F486452
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 946 | 326 | 1892 | 242 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100021373|Ga0075428_1000213732 |
| Length | 261 |
| Sequence | MSEHGPLFVQVSQLARRSVLRTFRRPINVFPSFFFPLMLLAVNVGGLQAASNLRGFPTDSYLDFALAFTFLQGALFATTNAGTDLARDIETGFLNRLALTPMRNAALLLGQLAGVVTLALLQATLYLTVGIVAGVRPESGVLGVFLIVFLGVLVALAFGAIGAFLALRTGSGEAIQALFPLFFVFLFLSSMNLPRNLIEIDWFRTVTTINPVSYLIEGIRSLIITGWDLQALLLGFGLAIGIGSVALTAAGWALRGRLARS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 62 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 101 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 149 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 150 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 157 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 170 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 173 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 174 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 177 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 178 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 179 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 180 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 184 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 185 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 186 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 187 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 188 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 189 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 190 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 191 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 192 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 196 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 197 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 198 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 199 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 200 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 201 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 202 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 203 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 274 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 277 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 278 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 279 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.58 |
| Metatranscriptomes | 0.42 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 9.51 |
| Rhizosphere | 89.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.44 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075428_100021373 | 3300006844 | Bacteria | 7164 |
| 2 | JGI24744J21845_10006167 | 3300002077 | Bacteria | 2487 |
| 3 | JGI24742J22300_10007079 | 3300002244 | Bacteria | 1848 |
| 4 | JGI25406J46586_10044899 | 3300003203 | Bacteria | 1526 |
| 5 | JGI25406J46586_10054715 | 3300003203 | Unclassified | 1318 |
| 6 | JGI25407J50210_10000296 | 3300003373 | Bacteria | 9040 |
| 7 | JGI25407J50210_10002731 | 3300003373 | Bacteria | 4198 |
| 8 | JGI25407J50210_10010599 | 3300003373 | Bacteria | 2347 |
| 9 | Ga0070658_10008472 | 3300005327 | Bacteria | 8267 |
| 10 | Ga0070683_100004962 | 3300005329 | Bacteria | 11041 |
| 11 | Ga0070683_100023359 | 3300005329 | Bacteria | 5530 |
| 12 | Ga0070683_100031568 | 3300005329 | Bacteria | 4818 |
| 13 | Ga0070683_100091742 | 3300005329 | Bacteria | 2853 |
| 14 | Ga0070683_100188404 | 3300005329 | Bacteria | 1958 |
| 15 | Ga0070683_100250161 | 3300005329 | Bacteria | 1686 |
| 16 | Ga0070683_100296513 | 3300005329 | Bacteria | 1538 |
| 17 | Ga0070683_100550008 | 3300005329 | Bacteria | 1104 |
| 18 | Ga0070690_100050328 | 3300005330 | Bacteria | 2658 |
| 19 | Ga0070680_100004037 | 3300005336 | Bacteria | 10977 |
| 20 | Ga0070680_100005608 | 3300005336 | Bacteria | 9506 |
| 21 | Ga0070680_100055164 | 3300005336 | Bacteria | 3247 |
| 22 | Ga0070680_100307574 | 3300005336 | Unclassified | 1344 |
| 23 | Ga0068868_100012943 | 3300005338 | Bacteria | 6103 |
| 24 | Ga0068868_100180041 | 3300005338 | Bacteria | 1753 |
| 25 | Ga0068868_100557303 | 3300005338 | Bacteria | 1011 |
| 26 | Ga0070660_100001494 | 3300005339 | Bacteria | 16003 |
| 27 | Ga0070660_100003867 | 3300005339 | Bacteria | 10339 |
| 28 | Ga0070660_100136777 | 3300005339 | Bacteria | 1963 |
| 29 | Ga0070660_100223563 | 3300005339 | Bacteria | 1530 |
| 30 | Ga0070689_100057873 | 3300005340 | Bacteria | 3010 |
| 31 | Ga0070661_100007123 | 3300005344 | Bacteria | 7712 |
| 32 | Ga0070661_100086221 | 3300005344 | Bacteria | 2321 |
| 33 | Ga0070661_100277989 | 3300005344 | Bacteria | 1298 |
| 34 | Ga0070661_100491230 | 3300005344 | Bacteria | 981 |
| 35 | Ga0070692_10074017 | 3300005345 | Unclassified | 1821 |
| 36 | Ga0070668_100603881 | 3300005347 | Bacteria | 960 |
| 37 | Ga0070671_100143550 | 3300005355 | Bacteria | 2015 |
| 38 | Ga0070673_100424035 | 3300005364 | Bacteria | 1193 |
| 39 | Ga0070673_100429948 | 3300005364 | Bacteria | 1185 |
| 40 | Ga0070673_100620347 | 3300005364 | Bacteria | 988 |
| 41 | Ga0070688_100047083 | 3300005365 | Bacteria | 2673 |
| 42 | Ga0070659_100022221 | 3300005366 | Bacteria | 4840 |
| 43 | Ga0070659_100026115 | 3300005366 | Bacteria | 4492 |
| 44 | Ga0070659_100141159 | 3300005366 | Bacteria | 1961 |
| 45 | Ga0070659_100439723 | 3300005366 | Bacteria | 1105 |
| 46 | Ga0070709_10198395 | 3300005434 | Bacteria | 1420 |
| 47 | Ga0070714_100523682 | 3300005435 | Bacteria | 1133 |
| 48 | Ga0070714_100544095 | 3300005435 | Bacteria | 1111 |
| 49 | Ga0070714_100596958 | 3300005435 | Unclassified | 1060 |
| 50 | Ga0070710_10029625 | 3300005437 | Bacteria | 2938 |
| 51 | Ga0070701_10187935 | 3300005438 | Bacteria | 1214 |
| 52 | Ga0070711_100025657 | 3300005439 | Bacteria | 3857 |
| 53 | Ga0070700_100021145 | 3300005441 | Bacteria | 3779 |
| 54 | Ga0070700_100250374 | 3300005441 | Bacteria | 1270 |
| 55 | Ga0070694_100034592 | 3300005444 | Bacteria | 3333 |
| 56 | Ga0070694_100548017 | 3300005444 | Bacteria | 926 |
| 57 | Ga0070678_100004691 | 3300005456 | Bacteria | 7779 |
| 58 | Ga0070678_100260104 | 3300005456 | Bacteria | 1459 |
| 59 | Ga0070681_10008977 | 3300005458 | Bacteria | 9830 |
| 60 | Ga0070681_10030842 | 3300005458 | Bacteria | 5381 |
| 61 | Ga0070681_10034745 | 3300005458 | Bacteria | 5062 |
| 62 | Ga0070681_10084225 | 3300005458 | Bacteria | 3132 |
| 63 | Ga0070681_10140034 | 3300005458 | Bacteria | 2349 |
| 64 | Ga0070681_10183635 | 3300005458 | Bacteria | 2012 |
| 65 | Ga0068867_100088449 | 3300005459 | Bacteria | 2347 |
| 66 | Ga0070685_10045930 | 3300005466 | Bacteria | 2506 |
| 67 | Ga0070706_100086274 | 3300005467 | Bacteria | 2909 |
| 68 | Ga0070707_100774811 | 3300005468 | Bacteria | 923 |
| 69 | Ga0070698_100071122 | 3300005471 | Bacteria | 3489 |
| 70 | Ga0070699_100312425 | 3300005518 | Bacteria | 1411 |
| 71 | Ga0070679_100075881 | 3300005530 | Bacteria | 3351 |
| 72 | Ga0070679_100139279 | 3300005530 | Bacteria | 2407 |
| 73 | Ga0070679_100179023 | 3300005530 | Bacteria | 2093 |
| 74 | Ga0070679_100242556 | 3300005530 | Bacteria | 1759 |
| 75 | Ga0070684_100001226 | 3300005535 | Bacteria | 18422 |
| 76 | Ga0070684_100071339 | 3300005535 | Bacteria | 3057 |
| 77 | Ga0070684_100075594 | 3300005535 | Bacteria | 2971 |
| 78 | Ga0070684_100128869 | 3300005535 | Bacteria | 2281 |
| 79 | Ga0068853_100094958 | 3300005539 | Bacteria | 2628 |
| 80 | Ga0068853_100220600 | 3300005539 | Bacteria | 1731 |
| 81 | Ga0070672_100046991 | 3300005543 | Bacteria | 3348 |
| 82 | Ga0070672_100306261 | 3300005543 | Unclassified | 1348 |
| 83 | Ga0070686_100033274 | 3300005544 | Bacteria | 3166 |
| 84 | Ga0070693_100042631 | 3300005547 | Bacteria | 2558 |
| 85 | Ga0070693_100418498 | 3300005547 | Bacteria | 933 |
| 86 | Ga0070665_100032824 | 3300005548 | Bacteria | 5223 |
| 87 | Ga0070665_100172112 | 3300005548 | Bacteria | 2166 |
| 88 | Ga0070665_100923507 | 3300005548 | Bacteria | 885 |
| 89 | Ga0068855_100014350 | 3300005563 | Bacteria | 9539 |
| 90 | Ga0068855_100060814 | 3300005563 | Bacteria | 4415 |
| 91 | Ga0068855_100272389 | 3300005563 | Bacteria | 1882 |
| 92 | Ga0068855_100624803 | 3300005563 | Bacteria | 1159 |
| 93 | Ga0070664_100017950 | 3300005564 | Bacteria | 5809 |
| 94 | Ga0070664_100221746 | 3300005564 | Bacteria | 1692 |
| 95 | Ga0068857_100004862 | 3300005577 | Bacteria | 11393 |
| 96 | Ga0068857_100006742 | 3300005577 | Bacteria | 9874 |
| 97 | Ga0068857_100142692 | 3300005577 | Bacteria | 2165 |
| 98 | Ga0068857_100211722 | 3300005577 | Bacteria | 1769 |
| 99 | Ga0068856_100042442 | 3300005614 | Bacteria | 4474 |
| 100 | Ga0068856_100637785 | 3300005614 | Bacteria | 1086 |
| 101 | Ga0070702_100010715 | 3300005615 | Bacteria | 4529 |
| 102 | Ga0068852_100146700 | 3300005616 | Bacteria | 2189 |
| 103 | Ga0068859_100587512 | 3300005617 | Bacteria | 1207 |
| 104 | Ga0068859_100752606 | 3300005617 | Bacteria | 1063 |
| 105 | Ga0068864_100122688 | 3300005618 | Bacteria | 2325 |
| 106 | Ga0068861_100153467 | 3300005719 | Bacteria | 1892 |
| 107 | Ga0068861_100540410 | 3300005719 | Bacteria | 1060 |
| 108 | Ga0068870_10208934 | 3300005840 | Unclassified | 1188 |
| 109 | Ga0068863_100802393 | 3300005841 | Unclassified | 939 |
| 110 | Ga0068858_100705059 | 3300005842 | Bacteria | 982 |
| 111 | Ga0068860_100412037 | 3300005843 | Bacteria | 1338 |
| 112 | Ga0068862_100126795 | 3300005844 | Bacteria | 2254 |
| 113 | Ga0081455_10008830 | 3300005937 | Bacteria | 10428 |
| 114 | Ga0081455_10014299 | 3300005937 | Bacteria | 7787 |
| 115 | Ga0081455_10030105 | 3300005937 | Bacteria | 4938 |
| 116 | Ga0081455_10069855 | 3300005937 | Bacteria | 2918 |
| 117 | Ga0081455_10169911 | 3300005937 | Bacteria | 1662 |
| 118 | Ga0081538_10000181 | 3300005981 | Bacteria | 68890 |
| 119 | Ga0081538_10000297 | 3300005981 | Bacteria | 57258 |
| 120 | Ga0081538_10000502 | 3300005981 | Bacteria | 43774 |
| 121 | Ga0081538_10000804 | 3300005981 | Bacteria | 34030 |
| 122 | Ga0081538_10000925 | 3300005981 | Bacteria | 31656 |
| 123 | Ga0081538_10008148 | 3300005981 | Bacteria | 8942 |
| 124 | Ga0081538_10017280 | 3300005981 | Bacteria | 5483 |
| 125 | Ga0081538_10018099 | 3300005981 | Bacteria | 5312 |
| 126 | Ga0081538_10018371 | 3300005981 | Bacteria | 5253 |
| 127 | Ga0081538_10069192 | 3300005981 | Bacteria | 1957 |
| 128 | Ga0081538_10139401 | 3300005981 | Bacteria | 1122 |
| 129 | Ga0081540_1006849 | 3300005983 | Bacteria | 8225 |
| 130 | Ga0081539_10000062 | 3300005985 | Bacteria | 249871 |
| 131 | Ga0081539_10001583 | 3300005985 | Bacteria | 37604 |
| 132 | Ga0081539_10009993 | 3300005985 | Bacteria | 7816 |
| 133 | Ga0081539_10012956 | 3300005985 | Bacteria | 6339 |
| 134 | Ga0081539_10019762 | 3300005985 | Bacteria | 4593 |
| 135 | Ga0075365_10175513 | 3300006038 | Bacteria | 1497 |
| 136 | Ga0075432_10064927 | 3300006058 | Bacteria | 1304 |
| 137 | Ga0070715_10022486 | 3300006163 | Bacteria | 2460 |
| 138 | Ga0070716_100288031 | 3300006173 | Bacteria | 1137 |
| 139 | Ga0070712_100004124 | 3300006175 | Bacteria | 8929 |
| 140 | Ga0070712_100537153 | 3300006175 | Bacteria | 984 |
| 141 | Ga0075427_10022130 | 3300006194 | Bacteria | 1014 |
| 142 | Ga0097621_100024560 | 3300006237 | Bacteria | 4708 |
| 143 | Ga0097621_100214086 | 3300006237 | Bacteria | 1677 |
| 144 | Ga0068871_100027672 | 3300006358 | Bacteria | 4436 |
| 145 | Ga0068871_100366585 | 3300006358 | Unclassified | 1277 |
| 146 | Ga0068871_100403331 | 3300006358 | Bacteria | 1218 |
| 147 | Ga0075428_100043736 | 3300006844 | Bacteria | 4924 |
| 148 | Ga0075428_100518490 | 3300006844 | Bacteria | 1275 |
| 149 | Ga0075428_100728850 | 3300006844 | Unclassified | 1055 |
| 150 | Ga0075430_100100857 | 3300006846 | Bacteria | 2411 |
| 151 | Ga0075430_100203256 | 3300006846 | Bacteria | 1644 |
| 152 | Ga0075430_100230303 | 3300006846 | Bacteria | 1536 |
| 153 | Ga0075431_100045347 | 3300006847 | Bacteria | 4533 |
| 154 | Ga0075433_10075025 | 3300006852 | Bacteria | 2976 |
| 155 | Ga0075433_10175656 | 3300006852 | Bacteria | 1906 |
| 156 | Ga0075434_100838263 | 3300006871 | Unclassified | 935 |
| 157 | Ga0075429_100007313 | 3300006880 | Bacteria | 9585 |
| 158 | Ga0068865_100031396 | 3300006881 | Bacteria | 3542 |
| 159 | Ga0068865_100229439 | 3300006881 | Bacteria | 1456 |
| 160 | Ga0097620_100587506 | 3300006931 | Bacteria | 1207 |
| 161 | Ga0097620_100752640 | 3300006931 | Bacteria | 1063 |
| 162 | Ga0075435_100037060 | 3300007076 | Bacteria | 3881 |
| 163 | Ga0075435_100485689 | 3300007076 | Bacteria | 1067 |
| 164 | Ga0105240_10026755 | 3300009093 | Bacteria | 7565 |
| 165 | Ga0105240_10049813 | 3300009093 | Bacteria | 5284 |
| 166 | Ga0105240_10213432 | 3300009093 | Bacteria | 2253 |
| 167 | Ga0111539_10005174 | 3300009094 | Bacteria | 16902 |
| 168 | Ga0111539_10058439 | 3300009094 | Bacteria | 4575 |
| 169 | Ga0111539_10207811 | 3300009094 | Bacteria | 2281 |
| 170 | Ga0111539_10337928 | 3300009094 | Bacteria | 1753 |
| 171 | Ga0105245_10060054 | 3300009098 | Bacteria | 3424 |
| 172 | Ga0105245_10064347 | 3300009098 | Bacteria | 3314 |
| 173 | Ga0105245_10275196 | 3300009098 | Bacteria | 1643 |
| 174 | Ga0105245_10418863 | 3300009098 | Bacteria | 1342 |
| 175 | Ga0114129_10003023 | 3300009147 | Bacteria | 23586 |
| 176 | Ga0114129_10028025 | 3300009147 | Bacteria | 7978 |
| 177 | Ga0114129_10173490 | 3300009147 | Bacteria | 2938 |
| 178 | Ga0114129_10682846 | 3300009147 | Bacteria | 1322 |
| 179 | Ga0114129_10702139 | 3300009147 | Bacteria | 1300 |
| 180 | Ga0114129_10938285 | 3300009147 | Bacteria | 1094 |
| 181 | Ga0114129_10954564 | 3300009147 | Bacteria | 1083 |
| 182 | Ga0105243_10033430 | 3300009148 | Bacteria | 3977 |
| 183 | Ga0105243_10192741 | 3300009148 | Bacteria | 1781 |
| 184 | Ga0105243_10481491 | 3300009148 | Unclassified | 1171 |
| 185 | Ga0105241_10446920 | 3300009174 | Bacteria | 1143 |
| 186 | Ga0105242_10014556 | 3300009176 | Bacteria | 6093 |
| 187 | Ga0105242_10051900 | 3300009176 | Bacteria | 3344 |
| 188 | Ga0105242_10341334 | 3300009176 | Bacteria | 1380 |
| 189 | Ga0105242_10511241 | 3300009176 | Bacteria | 1144 |
| 190 | Ga0105237_10001575 | 3300009545 | Bacteria | 29702 |
| 191 | Ga0105237_10032006 | 3300009545 | Bacteria | 5326 |
| 192 | Ga0105237_10169117 | 3300009545 | Bacteria | 2185 |
| 193 | Ga0105238_10306741 | 3300009551 | Bacteria | 1572 |
| 194 | Ga0105249_10011189 | 3300009553 | Bacteria | 7881 |
| 195 | Ga0105249_10658705 | 3300009553 | Bacteria | 1105 |
| 196 | Ga0105239_10006331 | 3300010375 | Bacteria | 13766 |
| 197 | Ga0105239_10360933 | 3300010375 | Bacteria | 1641 |
| 198 | Ga0105239_10398055 | 3300010375 | Bacteria | 1558 |
| 199 | Ga0105239_10676486 | 3300010375 | Bacteria | 1179 |
| 200 | Ga0105246_10039193 | 3300011119 | Bacteria | 3190 |
| 201 | Ga0157373_10252380 | 3300013100 | Bacteria | 1248 |
| 202 | Ga0157370_10038762 | 3300013104 | Bacteria | 4609 |
| 203 | Ga0157370_10356979 | 3300013104 | Bacteria | 1347 |
| 204 | Ga0157370_10436440 | 3300013104 | Bacteria | 1204 |
| 205 | Ga0157370_10445572 | 3300013104 | Bacteria | 1191 |
| 206 | Ga0157369_10035965 | 3300013105 | Bacteria | 5428 |
| 207 | Ga0157369_10068684 | 3300013105 | Bacteria | 3807 |
| 208 | Ga0157369_10094741 | 3300013105 | Bacteria | 3187 |
| 209 | Ga0157374_10006829 | 3300013296 | Bacteria | 9708 |
| 210 | Ga0157374_10098614 | 3300013296 | Bacteria | 2798 |
| 211 | Ga0157374_10192298 | 3300013296 | Bacteria | 1996 |
| 212 | Ga0157378_10011844 | 3300013297 | Bacteria | 7635 |
| 213 | Ga0163162_10007186 | 3300013306 | Bacteria | 10814 |
| 214 | Ga0157372_10075957 | 3300013307 | Bacteria | 3792 |
| 215 | Ga0157372_10197601 | 3300013307 | Bacteria | 2329 |
| 216 | Ga0157372_10317301 | 3300013307 | Bacteria | 1814 |
| 217 | Ga0157375_10010359 | 3300013308 | Bacteria | 8207 |
| 218 | Ga0157375_10177722 | 3300013308 | Bacteria | 2279 |
| 219 | Ga0163163_10428054 | 3300014325 | Unclassified | 1383 |
| 220 | Ga0157380_10119804 | 3300014326 | Bacteria | 2227 |
| 221 | Ga0157380_10152318 | 3300014326 | Bacteria | 2000 |
| 222 | Ga0157377_10005388 | 3300014745 | Bacteria | 6009 |
| 223 | Ga0157377_10022425 | 3300014745 | Bacteria | 3334 |
| 224 | Ga0157376_10047691 | 3300014969 | Bacteria | 3538 |
| 225 | Ga0157376_10210484 | 3300014969 | Bacteria | 1795 |
| 226 | Ga0182007_10049478 | 3300015262 | Unclassified | 1388 |
| 227 | Ga0206356_11664069 | 3300020070 | Bacteria | 3866 |
| 228 | Ga0206353_11255590 | 3300020082 | Bacteria | 3314 |
| 229 | Ga0206353_11829944 | 3300020082 | Bacteria | 2291 |
| 230 | Ga0206353_11844079 | 3300020082 | Bacteria | 5443 |
| 231 | Ga0207692_10040358 | 3300025898 | Bacteria | 2303 |
| 232 | Ga0207692_10041477 | 3300025898 | Bacteria | 2279 |
| 233 | Ga0207642_10089634 | 3300025899 | Bacteria | 1516 |
| 234 | Ga0207699_10027383 | 3300025906 | Bacteria | 3155 |
| 235 | Ga0207699_10043526 | 3300025906 | Bacteria | 2609 |
| 236 | Ga0207699_10120388 | 3300025906 | Bacteria | 1697 |
| 237 | Ga0207654_10169278 | 3300025911 | Bacteria | 1417 |
| 238 | Ga0207654_10375171 | 3300025911 | Bacteria | 984 |
| 239 | Ga0207707_10011148 | 3300025912 | Bacteria | 7820 |
| 240 | Ga0207707_10012057 | 3300025912 | Bacteria | 7517 |
| 241 | Ga0207707_10028270 | 3300025912 | Bacteria | 4902 |
| 242 | Ga0207707_10092802 | 3300025912 | Bacteria | 2637 |
| 243 | Ga0207707_10101297 | 3300025912 | Bacteria | 2517 |
| 244 | Ga0207707_10122363 | 3300025912 | Bacteria | 2275 |
| 245 | Ga0207695_10207394 | 3300025913 | Bacteria | 1872 |
| 246 | Ga0207695_10443331 | 3300025913 | Bacteria | 1182 |
| 247 | Ga0207671_10000835 | 3300025914 | Bacteria | 39117 |
| 248 | Ga0207671_10082479 | 3300025914 | Bacteria | 2413 |
| 249 | Ga0207671_10139513 | 3300025914 | Bacteria | 1867 |
| 250 | Ga0207693_10001551 | 3300025915 | Bacteria | 20284 |
| 251 | Ga0207693_10053039 | 3300025915 | Bacteria | 3181 |
| 252 | Ga0207693_10053072 | 3300025915 | Bacteria | 3180 |
| 253 | Ga0207693_10093503 | 3300025915 | Bacteria | 2357 |
| 254 | Ga0207693_10189021 | 3300025915 | Unclassified | 1621 |
| 255 | Ga0207660_10018009 | 3300025917 | Bacteria | 4704 |
| 256 | Ga0207660_10047444 | 3300025917 | Bacteria | 3037 |
| 257 | Ga0207660_10061128 | 3300025917 | Bacteria | 2711 |
| 258 | Ga0207660_10123453 | 3300025917 | Bacteria | 1964 |
| 259 | Ga0207660_10492645 | 3300025917 | Bacteria | 994 |
| 260 | Ga0207657_10001335 | 3300025919 | Bacteria | 26208 |
| 261 | Ga0207657_10003370 | 3300025919 | Bacteria | 17079 |
| 262 | Ga0207657_10014368 | 3300025919 | Bacteria | 7732 |
| 263 | Ga0207649_10016170 | 3300025920 | Bacteria | 4202 |
| 264 | Ga0207649_10030765 | 3300025920 | Bacteria | 3183 |
| 265 | Ga0207649_10060635 | 3300025920 | Bacteria | 2378 |
| 266 | Ga0207649_10181536 | 3300025920 | Bacteria | 1473 |
| 267 | Ga0207652_10093742 | 3300025921 | Bacteria | 2643 |
| 268 | Ga0207652_10103051 | 3300025921 | Bacteria | 2522 |
| 269 | Ga0207652_10211387 | 3300025921 | Bacteria | 1747 |
| 270 | Ga0207652_10232679 | 3300025921 | Bacteria | 1661 |
| 271 | Ga0207646_10060981 | 3300025922 | Bacteria | 3367 |
| 272 | Ga0207646_10173318 | 3300025922 | Bacteria | 1948 |
| 273 | Ga0207681_10205406 | 3300025923 | Bacteria | 1515 |
| 274 | Ga0207694_10097620 | 3300025924 | Bacteria | 2325 |
| 275 | Ga0207694_10430627 | 3300025924 | Bacteria | 1100 |
| 276 | Ga0207687_10048820 | 3300025927 | Bacteria | 2941 |
| 277 | Ga0207687_10220598 | 3300025927 | Bacteria | 1493 |
| 278 | Ga0207687_10276832 | 3300025927 | Bacteria | 1343 |
| 279 | Ga0207700_10266773 | 3300025928 | Unclassified | 1468 |
| 280 | Ga0207700_10341930 | 3300025928 | Bacteria | 1301 |
| 281 | Ga0207700_10480529 | 3300025928 | Bacteria | 1098 |
| 282 | Ga0207664_10161998 | 3300025929 | Bacteria | 1908 |
| 283 | Ga0207690_10031482 | 3300025932 | Bacteria | 3395 |
| 284 | Ga0207690_10334154 | 3300025932 | Bacteria | 1194 |
| 285 | Ga0207686_10023760 | 3300025934 | Bacteria | 3543 |
| 286 | Ga0207686_10036737 | 3300025934 | Bacteria | 2952 |
| 287 | Ga0207686_10344803 | 3300025934 | Bacteria | 1120 |
| 288 | Ga0207709_10015057 | 3300025935 | Bacteria | 4284 |
| 289 | Ga0207709_10132644 | 3300025935 | Unclassified | 1700 |
| 290 | Ga0207709_10347962 | 3300025935 | Bacteria | 1118 |
| 291 | Ga0207670_10168880 | 3300025936 | Bacteria | 1638 |
| 292 | Ga0207669_10132538 | 3300025937 | Bacteria | 1715 |
| 293 | Ga0207704_10008706 | 3300025938 | Bacteria | 4867 |
| 294 | Ga0207704_10154651 | 3300025938 | Bacteria | 1624 |
| 295 | Ga0207665_10176786 | 3300025939 | Bacteria | 1544 |
| 296 | Ga0207665_10190315 | 3300025939 | Bacteria | 1490 |
| 297 | Ga0207691_10018612 | 3300025940 | Bacteria | 6582 |
| 298 | Ga0207691_10270739 | 3300025940 | Bacteria | 1462 |
| 299 | Ga0207691_10309853 | 3300025940 | Bacteria | 1355 |
| 300 | Ga0207661_10013034 | 3300025944 | Bacteria | 6066 |
| 301 | Ga0207661_10024926 | 3300025944 | Bacteria | 4541 |
| 302 | Ga0207661_10053149 | 3300025944 | Bacteria | 3240 |
| 303 | Ga0207661_10242720 | 3300025944 | Bacteria | 1599 |
| 304 | Ga0207661_10471850 | 3300025944 | Bacteria | 1145 |
| 305 | Ga0207667_10102955 | 3300025949 | Bacteria | 2945 |
| 306 | Ga0207667_10202976 | 3300025949 | Bacteria | 2033 |
| 307 | Ga0207712_10027905 | 3300025961 | Bacteria | 3772 |
| 308 | Ga0207668_10340279 | 3300025972 | Bacteria | 1251 |
| 309 | Ga0207668_10433151 | 3300025972 | Bacteria | 1119 |
| 310 | Ga0207677_10018809 | 3300026023 | Bacteria | 4155 |
| 311 | Ga0207639_10025421 | 3300026041 | Bacteria | 4293 |
| 312 | Ga0207678_10025503 | 3300026067 | Bacteria | 5161 |
| 313 | Ga0207708_10000757 | 3300026075 | Bacteria | 24232 |
| 314 | Ga0207702_10178202 | 3300026078 | Bacteria | 1955 |
| 315 | Ga0207702_10399968 | 3300026078 | Bacteria | 1324 |
| 316 | Ga0207702_10518294 | 3300026078 | Bacteria | 1164 |
| 317 | Ga0207702_10636357 | 3300026078 | Bacteria | 1048 |
| 318 | Ga0207648_10026646 | 3300026089 | Bacteria | 5135 |
| 319 | Ga0207648_10067304 | 3300026089 | Bacteria | 3123 |
| 320 | Ga0207676_10080307 | 3300026095 | Bacteria | 2647 |
| 321 | Ga0207674_10007853 | 3300026116 | Bacteria | 12402 |
| 322 | Ga0207674_10019444 | 3300026116 | Bacteria | 7355 |
| 323 | Ga0207674_10050544 | 3300026116 | Bacteria | 4247 |
| 324 | Ga0207674_10072073 | 3300026116 | Bacteria | 3471 |
| 325 | Ga0207674_10158923 | 3300026116 | Bacteria | 2215 |
| 326 | Ga0207674_10168470 | 3300026116 | Bacteria | 2144 |
| 327 | Ga0207674_10291947 | 3300026116 | Bacteria | 1579 |
| 328 | Ga0207675_100088890 | 3300026118 | Bacteria | 2902 |
| 329 | Ga0207683_10000740 | 3300026121 | Bacteria | 29707 |
| 330 | Ga0207683_10183098 | 3300026121 | Bacteria | 1900 |
| 331 | Ga0207683_10495685 | 3300026121 | Bacteria | 1128 |
| 332 | Ga0207698_10009350 | 3300026142 | Bacteria | 6246 |
| 333 | Ga0207698_10552269 | 3300026142 | Bacteria | 1129 |
| 334 | Ga0207428_10114332 | 3300027907 | Bacteria | 2074 |
| 335 | Ga0268266_10813971 | 3300028379 | Unclassified | 902 |
| 336 | Ga0268265_10511186 | 3300028380 | Unclassified | 1134 |
| 337 | Ga0268264_10218847 | 3300028381 | Bacteria | 1752 |
| 338 | Ga0265319_1000175 | 3300028563 | Bacteria | 48774 |
| 339 | Ga0265319_1004884 | 3300028563 | Bacteria | 6557 |
| 340 | Ga0265318_10001659 | 3300028577 | Bacteria | 12794 |
| 341 | Ga0265322_10016779 | 3300028654 | Bacteria | 2112 |
| 342 | Ga0265338_10002978 | 3300028800 | Bacteria | 24543 |
| 343 | Ga0265338_10020014 | 3300028800 | Bacteria | 7062 |
| 344 | Ga0265320_10022983 | 3300031240 | Bacteria | 3327 |
| 345 | Ga0265320_10023798 | 3300031240 | Bacteria | 3252 |
| 346 | Ga0265316_10144442 | 3300031344 | Bacteria | 1785 |
| 347 | Ga0307408_100048271 | 3300031548 | Bacteria | 3053 |
| 348 | Ga0307408_100279369 | 3300031548 | Bacteria | 1390 |
| 349 | Ga0307405_10106736 | 3300031731 | Bacteria | 1889 |
| 350 | Ga0307405_10115674 | 3300031731 | Bacteria | 1825 |
| 351 | Ga0307413_10002156 | 3300031824 | Bacteria | 7907 |
| 352 | Ga0307413_10348857 | 3300031824 | Bacteria | 1141 |
| 353 | Ga0307410_10016214 | 3300031852 | Bacteria | 4438 |
| 354 | Ga0307410_10082209 | 3300031852 | Bacteria | 2265 |
| 355 | Ga0307410_10193461 | 3300031852 | Bacteria | 1548 |
| 356 | Ga0307406_10027082 | 3300031901 | Bacteria | 3450 |
| 357 | Ga0307406_10038981 | 3300031901 | Bacteria | 2944 |
| 358 | Ga0307406_10052159 | 3300031901 | Bacteria | 2600 |
| 359 | Ga0307407_10095163 | 3300031903 | Bacteria | 1835 |
| 360 | Ga0307412_10018003 | 3300031911 | Bacteria | 4241 |
| 361 | Ga0307412_10188235 | 3300031911 | Bacteria | 1558 |
| 362 | Ga0307409_100048352 | 3300031995 | Bacteria | 3236 |
| 363 | Ga0307409_100099462 | 3300031995 | Bacteria | 2408 |
| 364 | Ga0307409_100107955 | 3300031995 | Bacteria | 2326 |
| 365 | Ga0307409_100152069 | 3300031995 | Bacteria | 2011 |
| 366 | Ga0307409_100188332 | 3300031995 | Bacteria | 1834 |
| 367 | Ga0307416_100020572 | 3300032002 | Bacteria | 4713 |
| 368 | Ga0307416_100060430 | 3300032002 | Bacteria | 3086 |
| 369 | Ga0307416_100157670 | 3300032002 | Bacteria | 2092 |
| 370 | Ga0307416_100271023 | 3300032002 | Bacteria | 1666 |
| 371 | Ga0307414_10113428 | 3300032004 | Bacteria | 2069 |
| 372 | Ga0307414_10673601 | 3300032004 | Bacteria | 934 |
| 373 | Ga0307411_10006677 | 3300032005 | Bacteria | 5796 |
| 374 | Ga0307411_10058648 | 3300032005 | Bacteria | 2548 |
| 375 | Ga0307415_100000015 | 3300032126 | Bacteria | 79927 |
| 376 | Ga0307415_100013568 | 3300032126 | Bacteria | 4758 |
| 377 | Ga0307415_100020790 | 3300032126 | Bacteria | 4016 |
| 378 | Ga0307415_100190904 | 3300032126 | Bacteria | 1616 |
| 379 | Ga0373945_0027076 | 3300035116 | Bacteria | 2001 |
| 380 | Ga0373956_0019955 | 3300035119 | Bacteria | 2847 |
| 381 | Ga0373943_0000090 | 3300035170 | Bacteria | 33196 |
| 382 | Ga0373946_0007850 | 3300035171 | Bacteria | 3916 |
| 383 | Ga0373946_0104013 | 3300035171 | Bacteria | 1277 |
| 384 | Ga0373955_0097179 | 3300035172 | Unclassified | 1686 |
| 385 | Ga0373955_0108744 | 3300035172 | Bacteria | 1601 |
| 386 | Ga0373935_0043829 | 3300035692 | Bacteria | 2817 |
| 387 | Ga0373933_0017190 | 3300035724 | Bacteria | 4055 |
| 388 | Ga0373947_0000266 | 3300035725 | Bacteria | 29609 |
| 389 | Ga0373937_0074513 | 3300036401 | Bacteria | 3132 |
| 390 | Ga0373937_0176692 | 3300036401 | Bacteria | 2005 |
| 391 | Ga0373925_0001866 | 3300037068 | Bacteria | 17533 |
| 392 | Ga0395899_0002195 | 3300037312 | Bacteria | 16020 |
| 393 | Ga0395899_0002876 | 3300037312 | Bacteria | 13838 |
| 394 | Ga0395899_0003284 | 3300037312 | Bacteria | 12824 |
| 395 | Ga0395899_0004709 | 3300037312 | Bacteria | 10642 |
| 396 | Ga0395899_0012345 | 3300037312 | Bacteria | 6543 |
| 397 | Ga0395899_0017803 | 3300037312 | Bacteria | 5409 |
| 398 | Ga0395899_0056021 | 3300037312 | Bacteria | 2915 |
| 399 | Ga0395899_0092577 | 3300037312 | Bacteria | 2189 |
| 400 | Ga0395899_0107394 | 3300037312 | Bacteria | 2009 |
| 401 | Ga0395899_0219626 | 3300037312 | Bacteria | 1317 |
| 402 | Ga0395899_0310064 | 3300037312 | Bacteria | 1066 |
| 403 | Ga0395899_0357142 | 3300037312 | Unclassified | 976 |
| 404 | Ga0395899_0444745 | 3300037312 | Bacteria | 850 |
| 405 | Ga0395899_0469488 | 3300037312 | Bacteria | 821 |
| 406 | Ga0395900_0003322 | 3300037418 | Bacteria | 17399 |
| 407 | Ga0395900_0003557 | 3300037418 | Bacteria | 16757 |
| 408 | Ga0395900_0006758 | 3300037418 | Bacteria | 11903 |
| 409 | Ga0395900_0010351 | 3300037418 | Bacteria | 9543 |
| 410 | Ga0395900_0011065 | 3300037418 | Bacteria | 9219 |
| 411 | Ga0395900_0030406 | 3300037418 | Bacteria | 5546 |
| 412 | Ga0395900_0049279 | 3300037418 | Bacteria | 4339 |
| 413 | Ga0395900_0053577 | 3300037418 | Bacteria | 4152 |
| 414 | Ga0395900_0053624 | 3300037418 | Bacteria | 4150 |
| 415 | Ga0395900_0094819 | 3300037418 | Bacteria | 3066 |
| 416 | Ga0395900_0117171 | 3300037418 | Bacteria | 2733 |
| 417 | Ga0395900_0124218 | 3300037418 | Bacteria | 2647 |
| 418 | Ga0395900_0135277 | 3300037418 | Bacteria | 2525 |
| 419 | Ga0395900_0136718 | 3300037418 | Bacteria | 2511 |
| 420 | Ga0395900_0157668 | 3300037418 | Bacteria | 2318 |
| 421 | Ga0395900_0186777 | 3300037418 | Bacteria | 2104 |
| 422 | Ga0395900_0237339 | 3300037418 | Bacteria | 1830 |
| 423 | Ga0395900_0314142 | 3300037418 | Bacteria | 1549 |
| 424 | Ga0395900_0351589 | 3300037418 | Bacteria | 1447 |
| 425 | Ga0395900_0400214 | 3300037418 | Bacteria | 1337 |
| 426 | Ga0395898_0003445 | 3300037466 | Bacteria | 17691 |
| 427 | Ga0395898_0003903 | 3300037466 | Bacteria | 16468 |
| 428 | Ga0395898_0011171 | 3300037466 | Bacteria | 9351 |
| 429 | Ga0395898_0014290 | 3300037466 | Bacteria | 8159 |
| 430 | Ga0395898_0019644 | 3300037466 | Bacteria | 6872 |
| 431 | Ga0395898_0022550 | 3300037466 | Bacteria | 6376 |
| 432 | Ga0395898_0040303 | 3300037466 | Bacteria | 4619 |
| 433 | Ga0395898_0045562 | 3300037466 | Bacteria | 4311 |
| 434 | Ga0395898_0048290 | 3300037466 | Bacteria | 4175 |
| 435 | Ga0395898_0050255 | 3300037466 | Bacteria | 4082 |
| 436 | Ga0395898_0064493 | 3300037466 | Bacteria | 3552 |
| 437 | Ga0395898_0067865 | 3300037466 | Bacteria | 3452 |
| 438 | Ga0395898_0198696 | 3300037466 | Bacteria | 1915 |
| 439 | Ga0395898_0199571 | 3300037466 | Bacteria | 1910 |
| 440 | Ga0395898_0265295 | 3300037466 | Bacteria | 1638 |
| 441 | Ga0395898_0368271 | 3300037466 | Bacteria | 1370 |
| 442 | Ga0395898_0435977 | 3300037466 | Bacteria | 1248 |
| 443 | Ga0395898_0459360 | 3300037466 | Unclassified | 1212 |
| 444 | Ga0395898_0547052 | 3300037466 | Bacteria | 1100 |
| 445 | Ga0395898_0636000 | 3300037466 | Unclassified | 1009 |
| 446 | Ga0395905_0001505 | 3300037471 | Bacteria | 27874 |
| 447 | Ga0395905_0010800 | 3300037471 | Bacteria | 8847 |
| 448 | Ga0395905_0011659 | 3300037471 | Bacteria | 8489 |
| 449 | Ga0395905_0012564 | 3300037471 | Bacteria | 8144 |
| 450 | Ga0395905_0015454 | 3300037471 | Bacteria | 7257 |
| 451 | Ga0395905_0017620 | 3300037471 | Bacteria | 6779 |
| 452 | Ga0395905_0025788 | 3300037471 | Bacteria | 5542 |
| 453 | Ga0395905_0035532 | 3300037471 | Bacteria | 4679 |
| 454 | Ga0395905_0046007 | 3300037471 | Bacteria | 4093 |
| 455 | Ga0395905_0095963 | 3300037471 | Bacteria | 2784 |
| 456 | Ga0395905_0101923 | 3300037471 | Bacteria | 2695 |
| 457 | Ga0395905_0162045 | 3300037471 | Bacteria | 2102 |
| 458 | Ga0395905_0316679 | 3300037471 | Bacteria | 1449 |
| 459 | Ga0395905_0355525 | 3300037471 | Bacteria | 1357 |
| 460 | Ga0395905_0367816 | 3300037471 | Bacteria | 1331 |
| 461 | Ga0395905_0457326 | 3300037471 | Bacteria | 1175 |
| 462 | Ga0395901_0001420 | 3300038443 | Bacteria | 24995 |
| 463 | Ga0395901_0002025 | 3300038443 | Bacteria | 20844 |
| 464 | Ga0395901_0005860 | 3300038443 | Bacteria | 12430 |
| 465 | Ga0395901_0008893 | 3300038443 | Bacteria | 10170 |
| 466 | Ga0395901_0015572 | 3300038443 | Bacteria | 7746 |
| 467 | Ga0395901_0016543 | 3300038443 | Bacteria | 7515 |
| 468 | Ga0395901_0016812 | 3300038443 | Bacteria | 7455 |
| 469 | Ga0395901_0020676 | 3300038443 | Bacteria | 6737 |
| 470 | Ga0395901_0028265 | 3300038443 | Bacteria | 5769 |
| 471 | Ga0395901_0032743 | 3300038443 | Bacteria | 5362 |
| 472 | Ga0395901_0032816 | 3300038443 | Bacteria | 5356 |
| 473 | Ga0395901_0046351 | 3300038443 | Bacteria | 4515 |
| 474 | Ga0395901_0067601 | 3300038443 | Bacteria | 3722 |
| 475 | Ga0395901_0090099 | 3300038443 | Bacteria | 3210 |
| 476 | Ga0395901_0112930 | 3300038443 | Bacteria | 2853 |
| 477 | Ga0395901_0135470 | 3300038443 | Bacteria | 2589 |
| 478 | Ga0395901_0136094 | 3300038443 | Bacteria | 2582 |
| 479 | Ga0395901_0231359 | 3300038443 | Bacteria | 1929 |
| 480 | Ga0395901_0278177 | 3300038443 | Bacteria | 1739 |
| 481 | Ga0395901_0324663 | 3300038443 | Bacteria | 1592 |
| 482 | Ga0395901_0514864 | 3300038443 | Bacteria | 1216 |
| 483 | Ga0395901_0553889 | 3300038443 | Bacteria | 1165 |
| 484 | Ga0395901_0574959 | 3300038443 | Bacteria | 1139 |
| 485 | Ga0395901_0600228 | 3300038443 | Unclassified | 1110 |
| 486 | Ga0395901_0622244 | 3300038443 | Unclassified | 1086 |
| 487 | Ga0436363_1706338 | 3300039450 | Bacteria | 1224 |
| 488 | Ga0451802_0835110 | 3300041460 | Bacteria | 1130 |
| 489 | Ga0451837_1385120 | 3300041494 | Bacteria | 1104 |
| 490 | Ga0451853_0287148 | 3300041512 | Bacteria | 1128 |
| 491 | Ga0451853_0926783 | 3300041512 | Bacteria | 3340 |
| 492 | Ga0451853_2490875 | 3300041512 | Bacteria | 2459 |
| 493 | Ga0439442_022065 | 3300042002 | Bacteria | 1321 |
| 494 | Ga0439448_0016164 | 3300042005 | Bacteria | 2269 |
| 495 | Ga0439448_0032364 | 3300042005 | Bacteria | 1664 |
| 496 | Ga0439448_0187063 | 3300042005 | Bacteria | 724 |
| 497 | Ga0439454_024473 | 3300042011 | Unclassified | 912 |
| 498 | Ga0450915_001698 | 3300042119 | Unclassified | 1064 |
| 499 | Ga0450923_027145 | 3300042125 | Unclassified | 1150 |
| 500 | Ga0450916_008390 | 3300042530 | Bacteria | 1257 |
| 501 | Ga0466965_0121778 | 3300044683 | Bacteria | 1348 |
| 502 | Ga0466966_0020976 | 3300044684 | Bacteria | 4294 |
| 503 | Ga0466961_0008144 | 3300044693 | Bacteria | 6677 |
| 504 | Ga0466961_0166724 | 3300044693 | Bacteria | 1371 |
| 505 | Ga0466963_0025241 | 3300044694 | Bacteria | 3788 |
| 506 | Ga0466963_0086992 | 3300044694 | Bacteria | 2124 |
| 507 | Ga0466964_0010017 | 3300044706 | Bacteria | 3571 |
| 508 | Ga0466968_0017224 | 3300044735 | Bacteria | 2885 |
| 509 | Ga0466970_0095608 | 3300044765 | Bacteria | 1615 |
| 510 | Ga0466957_0027129 | 3300044842 | Bacteria | 3402 |
| 511 | Ga0466957_0195778 | 3300044842 | Bacteria | 1326 |
| 512 | Ga0466957_0447398 | 3300044842 | Bacteria | 890 |
| 513 | Ga0466960_0029005 | 3300044901 | Bacteria | 2536 |
| 514 | Ga0466960_0036774 | 3300044901 | Bacteria | 2294 |
| 515 | Ga0466960_0072775 | 3300044901 | Bacteria | 1714 |
| 516 | Ga0466960_0226119 | 3300044901 | Bacteria | 1031 |
| 517 | Ga0451576_0062670 | 3300045051 | Bacteria | 3876 |
| 518 | Ga0466958_0002118 | 3300045836 | Bacteria | 9853 |
| 519 | Ga0466967_0004393 | 3300045976 | Bacteria | 9495 |
| 520 | Ga0466967_0020474 | 3300045976 | Bacteria | 5348 |
| 521 | Ga0466967_0069123 | 3300045976 | Bacteria | 3155 |
| 522 | Ga0466967_0079454 | 3300045976 | Bacteria | 2957 |
| 523 | Ga0466967_0092522 | 3300045976 | Bacteria | 2750 |
| 524 | Ga0466967_0239770 | 3300045976 | Bacteria | 1729 |
| 525 | Ga0495592_0062638 | 3300046454 | Bacteria | 2730 |
| 526 | Ga0495592_0113725 | 3300046454 | Bacteria | 1912 |
| 527 | Ga0495592_0393177 | 3300046454 | Bacteria | 880 |
| 528 | Ga0495603_0128957 | 3300046455 | Bacteria | 1473 |
| 529 | Ga0495629_0002088 | 3300046459 | Bacteria | 15500 |
| 530 | Ga0495629_0205882 | 3300046459 | Bacteria | 1359 |
| 531 | Ga0495641_0005538 | 3300046461 | Bacteria | 8483 |
| 532 | Ga0495641_0015298 | 3300046461 | Bacteria | 4104 |
| 533 | Ga0495641_0031562 | 3300046461 | Bacteria | 2530 |
| 534 | Ga0495641_0067037 | 3300046461 | Bacteria | 1614 |
| 535 | Ga0495651_0014023 | 3300046462 | Bacteria | 6199 |
| 536 | Ga0495651_0024849 | 3300046462 | Bacteria | 4661 |
| 537 | Ga0495651_0083680 | 3300046462 | Bacteria | 2405 |
| 538 | Ga0495653_0022048 | 3300046463 | Bacteria | 5155 |
| 539 | Ga0495653_0032140 | 3300046463 | Bacteria | 4170 |
| 540 | Ga0495582_0000801 | 3300046473 | Bacteria | 17458 |
| 541 | Ga0495582_0017801 | 3300046473 | Bacteria | 3884 |
| 542 | Ga0495582_0027982 | 3300046473 | Bacteria | 3092 |
| 543 | Ga0495582_0028565 | 3300046473 | Bacteria | 3061 |
| 544 | Ga0495582_0038899 | 3300046473 | Bacteria | 2618 |
| 545 | Ga0495582_0277814 | 3300046473 | Bacteria | 962 |
| 546 | Ga0495605_0097616 | 3300046474 | Bacteria | 1354 |
| 547 | Ga0495605_0178965 | 3300046474 | Unclassified | 933 |
| 548 | Ga0495639_0002081 | 3300046475 | Bacteria | 8857 |
| 549 | Ga0495639_0165137 | 3300046475 | Bacteria | 1073 |
| 550 | Ga0495662_0000984 | 3300046476 | Bacteria | 13942 |
| 551 | Ga0495664_0052360 | 3300046477 | Bacteria | 2425 |
| 552 | Ga0495584_0060226 | 3300046491 | Bacteria | 1909 |
| 553 | Ga0495584_0145173 | 3300046491 | Bacteria | 1205 |
| 554 | Ga0495585_0150259 | 3300046492 | Bacteria | 1215 |
| 555 | Ga0495585_0227045 | 3300046492 | Bacteria | 940 |
| 556 | Ga0495594_0027397 | 3300046499 | Bacteria | 3071 |
| 557 | Ga0495594_0058068 | 3300046499 | Bacteria | 2137 |
| 558 | Ga0495596_0062281 | 3300046500 | Unclassified | 1452 |
| 559 | Ga0495596_0074820 | 3300046500 | Unclassified | 1315 |
| 560 | Ga0495608_0022630 | 3300046511 | Bacteria | 4310 |
| 561 | Ga0495608_0113461 | 3300046511 | Bacteria | 1741 |
| 562 | Ga0495608_0194279 | 3300046511 | Unclassified | 1280 |
| 563 | Ga0495608_0330688 | 3300046511 | Bacteria | 940 |
| 564 | Ga0495618_0100461 | 3300046514 | Bacteria | 1851 |
| 565 | Ga0495618_0140526 | 3300046514 | Bacteria | 1545 |
| 566 | Ga0495618_0185074 | 3300046514 | Unclassified | 1322 |
| 567 | Ga0495628_0008805 | 3300046516 | Bacteria | 8638 |
| 568 | Ga0495628_0039578 | 3300046516 | Bacteria | 3770 |
| 569 | Ga0495630_0005899 | 3300046517 | Bacteria | 8659 |
| 570 | Ga0495630_0178212 | 3300046517 | Bacteria | 1620 |
| 571 | Ga0495630_0392934 | 3300046517 | Unclassified | 1062 |
| 572 | Ga0495630_0440195 | 3300046517 | Bacteria | 999 |
| 573 | Ga0495631_0065306 | 3300046518 | Bacteria | 1575 |
| 574 | Ga0495631_0131155 | 3300046518 | Bacteria | 1077 |
| 575 | Ga0495663_0021663 | 3300046525 | Bacteria | 1852 |
| 576 | Ga0495663_0131459 | 3300046525 | Unclassified | 844 |
| 577 | Ga0495666_0016257 | 3300046526 | Bacteria | 3706 |
| 578 | Ga0495642_0019597 | 3300046528 | Bacteria | 2653 |
| 579 | Ga0495652_0011511 | 3300046529 | Bacteria | 8000 |
| 580 | Ga0495652_0351503 | 3300046529 | Bacteria | 1056 |
| 581 | Ga0495665_0000215 | 3300046531 | Bacteria | 29257 |
| 582 | Ga0495640_0001520 | 3300046533 | Bacteria | 18268 |
| 583 | Ga0495640_0077065 | 3300046533 | Bacteria | 2223 |
| 584 | Ga0495640_0121419 | 3300046533 | Bacteria | 1698 |
| 585 | Ga0495586_0031050 | 3300046535 | Bacteria | 2860 |
| 586 | Ga0495587_0031722 | 3300046536 | Bacteria | 3197 |
| 587 | Ga0495645_0048974 | 3300046543 | Bacteria | 3077 |
| 588 | Ga0495645_0124477 | 3300046543 | Bacteria | 1812 |
| 589 | Ga0495633_0096293 | 3300046558 | Bacteria | 1375 |
| 590 | Ga0495667_0010495 | 3300046559 | Bacteria | 6267 |
| 591 | Ga0495667_0064213 | 3300046559 | Bacteria | 2401 |
| 592 | Ga0495667_0114859 | 3300046559 | Bacteria | 1739 |
| 593 | Ga0495656_0018519 | 3300046615 | Bacteria | 2675 |
| 594 | Ga0495656_0097357 | 3300046615 | Bacteria | 1355 |
| 595 | Ga0495656_0233335 | 3300046615 | Bacteria | 924 |
| 596 | Ga0495668_0170136 | 3300046616 | Bacteria | 1194 |
| 597 | Ga0495634_0092617 | 3300046642 | Bacteria | 1961 |
| 598 | Ga0495634_0095954 | 3300046642 | Bacteria | 1920 |
| 599 | Ga0495635_0026331 | 3300046663 | Bacteria | 4048 |
| 600 | Ga0495635_0076575 | 3300046663 | Bacteria | 2292 |
| 601 | Ga0495588_0194974 | 3300046674 | Bacteria | 1070 |
| 602 | Ga0495657_0019467 | 3300046675 | Bacteria | 4895 |
| 603 | Ga0495657_0079758 | 3300046675 | Bacteria | 2119 |
| 604 | Ga0495599_0007133 | 3300046678 | Bacteria | 6767 |
| 605 | Ga0495599_0322564 | 3300046678 | Unclassified | 929 |
| 606 | Ga0495623_0066176 | 3300046679 | Bacteria | 2258 |
| 607 | Ga0495623_0159882 | 3300046679 | Bacteria | 1325 |
| 608 | Ga0495646_0053245 | 3300046680 | Bacteria | 2441 |
| 609 | Ga0495647_0002559 | 3300046681 | Bacteria | 5763 |
| 610 | Ga0495647_0038562 | 3300046681 | Bacteria | 1807 |
| 611 | Ga0495647_0129918 | 3300046681 | Bacteria | 1066 |
| 612 | Ga0495658_0002471 | 3300046683 | Bacteria | 9310 |
| 613 | Ga0495658_0070177 | 3300046683 | Bacteria | 2032 |
| 614 | Ga0495669_0077130 | 3300046684 | Bacteria | 1526 |
| 615 | Ga0495613_0003963 | 3300046689 | Bacteria | 11089 |
| 616 | Ga0495613_0017401 | 3300046689 | Bacteria | 5355 |
| 617 | Ga0495613_0156435 | 3300046689 | Unclassified | 1624 |
| 618 | Ga0495624_0012694 | 3300046690 | Bacteria | 5754 |
| 619 | Ga0495624_0092240 | 3300046690 | Bacteria | 1868 |
| 620 | Ga0495624_0102098 | 3300046690 | Bacteria | 1766 |
| 621 | Ga0495589_0072813 | 3300046794 | Bacteria | 1678 |
| 622 | Ga0495600_0043498 | 3300046809 | Bacteria | 2929 |
| 623 | Ga0495600_0045091 | 3300046809 | Bacteria | 2876 |
| 624 | Ga0495600_0081775 | 3300046809 | Bacteria | 2108 |
| 625 | Ga0495600_0274613 | 3300046809 | Bacteria | 1068 |
| 626 | Ga0495581_0000868 | 3300047315 | Bacteria | 16148 |
| 627 | Ga0495581_0000983 | 3300047315 | Bacteria | 15316 |
| 628 | Ga0495581_0038723 | 3300047315 | Bacteria | 2759 |
| 629 | Ga0495604_0009004 | 3300047317 | Bacteria | 7895 |
| 630 | Ga0495604_0049521 | 3300047317 | Bacteria | 3264 |
| 631 | Ga0495604_0071262 | 3300047317 | Bacteria | 2629 |
| 632 | Ga0495636_0097569 | 3300047318 | Bacteria | 1282 |
| 633 | Ga0495674_0030284 | 3300047319 | Bacteria | 4922 |
| 634 | Ga0495674_0034362 | 3300047319 | Bacteria | 4586 |
| 635 | Ga0495676_0001001 | 3300047321 | Bacteria | 23792 |
| 636 | Ga0495676_0005250 | 3300047321 | Bacteria | 11854 |
| 637 | Ga0495676_0107890 | 3300047321 | Bacteria | 2049 |
| 638 | Ga0495676_0129607 | 3300047321 | Bacteria | 1823 |
| 639 | Ga0495680_0005597 | 3300047322 | Bacteria | 11781 |
| 640 | Ga0495680_0013355 | 3300047322 | Bacteria | 7170 |
| 641 | Ga0495680_0019813 | 3300047322 | Bacteria | 5672 |
| 642 | Ga0495680_0021298 | 3300047322 | Bacteria | 5429 |
| 643 | Ga0495675_0024052 | 3300047444 | Bacteria | 3881 |
| 644 | Ga0495675_0065903 | 3300047444 | Bacteria | 2290 |
| 645 | Ga0495677_0029620 | 3300047445 | Bacteria | 1991 |
| 646 | Ga0495684_0006596 | 3300047471 | Bacteria | 9002 |
| 647 | Ga0495684_0010019 | 3300047471 | Bacteria | 7327 |
| 648 | Ga0495684_0098690 | 3300047471 | Bacteria | 2208 |
| 649 | Ga0495684_0136795 | 3300047471 | Bacteria | 1838 |
| 650 | Ga0495593_0001317 | 3300047673 | Bacteria | 14550 |
| 651 | Ga0495602_0046294 | 3300048088 | Bacteria | 3930 |
| 652 | Ga0495602_0061923 | 3300048088 | Bacteria | 3249 |
| 653 | Ga0495614_0004961 | 3300048089 | Bacteria | 6006 |
| 654 | Ga0496100_0010105 | 3300048903 | Bacteria | 5332 |
| 655 | Ga0496100_0034248 | 3300048903 | Bacteria | 3185 |
| 656 | Ga0496100_0041546 | 3300048903 | Bacteria | 2932 |
| 657 | Ga0496100_0047907 | 3300048903 | Bacteria | 2756 |
| 658 | Ga0496100_0111711 | 3300048903 | Bacteria | 1899 |
| 659 | Ga0496100_0231365 | 3300048903 | Bacteria | 1360 |
| 660 | Ga0496101_0008544 | 3300048904 | Bacteria | 6691 |
| 661 | Ga0496101_0032186 | 3300048904 | Bacteria | 3689 |
| 662 | Ga0496101_0104500 | 3300048904 | Bacteria | 2124 |
| 663 | Ga0496101_0143111 | 3300048904 | Bacteria | 1824 |
| 664 | Ga0496102_0001674 | 3300048905 | Bacteria | 19466 |
| 665 | Ga0496102_0042632 | 3300048905 | Bacteria | 4112 |
| 666 | Ga0496102_0077064 | 3300048905 | Bacteria | 3068 |
| 667 | Ga0496102_0215871 | 3300048905 | Bacteria | 1808 |
| 668 | Ga0496102_0400651 | 3300048905 | Bacteria | 1290 |
| 669 | Ga0496103_0002323 | 3300048906 | Bacteria | 12016 |
| 670 | Ga0496103_0021878 | 3300048906 | Bacteria | 3848 |
| 671 | Ga0496104_0007540 | 3300048907 | Bacteria | 9621 |
| 672 | Ga0496104_0017150 | 3300048907 | Bacteria | 6588 |
| 673 | Ga0496104_0049510 | 3300048907 | Bacteria | 3962 |
| 674 | Ga0496104_0082996 | 3300048907 | Bacteria | 3056 |
| 675 | Ga0496104_0137627 | 3300048907 | Bacteria | 2346 |
| 676 | Ga0496105_0001400 | 3300048908 | Bacteria | 16942 |
| 677 | Ga0496105_0012621 | 3300048908 | Bacteria | 6691 |
| 678 | Ga0496105_0027248 | 3300048908 | Bacteria | 4665 |
| 679 | Ga0496105_0081371 | 3300048908 | Bacteria | 2675 |
| 680 | Ga0496105_0207689 | 3300048908 | Bacteria | 1597 |
| 681 | Ga0496105_0271681 | 3300048908 | Bacteria | 1369 |
| 682 | Ga0496105_0435698 | 3300048908 | Bacteria | 1036 |
| 683 | Ga0496106_0011021 | 3300048909 | Bacteria | 6683 |
| 684 | Ga0496106_0062443 | 3300048909 | Bacteria | 2828 |
| 685 | Ga0496106_0142117 | 3300048909 | Bacteria | 1888 |
| 686 | Ga0496107_0004559 | 3300048910 | Bacteria | 9386 |
| 687 | Ga0496107_0052198 | 3300048910 | Bacteria | 2949 |
| 688 | Ga0496107_0081781 | 3300048910 | Bacteria | 2355 |
| 689 | Ga0496107_0207358 | 3300048910 | Bacteria | 1457 |
| 690 | Ga0496108_0020923 | 3300048911 | Bacteria | 5379 |
| 691 | Ga0496108_0026529 | 3300048911 | Bacteria | 4779 |
| 692 | Ga0496108_0144184 | 3300048911 | Bacteria | 2052 |
| 693 | Ga0496108_0174729 | 3300048911 | Bacteria | 1859 |
| 694 | Ga0496108_0238673 | 3300048911 | Bacteria | 1581 |
| 695 | Ga0496109_0001613 | 3300048912 | Bacteria | 18839 |
| 696 | Ga0496109_0002720 | 3300048912 | Bacteria | 14822 |
| 697 | Ga0496109_0003819 | 3300048912 | Bacteria | 12581 |
| 698 | Ga0496109_0025935 | 3300048912 | Bacteria | 5223 |
| 699 | Ga0496109_0035376 | 3300048912 | Bacteria | 4505 |
| 700 | Ga0496109_0092183 | 3300048912 | Bacteria | 2802 |
| 701 | Ga0496109_0126977 | 3300048912 | Bacteria | 2378 |
| 702 | Ga0496109_0142327 | 3300048912 | Bacteria | 2243 |
| 703 | Ga0496109_0147556 | 3300048912 | Bacteria | 2201 |
| 704 | Ga0496109_0498634 | 3300048912 | Bacteria | 1149 |
| 705 | Ga0496110_0020938 | 3300048913 | Bacteria | 5525 |
| 706 | Ga0496110_0076003 | 3300048913 | Bacteria | 2985 |
| 707 | Ga0496110_0076957 | 3300048913 | Bacteria | 2967 |
| 708 | Ga0496110_0191785 | 3300048913 | Bacteria | 1856 |
| 709 | Ga0496110_0257113 | 3300048913 | Bacteria | 1590 |
| 710 | Ga0496110_0264365 | 3300048913 | Bacteria | 1566 |
| 711 | Ga0496110_0631362 | 3300048913 | Bacteria | 970 |
| 712 | Ga0496111_0000230 | 3300048914 | Bacteria | 26717 |
| 713 | Ga0496111_0002628 | 3300048914 | Bacteria | 10890 |
| 714 | Ga0496111_0222511 | 3300048914 | Bacteria | 1402 |
| 715 | Ga0496111_0315425 | 3300048914 | Bacteria | 1158 |
| 716 | Ga0496111_0573571 | 3300048914 | Bacteria | 827 |
| 717 | Ga0496112_0016767 | 3300048915 | Bacteria | 6870 |
| 718 | Ga0496112_0026222 | 3300048915 | Bacteria | 5605 |
| 719 | Ga0496112_0046356 | 3300048915 | Bacteria | 4263 |
| 720 | Ga0496112_0051598 | 3300048915 | Bacteria | 4034 |
| 721 | Ga0496112_0090676 | 3300048915 | Bacteria | 3025 |
| 722 | Ga0496112_0211134 | 3300048915 | Bacteria | 1898 |
| 723 | Ga0496112_0252077 | 3300048915 | Bacteria | 1716 |
| 724 | Ga0496112_0286890 | 3300048915 | Bacteria | 1592 |
| 725 | Ga0496112_0615405 | 3300048915 | Unclassified | 1017 |
| 726 | Ga0496113_0083585 | 3300048916 | Bacteria | 2450 |
| 727 | Ga0496113_0091067 | 3300048916 | Bacteria | 2350 |
| 728 | Ga0496113_0121550 | 3300048916 | Bacteria | 2042 |
| 729 | Ga0496113_0213324 | 3300048916 | Bacteria | 1537 |
| 730 | Ga0496113_0237434 | 3300048916 | Bacteria | 1454 |
| 731 | Ga0496113_0369969 | 3300048916 | Bacteria | 1150 |
| 732 | Ga0496114_0001692 | 3300048917 | Bacteria | 16754 |
| 733 | Ga0496114_0009498 | 3300048917 | Bacteria | 7719 |
| 734 | Ga0496114_0012600 | 3300048917 | Bacteria | 6774 |
| 735 | Ga0496114_0050427 | 3300048917 | Bacteria | 3464 |
| 736 | Ga0496114_0167410 | 3300048917 | Bacteria | 1914 |
| 737 | Ga0496115_0001932 | 3300048918 | Bacteria | 14791 |
| 738 | Ga0496115_0005218 | 3300048918 | Bacteria | 9445 |
| 739 | Ga0496115_0005222 | 3300048918 | Bacteria | 9440 |
| 740 | Ga0496115_0006918 | 3300048918 | Bacteria | 8332 |
| 741 | Ga0496115_0040455 | 3300048918 | Bacteria | 3706 |
| 742 | Ga0496115_0105769 | 3300048918 | Bacteria | 2310 |
| 743 | Ga0496122_0238014 | 3300048925 | Bacteria | 1029 |
| 744 | Ga0501031_0000445 | 3300049568 | Bacteria | 23857 |
| 745 | Ga0501031_0012499 | 3300049568 | Bacteria | 5541 |
| 746 | Ga0501031_0058633 | 3300049568 | Bacteria | 2508 |
| 747 | Ga0501032_0000876 | 3300049569 | Bacteria | 24428 |
| 748 | Ga0501032_0064563 | 3300049569 | Bacteria | 2450 |
| 749 | Ga0501033_0000294 | 3300049570 | Bacteria | 47989 |
| 750 | Ga0501033_0000948 | 3300049570 | Bacteria | 26325 |
| 751 | Ga0501033_0014207 | 3300049570 | Bacteria | 6052 |
| 752 | Ga0501034_0003200 | 3300049571 | Bacteria | 18796 |
| 753 | Ga0501034_0666796 | 3300049571 | Bacteria | 941 |
| 754 | Ga0501036_0001590 | 3300049572 | Bacteria | 17574 |
| 755 | Ga0501036_0003535 | 3300049572 | Bacteria | 12502 |
| 756 | Ga0501036_0005562 | 3300049572 | Bacteria | 10223 |
| 757 | Ga0501036_0012995 | 3300049572 | Bacteria | 6913 |
| 758 | Ga0501037_0000378 | 3300049573 | Bacteria | 37014 |
| 759 | Ga0501037_0005219 | 3300049573 | Bacteria | 9448 |
| 760 | Ga0501037_0005716 | 3300049573 | Bacteria | 9075 |
| 761 | Ga0501038_0000087 | 3300049574 | Bacteria | 78741 |
| 762 | Ga0501038_0001030 | 3300049574 | Bacteria | 25161 |
| 763 | Ga0501038_0008491 | 3300049574 | Bacteria | 9442 |
| 764 | Ga0501038_0132419 | 3300049574 | Bacteria | 2045 |
| 765 | Ga0501039_0001020 | 3300049575 | Bacteria | 20404 |
| 766 | Ga0501039_0002129 | 3300049575 | Bacteria | 14657 |
| 767 | Ga0501039_0003991 | 3300049575 | Bacteria | 11095 |
| 768 | Ga0501039_0103067 | 3300049575 | Bacteria | 2227 |
| 769 | Ga0501039_0246188 | 3300049575 | Bacteria | 1406 |
| 770 | Ga0501040_0000007 | 3300049576 | Bacteria | 90368 |
| 771 | Ga0501040_0000954 | 3300049576 | Bacteria | 18260 |
| 772 | Ga0501040_0006120 | 3300049576 | Bacteria | 7804 |
| 773 | Ga0501040_0008385 | 3300049576 | Bacteria | 6715 |
| 774 | Ga0501040_0017844 | 3300049576 | Bacteria | 4711 |
| 775 | Ga0501040_0040161 | 3300049576 | Bacteria | 3183 |
| 776 | Ga0501040_0259194 | 3300049576 | Bacteria | 1241 |
| 777 | Ga0501040_0375145 | 3300049576 | Bacteria | 1020 |
| 778 | Ga0501041_0000005 | 3300049577 | Bacteria | 75426 |
| 779 | Ga0501041_0001093 | 3300049577 | Bacteria | 14842 |
| 780 | Ga0501041_0001786 | 3300049577 | Bacteria | 12044 |
| 781 | Ga0501041_0002281 | 3300049577 | Bacteria | 10857 |
| 782 | Ga0501041_0312647 | 3300049577 | Bacteria | 990 |
| 783 | Ga0501042_0003216 | 3300049578 | Bacteria | 10205 |
| 784 | Ga0501042_0003964 | 3300049578 | Bacteria | 9370 |
| 785 | Ga0501042_0010225 | 3300049578 | Bacteria | 6280 |
| 786 | Ga0501042_0034208 | 3300049578 | Bacteria | 3604 |
| 787 | Ga0501042_0140790 | 3300049578 | Bacteria | 1739 |
| 788 | Ga0501042_0314211 | 3300049578 | Bacteria | 1132 |
| 789 | Ga0501043_0000998 | 3300049579 | Bacteria | 24892 |
| 790 | Ga0501043_0002596 | 3300049579 | Bacteria | 15247 |
| 791 | Ga0501043_0048746 | 3300049579 | Bacteria | 3329 |
| 792 | Ga0501046_0001278 | 3300049580 | Bacteria | 24362 |
| 793 | Ga0501046_0002426 | 3300049580 | Bacteria | 17479 |
| 794 | Ga0501046_0017453 | 3300049580 | Bacteria | 5990 |
| 795 | Ga0501046_0028136 | 3300049580 | Bacteria | 4580 |
| 796 | Ga0501046_0053780 | 3300049580 | Bacteria | 3169 |
| 797 | Ga0501047_0000592 | 3300049581 | Bacteria | 38584 |
| 798 | Ga0501047_0084809 | 3300049581 | Bacteria | 3044 |
| 799 | Ga0501048_0000018 | 3300049582 | Bacteria | 72234 |
| 800 | Ga0501048_0001926 | 3300049582 | Bacteria | 15771 |
| 801 | Ga0501048_0010488 | 3300049582 | Bacteria | 6916 |
| 802 | Ga0501048_0030135 | 3300049582 | Bacteria | 3928 |
| 803 | Ga0501067_0000808 | 3300049583 | Bacteria | 16867 |
| 804 | Ga0501067_0009559 | 3300049583 | Bacteria | 5372 |
| 805 | Ga0501067_0046231 | 3300049583 | Bacteria | 2416 |
| 806 | Ga0501067_0251210 | 3300049583 | Bacteria | 984 |
| 807 | Ga0501068_0000134 | 3300049584 | Bacteria | 33588 |
| 808 | Ga0501068_0001631 | 3300049584 | Bacteria | 11969 |
| 809 | Ga0501068_0005123 | 3300049584 | Bacteria | 7140 |
| 810 | Ga0501068_0011873 | 3300049584 | Bacteria | 4924 |
| 811 | Ga0501068_0089746 | 3300049584 | Bacteria | 1895 |
| 812 | Ga0501069_0000426 | 3300049585 | Bacteria | 19142 |
| 813 | Ga0501069_0007694 | 3300049585 | Bacteria | 5652 |
| 814 | Ga0501069_0009322 | 3300049585 | Bacteria | 5181 |
| 815 | Ga0501069_0015243 | 3300049585 | Bacteria | 4119 |
| 816 | Ga0501069_0088960 | 3300049585 | Bacteria | 1745 |
| 817 | Ga0501069_0124989 | 3300049585 | Bacteria | 1471 |
| 818 | Ga0501070_0002768 | 3300049586 | Bacteria | 15306 |
| 819 | Ga0501070_0004569 | 3300049586 | Bacteria | 11863 |
| 820 | Ga0501070_0005855 | 3300049586 | Bacteria | 10483 |
| 821 | Ga0501070_0293181 | 3300049586 | Bacteria | 1326 |
| 822 | Ga0501070_0489327 | 3300049586 | Bacteria | 989 |
| 823 | Ga0501071_0000005 | 3300049587 | Bacteria | 78747 |
| 824 | Ga0501071_0001995 | 3300049587 | Bacteria | 12192 |
| 825 | Ga0501071_0003729 | 3300049587 | Bacteria | 9570 |
| 826 | Ga0501071_0089097 | 3300049587 | Bacteria | 2264 |
| 827 | Ga0501072_0000269 | 3300049588 | Bacteria | 37902 |
| 828 | Ga0501072_0004831 | 3300049588 | Bacteria | 10263 |
| 829 | Ga0501072_0011678 | 3300049588 | Bacteria | 6710 |
| 830 | Ga0501072_0012028 | 3300049588 | Bacteria | 6611 |
| 831 | Ga0501072_0038239 | 3300049588 | Bacteria | 3765 |
| 832 | Ga0501072_0092159 | 3300049588 | Bacteria | 2406 |
| 833 | Ga0501072_0368844 | 3300049588 | Bacteria | 1140 |
| 834 | Ga0501073_0000550 | 3300049589 | Bacteria | 26515 |
| 835 | Ga0501073_0001327 | 3300049589 | Bacteria | 18226 |
| 836 | Ga0501073_0033451 | 3300049589 | Bacteria | 3660 |
| 837 | Ga0501074_0000503 | 3300049590 | Bacteria | 24003 |
| 838 | Ga0501074_0001138 | 3300049590 | Bacteria | 17415 |
| 839 | Ga0501074_0060672 | 3300049590 | Bacteria | 2724 |
| 840 | Ga0501074_0075006 | 3300049590 | Bacteria | 2428 |
| 841 | Ga0501074_0150225 | 3300049590 | Bacteria | 1666 |
| 842 | Ga0501075_0000009 | 3300049591 | Bacteria | 97052 |
| 843 | Ga0501075_0000193 | 3300049591 | Bacteria | 31987 |
| 844 | Ga0501075_0020469 | 3300049591 | Bacteria | 4814 |
| 845 | Ga0501075_0050851 | 3300049591 | Bacteria | 3115 |
| 846 | Ga0501075_0126450 | 3300049591 | Bacteria | 1946 |
| 847 | Ga0501075_0313886 | 3300049591 | Bacteria | 1194 |
| 848 | Ga0501076_0000028 | 3300049592 | Bacteria | 76828 |
| 849 | Ga0501076_0001292 | 3300049592 | Bacteria | 16692 |
| 850 | Ga0501076_0004133 | 3300049592 | Bacteria | 10264 |
| 851 | Ga0501076_0019547 | 3300049592 | Bacteria | 5178 |
| 852 | Ga0501076_0342452 | 3300049592 | Bacteria | 1227 |
| 853 | Ga0501076_0578190 | 3300049592 | Bacteria | 926 |
| 854 | Ga0501077_0000006 | 3300049593 | Bacteria | 119936 |
| 855 | Ga0501077_0001176 | 3300049593 | Bacteria | 15828 |
| 856 | Ga0501077_0005443 | 3300049593 | Bacteria | 7747 |
| 857 | Ga0501077_0020007 | 3300049593 | Bacteria | 4235 |
| 858 | Ga0501079_0000881 | 3300049741 | Bacteria | 20585 |
| 859 | Ga0501079_0000929 | 3300049741 | Bacteria | 20116 |
| 860 | Ga0501079_0003399 | 3300049741 | Bacteria | 11682 |
| 861 | Ga0501079_0007488 | 3300049741 | Bacteria | 8256 |
| 862 | Ga0501079_0025921 | 3300049741 | Bacteria | 4497 |
| 863 | Ga0501079_0096299 | 3300049741 | Bacteria | 2294 |
| 864 | Ga0501079_0133505 | 3300049741 | Bacteria | 1932 |
| 865 | Ga0501080_0000626 | 3300049742 | Bacteria | 28026 |
| 866 | Ga0501080_0001089 | 3300049742 | Bacteria | 22370 |
| 867 | Ga0501080_0032292 | 3300049742 | Bacteria | 4881 |
| 868 | Ga0501080_0296810 | 3300049742 | Bacteria | 1466 |
| 869 | Ga0501081_0000003 | 3300049743 | Bacteria | 97558 |
| 870 | Ga0501081_0000159 | 3300049743 | Bacteria | 31036 |
| 871 | Ga0501081_0001137 | 3300049743 | Bacteria | 16055 |
| 872 | Ga0501081_0001281 | 3300049743 | Bacteria | 15290 |
| 873 | Ga0501081_0176860 | 3300049743 | Bacteria | 1542 |
| 874 | Ga0501081_0353352 | 3300049743 | Bacteria | 1083 |
| 875 | Ga0501083_0000816 | 3300049744 | Bacteria | 20385 |
| 876 | Ga0501083_0001673 | 3300049744 | Bacteria | 15132 |
| 877 | Ga0501083_0008047 | 3300049744 | Bacteria | 7457 |
| 878 | Ga0501083_0216452 | 3300049744 | Bacteria | 1248 |
| 879 | Ga0501035_0000175 | 3300049822 | Bacteria | 78747 |
| 880 | Ga0501035_0078473 | 3300049822 | Bacteria | 2916 |
| 881 | Ga0501035_0083328 | 3300049822 | Bacteria | 2821 |
| 882 | Ga0501044_0006303 | 3300049823 | Bacteria | 13113 |
| 883 | Ga0501044_0038039 | 3300049823 | Bacteria | 5025 |
| 884 | Ga0501044_0047928 | 3300049823 | Bacteria | 4418 |
| 885 | Ga0501044_0486546 | 3300049823 | Bacteria | 1136 |
| 886 | Ga0501045_0000009 | 3300049824 | Bacteria | 75255 |
| 887 | Ga0501045_0000585 | 3300049824 | Bacteria | 22890 |
| 888 | Ga0501045_0002161 | 3300049824 | Bacteria | 13314 |
| 889 | Ga0501045_0002370 | 3300049824 | Bacteria | 12795 |
| 890 | Ga0501045_0150860 | 3300049824 | Bacteria | 1729 |
| 891 | Ga0501045_0333865 | 3300049824 | Unclassified | 1128 |
| 892 | nmdc:mga05p37_11001_c1 | 3300050507 | Bacteria | 10744 |
| 893 | nmdc:mga05p37_228180_c1 | 3300050507 | Bacteria | 2245 |
| 894 | nmdc:mga05p37_43470_c1 | 3300050507 | Bacteria | 5528 |
| 895 | nmdc:mga05p37_613470_c1 | 3300050507 | Unclassified | 1226 |
| 896 | nmdc:mga05p37_663035_c1 | 3300050507 | Bacteria | 1166 |
| 897 | nmdc:mga05p37_765488_c1 | 3300050507 | Bacteria | 1062 |
| 898 | nmdc:mga09592_1116_c1 | 3300050508 | Bacteria | 21373 |
| 899 | nmdc:mga0qj67_546827_c1 | 3300050509 | Bacteria | 929 |
| 900 | nmdc:mga0qj67_58145_c1 | 3300050509 | Bacteria | 3065 |
| 901 | nmdc:mga0qj67_76093_c1 | 3300050509 | Bacteria | 2684 |
| 902 | nmdc:mga0qj67_9898_c1 | 3300050509 | Bacteria | 7109 |
| 903 | nmdc:mga06r32_133490_c1 | 3300050510 | Bacteria | 2456 |
| 904 | nmdc:mga06r32_325329_c1 | 3300050510 | Bacteria | 1523 |
| 905 | nmdc:mga08y16_267648_c1 | 3300050511 | Unclassified | 1765 |
| 906 | nmdc:mga08y16_273891_c1 | 3300050511 | Bacteria | 1742 |
| 907 | nmdc:mga08y16_328075_c1 | 3300050511 | Bacteria | 1575 |
| 908 | nmdc:mga0n895_434154_c1 | 3300050512 | Bacteria | 1327 |
| 909 | nmdc:mga0n895_851867_c1 | 3300050512 | Bacteria | 899 |
| 910 | nmdc:mga0rr50_481469_c1 | 3300050513 | Bacteria | 1054 |
| 911 | nmdc:mga0a205_169830_c1 | 3300050515 | Bacteria | 2077 |
| 912 | nmdc:mga0a205_389828_c1 | 3300050515 | Bacteria | 1257 |
| 913 | nmdc:mga0a205_54850_c1 | 3300050515 | Bacteria | 2996 |
| 914 | Ga0495601_0063919 | 3300053077 | Bacteria | 2339 |
| 915 | Ga0495601_0066823 | 3300053077 | Bacteria | 2289 |
| 916 | Ga0495612_0011495 | 3300053078 | Bacteria | 3570 |
| 917 | Ga0495612_0020933 | 3300053078 | Bacteria | 2623 |
| 918 | Ga0495612_0085111 | 3300053078 | Bacteria | 1332 |
| 919 | Ga0495595_0006454 | 3300053084 | Bacteria | 4785 |
| 920 | Ga0495595_0013656 | 3300053084 | Bacteria | 3433 |
| 921 | Ga0495595_0077560 | 3300053084 | Bacteria | 1578 |
| 922 | Ga0495619_0003097 | 3300053085 | Bacteria | 10800 |
| 923 | Ga0495619_0004791 | 3300053085 | Bacteria | 8599 |
| 924 | Ga0495619_0025587 | 3300053085 | Bacteria | 3791 |
| 925 | Ga0495619_0069309 | 3300053085 | Bacteria | 2357 |
| 926 | Ga0501084_0001358 | 3300054114 | Bacteria | 19353 |
| 927 | Ga0501084_0005874 | 3300054114 | Bacteria | 10101 |
| 928 | Ga0501084_0007802 | 3300054114 | Bacteria | 8810 |
| 929 | Ga0501084_0050734 | 3300054114 | Bacteria | 3471 |
| 930 | Ga0501084_0065108 | 3300054114 | Bacteria | 3049 |
| 931 | Ga0501084_0091250 | 3300054114 | Bacteria | 2558 |
| 932 | Ga0501084_0293985 | 3300054114 | Bacteria | 1372 |
| 933 | Ga0501084_0515238 | 3300054114 | Unclassified | 1011 |
| 934 | Ga0501082_0000063 | 3300060353 | Bacteria | 76891 |
| 935 | Ga0501082_0001009 | 3300060353 | Bacteria | 24886 |
| 936 | Ga0501082_0001714 | 3300060353 | Bacteria | 19338 |
| 937 | Ga0501082_0047272 | 3300060353 | Bacteria | 3708 |
| 938 | Ga0501082_0174255 | 3300060353 | Bacteria | 1870 |
| 939 | Ga0501082_0179897 | 3300060353 | Bacteria | 1839 |
| 940 | Ga0530510_0000014 | 3300061734 | Bacteria | 106661 |
| 941 | Ga0530510_0001148 | 3300061734 | Bacteria | 17568 |
| 942 | Ga0530510_0001637 | 3300061734 | Bacteria | 15131 |
| 943 | Ga0530510_0031133 | 3300061734 | Bacteria | 3835 |
| 944 | Ga0530510_0062221 | 3300061734 | Bacteria | 2702 |
| 945 | Ga0530510_0187208 | 3300061734 | Bacteria | 1536 |
| 946 | Ga0530510_0237292 | 3300061734 | Unclassified | 1357 |
| 947 | Ga0075428_100021373 | |||
| 948 | JGI24744J21845_10006167 | |||
| 949 | JGI24742J22300_10007079 | |||
| 950 | JGI25406J46586_10044899 | |||
| 951 | JGI25406J46586_10054715 | |||
| 952 | JGI25407J50210_10000296 | |||
| 953 | JGI25407J50210_10002731 | |||
| 954 | JGI25407J50210_10010599 | |||
| 955 | Ga0070658_10008472 | |||
| 956 | Ga0070683_100004962 | |||
| 957 | Ga0070683_100023359 | |||
| 958 | Ga0070683_100031568 | |||
| 959 | Ga0070683_100091742 | |||
| 960 | Ga0070683_100188404 | |||
| 961 | Ga0070683_100250161 | |||
| 962 | Ga0070683_100296513 | |||
| 963 | Ga0070683_100550008 | |||
| 964 | Ga0070690_100050328 | |||
| 965 | Ga0070680_100004037 | |||
| 966 | Ga0070680_100005608 | |||
| 967 | Ga0070680_100055164 | |||
| 968 | Ga0070680_100307574 | |||
| 969 | Ga0068868_100012943 | |||
| 970 | Ga0068868_100180041 | |||
| 971 | Ga0068868_100557303 | |||
| 972 | Ga0070660_100001494 | |||
| 973 | Ga0070660_100003867 | |||
| 974 | Ga0070660_100136777 | |||
| 975 | Ga0070660_100223563 | |||
| 976 | Ga0070689_100057873 | |||
| 977 | Ga0070661_100007123 | |||
| 978 | Ga0070661_100086221 | |||
| 979 | Ga0070661_100277989 | |||
| 980 | Ga0070661_100491230 | |||
| 981 | Ga0070692_10074017 | |||
| 982 | Ga0070668_100603881 | |||
| 983 | Ga0070671_100143550 | |||
| 984 | Ga0070673_100424035 | |||
| 985 | Ga0070673_100429948 | |||
| 986 | Ga0070673_100620347 | |||
| 987 | Ga0070688_100047083 | |||
| 988 | Ga0070659_100022221 | |||
| 989 | Ga0070659_100026115 | |||
| 990 | Ga0070659_100141159 | |||
| 991 | Ga0070659_100439723 | |||
| 992 | Ga0070709_10198395 | |||
| 993 | Ga0070714_100523682 | |||
| 994 | Ga0070714_100544095 | |||
| 995 | Ga0070714_100596958 | |||
| 996 | Ga0070710_10029625 | |||
| 997 | Ga0070701_10187935 | |||
| 998 | Ga0070711_100025657 | |||
| 999 | Ga0070700_100021145 | |||
| 1000 | Ga0070700_100250374 | |||
| 1001 | Ga0070694_100034592 | |||
| 1002 | Ga0070694_100548017 | |||
| 1003 | Ga0070678_100004691 | |||
| 1004 | Ga0070678_100260104 | |||
| 1005 | Ga0070681_10008977 | |||
| 1006 | Ga0070681_10030842 | |||
| 1007 | Ga0070681_10034745 | |||
| 1008 | Ga0070681_10084225 | |||
| 1009 | Ga0070681_10140034 | |||
| 1010 | Ga0070681_10183635 | |||
| 1011 | Ga0068867_100088449 | |||
| 1012 | Ga0070685_10045930 | |||
| 1013 | Ga0070706_100086274 | |||
| 1014 | Ga0070707_100774811 | |||
| 1015 | Ga0070698_100071122 | |||
| 1016 | Ga0070699_100312425 | |||
| 1017 | Ga0070679_100075881 | |||
| 1018 | Ga0070679_100139279 | |||
| 1019 | Ga0070679_100179023 | |||
| 1020 | Ga0070679_100242556 | |||
| 1021 | Ga0070684_100001226 | |||
| 1022 | Ga0070684_100071339 | |||
| 1023 | Ga0070684_100075594 | |||
| 1024 | Ga0070684_100128869 | |||
| 1025 | Ga0068853_100094958 | |||
| 1026 | Ga0068853_100220600 | |||
| 1027 | Ga0070672_100046991 | |||
| 1028 | Ga0070672_100306261 | |||
| 1029 | Ga0070686_100033274 | |||
| 1030 | Ga0070693_100042631 | |||
| 1031 | Ga0070693_100418498 | |||
| 1032 | Ga0070665_100032824 | |||
| 1033 | Ga0070665_100172112 | |||
| 1034 | Ga0070665_100923507 | |||
| 1035 | Ga0068855_100014350 | |||
| 1036 | Ga0068855_100060814 | |||
| 1037 | Ga0068855_100272389 | |||
| 1038 | Ga0068855_100624803 | |||
| 1039 | Ga0070664_100017950 | |||
| 1040 | Ga0070664_100221746 | |||
| 1041 | Ga0068857_100004862 | |||
| 1042 | Ga0068857_100006742 | |||
| 1043 | Ga0068857_100142692 | |||
| 1044 | Ga0068857_100211722 | |||
| 1045 | Ga0068856_100042442 | |||
| 1046 | Ga0068856_100637785 | |||
| 1047 | Ga0070702_100010715 | |||
| 1048 | Ga0068852_100146700 | |||
| 1049 | Ga0068859_100587512 | |||
| 1050 | Ga0068859_100752606 | |||
| 1051 | Ga0068864_100122688 | |||
| 1052 | Ga0068861_100153467 | |||
| 1053 | Ga0068861_100540410 | |||
| 1054 | Ga0068870_10208934 | |||
| 1055 | Ga0068863_100802393 | |||
| 1056 | Ga0068858_100705059 | |||
| 1057 | Ga0068860_100412037 | |||
| 1058 | Ga0068862_100126795 | |||
| 1059 | Ga0081455_10008830 | |||
| 1060 | Ga0081455_10014299 | |||
| 1061 | Ga0081455_10030105 | |||
| 1062 | Ga0081455_10069855 | |||
| 1063 | Ga0081455_10169911 | |||
| 1064 | Ga0081538_10000181 | |||
| 1065 | Ga0081538_10000297 | |||
| 1066 | Ga0081538_10000502 | |||
| 1067 | Ga0081538_10000804 | |||
| 1068 | Ga0081538_10000925 | |||
| 1069 | Ga0081538_10008148 | |||
| 1070 | Ga0081538_10017280 | |||
| 1071 | Ga0081538_10018099 | |||
| 1072 | Ga0081538_10018371 | |||
| 1073 | Ga0081538_10069192 | |||
| 1074 | Ga0081538_10139401 | |||
| 1075 | Ga0081540_1006849 | |||
| 1076 | Ga0081539_10000062 | |||
| 1077 | Ga0081539_10001583 | |||
| 1078 | Ga0081539_10009993 | |||
| 1079 | Ga0081539_10012956 | |||
| 1080 | Ga0081539_10019762 | |||
| 1081 | Ga0075365_10175513 | |||
| 1082 | Ga0075432_10064927 | |||
| 1083 | Ga0070715_10022486 | |||
| 1084 | Ga0070716_100288031 | |||
| 1085 | Ga0070712_100004124 | |||
| 1086 | Ga0070712_100537153 | |||
| 1087 | Ga0075427_10022130 | |||
| 1088 | Ga0097621_100024560 | |||
| 1089 | Ga0097621_100214086 | |||
| 1090 | Ga0068871_100027672 | |||
| 1091 | Ga0068871_100366585 | |||
| 1092 | Ga0068871_100403331 | |||
| 1093 | Ga0075428_100043736 | |||
| 1094 | Ga0075428_100518490 | |||
| 1095 | Ga0075428_100728850 | |||
| 1096 | Ga0075430_100100857 | |||
| 1097 | Ga0075430_100203256 | |||
| 1098 | Ga0075430_100230303 | |||
| 1099 | Ga0075431_100045347 | |||
| 1100 | Ga0075433_10075025 | |||
| 1101 | Ga0075433_10175656 | |||
| 1102 | Ga0075434_100838263 | |||
| 1103 | Ga0075429_100007313 | |||
| 1104 | Ga0068865_100031396 | |||
| 1105 | Ga0068865_100229439 | |||
| 1106 | Ga0097620_100587506 | |||
| 1107 | Ga0097620_100752640 | |||
| 1108 | Ga0075435_100037060 | |||
| 1109 | Ga0075435_100485689 | |||
| 1110 | Ga0105240_10026755 | |||
| 1111 | Ga0105240_10049813 | |||
| 1112 | Ga0105240_10213432 | |||
| 1113 | Ga0111539_10005174 | |||
| 1114 | Ga0111539_10058439 | |||
| 1115 | Ga0111539_10207811 | |||
| 1116 | Ga0111539_10337928 | |||
| 1117 | Ga0105245_10060054 | |||
| 1118 | Ga0105245_10064347 | |||
| 1119 | Ga0105245_10275196 | |||
| 1120 | Ga0105245_10418863 | |||
| 1121 | Ga0114129_10003023 | |||
| 1122 | Ga0114129_10028025 | |||
| 1123 | Ga0114129_10173490 | |||
| 1124 | Ga0114129_10682846 | |||
| 1125 | Ga0114129_10702139 | |||
| 1126 | Ga0114129_10938285 | |||
| 1127 | Ga0114129_10954564 | |||
| 1128 | Ga0105243_10033430 | |||
| 1129 | Ga0105243_10192741 | |||
| 1130 | Ga0105243_10481491 | |||
| 1131 | Ga0105241_10446920 | |||
| 1132 | Ga0105242_10014556 | |||
| 1133 | Ga0105242_10051900 | |||
| 1134 | Ga0105242_10341334 | |||
| 1135 | Ga0105242_10511241 | |||
| 1136 | Ga0105237_10001575 | |||
| 1137 | Ga0105237_10032006 | |||
| 1138 | Ga0105237_10169117 | |||
| 1139 | Ga0105238_10306741 | |||
| 1140 | Ga0105249_10011189 | |||
| 1141 | Ga0105249_10658705 | |||
| 1142 | Ga0105239_10006331 | |||
| 1143 | Ga0105239_10360933 | |||
| 1144 | Ga0105239_10398055 | |||
| 1145 | Ga0105239_10676486 | |||
| 1146 | Ga0105246_10039193 | |||
| 1147 | Ga0157373_10252380 | |||
| 1148 | Ga0157370_10038762 | |||
| 1149 | Ga0157370_10356979 | |||
| 1150 | Ga0157370_10436440 | |||
| 1151 | Ga0157370_10445572 | |||
| 1152 | Ga0157369_10035965 | |||
| 1153 | Ga0157369_10068684 | |||
| 1154 | Ga0157369_10094741 | |||
| 1155 | Ga0157374_10006829 | |||
| 1156 | Ga0157374_10098614 | |||
| 1157 | Ga0157374_10192298 | |||
| 1158 | Ga0157378_10011844 | |||
| 1159 | Ga0163162_10007186 | |||
| 1160 | Ga0157372_10075957 | |||
| 1161 | Ga0157372_10197601 | |||
| 1162 | Ga0157372_10317301 | |||
| 1163 | Ga0157375_10010359 | |||
| 1164 | Ga0157375_10177722 | |||
| 1165 | Ga0163163_10428054 | |||
| 1166 | Ga0157380_10119804 | |||
| 1167 | Ga0157380_10152318 | |||
| 1168 | Ga0157377_10005388 | |||
| 1169 | Ga0157377_10022425 | |||
| 1170 | Ga0157376_10047691 | |||
| 1171 | Ga0157376_10210484 | |||
| 1172 | Ga0182007_10049478 | |||
| 1173 | Ga0206356_11664069 | |||
| 1174 | Ga0206353_11255590 | |||
| 1175 | Ga0206353_11829944 | |||
| 1176 | Ga0206353_11844079 | |||
| 1177 | Ga0207692_10040358 | |||
| 1178 | Ga0207692_10041477 | |||
| 1179 | Ga0207642_10089634 | |||
| 1180 | Ga0207699_10027383 | |||
| 1181 | Ga0207699_10043526 | |||
| 1182 | Ga0207699_10120388 | |||
| 1183 | Ga0207654_10169278 | |||
| 1184 | Ga0207654_10375171 | |||
| 1185 | Ga0207707_10011148 | |||
| 1186 | Ga0207707_10012057 | |||
| 1187 | Ga0207707_10028270 | |||
| 1188 | Ga0207707_10092802 | |||
| 1189 | Ga0207707_10101297 | |||
| 1190 | Ga0207707_10122363 | |||
| 1191 | Ga0207695_10207394 | |||
| 1192 | Ga0207695_10443331 | |||
| 1193 | Ga0207671_10000835 | |||
| 1194 | Ga0207671_10082479 | |||
| 1195 | Ga0207671_10139513 | |||
| 1196 | Ga0207693_10001551 | |||
| 1197 | Ga0207693_10053039 | |||
| 1198 | Ga0207693_10053072 | |||
| 1199 | Ga0207693_10093503 | |||
| 1200 | Ga0207693_10189021 | |||
| 1201 | Ga0207660_10018009 | |||
| 1202 | Ga0207660_10047444 | |||
| 1203 | Ga0207660_10061128 | |||
| 1204 | Ga0207660_10123453 | |||
| 1205 | Ga0207660_10492645 | |||
| 1206 | Ga0207657_10001335 | |||
| 1207 | Ga0207657_10003370 | |||
| 1208 | Ga0207657_10014368 | |||
| 1209 | Ga0207649_10016170 | |||
| 1210 | Ga0207649_10030765 | |||
| 1211 | Ga0207649_10060635 | |||
| 1212 | Ga0207649_10181536 | |||
| 1213 | Ga0207652_10093742 | |||
| 1214 | Ga0207652_10103051 | |||
| 1215 | Ga0207652_10211387 | |||
| 1216 | Ga0207652_10232679 | |||
| 1217 | Ga0207646_10060981 | |||
| 1218 | Ga0207646_10173318 | |||
| 1219 | Ga0207681_10205406 | |||
| 1220 | Ga0207694_10097620 | |||
| 1221 | Ga0207694_10430627 | |||
| 1222 | Ga0207687_10048820 | |||
| 1223 | Ga0207687_10220598 | |||
| 1224 | Ga0207687_10276832 | |||
| 1225 | Ga0207700_10266773 | |||
| 1226 | Ga0207700_10341930 | |||
| 1227 | Ga0207700_10480529 | |||
| 1228 | Ga0207664_10161998 | |||
| 1229 | Ga0207690_10031482 | |||
| 1230 | Ga0207690_10334154 | |||
| 1231 | Ga0207686_10023760 | |||
| 1232 | Ga0207686_10036737 | |||
| 1233 | Ga0207686_10344803 | |||
| 1234 | Ga0207709_10015057 | |||
| 1235 | Ga0207709_10132644 | |||
| 1236 | Ga0207709_10347962 | |||
| 1237 | Ga0207670_10168880 | |||
| 1238 | Ga0207669_10132538 | |||
| 1239 | Ga0207704_10008706 | |||
| 1240 | Ga0207704_10154651 | |||
| 1241 | Ga0207665_10176786 | |||
| 1242 | Ga0207665_10190315 | |||
| 1243 | Ga0207691_10018612 | |||
| 1244 | Ga0207691_10270739 | |||
| 1245 | Ga0207691_10309853 | |||
| 1246 | Ga0207661_10013034 | |||
| 1247 | Ga0207661_10024926 | |||
| 1248 | Ga0207661_10053149 | |||
| 1249 | Ga0207661_10242720 | |||
| 1250 | Ga0207661_10471850 | |||
| 1251 | Ga0207667_10102955 | |||
| 1252 | Ga0207667_10202976 | |||
| 1253 | Ga0207712_10027905 | |||
| 1254 | Ga0207668_10340279 | |||
| 1255 | Ga0207668_10433151 | |||
| 1256 | Ga0207677_10018809 | |||
| 1257 | Ga0207639_10025421 | |||
| 1258 | Ga0207678_10025503 | |||
| 1259 | Ga0207708_10000757 | |||
| 1260 | Ga0207702_10178202 | |||
| 1261 | Ga0207702_10399968 | |||
| 1262 | Ga0207702_10518294 | |||
| 1263 | Ga0207702_10636357 | |||
| 1264 | Ga0207648_10026646 | |||
| 1265 | Ga0207648_10067304 | |||
| 1266 | Ga0207676_10080307 | |||
| 1267 | Ga0207674_10007853 | |||
| 1268 | Ga0207674_10019444 | |||
| 1269 | Ga0207674_10050544 | |||
| 1270 | Ga0207674_10072073 | |||
| 1271 | Ga0207674_10158923 | |||
| 1272 | Ga0207674_10168470 | |||
| 1273 | Ga0207674_10291947 | |||
| 1274 | Ga0207675_100088890 | |||
| 1275 | Ga0207683_10000740 | |||
| 1276 | Ga0207683_10183098 | |||
| 1277 | Ga0207683_10495685 | |||
| 1278 | Ga0207698_10009350 | |||
| 1279 | Ga0207698_10552269 | |||
| 1280 | Ga0207428_10114332 | |||
| 1281 | Ga0268266_10813971 | |||
| 1282 | Ga0268265_10511186 | |||
| 1283 | Ga0268264_10218847 | |||
| 1284 | Ga0265319_1000175 | |||
| 1285 | Ga0265319_1004884 | |||
| 1286 | Ga0265318_10001659 | |||
| 1287 | Ga0265322_10016779 | |||
| 1288 | Ga0265338_10002978 | |||
| 1289 | Ga0265338_10020014 | |||
| 1290 | Ga0265320_10022983 | |||
| 1291 | Ga0265320_10023798 | |||
| 1292 | Ga0265316_10144442 | |||
| 1293 | Ga0307408_100048271 | |||
| 1294 | Ga0307408_100279369 | |||
| 1295 | Ga0307405_10106736 | |||
| 1296 | Ga0307405_10115674 | |||
| 1297 | Ga0307413_10002156 | |||
| 1298 | Ga0307413_10348857 | |||
| 1299 | Ga0307410_10016214 | |||
| 1300 | Ga0307410_10082209 | |||
| 1301 | Ga0307410_10193461 | |||
| 1302 | Ga0307406_10027082 | |||
| 1303 | Ga0307406_10038981 | |||
| 1304 | Ga0307406_10052159 | |||
| 1305 | Ga0307407_10095163 | |||
| 1306 | Ga0307412_10018003 | |||
| 1307 | Ga0307412_10188235 | |||
| 1308 | Ga0307409_100048352 | |||
| 1309 | Ga0307409_100099462 | |||
| 1310 | Ga0307409_100107955 | |||
| 1311 | Ga0307409_100152069 | |||
| 1312 | Ga0307409_100188332 | |||
| 1313 | Ga0307416_100020572 | |||
| 1314 | Ga0307416_100060430 | |||
| 1315 | Ga0307416_100157670 | |||
| 1316 | Ga0307416_100271023 | |||
| 1317 | Ga0307414_10113428 | |||
| 1318 | Ga0307414_10673601 | |||
| 1319 | Ga0307411_10006677 | |||
| 1320 | Ga0307411_10058648 | |||
| 1321 | Ga0307415_100000015 | |||
| 1322 | Ga0307415_100013568 | |||
| 1323 | Ga0307415_100020790 | |||
| 1324 | Ga0307415_100190904 | |||
| 1325 | Ga0373945_0027076 | |||
| 1326 | Ga0373956_0019955 | |||
| 1327 | Ga0373943_0000090 | |||
| 1328 | Ga0373946_0007850 | |||
| 1329 | Ga0373946_0104013 | |||
| 1330 | Ga0373955_0097179 | |||
| 1331 | Ga0373955_0108744 | |||
| 1332 | Ga0373935_0043829 | |||
| 1333 | Ga0373933_0017190 | |||
| 1334 | Ga0373947_0000266 | |||
| 1335 | Ga0373937_0074513 | |||
| 1336 | Ga0373937_0176692 | |||
| 1337 | Ga0373925_0001866 | |||
| 1338 | Ga0395899_0002195 | |||
| 1339 | Ga0395899_0002876 | |||
| 1340 | Ga0395899_0003284 | |||
| 1341 | Ga0395899_0004709 | |||
| 1342 | Ga0395899_0012345 | |||
| 1343 | Ga0395899_0017803 | |||
| 1344 | Ga0395899_0056021 | |||
| 1345 | Ga0395899_0092577 | |||
| 1346 | Ga0395899_0107394 | |||
| 1347 | Ga0395899_0219626 | |||
| 1348 | Ga0395899_0310064 | |||
| 1349 | Ga0395899_0357142 | |||
| 1350 | Ga0395899_0444745 | |||
| 1351 | Ga0395899_0469488 | |||
| 1352 | Ga0395900_0003322 | |||
| 1353 | Ga0395900_0003557 | |||
| 1354 | Ga0395900_0006758 | |||
| 1355 | Ga0395900_0010351 | |||
| 1356 | Ga0395900_0011065 | |||
| 1357 | Ga0395900_0030406 | |||
| 1358 | Ga0395900_0049279 | |||
| 1359 | Ga0395900_0053577 | |||
| 1360 | Ga0395900_0053624 | |||
| 1361 | Ga0395900_0094819 | |||
| 1362 | Ga0395900_0117171 | |||
| 1363 | Ga0395900_0124218 | |||
| 1364 | Ga0395900_0135277 | |||
| 1365 | Ga0395900_0136718 | |||
| 1366 | Ga0395900_0157668 | |||
| 1367 | Ga0395900_0186777 | |||
| 1368 | Ga0395900_0237339 | |||
| 1369 | Ga0395900_0314142 | |||
| 1370 | Ga0395900_0351589 | |||
| 1371 | Ga0395900_0400214 | |||
| 1372 | Ga0395898_0003445 | |||
| 1373 | Ga0395898_0003903 | |||
| 1374 | Ga0395898_0011171 | |||
| 1375 | Ga0395898_0014290 | |||
| 1376 | Ga0395898_0019644 | |||
| 1377 | Ga0395898_0022550 | |||
| 1378 | Ga0395898_0040303 | |||
| 1379 | Ga0395898_0045562 | |||
| 1380 | Ga0395898_0048290 | |||
| 1381 | Ga0395898_0050255 | |||
| 1382 | Ga0395898_0064493 | |||
| 1383 | Ga0395898_0067865 | |||
| 1384 | Ga0395898_0198696 | |||
| 1385 | Ga0395898_0199571 | |||
| 1386 | Ga0395898_0265295 | |||
| 1387 | Ga0395898_0368271 | |||
| 1388 | Ga0395898_0435977 | |||
| 1389 | Ga0395898_0459360 | |||
| 1390 | Ga0395898_0547052 | |||
| 1391 | Ga0395898_0636000 | |||
| 1392 | Ga0395905_0001505 | |||
| 1393 | Ga0395905_0010800 | |||
| 1394 | Ga0395905_0011659 | |||
| 1395 | Ga0395905_0012564 | |||
| 1396 | Ga0395905_0015454 | |||
| 1397 | Ga0395905_0017620 | |||
| 1398 | Ga0395905_0025788 | |||
| 1399 | Ga0395905_0035532 | |||
| 1400 | Ga0395905_0046007 | |||
| 1401 | Ga0395905_0095963 | |||
| 1402 | Ga0395905_0101923 | |||
| 1403 | Ga0395905_0162045 | |||
| 1404 | Ga0395905_0316679 | |||
| 1405 | Ga0395905_0355525 | |||
| 1406 | Ga0395905_0367816 | |||
| 1407 | Ga0395905_0457326 | |||
| 1408 | Ga0395901_0001420 | |||
| 1409 | Ga0395901_0002025 | |||
| 1410 | Ga0395901_0005860 | |||
| 1411 | Ga0395901_0008893 | |||
| 1412 | Ga0395901_0015572 | |||
| 1413 | Ga0395901_0016543 | |||
| 1414 | Ga0395901_0016812 | |||
| 1415 | Ga0395901_0020676 | |||
| 1416 | Ga0395901_0028265 | |||
| 1417 | Ga0395901_0032743 | |||
| 1418 | Ga0395901_0032816 | |||
| 1419 | Ga0395901_0046351 | |||
| 1420 | Ga0395901_0067601 | |||
| 1421 | Ga0395901_0090099 | |||
| 1422 | Ga0395901_0112930 | |||
| 1423 | Ga0395901_0135470 | |||
| 1424 | Ga0395901_0136094 | |||
| 1425 | Ga0395901_0231359 | |||
| 1426 | Ga0395901_0278177 | |||
| 1427 | Ga0395901_0324663 | |||
| 1428 | Ga0395901_0514864 | |||
| 1429 | Ga0395901_0553889 | |||
| 1430 | Ga0395901_0574959 | |||
| 1431 | Ga0395901_0600228 | |||
| 1432 | Ga0395901_0622244 | |||
| 1433 | Ga0436363_1706338 | |||
| 1434 | Ga0451802_0835110 | |||
| 1435 | Ga0451837_1385120 | |||
| 1436 | Ga0451853_0287148 | |||
| 1437 | Ga0451853_0926783 | |||
| 1438 | Ga0451853_2490875 | |||
| 1439 | Ga0439442_022065 | |||
| 1440 | Ga0439448_0016164 | |||
| 1441 | Ga0439448_0032364 | |||
| 1442 | Ga0439448_0187063 | |||
| 1443 | Ga0439454_024473 | |||
| 1444 | Ga0450915_001698 | |||
| 1445 | Ga0450923_027145 | |||
| 1446 | Ga0450916_008390 | |||
| 1447 | Ga0466965_0121778 | |||
| 1448 | Ga0466966_0020976 | |||
| 1449 | Ga0466961_0008144 | |||
| 1450 | Ga0466961_0166724 | |||
| 1451 | Ga0466963_0025241 | |||
| 1452 | Ga0466963_0086992 | |||
| 1453 | Ga0466964_0010017 | |||
| 1454 | Ga0466968_0017224 | |||
| 1455 | Ga0466970_0095608 | |||
| 1456 | Ga0466957_0027129 | |||
| 1457 | Ga0466957_0195778 | |||
| 1458 | Ga0466957_0447398 | |||
| 1459 | Ga0466960_0029005 | |||
| 1460 | Ga0466960_0036774 | |||
| 1461 | Ga0466960_0072775 | |||
| 1462 | Ga0466960_0226119 | |||
| 1463 | Ga0451576_0062670 | |||
| 1464 | Ga0466958_0002118 | |||
| 1465 | Ga0466967_0004393 | |||
| 1466 | Ga0466967_0020474 | |||
| 1467 | Ga0466967_0069123 | |||
| 1468 | Ga0466967_0079454 | |||
| 1469 | Ga0466967_0092522 | |||
| 1470 | Ga0466967_0239770 | |||
| 1471 | Ga0495592_0062638 | |||
| 1472 | Ga0495592_0113725 | |||
| 1473 | Ga0495592_0393177 | |||
| 1474 | Ga0495603_0128957 | |||
| 1475 | Ga0495629_0002088 | |||
| 1476 | Ga0495629_0205882 | |||
| 1477 | Ga0495641_0005538 | |||
| 1478 | Ga0495641_0015298 | |||
| 1479 | Ga0495641_0031562 | |||
| 1480 | Ga0495641_0067037 | |||
| 1481 | Ga0495651_0014023 | |||
| 1482 | Ga0495651_0024849 | |||
| 1483 | Ga0495651_0083680 | |||
| 1484 | Ga0495653_0022048 | |||
| 1485 | Ga0495653_0032140 | |||
| 1486 | Ga0495582_0000801 | |||
| 1487 | Ga0495582_0017801 | |||
| 1488 | Ga0495582_0027982 | |||
| 1489 | Ga0495582_0028565 | |||
| 1490 | Ga0495582_0038899 | |||
| 1491 | Ga0495582_0277814 | |||
| 1492 | Ga0495605_0097616 | |||
| 1493 | Ga0495605_0178965 | |||
| 1494 | Ga0495639_0002081 | |||
| 1495 | Ga0495639_0165137 | |||
| 1496 | Ga0495662_0000984 | |||
| 1497 | Ga0495664_0052360 | |||
| 1498 | Ga0495584_0060226 | |||
| 1499 | Ga0495584_0145173 | |||
| 1500 | Ga0495585_0150259 | |||
| 1501 | Ga0495585_0227045 | |||
| 1502 | Ga0495594_0027397 | |||
| 1503 | Ga0495594_0058068 | |||
| 1504 | Ga0495596_0062281 | |||
| 1505 | Ga0495596_0074820 | |||
| 1506 | Ga0495608_0022630 | |||
| 1507 | Ga0495608_0113461 | |||
| 1508 | Ga0495608_0194279 | |||
| 1509 | Ga0495608_0330688 | |||
| 1510 | Ga0495618_0100461 | |||
| 1511 | Ga0495618_0140526 | |||
| 1512 | Ga0495618_0185074 | |||
| 1513 | Ga0495628_0008805 | |||
| 1514 | Ga0495628_0039578 | |||
| 1515 | Ga0495630_0005899 | |||
| 1516 | Ga0495630_0178212 | |||
| 1517 | Ga0495630_0392934 | |||
| 1518 | Ga0495630_0440195 | |||
| 1519 | Ga0495631_0065306 | |||
| 1520 | Ga0495631_0131155 | |||
| 1521 | Ga0495663_0021663 | |||
| 1522 | Ga0495663_0131459 | |||
| 1523 | Ga0495666_0016257 | |||
| 1524 | Ga0495642_0019597 | |||
| 1525 | Ga0495652_0011511 | |||
| 1526 | Ga0495652_0351503 | |||
| 1527 | Ga0495665_0000215 | |||
| 1528 | Ga0495640_0001520 | |||
| 1529 | Ga0495640_0077065 | |||
| 1530 | Ga0495640_0121419 | |||
| 1531 | Ga0495586_0031050 | |||
| 1532 | Ga0495587_0031722 | |||
| 1533 | Ga0495645_0048974 | |||
| 1534 | Ga0495645_0124477 | |||
| 1535 | Ga0495633_0096293 | |||
| 1536 | Ga0495667_0010495 | |||
| 1537 | Ga0495667_0064213 | |||
| 1538 | Ga0495667_0114859 | |||
| 1539 | Ga0495656_0018519 | |||
| 1540 | Ga0495656_0097357 | |||
| 1541 | Ga0495656_0233335 | |||
| 1542 | Ga0495668_0170136 | |||
| 1543 | Ga0495634_0092617 | |||
| 1544 | Ga0495634_0095954 | |||
| 1545 | Ga0495635_0026331 | |||
| 1546 | Ga0495635_0076575 | |||
| 1547 | Ga0495588_0194974 | |||
| 1548 | Ga0495657_0019467 | |||
| 1549 | Ga0495657_0079758 | |||
| 1550 | Ga0495599_0007133 | |||
| 1551 | Ga0495599_0322564 | |||
| 1552 | Ga0495623_0066176 | |||
| 1553 | Ga0495623_0159882 | |||
| 1554 | Ga0495646_0053245 | |||
| 1555 | Ga0495647_0002559 | |||
| 1556 | Ga0495647_0038562 | |||
| 1557 | Ga0495647_0129918 | |||
| 1558 | Ga0495658_0002471 | |||
| 1559 | Ga0495658_0070177 | |||
| 1560 | Ga0495669_0077130 | |||
| 1561 | Ga0495613_0003963 | |||
| 1562 | Ga0495613_0017401 | |||
| 1563 | Ga0495613_0156435 | |||
| 1564 | Ga0495624_0012694 | |||
| 1565 | Ga0495624_0092240 | |||
| 1566 | Ga0495624_0102098 | |||
| 1567 | Ga0495589_0072813 | |||
| 1568 | Ga0495600_0043498 | |||
| 1569 | Ga0495600_0045091 | |||
| 1570 | Ga0495600_0081775 | |||
| 1571 | Ga0495600_0274613 | |||
| 1572 | Ga0495581_0000868 | |||
| 1573 | Ga0495581_0000983 | |||
| 1574 | Ga0495581_0038723 | |||
| 1575 | Ga0495604_0009004 | |||
| 1576 | Ga0495604_0049521 | |||
| 1577 | Ga0495604_0071262 | |||
| 1578 | Ga0495636_0097569 | |||
| 1579 | Ga0495674_0030284 | |||
| 1580 | Ga0495674_0034362 | |||
| 1581 | Ga0495676_0001001 | |||
| 1582 | Ga0495676_0005250 | |||
| 1583 | Ga0495676_0107890 | |||
| 1584 | Ga0495676_0129607 | |||
| 1585 | Ga0495680_0005597 | |||
| 1586 | Ga0495680_0013355 | |||
| 1587 | Ga0495680_0019813 | |||
| 1588 | Ga0495680_0021298 | |||
| 1589 | Ga0495675_0024052 | |||
| 1590 | Ga0495675_0065903 | |||
| 1591 | Ga0495677_0029620 | |||
| 1592 | Ga0495684_0006596 | |||
| 1593 | Ga0495684_0010019 | |||
| 1594 | Ga0495684_0098690 | |||
| 1595 | Ga0495684_0136795 | |||
| 1596 | Ga0495593_0001317 | |||
| 1597 | Ga0495602_0046294 | |||
| 1598 | Ga0495602_0061923 | |||
| 1599 | Ga0495614_0004961 | |||
| 1600 | Ga0496100_0010105 | |||
| 1601 | Ga0496100_0034248 | |||
| 1602 | Ga0496100_0041546 | |||
| 1603 | Ga0496100_0047907 | |||
| 1604 | Ga0496100_0111711 | |||
| 1605 | Ga0496100_0231365 | |||
| 1606 | Ga0496101_0008544 | |||
| 1607 | Ga0496101_0032186 | |||
| 1608 | Ga0496101_0104500 | |||
| 1609 | Ga0496101_0143111 | |||
| 1610 | Ga0496102_0001674 | |||
| 1611 | Ga0496102_0042632 | |||
| 1612 | Ga0496102_0077064 | |||
| 1613 | Ga0496102_0215871 | |||
| 1614 | Ga0496102_0400651 | |||
| 1615 | Ga0496103_0002323 | |||
| 1616 | Ga0496103_0021878 | |||
| 1617 | Ga0496104_0007540 | |||
| 1618 | Ga0496104_0017150 | |||
| 1619 | Ga0496104_0049510 | |||
| 1620 | Ga0496104_0082996 | |||
| 1621 | Ga0496104_0137627 | |||
| 1622 | Ga0496105_0001400 | |||
| 1623 | Ga0496105_0012621 | |||
| 1624 | Ga0496105_0027248 | |||
| 1625 | Ga0496105_0081371 | |||
| 1626 | Ga0496105_0207689 | |||
| 1627 | Ga0496105_0271681 | |||
| 1628 | Ga0496105_0435698 | |||
| 1629 | Ga0496106_0011021 | |||
| 1630 | Ga0496106_0062443 | |||
| 1631 | Ga0496106_0142117 | |||
| 1632 | Ga0496107_0004559 | |||
| 1633 | Ga0496107_0052198 | |||
| 1634 | Ga0496107_0081781 | |||
| 1635 | Ga0496107_0207358 | |||
| 1636 | Ga0496108_0020923 | |||
| 1637 | Ga0496108_0026529 | |||
| 1638 | Ga0496108_0144184 | |||
| 1639 | Ga0496108_0174729 | |||
| 1640 | Ga0496108_0238673 | |||
| 1641 | Ga0496109_0001613 | |||
| 1642 | Ga0496109_0002720 | |||
| 1643 | Ga0496109_0003819 | |||
| 1644 | Ga0496109_0025935 | |||
| 1645 | Ga0496109_0035376 | |||
| 1646 | Ga0496109_0092183 | |||
| 1647 | Ga0496109_0126977 | |||
| 1648 | Ga0496109_0142327 | |||
| 1649 | Ga0496109_0147556 | |||
| 1650 | Ga0496109_0498634 | |||
| 1651 | Ga0496110_0020938 | |||
| 1652 | Ga0496110_0076003 | |||
| 1653 | Ga0496110_0076957 | |||
| 1654 | Ga0496110_0191785 | |||
| 1655 | Ga0496110_0257113 | |||
| 1656 | Ga0496110_0264365 | |||
| 1657 | Ga0496110_0631362 | |||
| 1658 | Ga0496111_0000230 | |||
| 1659 | Ga0496111_0002628 | |||
| 1660 | Ga0496111_0222511 | |||
| 1661 | Ga0496111_0315425 | |||
| 1662 | Ga0496111_0573571 | |||
| 1663 | Ga0496112_0016767 | |||
| 1664 | Ga0496112_0026222 | |||
| 1665 | Ga0496112_0046356 | |||
| 1666 | Ga0496112_0051598 | |||
| 1667 | Ga0496112_0090676 | |||
| 1668 | Ga0496112_0211134 | |||
| 1669 | Ga0496112_0252077 | |||
| 1670 | Ga0496112_0286890 | |||
| 1671 | Ga0496112_0615405 | |||
| 1672 | Ga0496113_0083585 | |||
| 1673 | Ga0496113_0091067 | |||
| 1674 | Ga0496113_0121550 | |||
| 1675 | Ga0496113_0213324 | |||
| 1676 | Ga0496113_0237434 | |||
| 1677 | Ga0496113_0369969 | |||
| 1678 | Ga0496114_0001692 | |||
| 1679 | Ga0496114_0009498 | |||
| 1680 | Ga0496114_0012600 | |||
| 1681 | Ga0496114_0050427 | |||
| 1682 | Ga0496114_0167410 | |||
| 1683 | Ga0496115_0001932 | |||
| 1684 | Ga0496115_0005218 | |||
| 1685 | Ga0496115_0005222 | |||
| 1686 | Ga0496115_0006918 | |||
| 1687 | Ga0496115_0040455 | |||
| 1688 | Ga0496115_0105769 | |||
| 1689 | Ga0496122_0238014 | |||
| 1690 | Ga0501031_0000445 | |||
| 1691 | Ga0501031_0012499 | |||
| 1692 | Ga0501031_0058633 | |||
| 1693 | Ga0501032_0000876 | |||
| 1694 | Ga0501032_0064563 | |||
| 1695 | Ga0501033_0000294 | |||
| 1696 | Ga0501033_0000948 | |||
| 1697 | Ga0501033_0014207 | |||
| 1698 | Ga0501034_0003200 | |||
| 1699 | Ga0501034_0666796 | |||
| 1700 | Ga0501036_0001590 | |||
| 1701 | Ga0501036_0003535 | |||
| 1702 | Ga0501036_0005562 | |||
| 1703 | Ga0501036_0012995 | |||
| 1704 | Ga0501037_0000378 | |||
| 1705 | Ga0501037_0005219 | |||
| 1706 | Ga0501037_0005716 | |||
| 1707 | Ga0501038_0000087 | |||
| 1708 | Ga0501038_0001030 | |||
| 1709 | Ga0501038_0008491 | |||
| 1710 | Ga0501038_0132419 | |||
| 1711 | Ga0501039_0001020 | |||
| 1712 | Ga0501039_0002129 | |||
| 1713 | Ga0501039_0003991 | |||
| 1714 | Ga0501039_0103067 | |||
| 1715 | Ga0501039_0246188 | |||
| 1716 | Ga0501040_0000007 | |||
| 1717 | Ga0501040_0000954 | |||
| 1718 | Ga0501040_0006120 | |||
| 1719 | Ga0501040_0008385 | |||
| 1720 | Ga0501040_0017844 | |||
| 1721 | Ga0501040_0040161 | |||
| 1722 | Ga0501040_0259194 | |||
| 1723 | Ga0501040_0375145 | |||
| 1724 | Ga0501041_0000005 | |||
| 1725 | Ga0501041_0001093 | |||
| 1726 | Ga0501041_0001786 | |||
| 1727 | Ga0501041_0002281 | |||
| 1728 | Ga0501041_0312647 | |||
| 1729 | Ga0501042_0003216 | |||
| 1730 | Ga0501042_0003964 | |||
| 1731 | Ga0501042_0010225 | |||
| 1732 | Ga0501042_0034208 | |||
| 1733 | Ga0501042_0140790 | |||
| 1734 | Ga0501042_0314211 | |||
| 1735 | Ga0501043_0000998 | |||
| 1736 | Ga0501043_0002596 | |||
| 1737 | Ga0501043_0048746 | |||
| 1738 | Ga0501046_0001278 | |||
| 1739 | Ga0501046_0002426 | |||
| 1740 | Ga0501046_0017453 | |||
| 1741 | Ga0501046_0028136 | |||
| 1742 | Ga0501046_0053780 | |||
| 1743 | Ga0501047_0000592 | |||
| 1744 | Ga0501047_0084809 | |||
| 1745 | Ga0501048_0000018 | |||
| 1746 | Ga0501048_0001926 | |||
| 1747 | Ga0501048_0010488 | |||
| 1748 | Ga0501048_0030135 | |||
| 1749 | Ga0501067_0000808 | |||
| 1750 | Ga0501067_0009559 | |||
| 1751 | Ga0501067_0046231 | |||
| 1752 | Ga0501067_0251210 | |||
| 1753 | Ga0501068_0000134 | |||
| 1754 | Ga0501068_0001631 | |||
| 1755 | Ga0501068_0005123 | |||
| 1756 | Ga0501068_0011873 | |||
| 1757 | Ga0501068_0089746 | |||
| 1758 | Ga0501069_0000426 | |||
| 1759 | Ga0501069_0007694 | |||
| 1760 | Ga0501069_0009322 | |||
| 1761 | Ga0501069_0015243 | |||
| 1762 | Ga0501069_0088960 | |||
| 1763 | Ga0501069_0124989 | |||
| 1764 | Ga0501070_0002768 | |||
| 1765 | Ga0501070_0004569 | |||
| 1766 | Ga0501070_0005855 | |||
| 1767 | Ga0501070_0293181 | |||
| 1768 | Ga0501070_0489327 | |||
| 1769 | Ga0501071_0000005 | |||
| 1770 | Ga0501071_0001995 | |||
| 1771 | Ga0501071_0003729 | |||
| 1772 | Ga0501071_0089097 | |||
| 1773 | Ga0501072_0000269 | |||
| 1774 | Ga0501072_0004831 | |||
| 1775 | Ga0501072_0011678 | |||
| 1776 | Ga0501072_0012028 | |||
| 1777 | Ga0501072_0038239 | |||
| 1778 | Ga0501072_0092159 | |||
| 1779 | Ga0501072_0368844 | |||
| 1780 | Ga0501073_0000550 | |||
| 1781 | Ga0501073_0001327 | |||
| 1782 | Ga0501073_0033451 | |||
| 1783 | Ga0501074_0000503 | |||
| 1784 | Ga0501074_0001138 | |||
| 1785 | Ga0501074_0060672 | |||
| 1786 | Ga0501074_0075006 | |||
| 1787 | Ga0501074_0150225 | |||
| 1788 | Ga0501075_0000009 | |||
| 1789 | Ga0501075_0000193 | |||
| 1790 | Ga0501075_0020469 | |||
| 1791 | Ga0501075_0050851 | |||
| 1792 | Ga0501075_0126450 | |||
| 1793 | Ga0501075_0313886 | |||
| 1794 | Ga0501076_0000028 | |||
| 1795 | Ga0501076_0001292 | |||
| 1796 | Ga0501076_0004133 | |||
| 1797 | Ga0501076_0019547 | |||
| 1798 | Ga0501076_0342452 | |||
| 1799 | Ga0501076_0578190 | |||
| 1800 | Ga0501077_0000006 | |||
| 1801 | Ga0501077_0001176 | |||
| 1802 | Ga0501077_0005443 | |||
| 1803 | Ga0501077_0020007 | |||
| 1804 | Ga0501079_0000881 | |||
| 1805 | Ga0501079_0000929 | |||
| 1806 | Ga0501079_0003399 | |||
| 1807 | Ga0501079_0007488 | |||
| 1808 | Ga0501079_0025921 | |||
| 1809 | Ga0501079_0096299 | |||
| 1810 | Ga0501079_0133505 | |||
| 1811 | Ga0501080_0000626 | |||
| 1812 | Ga0501080_0001089 | |||
| 1813 | Ga0501080_0032292 | |||
| 1814 | Ga0501080_0296810 | |||
| 1815 | Ga0501081_0000003 | |||
| 1816 | Ga0501081_0000159 | |||
| 1817 | Ga0501081_0001137 | |||
| 1818 | Ga0501081_0001281 | |||
| 1819 | Ga0501081_0176860 | |||
| 1820 | Ga0501081_0353352 | |||
| 1821 | Ga0501083_0000816 | |||
| 1822 | Ga0501083_0001673 | |||
| 1823 | Ga0501083_0008047 | |||
| 1824 | Ga0501083_0216452 | |||
| 1825 | Ga0501035_0000175 | |||
| 1826 | Ga0501035_0078473 | |||
| 1827 | Ga0501035_0083328 | |||
| 1828 | Ga0501044_0006303 | |||
| 1829 | Ga0501044_0038039 | |||
| 1830 | Ga0501044_0047928 | |||
| 1831 | Ga0501044_0486546 | |||
| 1832 | Ga0501045_0000009 | |||
| 1833 | Ga0501045_0000585 | |||
| 1834 | Ga0501045_0002161 | |||
| 1835 | Ga0501045_0002370 | |||
| 1836 | Ga0501045_0150860 | |||
| 1837 | Ga0501045_0333865 | |||
| 1838 | nmdc:mga05p37_11001_c1 | |||
| 1839 | nmdc:mga05p37_228180_c1 | |||
| 1840 | nmdc:mga05p37_43470_c1 | |||
| 1841 | nmdc:mga05p37_613470_c1 | |||
| 1842 | nmdc:mga05p37_663035_c1 | |||
| 1843 | nmdc:mga05p37_765488_c1 | |||
| 1844 | nmdc:mga09592_1116_c1 | |||
| 1845 | nmdc:mga0qj67_546827_c1 | |||
| 1846 | nmdc:mga0qj67_58145_c1 | |||
| 1847 | nmdc:mga0qj67_76093_c1 | |||
| 1848 | nmdc:mga0qj67_9898_c1 | |||
| 1849 | nmdc:mga06r32_133490_c1 | |||
| 1850 | nmdc:mga06r32_325329_c1 | |||
| 1851 | nmdc:mga08y16_267648_c1 | |||
| 1852 | nmdc:mga08y16_273891_c1 | |||
| 1853 | nmdc:mga08y16_328075_c1 | |||
| 1854 | nmdc:mga0n895_434154_c1 | |||
| 1855 | nmdc:mga0n895_851867_c1 | |||
| 1856 | nmdc:mga0rr50_481469_c1 | |||
| 1857 | nmdc:mga0a205_169830_c1 | |||
| 1858 | nmdc:mga0a205_389828_c1 | |||
| 1859 | nmdc:mga0a205_54850_c1 | |||
| 1860 | Ga0495601_0063919 | |||
| 1861 | Ga0495601_0066823 | |||
| 1862 | Ga0495612_0011495 | |||
| 1863 | Ga0495612_0020933 | |||
| 1864 | Ga0495612_0085111 | |||
| 1865 | Ga0495595_0006454 | |||
| 1866 | Ga0495595_0013656 | |||
| 1867 | Ga0495595_0077560 | |||
| 1868 | Ga0495619_0003097 | |||
| 1869 | Ga0495619_0004791 | |||
| 1870 | Ga0495619_0025587 | |||
| 1871 | Ga0495619_0069309 | |||
| 1872 | Ga0501084_0001358 | |||
| 1873 | Ga0501084_0005874 | |||
| 1874 | Ga0501084_0007802 | |||
| 1875 | Ga0501084_0050734 | |||
| 1876 | Ga0501084_0065108 | |||
| 1877 | Ga0501084_0091250 | |||
| 1878 | Ga0501084_0293985 | |||
| 1879 | Ga0501084_0515238 | |||
| 1880 | Ga0501082_0000063 | |||
| 1881 | Ga0501082_0001009 | |||
| 1882 | Ga0501082_0001714 | |||
| 1883 | Ga0501082_0047272 | |||
| 1884 | Ga0501082_0174255 | |||
| 1885 | Ga0501082_0179897 | |||
| 1886 | Ga0530510_0000014 | |||
| 1887 | Ga0530510_0001148 | |||
| 1888 | Ga0530510_0001637 | |||
| 1889 | Ga0530510_0031133 | |||
| 1890 | Ga0530510_0062221 | |||
| 1891 | Ga0530510_0187208 | |||
| 1892 | Ga0530510_0237292 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7tbw-assembly1.cif.gz_A | the structure of atp-bound abca1 | 0.7773 | 59 | 253 |
| 8bi0-assembly1.cif.gz_A | abcg2 turnover-2 state with tariquidar bound | 0.7394 | 7 | 252 |
| 8ee6-assembly1.cif.gz_A | cryo-em structure of human abca7 in pe/ch nanodiscs | 0.7245 | 58 | 253 |
| 7lkz-assembly1.cif.gz_A | structure of atp-bound human abca4 | 0.7156 | 59 | 254 |
| 8bht-assembly1.cif.gz_A | abcg2 turnover-1 state with tariquidar bound | 0.7118 | 4 | 252 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.849 | 46 | 251 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.8051 | 36 | 250 | 3.40.1710.10 |
| af_Q9VMM9_322_706_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.7741 | 32 | 247 | 3.40.1710.10 |
| af_Q86P18_394_773_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6862 | 46 | 251 | 3.40.1710.10 |
| af_A0A2R8QMX4_332_689_3.40.1710.10 | Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain | 0.6772 | 36 | 250 | 3.40.1710.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538G3Q1-F1-model_v4 | Transport permease protein | 0.9895 | 1 | 258 |
GO:0043190
GO:0140359 |
| AF-A0A7W0G9Y8-F1-model_v4 | Transport permease protein | 0.9882 | 3 | 258 |
GO:0043190
GO:0140359 |
| AF-A0A538I9E5-F1-model_v4 | ABC-2 type transporter transmembrane domain-containing protein | 0.9857 | 2 | 258 |
GO:0043190
GO:0140359 |
| AF-A0A538G3Q1-F1-model_v4 | Transport permease protein | 0.9857 | 1 | 258 |
GO:0043190
GO:0140359 |
| AF-A0A2W5ZCK5-F1-model_v4 | Transport permease protein | 0.9856 | 7 | 258 |
GO:0043190
GO:0140359 |