F486452

General Info

Members Datasets Scaffolds Average Seq Length
946 326 1892 242

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100021373|Ga0075428_1000213732
Length 261
Sequence MSEHGPLFVQVSQLARRSVLRTFRRPINVFPSFFFPLMLLAVNVGGLQAASNLRGFPTDSYLDFALAFTFLQGALFATTNAGTDLARDIETGFLNRLALTPMRNAALLLGQLAGVVTLALLQATLYLTVGIVAGVRPESGVLGVFLIVFLGVLVALAFGAIGAFLALRTGSGEAIQALFPLFFVFLFLSSMNLPRNLIEIDWFRTVTTINPVSYLIEGIRSLIITGWDLQALLLGFGLAIGIGSVALTAAGWALRGRLARS

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
188 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
191 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
192 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
208 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
209 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
210 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
211 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
214 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
217 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
225 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
232 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
233 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
234 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
238 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
239 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
240 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
241 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
242 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
246 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
277 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
278 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
302 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
303 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
304 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
309 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
312 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
313 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
314 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
322 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
323 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.58
Metatranscriptomes 0.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 9.51
Rhizosphere 89.75
Stem 0
Stem Tuber 0
Unclassified 4.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100021373 3300006844 Bacteria 7164
2 JGI24744J21845_10006167 3300002077 Bacteria 2487
3 JGI24742J22300_10007079 3300002244 Bacteria 1848
4 JGI25406J46586_10044899 3300003203 Bacteria 1526
5 JGI25406J46586_10054715 3300003203 Unclassified 1318
6 JGI25407J50210_10000296 3300003373 Bacteria 9040
7 JGI25407J50210_10002731 3300003373 Bacteria 4198
8 JGI25407J50210_10010599 3300003373 Bacteria 2347
9 Ga0070658_10008472 3300005327 Bacteria 8267
10 Ga0070683_100004962 3300005329 Bacteria 11041
11 Ga0070683_100023359 3300005329 Bacteria 5530
12 Ga0070683_100031568 3300005329 Bacteria 4818
13 Ga0070683_100091742 3300005329 Bacteria 2853
14 Ga0070683_100188404 3300005329 Bacteria 1958
15 Ga0070683_100250161 3300005329 Bacteria 1686
16 Ga0070683_100296513 3300005329 Bacteria 1538
17 Ga0070683_100550008 3300005329 Bacteria 1104
18 Ga0070690_100050328 3300005330 Bacteria 2658
19 Ga0070680_100004037 3300005336 Bacteria 10977
20 Ga0070680_100005608 3300005336 Bacteria 9506
21 Ga0070680_100055164 3300005336 Bacteria 3247
22 Ga0070680_100307574 3300005336 Unclassified 1344
23 Ga0068868_100012943 3300005338 Bacteria 6103
24 Ga0068868_100180041 3300005338 Bacteria 1753
25 Ga0068868_100557303 3300005338 Bacteria 1011
26 Ga0070660_100001494 3300005339 Bacteria 16003
27 Ga0070660_100003867 3300005339 Bacteria 10339
28 Ga0070660_100136777 3300005339 Bacteria 1963
29 Ga0070660_100223563 3300005339 Bacteria 1530
30 Ga0070689_100057873 3300005340 Bacteria 3010
31 Ga0070661_100007123 3300005344 Bacteria 7712
32 Ga0070661_100086221 3300005344 Bacteria 2321
33 Ga0070661_100277989 3300005344 Bacteria 1298
34 Ga0070661_100491230 3300005344 Bacteria 981
35 Ga0070692_10074017 3300005345 Unclassified 1821
36 Ga0070668_100603881 3300005347 Bacteria 960
37 Ga0070671_100143550 3300005355 Bacteria 2015
38 Ga0070673_100424035 3300005364 Bacteria 1193
39 Ga0070673_100429948 3300005364 Bacteria 1185
40 Ga0070673_100620347 3300005364 Bacteria 988
41 Ga0070688_100047083 3300005365 Bacteria 2673
42 Ga0070659_100022221 3300005366 Bacteria 4840
43 Ga0070659_100026115 3300005366 Bacteria 4492
44 Ga0070659_100141159 3300005366 Bacteria 1961
45 Ga0070659_100439723 3300005366 Bacteria 1105
46 Ga0070709_10198395 3300005434 Bacteria 1420
47 Ga0070714_100523682 3300005435 Bacteria 1133
48 Ga0070714_100544095 3300005435 Bacteria 1111
49 Ga0070714_100596958 3300005435 Unclassified 1060
50 Ga0070710_10029625 3300005437 Bacteria 2938
51 Ga0070701_10187935 3300005438 Bacteria 1214
52 Ga0070711_100025657 3300005439 Bacteria 3857
53 Ga0070700_100021145 3300005441 Bacteria 3779
54 Ga0070700_100250374 3300005441 Bacteria 1270
55 Ga0070694_100034592 3300005444 Bacteria 3333
56 Ga0070694_100548017 3300005444 Bacteria 926
57 Ga0070678_100004691 3300005456 Bacteria 7779
58 Ga0070678_100260104 3300005456 Bacteria 1459
59 Ga0070681_10008977 3300005458 Bacteria 9830
60 Ga0070681_10030842 3300005458 Bacteria 5381
61 Ga0070681_10034745 3300005458 Bacteria 5062
62 Ga0070681_10084225 3300005458 Bacteria 3132
63 Ga0070681_10140034 3300005458 Bacteria 2349
64 Ga0070681_10183635 3300005458 Bacteria 2012
65 Ga0068867_100088449 3300005459 Bacteria 2347
66 Ga0070685_10045930 3300005466 Bacteria 2506
67 Ga0070706_100086274 3300005467 Bacteria 2909
68 Ga0070707_100774811 3300005468 Bacteria 923
69 Ga0070698_100071122 3300005471 Bacteria 3489
70 Ga0070699_100312425 3300005518 Bacteria 1411
71 Ga0070679_100075881 3300005530 Bacteria 3351
72 Ga0070679_100139279 3300005530 Bacteria 2407
73 Ga0070679_100179023 3300005530 Bacteria 2093
74 Ga0070679_100242556 3300005530 Bacteria 1759
75 Ga0070684_100001226 3300005535 Bacteria 18422
76 Ga0070684_100071339 3300005535 Bacteria 3057
77 Ga0070684_100075594 3300005535 Bacteria 2971
78 Ga0070684_100128869 3300005535 Bacteria 2281
79 Ga0068853_100094958 3300005539 Bacteria 2628
80 Ga0068853_100220600 3300005539 Bacteria 1731
81 Ga0070672_100046991 3300005543 Bacteria 3348
82 Ga0070672_100306261 3300005543 Unclassified 1348
83 Ga0070686_100033274 3300005544 Bacteria 3166
84 Ga0070693_100042631 3300005547 Bacteria 2558
85 Ga0070693_100418498 3300005547 Bacteria 933
86 Ga0070665_100032824 3300005548 Bacteria 5223
87 Ga0070665_100172112 3300005548 Bacteria 2166
88 Ga0070665_100923507 3300005548 Bacteria 885
89 Ga0068855_100014350 3300005563 Bacteria 9539
90 Ga0068855_100060814 3300005563 Bacteria 4415
91 Ga0068855_100272389 3300005563 Bacteria 1882
92 Ga0068855_100624803 3300005563 Bacteria 1159
93 Ga0070664_100017950 3300005564 Bacteria 5809
94 Ga0070664_100221746 3300005564 Bacteria 1692
95 Ga0068857_100004862 3300005577 Bacteria 11393
96 Ga0068857_100006742 3300005577 Bacteria 9874
97 Ga0068857_100142692 3300005577 Bacteria 2165
98 Ga0068857_100211722 3300005577 Bacteria 1769
99 Ga0068856_100042442 3300005614 Bacteria 4474
100 Ga0068856_100637785 3300005614 Bacteria 1086
101 Ga0070702_100010715 3300005615 Bacteria 4529
102 Ga0068852_100146700 3300005616 Bacteria 2189
103 Ga0068859_100587512 3300005617 Bacteria 1207
104 Ga0068859_100752606 3300005617 Bacteria 1063
105 Ga0068864_100122688 3300005618 Bacteria 2325
106 Ga0068861_100153467 3300005719 Bacteria 1892
107 Ga0068861_100540410 3300005719 Bacteria 1060
108 Ga0068870_10208934 3300005840 Unclassified 1188
109 Ga0068863_100802393 3300005841 Unclassified 939
110 Ga0068858_100705059 3300005842 Bacteria 982
111 Ga0068860_100412037 3300005843 Bacteria 1338
112 Ga0068862_100126795 3300005844 Bacteria 2254
113 Ga0081455_10008830 3300005937 Bacteria 10428
114 Ga0081455_10014299 3300005937 Bacteria 7787
115 Ga0081455_10030105 3300005937 Bacteria 4938
116 Ga0081455_10069855 3300005937 Bacteria 2918
117 Ga0081455_10169911 3300005937 Bacteria 1662
118 Ga0081538_10000181 3300005981 Bacteria 68890
119 Ga0081538_10000297 3300005981 Bacteria 57258
120 Ga0081538_10000502 3300005981 Bacteria 43774
121 Ga0081538_10000804 3300005981 Bacteria 34030
122 Ga0081538_10000925 3300005981 Bacteria 31656
123 Ga0081538_10008148 3300005981 Bacteria 8942
124 Ga0081538_10017280 3300005981 Bacteria 5483
125 Ga0081538_10018099 3300005981 Bacteria 5312
126 Ga0081538_10018371 3300005981 Bacteria 5253
127 Ga0081538_10069192 3300005981 Bacteria 1957
128 Ga0081538_10139401 3300005981 Bacteria 1122
129 Ga0081540_1006849 3300005983 Bacteria 8225
130 Ga0081539_10000062 3300005985 Bacteria 249871
131 Ga0081539_10001583 3300005985 Bacteria 37604
132 Ga0081539_10009993 3300005985 Bacteria 7816
133 Ga0081539_10012956 3300005985 Bacteria 6339
134 Ga0081539_10019762 3300005985 Bacteria 4593
135 Ga0075365_10175513 3300006038 Bacteria 1497
136 Ga0075432_10064927 3300006058 Bacteria 1304
137 Ga0070715_10022486 3300006163 Bacteria 2460
138 Ga0070716_100288031 3300006173 Bacteria 1137
139 Ga0070712_100004124 3300006175 Bacteria 8929
140 Ga0070712_100537153 3300006175 Bacteria 984
141 Ga0075427_10022130 3300006194 Bacteria 1014
142 Ga0097621_100024560 3300006237 Bacteria 4708
143 Ga0097621_100214086 3300006237 Bacteria 1677
144 Ga0068871_100027672 3300006358 Bacteria 4436
145 Ga0068871_100366585 3300006358 Unclassified 1277
146 Ga0068871_100403331 3300006358 Bacteria 1218
147 Ga0075428_100043736 3300006844 Bacteria 4924
148 Ga0075428_100518490 3300006844 Bacteria 1275
149 Ga0075428_100728850 3300006844 Unclassified 1055
150 Ga0075430_100100857 3300006846 Bacteria 2411
151 Ga0075430_100203256 3300006846 Bacteria 1644
152 Ga0075430_100230303 3300006846 Bacteria 1536
153 Ga0075431_100045347 3300006847 Bacteria 4533
154 Ga0075433_10075025 3300006852 Bacteria 2976
155 Ga0075433_10175656 3300006852 Bacteria 1906
156 Ga0075434_100838263 3300006871 Unclassified 935
157 Ga0075429_100007313 3300006880 Bacteria 9585
158 Ga0068865_100031396 3300006881 Bacteria 3542
159 Ga0068865_100229439 3300006881 Bacteria 1456
160 Ga0097620_100587506 3300006931 Bacteria 1207
161 Ga0097620_100752640 3300006931 Bacteria 1063
162 Ga0075435_100037060 3300007076 Bacteria 3881
163 Ga0075435_100485689 3300007076 Bacteria 1067
164 Ga0105240_10026755 3300009093 Bacteria 7565
165 Ga0105240_10049813 3300009093 Bacteria 5284
166 Ga0105240_10213432 3300009093 Bacteria 2253
167 Ga0111539_10005174 3300009094 Bacteria 16902
168 Ga0111539_10058439 3300009094 Bacteria 4575
169 Ga0111539_10207811 3300009094 Bacteria 2281
170 Ga0111539_10337928 3300009094 Bacteria 1753
171 Ga0105245_10060054 3300009098 Bacteria 3424
172 Ga0105245_10064347 3300009098 Bacteria 3314
173 Ga0105245_10275196 3300009098 Bacteria 1643
174 Ga0105245_10418863 3300009098 Bacteria 1342
175 Ga0114129_10003023 3300009147 Bacteria 23586
176 Ga0114129_10028025 3300009147 Bacteria 7978
177 Ga0114129_10173490 3300009147 Bacteria 2938
178 Ga0114129_10682846 3300009147 Bacteria 1322
179 Ga0114129_10702139 3300009147 Bacteria 1300
180 Ga0114129_10938285 3300009147 Bacteria 1094
181 Ga0114129_10954564 3300009147 Bacteria 1083
182 Ga0105243_10033430 3300009148 Bacteria 3977
183 Ga0105243_10192741 3300009148 Bacteria 1781
184 Ga0105243_10481491 3300009148 Unclassified 1171
185 Ga0105241_10446920 3300009174 Bacteria 1143
186 Ga0105242_10014556 3300009176 Bacteria 6093
187 Ga0105242_10051900 3300009176 Bacteria 3344
188 Ga0105242_10341334 3300009176 Bacteria 1380
189 Ga0105242_10511241 3300009176 Bacteria 1144
190 Ga0105237_10001575 3300009545 Bacteria 29702
191 Ga0105237_10032006 3300009545 Bacteria 5326
192 Ga0105237_10169117 3300009545 Bacteria 2185
193 Ga0105238_10306741 3300009551 Bacteria 1572
194 Ga0105249_10011189 3300009553 Bacteria 7881
195 Ga0105249_10658705 3300009553 Bacteria 1105
196 Ga0105239_10006331 3300010375 Bacteria 13766
197 Ga0105239_10360933 3300010375 Bacteria 1641
198 Ga0105239_10398055 3300010375 Bacteria 1558
199 Ga0105239_10676486 3300010375 Bacteria 1179
200 Ga0105246_10039193 3300011119 Bacteria 3190
201 Ga0157373_10252380 3300013100 Bacteria 1248
202 Ga0157370_10038762 3300013104 Bacteria 4609
203 Ga0157370_10356979 3300013104 Bacteria 1347
204 Ga0157370_10436440 3300013104 Bacteria 1204
205 Ga0157370_10445572 3300013104 Bacteria 1191
206 Ga0157369_10035965 3300013105 Bacteria 5428
207 Ga0157369_10068684 3300013105 Bacteria 3807
208 Ga0157369_10094741 3300013105 Bacteria 3187
209 Ga0157374_10006829 3300013296 Bacteria 9708
210 Ga0157374_10098614 3300013296 Bacteria 2798
211 Ga0157374_10192298 3300013296 Bacteria 1996
212 Ga0157378_10011844 3300013297 Bacteria 7635
213 Ga0163162_10007186 3300013306 Bacteria 10814
214 Ga0157372_10075957 3300013307 Bacteria 3792
215 Ga0157372_10197601 3300013307 Bacteria 2329
216 Ga0157372_10317301 3300013307 Bacteria 1814
217 Ga0157375_10010359 3300013308 Bacteria 8207
218 Ga0157375_10177722 3300013308 Bacteria 2279
219 Ga0163163_10428054 3300014325 Unclassified 1383
220 Ga0157380_10119804 3300014326 Bacteria 2227
221 Ga0157380_10152318 3300014326 Bacteria 2000
222 Ga0157377_10005388 3300014745 Bacteria 6009
223 Ga0157377_10022425 3300014745 Bacteria 3334
224 Ga0157376_10047691 3300014969 Bacteria 3538
225 Ga0157376_10210484 3300014969 Bacteria 1795
226 Ga0182007_10049478 3300015262 Unclassified 1388
227 Ga0206356_11664069 3300020070 Bacteria 3866
228 Ga0206353_11255590 3300020082 Bacteria 3314
229 Ga0206353_11829944 3300020082 Bacteria 2291
230 Ga0206353_11844079 3300020082 Bacteria 5443
231 Ga0207692_10040358 3300025898 Bacteria 2303
232 Ga0207692_10041477 3300025898 Bacteria 2279
233 Ga0207642_10089634 3300025899 Bacteria 1516
234 Ga0207699_10027383 3300025906 Bacteria 3155
235 Ga0207699_10043526 3300025906 Bacteria 2609
236 Ga0207699_10120388 3300025906 Bacteria 1697
237 Ga0207654_10169278 3300025911 Bacteria 1417
238 Ga0207654_10375171 3300025911 Bacteria 984
239 Ga0207707_10011148 3300025912 Bacteria 7820
240 Ga0207707_10012057 3300025912 Bacteria 7517
241 Ga0207707_10028270 3300025912 Bacteria 4902
242 Ga0207707_10092802 3300025912 Bacteria 2637
243 Ga0207707_10101297 3300025912 Bacteria 2517
244 Ga0207707_10122363 3300025912 Bacteria 2275
245 Ga0207695_10207394 3300025913 Bacteria 1872
246 Ga0207695_10443331 3300025913 Bacteria 1182
247 Ga0207671_10000835 3300025914 Bacteria 39117
248 Ga0207671_10082479 3300025914 Bacteria 2413
249 Ga0207671_10139513 3300025914 Bacteria 1867
250 Ga0207693_10001551 3300025915 Bacteria 20284
251 Ga0207693_10053039 3300025915 Bacteria 3181
252 Ga0207693_10053072 3300025915 Bacteria 3180
253 Ga0207693_10093503 3300025915 Bacteria 2357
254 Ga0207693_10189021 3300025915 Unclassified 1621
255 Ga0207660_10018009 3300025917 Bacteria 4704
256 Ga0207660_10047444 3300025917 Bacteria 3037
257 Ga0207660_10061128 3300025917 Bacteria 2711
258 Ga0207660_10123453 3300025917 Bacteria 1964
259 Ga0207660_10492645 3300025917 Bacteria 994
260 Ga0207657_10001335 3300025919 Bacteria 26208
261 Ga0207657_10003370 3300025919 Bacteria 17079
262 Ga0207657_10014368 3300025919 Bacteria 7732
263 Ga0207649_10016170 3300025920 Bacteria 4202
264 Ga0207649_10030765 3300025920 Bacteria 3183
265 Ga0207649_10060635 3300025920 Bacteria 2378
266 Ga0207649_10181536 3300025920 Bacteria 1473
267 Ga0207652_10093742 3300025921 Bacteria 2643
268 Ga0207652_10103051 3300025921 Bacteria 2522
269 Ga0207652_10211387 3300025921 Bacteria 1747
270 Ga0207652_10232679 3300025921 Bacteria 1661
271 Ga0207646_10060981 3300025922 Bacteria 3367
272 Ga0207646_10173318 3300025922 Bacteria 1948
273 Ga0207681_10205406 3300025923 Bacteria 1515
274 Ga0207694_10097620 3300025924 Bacteria 2325
275 Ga0207694_10430627 3300025924 Bacteria 1100
276 Ga0207687_10048820 3300025927 Bacteria 2941
277 Ga0207687_10220598 3300025927 Bacteria 1493
278 Ga0207687_10276832 3300025927 Bacteria 1343
279 Ga0207700_10266773 3300025928 Unclassified 1468
280 Ga0207700_10341930 3300025928 Bacteria 1301
281 Ga0207700_10480529 3300025928 Bacteria 1098
282 Ga0207664_10161998 3300025929 Bacteria 1908
283 Ga0207690_10031482 3300025932 Bacteria 3395
284 Ga0207690_10334154 3300025932 Bacteria 1194
285 Ga0207686_10023760 3300025934 Bacteria 3543
286 Ga0207686_10036737 3300025934 Bacteria 2952
287 Ga0207686_10344803 3300025934 Bacteria 1120
288 Ga0207709_10015057 3300025935 Bacteria 4284
289 Ga0207709_10132644 3300025935 Unclassified 1700
290 Ga0207709_10347962 3300025935 Bacteria 1118
291 Ga0207670_10168880 3300025936 Bacteria 1638
292 Ga0207669_10132538 3300025937 Bacteria 1715
293 Ga0207704_10008706 3300025938 Bacteria 4867
294 Ga0207704_10154651 3300025938 Bacteria 1624
295 Ga0207665_10176786 3300025939 Bacteria 1544
296 Ga0207665_10190315 3300025939 Bacteria 1490
297 Ga0207691_10018612 3300025940 Bacteria 6582
298 Ga0207691_10270739 3300025940 Bacteria 1462
299 Ga0207691_10309853 3300025940 Bacteria 1355
300 Ga0207661_10013034 3300025944 Bacteria 6066
301 Ga0207661_10024926 3300025944 Bacteria 4541
302 Ga0207661_10053149 3300025944 Bacteria 3240
303 Ga0207661_10242720 3300025944 Bacteria 1599
304 Ga0207661_10471850 3300025944 Bacteria 1145
305 Ga0207667_10102955 3300025949 Bacteria 2945
306 Ga0207667_10202976 3300025949 Bacteria 2033
307 Ga0207712_10027905 3300025961 Bacteria 3772
308 Ga0207668_10340279 3300025972 Bacteria 1251
309 Ga0207668_10433151 3300025972 Bacteria 1119
310 Ga0207677_10018809 3300026023 Bacteria 4155
311 Ga0207639_10025421 3300026041 Bacteria 4293
312 Ga0207678_10025503 3300026067 Bacteria 5161
313 Ga0207708_10000757 3300026075 Bacteria 24232
314 Ga0207702_10178202 3300026078 Bacteria 1955
315 Ga0207702_10399968 3300026078 Bacteria 1324
316 Ga0207702_10518294 3300026078 Bacteria 1164
317 Ga0207702_10636357 3300026078 Bacteria 1048
318 Ga0207648_10026646 3300026089 Bacteria 5135
319 Ga0207648_10067304 3300026089 Bacteria 3123
320 Ga0207676_10080307 3300026095 Bacteria 2647
321 Ga0207674_10007853 3300026116 Bacteria 12402
322 Ga0207674_10019444 3300026116 Bacteria 7355
323 Ga0207674_10050544 3300026116 Bacteria 4247
324 Ga0207674_10072073 3300026116 Bacteria 3471
325 Ga0207674_10158923 3300026116 Bacteria 2215
326 Ga0207674_10168470 3300026116 Bacteria 2144
327 Ga0207674_10291947 3300026116 Bacteria 1579
328 Ga0207675_100088890 3300026118 Bacteria 2902
329 Ga0207683_10000740 3300026121 Bacteria 29707
330 Ga0207683_10183098 3300026121 Bacteria 1900
331 Ga0207683_10495685 3300026121 Bacteria 1128
332 Ga0207698_10009350 3300026142 Bacteria 6246
333 Ga0207698_10552269 3300026142 Bacteria 1129
334 Ga0207428_10114332 3300027907 Bacteria 2074
335 Ga0268266_10813971 3300028379 Unclassified 902
336 Ga0268265_10511186 3300028380 Unclassified 1134
337 Ga0268264_10218847 3300028381 Bacteria 1752
338 Ga0265319_1000175 3300028563 Bacteria 48774
339 Ga0265319_1004884 3300028563 Bacteria 6557
340 Ga0265318_10001659 3300028577 Bacteria 12794
341 Ga0265322_10016779 3300028654 Bacteria 2112
342 Ga0265338_10002978 3300028800 Bacteria 24543
343 Ga0265338_10020014 3300028800 Bacteria 7062
344 Ga0265320_10022983 3300031240 Bacteria 3327
345 Ga0265320_10023798 3300031240 Bacteria 3252
346 Ga0265316_10144442 3300031344 Bacteria 1785
347 Ga0307408_100048271 3300031548 Bacteria 3053
348 Ga0307408_100279369 3300031548 Bacteria 1390
349 Ga0307405_10106736 3300031731 Bacteria 1889
350 Ga0307405_10115674 3300031731 Bacteria 1825
351 Ga0307413_10002156 3300031824 Bacteria 7907
352 Ga0307413_10348857 3300031824 Bacteria 1141
353 Ga0307410_10016214 3300031852 Bacteria 4438
354 Ga0307410_10082209 3300031852 Bacteria 2265
355 Ga0307410_10193461 3300031852 Bacteria 1548
356 Ga0307406_10027082 3300031901 Bacteria 3450
357 Ga0307406_10038981 3300031901 Bacteria 2944
358 Ga0307406_10052159 3300031901 Bacteria 2600
359 Ga0307407_10095163 3300031903 Bacteria 1835
360 Ga0307412_10018003 3300031911 Bacteria 4241
361 Ga0307412_10188235 3300031911 Bacteria 1558
362 Ga0307409_100048352 3300031995 Bacteria 3236
363 Ga0307409_100099462 3300031995 Bacteria 2408
364 Ga0307409_100107955 3300031995 Bacteria 2326
365 Ga0307409_100152069 3300031995 Bacteria 2011
366 Ga0307409_100188332 3300031995 Bacteria 1834
367 Ga0307416_100020572 3300032002 Bacteria 4713
368 Ga0307416_100060430 3300032002 Bacteria 3086
369 Ga0307416_100157670 3300032002 Bacteria 2092
370 Ga0307416_100271023 3300032002 Bacteria 1666
371 Ga0307414_10113428 3300032004 Bacteria 2069
372 Ga0307414_10673601 3300032004 Bacteria 934
373 Ga0307411_10006677 3300032005 Bacteria 5796
374 Ga0307411_10058648 3300032005 Bacteria 2548
375 Ga0307415_100000015 3300032126 Bacteria 79927
376 Ga0307415_100013568 3300032126 Bacteria 4758
377 Ga0307415_100020790 3300032126 Bacteria 4016
378 Ga0307415_100190904 3300032126 Bacteria 1616
379 Ga0373945_0027076 3300035116 Bacteria 2001
380 Ga0373956_0019955 3300035119 Bacteria 2847
381 Ga0373943_0000090 3300035170 Bacteria 33196
382 Ga0373946_0007850 3300035171 Bacteria 3916
383 Ga0373946_0104013 3300035171 Bacteria 1277
384 Ga0373955_0097179 3300035172 Unclassified 1686
385 Ga0373955_0108744 3300035172 Bacteria 1601
386 Ga0373935_0043829 3300035692 Bacteria 2817
387 Ga0373933_0017190 3300035724 Bacteria 4055
388 Ga0373947_0000266 3300035725 Bacteria 29609
389 Ga0373937_0074513 3300036401 Bacteria 3132
390 Ga0373937_0176692 3300036401 Bacteria 2005
391 Ga0373925_0001866 3300037068 Bacteria 17533
392 Ga0395899_0002195 3300037312 Bacteria 16020
393 Ga0395899_0002876 3300037312 Bacteria 13838
394 Ga0395899_0003284 3300037312 Bacteria 12824
395 Ga0395899_0004709 3300037312 Bacteria 10642
396 Ga0395899_0012345 3300037312 Bacteria 6543
397 Ga0395899_0017803 3300037312 Bacteria 5409
398 Ga0395899_0056021 3300037312 Bacteria 2915
399 Ga0395899_0092577 3300037312 Bacteria 2189
400 Ga0395899_0107394 3300037312 Bacteria 2009
401 Ga0395899_0219626 3300037312 Bacteria 1317
402 Ga0395899_0310064 3300037312 Bacteria 1066
403 Ga0395899_0357142 3300037312 Unclassified 976
404 Ga0395899_0444745 3300037312 Bacteria 850
405 Ga0395899_0469488 3300037312 Bacteria 821
406 Ga0395900_0003322 3300037418 Bacteria 17399
407 Ga0395900_0003557 3300037418 Bacteria 16757
408 Ga0395900_0006758 3300037418 Bacteria 11903
409 Ga0395900_0010351 3300037418 Bacteria 9543
410 Ga0395900_0011065 3300037418 Bacteria 9219
411 Ga0395900_0030406 3300037418 Bacteria 5546
412 Ga0395900_0049279 3300037418 Bacteria 4339
413 Ga0395900_0053577 3300037418 Bacteria 4152
414 Ga0395900_0053624 3300037418 Bacteria 4150
415 Ga0395900_0094819 3300037418 Bacteria 3066
416 Ga0395900_0117171 3300037418 Bacteria 2733
417 Ga0395900_0124218 3300037418 Bacteria 2647
418 Ga0395900_0135277 3300037418 Bacteria 2525
419 Ga0395900_0136718 3300037418 Bacteria 2511
420 Ga0395900_0157668 3300037418 Bacteria 2318
421 Ga0395900_0186777 3300037418 Bacteria 2104
422 Ga0395900_0237339 3300037418 Bacteria 1830
423 Ga0395900_0314142 3300037418 Bacteria 1549
424 Ga0395900_0351589 3300037418 Bacteria 1447
425 Ga0395900_0400214 3300037418 Bacteria 1337
426 Ga0395898_0003445 3300037466 Bacteria 17691
427 Ga0395898_0003903 3300037466 Bacteria 16468
428 Ga0395898_0011171 3300037466 Bacteria 9351
429 Ga0395898_0014290 3300037466 Bacteria 8159
430 Ga0395898_0019644 3300037466 Bacteria 6872
431 Ga0395898_0022550 3300037466 Bacteria 6376
432 Ga0395898_0040303 3300037466 Bacteria 4619
433 Ga0395898_0045562 3300037466 Bacteria 4311
434 Ga0395898_0048290 3300037466 Bacteria 4175
435 Ga0395898_0050255 3300037466 Bacteria 4082
436 Ga0395898_0064493 3300037466 Bacteria 3552
437 Ga0395898_0067865 3300037466 Bacteria 3452
438 Ga0395898_0198696 3300037466 Bacteria 1915
439 Ga0395898_0199571 3300037466 Bacteria 1910
440 Ga0395898_0265295 3300037466 Bacteria 1638
441 Ga0395898_0368271 3300037466 Bacteria 1370
442 Ga0395898_0435977 3300037466 Bacteria 1248
443 Ga0395898_0459360 3300037466 Unclassified 1212
444 Ga0395898_0547052 3300037466 Bacteria 1100
445 Ga0395898_0636000 3300037466 Unclassified 1009
446 Ga0395905_0001505 3300037471 Bacteria 27874
447 Ga0395905_0010800 3300037471 Bacteria 8847
448 Ga0395905_0011659 3300037471 Bacteria 8489
449 Ga0395905_0012564 3300037471 Bacteria 8144
450 Ga0395905_0015454 3300037471 Bacteria 7257
451 Ga0395905_0017620 3300037471 Bacteria 6779
452 Ga0395905_0025788 3300037471 Bacteria 5542
453 Ga0395905_0035532 3300037471 Bacteria 4679
454 Ga0395905_0046007 3300037471 Bacteria 4093
455 Ga0395905_0095963 3300037471 Bacteria 2784
456 Ga0395905_0101923 3300037471 Bacteria 2695
457 Ga0395905_0162045 3300037471 Bacteria 2102
458 Ga0395905_0316679 3300037471 Bacteria 1449
459 Ga0395905_0355525 3300037471 Bacteria 1357
460 Ga0395905_0367816 3300037471 Bacteria 1331
461 Ga0395905_0457326 3300037471 Bacteria 1175
462 Ga0395901_0001420 3300038443 Bacteria 24995
463 Ga0395901_0002025 3300038443 Bacteria 20844
464 Ga0395901_0005860 3300038443 Bacteria 12430
465 Ga0395901_0008893 3300038443 Bacteria 10170
466 Ga0395901_0015572 3300038443 Bacteria 7746
467 Ga0395901_0016543 3300038443 Bacteria 7515
468 Ga0395901_0016812 3300038443 Bacteria 7455
469 Ga0395901_0020676 3300038443 Bacteria 6737
470 Ga0395901_0028265 3300038443 Bacteria 5769
471 Ga0395901_0032743 3300038443 Bacteria 5362
472 Ga0395901_0032816 3300038443 Bacteria 5356
473 Ga0395901_0046351 3300038443 Bacteria 4515
474 Ga0395901_0067601 3300038443 Bacteria 3722
475 Ga0395901_0090099 3300038443 Bacteria 3210
476 Ga0395901_0112930 3300038443 Bacteria 2853
477 Ga0395901_0135470 3300038443 Bacteria 2589
478 Ga0395901_0136094 3300038443 Bacteria 2582
479 Ga0395901_0231359 3300038443 Bacteria 1929
480 Ga0395901_0278177 3300038443 Bacteria 1739
481 Ga0395901_0324663 3300038443 Bacteria 1592
482 Ga0395901_0514864 3300038443 Bacteria 1216
483 Ga0395901_0553889 3300038443 Bacteria 1165
484 Ga0395901_0574959 3300038443 Bacteria 1139
485 Ga0395901_0600228 3300038443 Unclassified 1110
486 Ga0395901_0622244 3300038443 Unclassified 1086
487 Ga0436363_1706338 3300039450 Bacteria 1224
488 Ga0451802_0835110 3300041460 Bacteria 1130
489 Ga0451837_1385120 3300041494 Bacteria 1104
490 Ga0451853_0287148 3300041512 Bacteria 1128
491 Ga0451853_0926783 3300041512 Bacteria 3340
492 Ga0451853_2490875 3300041512 Bacteria 2459
493 Ga0439442_022065 3300042002 Bacteria 1321
494 Ga0439448_0016164 3300042005 Bacteria 2269
495 Ga0439448_0032364 3300042005 Bacteria 1664
496 Ga0439448_0187063 3300042005 Bacteria 724
497 Ga0439454_024473 3300042011 Unclassified 912
498 Ga0450915_001698 3300042119 Unclassified 1064
499 Ga0450923_027145 3300042125 Unclassified 1150
500 Ga0450916_008390 3300042530 Bacteria 1257
501 Ga0466965_0121778 3300044683 Bacteria 1348
502 Ga0466966_0020976 3300044684 Bacteria 4294
503 Ga0466961_0008144 3300044693 Bacteria 6677
504 Ga0466961_0166724 3300044693 Bacteria 1371
505 Ga0466963_0025241 3300044694 Bacteria 3788
506 Ga0466963_0086992 3300044694 Bacteria 2124
507 Ga0466964_0010017 3300044706 Bacteria 3571
508 Ga0466968_0017224 3300044735 Bacteria 2885
509 Ga0466970_0095608 3300044765 Bacteria 1615
510 Ga0466957_0027129 3300044842 Bacteria 3402
511 Ga0466957_0195778 3300044842 Bacteria 1326
512 Ga0466957_0447398 3300044842 Bacteria 890
513 Ga0466960_0029005 3300044901 Bacteria 2536
514 Ga0466960_0036774 3300044901 Bacteria 2294
515 Ga0466960_0072775 3300044901 Bacteria 1714
516 Ga0466960_0226119 3300044901 Bacteria 1031
517 Ga0451576_0062670 3300045051 Bacteria 3876
518 Ga0466958_0002118 3300045836 Bacteria 9853
519 Ga0466967_0004393 3300045976 Bacteria 9495
520 Ga0466967_0020474 3300045976 Bacteria 5348
521 Ga0466967_0069123 3300045976 Bacteria 3155
522 Ga0466967_0079454 3300045976 Bacteria 2957
523 Ga0466967_0092522 3300045976 Bacteria 2750
524 Ga0466967_0239770 3300045976 Bacteria 1729
525 Ga0495592_0062638 3300046454 Bacteria 2730
526 Ga0495592_0113725 3300046454 Bacteria 1912
527 Ga0495592_0393177 3300046454 Bacteria 880
528 Ga0495603_0128957 3300046455 Bacteria 1473
529 Ga0495629_0002088 3300046459 Bacteria 15500
530 Ga0495629_0205882 3300046459 Bacteria 1359
531 Ga0495641_0005538 3300046461 Bacteria 8483
532 Ga0495641_0015298 3300046461 Bacteria 4104
533 Ga0495641_0031562 3300046461 Bacteria 2530
534 Ga0495641_0067037 3300046461 Bacteria 1614
535 Ga0495651_0014023 3300046462 Bacteria 6199
536 Ga0495651_0024849 3300046462 Bacteria 4661
537 Ga0495651_0083680 3300046462 Bacteria 2405
538 Ga0495653_0022048 3300046463 Bacteria 5155
539 Ga0495653_0032140 3300046463 Bacteria 4170
540 Ga0495582_0000801 3300046473 Bacteria 17458
541 Ga0495582_0017801 3300046473 Bacteria 3884
542 Ga0495582_0027982 3300046473 Bacteria 3092
543 Ga0495582_0028565 3300046473 Bacteria 3061
544 Ga0495582_0038899 3300046473 Bacteria 2618
545 Ga0495582_0277814 3300046473 Bacteria 962
546 Ga0495605_0097616 3300046474 Bacteria 1354
547 Ga0495605_0178965 3300046474 Unclassified 933
548 Ga0495639_0002081 3300046475 Bacteria 8857
549 Ga0495639_0165137 3300046475 Bacteria 1073
550 Ga0495662_0000984 3300046476 Bacteria 13942
551 Ga0495664_0052360 3300046477 Bacteria 2425
552 Ga0495584_0060226 3300046491 Bacteria 1909
553 Ga0495584_0145173 3300046491 Bacteria 1205
554 Ga0495585_0150259 3300046492 Bacteria 1215
555 Ga0495585_0227045 3300046492 Bacteria 940
556 Ga0495594_0027397 3300046499 Bacteria 3071
557 Ga0495594_0058068 3300046499 Bacteria 2137
558 Ga0495596_0062281 3300046500 Unclassified 1452
559 Ga0495596_0074820 3300046500 Unclassified 1315
560 Ga0495608_0022630 3300046511 Bacteria 4310
561 Ga0495608_0113461 3300046511 Bacteria 1741
562 Ga0495608_0194279 3300046511 Unclassified 1280
563 Ga0495608_0330688 3300046511 Bacteria 940
564 Ga0495618_0100461 3300046514 Bacteria 1851
565 Ga0495618_0140526 3300046514 Bacteria 1545
566 Ga0495618_0185074 3300046514 Unclassified 1322
567 Ga0495628_0008805 3300046516 Bacteria 8638
568 Ga0495628_0039578 3300046516 Bacteria 3770
569 Ga0495630_0005899 3300046517 Bacteria 8659
570 Ga0495630_0178212 3300046517 Bacteria 1620
571 Ga0495630_0392934 3300046517 Unclassified 1062
572 Ga0495630_0440195 3300046517 Bacteria 999
573 Ga0495631_0065306 3300046518 Bacteria 1575
574 Ga0495631_0131155 3300046518 Bacteria 1077
575 Ga0495663_0021663 3300046525 Bacteria 1852
576 Ga0495663_0131459 3300046525 Unclassified 844
577 Ga0495666_0016257 3300046526 Bacteria 3706
578 Ga0495642_0019597 3300046528 Bacteria 2653
579 Ga0495652_0011511 3300046529 Bacteria 8000
580 Ga0495652_0351503 3300046529 Bacteria 1056
581 Ga0495665_0000215 3300046531 Bacteria 29257
582 Ga0495640_0001520 3300046533 Bacteria 18268
583 Ga0495640_0077065 3300046533 Bacteria 2223
584 Ga0495640_0121419 3300046533 Bacteria 1698
585 Ga0495586_0031050 3300046535 Bacteria 2860
586 Ga0495587_0031722 3300046536 Bacteria 3197
587 Ga0495645_0048974 3300046543 Bacteria 3077
588 Ga0495645_0124477 3300046543 Bacteria 1812
589 Ga0495633_0096293 3300046558 Bacteria 1375
590 Ga0495667_0010495 3300046559 Bacteria 6267
591 Ga0495667_0064213 3300046559 Bacteria 2401
592 Ga0495667_0114859 3300046559 Bacteria 1739
593 Ga0495656_0018519 3300046615 Bacteria 2675
594 Ga0495656_0097357 3300046615 Bacteria 1355
595 Ga0495656_0233335 3300046615 Bacteria 924
596 Ga0495668_0170136 3300046616 Bacteria 1194
597 Ga0495634_0092617 3300046642 Bacteria 1961
598 Ga0495634_0095954 3300046642 Bacteria 1920
599 Ga0495635_0026331 3300046663 Bacteria 4048
600 Ga0495635_0076575 3300046663 Bacteria 2292
601 Ga0495588_0194974 3300046674 Bacteria 1070
602 Ga0495657_0019467 3300046675 Bacteria 4895
603 Ga0495657_0079758 3300046675 Bacteria 2119
604 Ga0495599_0007133 3300046678 Bacteria 6767
605 Ga0495599_0322564 3300046678 Unclassified 929
606 Ga0495623_0066176 3300046679 Bacteria 2258
607 Ga0495623_0159882 3300046679 Bacteria 1325
608 Ga0495646_0053245 3300046680 Bacteria 2441
609 Ga0495647_0002559 3300046681 Bacteria 5763
610 Ga0495647_0038562 3300046681 Bacteria 1807
611 Ga0495647_0129918 3300046681 Bacteria 1066
612 Ga0495658_0002471 3300046683 Bacteria 9310
613 Ga0495658_0070177 3300046683 Bacteria 2032
614 Ga0495669_0077130 3300046684 Bacteria 1526
615 Ga0495613_0003963 3300046689 Bacteria 11089
616 Ga0495613_0017401 3300046689 Bacteria 5355
617 Ga0495613_0156435 3300046689 Unclassified 1624
618 Ga0495624_0012694 3300046690 Bacteria 5754
619 Ga0495624_0092240 3300046690 Bacteria 1868
620 Ga0495624_0102098 3300046690 Bacteria 1766
621 Ga0495589_0072813 3300046794 Bacteria 1678
622 Ga0495600_0043498 3300046809 Bacteria 2929
623 Ga0495600_0045091 3300046809 Bacteria 2876
624 Ga0495600_0081775 3300046809 Bacteria 2108
625 Ga0495600_0274613 3300046809 Bacteria 1068
626 Ga0495581_0000868 3300047315 Bacteria 16148
627 Ga0495581_0000983 3300047315 Bacteria 15316
628 Ga0495581_0038723 3300047315 Bacteria 2759
629 Ga0495604_0009004 3300047317 Bacteria 7895
630 Ga0495604_0049521 3300047317 Bacteria 3264
631 Ga0495604_0071262 3300047317 Bacteria 2629
632 Ga0495636_0097569 3300047318 Bacteria 1282
633 Ga0495674_0030284 3300047319 Bacteria 4922
634 Ga0495674_0034362 3300047319 Bacteria 4586
635 Ga0495676_0001001 3300047321 Bacteria 23792
636 Ga0495676_0005250 3300047321 Bacteria 11854
637 Ga0495676_0107890 3300047321 Bacteria 2049
638 Ga0495676_0129607 3300047321 Bacteria 1823
639 Ga0495680_0005597 3300047322 Bacteria 11781
640 Ga0495680_0013355 3300047322 Bacteria 7170
641 Ga0495680_0019813 3300047322 Bacteria 5672
642 Ga0495680_0021298 3300047322 Bacteria 5429
643 Ga0495675_0024052 3300047444 Bacteria 3881
644 Ga0495675_0065903 3300047444 Bacteria 2290
645 Ga0495677_0029620 3300047445 Bacteria 1991
646 Ga0495684_0006596 3300047471 Bacteria 9002
647 Ga0495684_0010019 3300047471 Bacteria 7327
648 Ga0495684_0098690 3300047471 Bacteria 2208
649 Ga0495684_0136795 3300047471 Bacteria 1838
650 Ga0495593_0001317 3300047673 Bacteria 14550
651 Ga0495602_0046294 3300048088 Bacteria 3930
652 Ga0495602_0061923 3300048088 Bacteria 3249
653 Ga0495614_0004961 3300048089 Bacteria 6006
654 Ga0496100_0010105 3300048903 Bacteria 5332
655 Ga0496100_0034248 3300048903 Bacteria 3185
656 Ga0496100_0041546 3300048903 Bacteria 2932
657 Ga0496100_0047907 3300048903 Bacteria 2756
658 Ga0496100_0111711 3300048903 Bacteria 1899
659 Ga0496100_0231365 3300048903 Bacteria 1360
660 Ga0496101_0008544 3300048904 Bacteria 6691
661 Ga0496101_0032186 3300048904 Bacteria 3689
662 Ga0496101_0104500 3300048904 Bacteria 2124
663 Ga0496101_0143111 3300048904 Bacteria 1824
664 Ga0496102_0001674 3300048905 Bacteria 19466
665 Ga0496102_0042632 3300048905 Bacteria 4112
666 Ga0496102_0077064 3300048905 Bacteria 3068
667 Ga0496102_0215871 3300048905 Bacteria 1808
668 Ga0496102_0400651 3300048905 Bacteria 1290
669 Ga0496103_0002323 3300048906 Bacteria 12016
670 Ga0496103_0021878 3300048906 Bacteria 3848
671 Ga0496104_0007540 3300048907 Bacteria 9621
672 Ga0496104_0017150 3300048907 Bacteria 6588
673 Ga0496104_0049510 3300048907 Bacteria 3962
674 Ga0496104_0082996 3300048907 Bacteria 3056
675 Ga0496104_0137627 3300048907 Bacteria 2346
676 Ga0496105_0001400 3300048908 Bacteria 16942
677 Ga0496105_0012621 3300048908 Bacteria 6691
678 Ga0496105_0027248 3300048908 Bacteria 4665
679 Ga0496105_0081371 3300048908 Bacteria 2675
680 Ga0496105_0207689 3300048908 Bacteria 1597
681 Ga0496105_0271681 3300048908 Bacteria 1369
682 Ga0496105_0435698 3300048908 Bacteria 1036
683 Ga0496106_0011021 3300048909 Bacteria 6683
684 Ga0496106_0062443 3300048909 Bacteria 2828
685 Ga0496106_0142117 3300048909 Bacteria 1888
686 Ga0496107_0004559 3300048910 Bacteria 9386
687 Ga0496107_0052198 3300048910 Bacteria 2949
688 Ga0496107_0081781 3300048910 Bacteria 2355
689 Ga0496107_0207358 3300048910 Bacteria 1457
690 Ga0496108_0020923 3300048911 Bacteria 5379
691 Ga0496108_0026529 3300048911 Bacteria 4779
692 Ga0496108_0144184 3300048911 Bacteria 2052
693 Ga0496108_0174729 3300048911 Bacteria 1859
694 Ga0496108_0238673 3300048911 Bacteria 1581
695 Ga0496109_0001613 3300048912 Bacteria 18839
696 Ga0496109_0002720 3300048912 Bacteria 14822
697 Ga0496109_0003819 3300048912 Bacteria 12581
698 Ga0496109_0025935 3300048912 Bacteria 5223
699 Ga0496109_0035376 3300048912 Bacteria 4505
700 Ga0496109_0092183 3300048912 Bacteria 2802
701 Ga0496109_0126977 3300048912 Bacteria 2378
702 Ga0496109_0142327 3300048912 Bacteria 2243
703 Ga0496109_0147556 3300048912 Bacteria 2201
704 Ga0496109_0498634 3300048912 Bacteria 1149
705 Ga0496110_0020938 3300048913 Bacteria 5525
706 Ga0496110_0076003 3300048913 Bacteria 2985
707 Ga0496110_0076957 3300048913 Bacteria 2967
708 Ga0496110_0191785 3300048913 Bacteria 1856
709 Ga0496110_0257113 3300048913 Bacteria 1590
710 Ga0496110_0264365 3300048913 Bacteria 1566
711 Ga0496110_0631362 3300048913 Bacteria 970
712 Ga0496111_0000230 3300048914 Bacteria 26717
713 Ga0496111_0002628 3300048914 Bacteria 10890
714 Ga0496111_0222511 3300048914 Bacteria 1402
715 Ga0496111_0315425 3300048914 Bacteria 1158
716 Ga0496111_0573571 3300048914 Bacteria 827
717 Ga0496112_0016767 3300048915 Bacteria 6870
718 Ga0496112_0026222 3300048915 Bacteria 5605
719 Ga0496112_0046356 3300048915 Bacteria 4263
720 Ga0496112_0051598 3300048915 Bacteria 4034
721 Ga0496112_0090676 3300048915 Bacteria 3025
722 Ga0496112_0211134 3300048915 Bacteria 1898
723 Ga0496112_0252077 3300048915 Bacteria 1716
724 Ga0496112_0286890 3300048915 Bacteria 1592
725 Ga0496112_0615405 3300048915 Unclassified 1017
726 Ga0496113_0083585 3300048916 Bacteria 2450
727 Ga0496113_0091067 3300048916 Bacteria 2350
728 Ga0496113_0121550 3300048916 Bacteria 2042
729 Ga0496113_0213324 3300048916 Bacteria 1537
730 Ga0496113_0237434 3300048916 Bacteria 1454
731 Ga0496113_0369969 3300048916 Bacteria 1150
732 Ga0496114_0001692 3300048917 Bacteria 16754
733 Ga0496114_0009498 3300048917 Bacteria 7719
734 Ga0496114_0012600 3300048917 Bacteria 6774
735 Ga0496114_0050427 3300048917 Bacteria 3464
736 Ga0496114_0167410 3300048917 Bacteria 1914
737 Ga0496115_0001932 3300048918 Bacteria 14791
738 Ga0496115_0005218 3300048918 Bacteria 9445
739 Ga0496115_0005222 3300048918 Bacteria 9440
740 Ga0496115_0006918 3300048918 Bacteria 8332
741 Ga0496115_0040455 3300048918 Bacteria 3706
742 Ga0496115_0105769 3300048918 Bacteria 2310
743 Ga0496122_0238014 3300048925 Bacteria 1029
744 Ga0501031_0000445 3300049568 Bacteria 23857
745 Ga0501031_0012499 3300049568 Bacteria 5541
746 Ga0501031_0058633 3300049568 Bacteria 2508
747 Ga0501032_0000876 3300049569 Bacteria 24428
748 Ga0501032_0064563 3300049569 Bacteria 2450
749 Ga0501033_0000294 3300049570 Bacteria 47989
750 Ga0501033_0000948 3300049570 Bacteria 26325
751 Ga0501033_0014207 3300049570 Bacteria 6052
752 Ga0501034_0003200 3300049571 Bacteria 18796
753 Ga0501034_0666796 3300049571 Bacteria 941
754 Ga0501036_0001590 3300049572 Bacteria 17574
755 Ga0501036_0003535 3300049572 Bacteria 12502
756 Ga0501036_0005562 3300049572 Bacteria 10223
757 Ga0501036_0012995 3300049572 Bacteria 6913
758 Ga0501037_0000378 3300049573 Bacteria 37014
759 Ga0501037_0005219 3300049573 Bacteria 9448
760 Ga0501037_0005716 3300049573 Bacteria 9075
761 Ga0501038_0000087 3300049574 Bacteria 78741
762 Ga0501038_0001030 3300049574 Bacteria 25161
763 Ga0501038_0008491 3300049574 Bacteria 9442
764 Ga0501038_0132419 3300049574 Bacteria 2045
765 Ga0501039_0001020 3300049575 Bacteria 20404
766 Ga0501039_0002129 3300049575 Bacteria 14657
767 Ga0501039_0003991 3300049575 Bacteria 11095
768 Ga0501039_0103067 3300049575 Bacteria 2227
769 Ga0501039_0246188 3300049575 Bacteria 1406
770 Ga0501040_0000007 3300049576 Bacteria 90368
771 Ga0501040_0000954 3300049576 Bacteria 18260
772 Ga0501040_0006120 3300049576 Bacteria 7804
773 Ga0501040_0008385 3300049576 Bacteria 6715
774 Ga0501040_0017844 3300049576 Bacteria 4711
775 Ga0501040_0040161 3300049576 Bacteria 3183
776 Ga0501040_0259194 3300049576 Bacteria 1241
777 Ga0501040_0375145 3300049576 Bacteria 1020
778 Ga0501041_0000005 3300049577 Bacteria 75426
779 Ga0501041_0001093 3300049577 Bacteria 14842
780 Ga0501041_0001786 3300049577 Bacteria 12044
781 Ga0501041_0002281 3300049577 Bacteria 10857
782 Ga0501041_0312647 3300049577 Bacteria 990
783 Ga0501042_0003216 3300049578 Bacteria 10205
784 Ga0501042_0003964 3300049578 Bacteria 9370
785 Ga0501042_0010225 3300049578 Bacteria 6280
786 Ga0501042_0034208 3300049578 Bacteria 3604
787 Ga0501042_0140790 3300049578 Bacteria 1739
788 Ga0501042_0314211 3300049578 Bacteria 1132
789 Ga0501043_0000998 3300049579 Bacteria 24892
790 Ga0501043_0002596 3300049579 Bacteria 15247
791 Ga0501043_0048746 3300049579 Bacteria 3329
792 Ga0501046_0001278 3300049580 Bacteria 24362
793 Ga0501046_0002426 3300049580 Bacteria 17479
794 Ga0501046_0017453 3300049580 Bacteria 5990
795 Ga0501046_0028136 3300049580 Bacteria 4580
796 Ga0501046_0053780 3300049580 Bacteria 3169
797 Ga0501047_0000592 3300049581 Bacteria 38584
798 Ga0501047_0084809 3300049581 Bacteria 3044
799 Ga0501048_0000018 3300049582 Bacteria 72234
800 Ga0501048_0001926 3300049582 Bacteria 15771
801 Ga0501048_0010488 3300049582 Bacteria 6916
802 Ga0501048_0030135 3300049582 Bacteria 3928
803 Ga0501067_0000808 3300049583 Bacteria 16867
804 Ga0501067_0009559 3300049583 Bacteria 5372
805 Ga0501067_0046231 3300049583 Bacteria 2416
806 Ga0501067_0251210 3300049583 Bacteria 984
807 Ga0501068_0000134 3300049584 Bacteria 33588
808 Ga0501068_0001631 3300049584 Bacteria 11969
809 Ga0501068_0005123 3300049584 Bacteria 7140
810 Ga0501068_0011873 3300049584 Bacteria 4924
811 Ga0501068_0089746 3300049584 Bacteria 1895
812 Ga0501069_0000426 3300049585 Bacteria 19142
813 Ga0501069_0007694 3300049585 Bacteria 5652
814 Ga0501069_0009322 3300049585 Bacteria 5181
815 Ga0501069_0015243 3300049585 Bacteria 4119
816 Ga0501069_0088960 3300049585 Bacteria 1745
817 Ga0501069_0124989 3300049585 Bacteria 1471
818 Ga0501070_0002768 3300049586 Bacteria 15306
819 Ga0501070_0004569 3300049586 Bacteria 11863
820 Ga0501070_0005855 3300049586 Bacteria 10483
821 Ga0501070_0293181 3300049586 Bacteria 1326
822 Ga0501070_0489327 3300049586 Bacteria 989
823 Ga0501071_0000005 3300049587 Bacteria 78747
824 Ga0501071_0001995 3300049587 Bacteria 12192
825 Ga0501071_0003729 3300049587 Bacteria 9570
826 Ga0501071_0089097 3300049587 Bacteria 2264
827 Ga0501072_0000269 3300049588 Bacteria 37902
828 Ga0501072_0004831 3300049588 Bacteria 10263
829 Ga0501072_0011678 3300049588 Bacteria 6710
830 Ga0501072_0012028 3300049588 Bacteria 6611
831 Ga0501072_0038239 3300049588 Bacteria 3765
832 Ga0501072_0092159 3300049588 Bacteria 2406
833 Ga0501072_0368844 3300049588 Bacteria 1140
834 Ga0501073_0000550 3300049589 Bacteria 26515
835 Ga0501073_0001327 3300049589 Bacteria 18226
836 Ga0501073_0033451 3300049589 Bacteria 3660
837 Ga0501074_0000503 3300049590 Bacteria 24003
838 Ga0501074_0001138 3300049590 Bacteria 17415
839 Ga0501074_0060672 3300049590 Bacteria 2724
840 Ga0501074_0075006 3300049590 Bacteria 2428
841 Ga0501074_0150225 3300049590 Bacteria 1666
842 Ga0501075_0000009 3300049591 Bacteria 97052
843 Ga0501075_0000193 3300049591 Bacteria 31987
844 Ga0501075_0020469 3300049591 Bacteria 4814
845 Ga0501075_0050851 3300049591 Bacteria 3115
846 Ga0501075_0126450 3300049591 Bacteria 1946
847 Ga0501075_0313886 3300049591 Bacteria 1194
848 Ga0501076_0000028 3300049592 Bacteria 76828
849 Ga0501076_0001292 3300049592 Bacteria 16692
850 Ga0501076_0004133 3300049592 Bacteria 10264
851 Ga0501076_0019547 3300049592 Bacteria 5178
852 Ga0501076_0342452 3300049592 Bacteria 1227
853 Ga0501076_0578190 3300049592 Bacteria 926
854 Ga0501077_0000006 3300049593 Bacteria 119936
855 Ga0501077_0001176 3300049593 Bacteria 15828
856 Ga0501077_0005443 3300049593 Bacteria 7747
857 Ga0501077_0020007 3300049593 Bacteria 4235
858 Ga0501079_0000881 3300049741 Bacteria 20585
859 Ga0501079_0000929 3300049741 Bacteria 20116
860 Ga0501079_0003399 3300049741 Bacteria 11682
861 Ga0501079_0007488 3300049741 Bacteria 8256
862 Ga0501079_0025921 3300049741 Bacteria 4497
863 Ga0501079_0096299 3300049741 Bacteria 2294
864 Ga0501079_0133505 3300049741 Bacteria 1932
865 Ga0501080_0000626 3300049742 Bacteria 28026
866 Ga0501080_0001089 3300049742 Bacteria 22370
867 Ga0501080_0032292 3300049742 Bacteria 4881
868 Ga0501080_0296810 3300049742 Bacteria 1466
869 Ga0501081_0000003 3300049743 Bacteria 97558
870 Ga0501081_0000159 3300049743 Bacteria 31036
871 Ga0501081_0001137 3300049743 Bacteria 16055
872 Ga0501081_0001281 3300049743 Bacteria 15290
873 Ga0501081_0176860 3300049743 Bacteria 1542
874 Ga0501081_0353352 3300049743 Bacteria 1083
875 Ga0501083_0000816 3300049744 Bacteria 20385
876 Ga0501083_0001673 3300049744 Bacteria 15132
877 Ga0501083_0008047 3300049744 Bacteria 7457
878 Ga0501083_0216452 3300049744 Bacteria 1248
879 Ga0501035_0000175 3300049822 Bacteria 78747
880 Ga0501035_0078473 3300049822 Bacteria 2916
881 Ga0501035_0083328 3300049822 Bacteria 2821
882 Ga0501044_0006303 3300049823 Bacteria 13113
883 Ga0501044_0038039 3300049823 Bacteria 5025
884 Ga0501044_0047928 3300049823 Bacteria 4418
885 Ga0501044_0486546 3300049823 Bacteria 1136
886 Ga0501045_0000009 3300049824 Bacteria 75255
887 Ga0501045_0000585 3300049824 Bacteria 22890
888 Ga0501045_0002161 3300049824 Bacteria 13314
889 Ga0501045_0002370 3300049824 Bacteria 12795
890 Ga0501045_0150860 3300049824 Bacteria 1729
891 Ga0501045_0333865 3300049824 Unclassified 1128
892 nmdc:mga05p37_11001_c1 3300050507 Bacteria 10744
893 nmdc:mga05p37_228180_c1 3300050507 Bacteria 2245
894 nmdc:mga05p37_43470_c1 3300050507 Bacteria 5528
895 nmdc:mga05p37_613470_c1 3300050507 Unclassified 1226
896 nmdc:mga05p37_663035_c1 3300050507 Bacteria 1166
897 nmdc:mga05p37_765488_c1 3300050507 Bacteria 1062
898 nmdc:mga09592_1116_c1 3300050508 Bacteria 21373
899 nmdc:mga0qj67_546827_c1 3300050509 Bacteria 929
900 nmdc:mga0qj67_58145_c1 3300050509 Bacteria 3065
901 nmdc:mga0qj67_76093_c1 3300050509 Bacteria 2684
902 nmdc:mga0qj67_9898_c1 3300050509 Bacteria 7109
903 nmdc:mga06r32_133490_c1 3300050510 Bacteria 2456
904 nmdc:mga06r32_325329_c1 3300050510 Bacteria 1523
905 nmdc:mga08y16_267648_c1 3300050511 Unclassified 1765
906 nmdc:mga08y16_273891_c1 3300050511 Bacteria 1742
907 nmdc:mga08y16_328075_c1 3300050511 Bacteria 1575
908 nmdc:mga0n895_434154_c1 3300050512 Bacteria 1327
909 nmdc:mga0n895_851867_c1 3300050512 Bacteria 899
910 nmdc:mga0rr50_481469_c1 3300050513 Bacteria 1054
911 nmdc:mga0a205_169830_c1 3300050515 Bacteria 2077
912 nmdc:mga0a205_389828_c1 3300050515 Bacteria 1257
913 nmdc:mga0a205_54850_c1 3300050515 Bacteria 2996
914 Ga0495601_0063919 3300053077 Bacteria 2339
915 Ga0495601_0066823 3300053077 Bacteria 2289
916 Ga0495612_0011495 3300053078 Bacteria 3570
917 Ga0495612_0020933 3300053078 Bacteria 2623
918 Ga0495612_0085111 3300053078 Bacteria 1332
919 Ga0495595_0006454 3300053084 Bacteria 4785
920 Ga0495595_0013656 3300053084 Bacteria 3433
921 Ga0495595_0077560 3300053084 Bacteria 1578
922 Ga0495619_0003097 3300053085 Bacteria 10800
923 Ga0495619_0004791 3300053085 Bacteria 8599
924 Ga0495619_0025587 3300053085 Bacteria 3791
925 Ga0495619_0069309 3300053085 Bacteria 2357
926 Ga0501084_0001358 3300054114 Bacteria 19353
927 Ga0501084_0005874 3300054114 Bacteria 10101
928 Ga0501084_0007802 3300054114 Bacteria 8810
929 Ga0501084_0050734 3300054114 Bacteria 3471
930 Ga0501084_0065108 3300054114 Bacteria 3049
931 Ga0501084_0091250 3300054114 Bacteria 2558
932 Ga0501084_0293985 3300054114 Bacteria 1372
933 Ga0501084_0515238 3300054114 Unclassified 1011
934 Ga0501082_0000063 3300060353 Bacteria 76891
935 Ga0501082_0001009 3300060353 Bacteria 24886
936 Ga0501082_0001714 3300060353 Bacteria 19338
937 Ga0501082_0047272 3300060353 Bacteria 3708
938 Ga0501082_0174255 3300060353 Bacteria 1870
939 Ga0501082_0179897 3300060353 Bacteria 1839
940 Ga0530510_0000014 3300061734 Bacteria 106661
941 Ga0530510_0001148 3300061734 Bacteria 17568
942 Ga0530510_0001637 3300061734 Bacteria 15131
943 Ga0530510_0031133 3300061734 Bacteria 3835
944 Ga0530510_0062221 3300061734 Bacteria 2702
945 Ga0530510_0187208 3300061734 Bacteria 1536
946 Ga0530510_0237292 3300061734 Unclassified 1357
947 Ga0075428_100021373
948 JGI24744J21845_10006167
949 JGI24742J22300_10007079
950 JGI25406J46586_10044899
951 JGI25406J46586_10054715
952 JGI25407J50210_10000296
953 JGI25407J50210_10002731
954 JGI25407J50210_10010599
955 Ga0070658_10008472
956 Ga0070683_100004962
957 Ga0070683_100023359
958 Ga0070683_100031568
959 Ga0070683_100091742
960 Ga0070683_100188404
961 Ga0070683_100250161
962 Ga0070683_100296513
963 Ga0070683_100550008
964 Ga0070690_100050328
965 Ga0070680_100004037
966 Ga0070680_100005608
967 Ga0070680_100055164
968 Ga0070680_100307574
969 Ga0068868_100012943
970 Ga0068868_100180041
971 Ga0068868_100557303
972 Ga0070660_100001494
973 Ga0070660_100003867
974 Ga0070660_100136777
975 Ga0070660_100223563
976 Ga0070689_100057873
977 Ga0070661_100007123
978 Ga0070661_100086221
979 Ga0070661_100277989
980 Ga0070661_100491230
981 Ga0070692_10074017
982 Ga0070668_100603881
983 Ga0070671_100143550
984 Ga0070673_100424035
985 Ga0070673_100429948
986 Ga0070673_100620347
987 Ga0070688_100047083
988 Ga0070659_100022221
989 Ga0070659_100026115
990 Ga0070659_100141159
991 Ga0070659_100439723
992 Ga0070709_10198395
993 Ga0070714_100523682
994 Ga0070714_100544095
995 Ga0070714_100596958
996 Ga0070710_10029625
997 Ga0070701_10187935
998 Ga0070711_100025657
999 Ga0070700_100021145
1000 Ga0070700_100250374
1001 Ga0070694_100034592
1002 Ga0070694_100548017
1003 Ga0070678_100004691
1004 Ga0070678_100260104
1005 Ga0070681_10008977
1006 Ga0070681_10030842
1007 Ga0070681_10034745
1008 Ga0070681_10084225
1009 Ga0070681_10140034
1010 Ga0070681_10183635
1011 Ga0068867_100088449
1012 Ga0070685_10045930
1013 Ga0070706_100086274
1014 Ga0070707_100774811
1015 Ga0070698_100071122
1016 Ga0070699_100312425
1017 Ga0070679_100075881
1018 Ga0070679_100139279
1019 Ga0070679_100179023
1020 Ga0070679_100242556
1021 Ga0070684_100001226
1022 Ga0070684_100071339
1023 Ga0070684_100075594
1024 Ga0070684_100128869
1025 Ga0068853_100094958
1026 Ga0068853_100220600
1027 Ga0070672_100046991
1028 Ga0070672_100306261
1029 Ga0070686_100033274
1030 Ga0070693_100042631
1031 Ga0070693_100418498
1032 Ga0070665_100032824
1033 Ga0070665_100172112
1034 Ga0070665_100923507
1035 Ga0068855_100014350
1036 Ga0068855_100060814
1037 Ga0068855_100272389
1038 Ga0068855_100624803
1039 Ga0070664_100017950
1040 Ga0070664_100221746
1041 Ga0068857_100004862
1042 Ga0068857_100006742
1043 Ga0068857_100142692
1044 Ga0068857_100211722
1045 Ga0068856_100042442
1046 Ga0068856_100637785
1047 Ga0070702_100010715
1048 Ga0068852_100146700
1049 Ga0068859_100587512
1050 Ga0068859_100752606
1051 Ga0068864_100122688
1052 Ga0068861_100153467
1053 Ga0068861_100540410
1054 Ga0068870_10208934
1055 Ga0068863_100802393
1056 Ga0068858_100705059
1057 Ga0068860_100412037
1058 Ga0068862_100126795
1059 Ga0081455_10008830
1060 Ga0081455_10014299
1061 Ga0081455_10030105
1062 Ga0081455_10069855
1063 Ga0081455_10169911
1064 Ga0081538_10000181
1065 Ga0081538_10000297
1066 Ga0081538_10000502
1067 Ga0081538_10000804
1068 Ga0081538_10000925
1069 Ga0081538_10008148
1070 Ga0081538_10017280
1071 Ga0081538_10018099
1072 Ga0081538_10018371
1073 Ga0081538_10069192
1074 Ga0081538_10139401
1075 Ga0081540_1006849
1076 Ga0081539_10000062
1077 Ga0081539_10001583
1078 Ga0081539_10009993
1079 Ga0081539_10012956
1080 Ga0081539_10019762
1081 Ga0075365_10175513
1082 Ga0075432_10064927
1083 Ga0070715_10022486
1084 Ga0070716_100288031
1085 Ga0070712_100004124
1086 Ga0070712_100537153
1087 Ga0075427_10022130
1088 Ga0097621_100024560
1089 Ga0097621_100214086
1090 Ga0068871_100027672
1091 Ga0068871_100366585
1092 Ga0068871_100403331
1093 Ga0075428_100043736
1094 Ga0075428_100518490
1095 Ga0075428_100728850
1096 Ga0075430_100100857
1097 Ga0075430_100203256
1098 Ga0075430_100230303
1099 Ga0075431_100045347
1100 Ga0075433_10075025
1101 Ga0075433_10175656
1102 Ga0075434_100838263
1103 Ga0075429_100007313
1104 Ga0068865_100031396
1105 Ga0068865_100229439
1106 Ga0097620_100587506
1107 Ga0097620_100752640
1108 Ga0075435_100037060
1109 Ga0075435_100485689
1110 Ga0105240_10026755
1111 Ga0105240_10049813
1112 Ga0105240_10213432
1113 Ga0111539_10005174
1114 Ga0111539_10058439
1115 Ga0111539_10207811
1116 Ga0111539_10337928
1117 Ga0105245_10060054
1118 Ga0105245_10064347
1119 Ga0105245_10275196
1120 Ga0105245_10418863
1121 Ga0114129_10003023
1122 Ga0114129_10028025
1123 Ga0114129_10173490
1124 Ga0114129_10682846
1125 Ga0114129_10702139
1126 Ga0114129_10938285
1127 Ga0114129_10954564
1128 Ga0105243_10033430
1129 Ga0105243_10192741
1130 Ga0105243_10481491
1131 Ga0105241_10446920
1132 Ga0105242_10014556
1133 Ga0105242_10051900
1134 Ga0105242_10341334
1135 Ga0105242_10511241
1136 Ga0105237_10001575
1137 Ga0105237_10032006
1138 Ga0105237_10169117
1139 Ga0105238_10306741
1140 Ga0105249_10011189
1141 Ga0105249_10658705
1142 Ga0105239_10006331
1143 Ga0105239_10360933
1144 Ga0105239_10398055
1145 Ga0105239_10676486
1146 Ga0105246_10039193
1147 Ga0157373_10252380
1148 Ga0157370_10038762
1149 Ga0157370_10356979
1150 Ga0157370_10436440
1151 Ga0157370_10445572
1152 Ga0157369_10035965
1153 Ga0157369_10068684
1154 Ga0157369_10094741
1155 Ga0157374_10006829
1156 Ga0157374_10098614
1157 Ga0157374_10192298
1158 Ga0157378_10011844
1159 Ga0163162_10007186
1160 Ga0157372_10075957
1161 Ga0157372_10197601
1162 Ga0157372_10317301
1163 Ga0157375_10010359
1164 Ga0157375_10177722
1165 Ga0163163_10428054
1166 Ga0157380_10119804
1167 Ga0157380_10152318
1168 Ga0157377_10005388
1169 Ga0157377_10022425
1170 Ga0157376_10047691
1171 Ga0157376_10210484
1172 Ga0182007_10049478
1173 Ga0206356_11664069
1174 Ga0206353_11255590
1175 Ga0206353_11829944
1176 Ga0206353_11844079
1177 Ga0207692_10040358
1178 Ga0207692_10041477
1179 Ga0207642_10089634
1180 Ga0207699_10027383
1181 Ga0207699_10043526
1182 Ga0207699_10120388
1183 Ga0207654_10169278
1184 Ga0207654_10375171
1185 Ga0207707_10011148
1186 Ga0207707_10012057
1187 Ga0207707_10028270
1188 Ga0207707_10092802
1189 Ga0207707_10101297
1190 Ga0207707_10122363
1191 Ga0207695_10207394
1192 Ga0207695_10443331
1193 Ga0207671_10000835
1194 Ga0207671_10082479
1195 Ga0207671_10139513
1196 Ga0207693_10001551
1197 Ga0207693_10053039
1198 Ga0207693_10053072
1199 Ga0207693_10093503
1200 Ga0207693_10189021
1201 Ga0207660_10018009
1202 Ga0207660_10047444
1203 Ga0207660_10061128
1204 Ga0207660_10123453
1205 Ga0207660_10492645
1206 Ga0207657_10001335
1207 Ga0207657_10003370
1208 Ga0207657_10014368
1209 Ga0207649_10016170
1210 Ga0207649_10030765
1211 Ga0207649_10060635
1212 Ga0207649_10181536
1213 Ga0207652_10093742
1214 Ga0207652_10103051
1215 Ga0207652_10211387
1216 Ga0207652_10232679
1217 Ga0207646_10060981
1218 Ga0207646_10173318
1219 Ga0207681_10205406
1220 Ga0207694_10097620
1221 Ga0207694_10430627
1222 Ga0207687_10048820
1223 Ga0207687_10220598
1224 Ga0207687_10276832
1225 Ga0207700_10266773
1226 Ga0207700_10341930
1227 Ga0207700_10480529
1228 Ga0207664_10161998
1229 Ga0207690_10031482
1230 Ga0207690_10334154
1231 Ga0207686_10023760
1232 Ga0207686_10036737
1233 Ga0207686_10344803
1234 Ga0207709_10015057
1235 Ga0207709_10132644
1236 Ga0207709_10347962
1237 Ga0207670_10168880
1238 Ga0207669_10132538
1239 Ga0207704_10008706
1240 Ga0207704_10154651
1241 Ga0207665_10176786
1242 Ga0207665_10190315
1243 Ga0207691_10018612
1244 Ga0207691_10270739
1245 Ga0207691_10309853
1246 Ga0207661_10013034
1247 Ga0207661_10024926
1248 Ga0207661_10053149
1249 Ga0207661_10242720
1250 Ga0207661_10471850
1251 Ga0207667_10102955
1252 Ga0207667_10202976
1253 Ga0207712_10027905
1254 Ga0207668_10340279
1255 Ga0207668_10433151
1256 Ga0207677_10018809
1257 Ga0207639_10025421
1258 Ga0207678_10025503
1259 Ga0207708_10000757
1260 Ga0207702_10178202
1261 Ga0207702_10399968
1262 Ga0207702_10518294
1263 Ga0207702_10636357
1264 Ga0207648_10026646
1265 Ga0207648_10067304
1266 Ga0207676_10080307
1267 Ga0207674_10007853
1268 Ga0207674_10019444
1269 Ga0207674_10050544
1270 Ga0207674_10072073
1271 Ga0207674_10158923
1272 Ga0207674_10168470
1273 Ga0207674_10291947
1274 Ga0207675_100088890
1275 Ga0207683_10000740
1276 Ga0207683_10183098
1277 Ga0207683_10495685
1278 Ga0207698_10009350
1279 Ga0207698_10552269
1280 Ga0207428_10114332
1281 Ga0268266_10813971
1282 Ga0268265_10511186
1283 Ga0268264_10218847
1284 Ga0265319_1000175
1285 Ga0265319_1004884
1286 Ga0265318_10001659
1287 Ga0265322_10016779
1288 Ga0265338_10002978
1289 Ga0265338_10020014
1290 Ga0265320_10022983
1291 Ga0265320_10023798
1292 Ga0265316_10144442
1293 Ga0307408_100048271
1294 Ga0307408_100279369
1295 Ga0307405_10106736
1296 Ga0307405_10115674
1297 Ga0307413_10002156
1298 Ga0307413_10348857
1299 Ga0307410_10016214
1300 Ga0307410_10082209
1301 Ga0307410_10193461
1302 Ga0307406_10027082
1303 Ga0307406_10038981
1304 Ga0307406_10052159
1305 Ga0307407_10095163
1306 Ga0307412_10018003
1307 Ga0307412_10188235
1308 Ga0307409_100048352
1309 Ga0307409_100099462
1310 Ga0307409_100107955
1311 Ga0307409_100152069
1312 Ga0307409_100188332
1313 Ga0307416_100020572
1314 Ga0307416_100060430
1315 Ga0307416_100157670
1316 Ga0307416_100271023
1317 Ga0307414_10113428
1318 Ga0307414_10673601
1319 Ga0307411_10006677
1320 Ga0307411_10058648
1321 Ga0307415_100000015
1322 Ga0307415_100013568
1323 Ga0307415_100020790
1324 Ga0307415_100190904
1325 Ga0373945_0027076
1326 Ga0373956_0019955
1327 Ga0373943_0000090
1328 Ga0373946_0007850
1329 Ga0373946_0104013
1330 Ga0373955_0097179
1331 Ga0373955_0108744
1332 Ga0373935_0043829
1333 Ga0373933_0017190
1334 Ga0373947_0000266
1335 Ga0373937_0074513
1336 Ga0373937_0176692
1337 Ga0373925_0001866
1338 Ga0395899_0002195
1339 Ga0395899_0002876
1340 Ga0395899_0003284
1341 Ga0395899_0004709
1342 Ga0395899_0012345
1343 Ga0395899_0017803
1344 Ga0395899_0056021
1345 Ga0395899_0092577
1346 Ga0395899_0107394
1347 Ga0395899_0219626
1348 Ga0395899_0310064
1349 Ga0395899_0357142
1350 Ga0395899_0444745
1351 Ga0395899_0469488
1352 Ga0395900_0003322
1353 Ga0395900_0003557
1354 Ga0395900_0006758
1355 Ga0395900_0010351
1356 Ga0395900_0011065
1357 Ga0395900_0030406
1358 Ga0395900_0049279
1359 Ga0395900_0053577
1360 Ga0395900_0053624
1361 Ga0395900_0094819
1362 Ga0395900_0117171
1363 Ga0395900_0124218
1364 Ga0395900_0135277
1365 Ga0395900_0136718
1366 Ga0395900_0157668
1367 Ga0395900_0186777
1368 Ga0395900_0237339
1369 Ga0395900_0314142
1370 Ga0395900_0351589
1371 Ga0395900_0400214
1372 Ga0395898_0003445
1373 Ga0395898_0003903
1374 Ga0395898_0011171
1375 Ga0395898_0014290
1376 Ga0395898_0019644
1377 Ga0395898_0022550
1378 Ga0395898_0040303
1379 Ga0395898_0045562
1380 Ga0395898_0048290
1381 Ga0395898_0050255
1382 Ga0395898_0064493
1383 Ga0395898_0067865
1384 Ga0395898_0198696
1385 Ga0395898_0199571
1386 Ga0395898_0265295
1387 Ga0395898_0368271
1388 Ga0395898_0435977
1389 Ga0395898_0459360
1390 Ga0395898_0547052
1391 Ga0395898_0636000
1392 Ga0395905_0001505
1393 Ga0395905_0010800
1394 Ga0395905_0011659
1395 Ga0395905_0012564
1396 Ga0395905_0015454
1397 Ga0395905_0017620
1398 Ga0395905_0025788
1399 Ga0395905_0035532
1400 Ga0395905_0046007
1401 Ga0395905_0095963
1402 Ga0395905_0101923
1403 Ga0395905_0162045
1404 Ga0395905_0316679
1405 Ga0395905_0355525
1406 Ga0395905_0367816
1407 Ga0395905_0457326
1408 Ga0395901_0001420
1409 Ga0395901_0002025
1410 Ga0395901_0005860
1411 Ga0395901_0008893
1412 Ga0395901_0015572
1413 Ga0395901_0016543
1414 Ga0395901_0016812
1415 Ga0395901_0020676
1416 Ga0395901_0028265
1417 Ga0395901_0032743
1418 Ga0395901_0032816
1419 Ga0395901_0046351
1420 Ga0395901_0067601
1421 Ga0395901_0090099
1422 Ga0395901_0112930
1423 Ga0395901_0135470
1424 Ga0395901_0136094
1425 Ga0395901_0231359
1426 Ga0395901_0278177
1427 Ga0395901_0324663
1428 Ga0395901_0514864
1429 Ga0395901_0553889
1430 Ga0395901_0574959
1431 Ga0395901_0600228
1432 Ga0395901_0622244
1433 Ga0436363_1706338
1434 Ga0451802_0835110
1435 Ga0451837_1385120
1436 Ga0451853_0287148
1437 Ga0451853_0926783
1438 Ga0451853_2490875
1439 Ga0439442_022065
1440 Ga0439448_0016164
1441 Ga0439448_0032364
1442 Ga0439448_0187063
1443 Ga0439454_024473
1444 Ga0450915_001698
1445 Ga0450923_027145
1446 Ga0450916_008390
1447 Ga0466965_0121778
1448 Ga0466966_0020976
1449 Ga0466961_0008144
1450 Ga0466961_0166724
1451 Ga0466963_0025241
1452 Ga0466963_0086992
1453 Ga0466964_0010017
1454 Ga0466968_0017224
1455 Ga0466970_0095608
1456 Ga0466957_0027129
1457 Ga0466957_0195778
1458 Ga0466957_0447398
1459 Ga0466960_0029005
1460 Ga0466960_0036774
1461 Ga0466960_0072775
1462 Ga0466960_0226119
1463 Ga0451576_0062670
1464 Ga0466958_0002118
1465 Ga0466967_0004393
1466 Ga0466967_0020474
1467 Ga0466967_0069123
1468 Ga0466967_0079454
1469 Ga0466967_0092522
1470 Ga0466967_0239770
1471 Ga0495592_0062638
1472 Ga0495592_0113725
1473 Ga0495592_0393177
1474 Ga0495603_0128957
1475 Ga0495629_0002088
1476 Ga0495629_0205882
1477 Ga0495641_0005538
1478 Ga0495641_0015298
1479 Ga0495641_0031562
1480 Ga0495641_0067037
1481 Ga0495651_0014023
1482 Ga0495651_0024849
1483 Ga0495651_0083680
1484 Ga0495653_0022048
1485 Ga0495653_0032140
1486 Ga0495582_0000801
1487 Ga0495582_0017801
1488 Ga0495582_0027982
1489 Ga0495582_0028565
1490 Ga0495582_0038899
1491 Ga0495582_0277814
1492 Ga0495605_0097616
1493 Ga0495605_0178965
1494 Ga0495639_0002081
1495 Ga0495639_0165137
1496 Ga0495662_0000984
1497 Ga0495664_0052360
1498 Ga0495584_0060226
1499 Ga0495584_0145173
1500 Ga0495585_0150259
1501 Ga0495585_0227045
1502 Ga0495594_0027397
1503 Ga0495594_0058068
1504 Ga0495596_0062281
1505 Ga0495596_0074820
1506 Ga0495608_0022630
1507 Ga0495608_0113461
1508 Ga0495608_0194279
1509 Ga0495608_0330688
1510 Ga0495618_0100461
1511 Ga0495618_0140526
1512 Ga0495618_0185074
1513 Ga0495628_0008805
1514 Ga0495628_0039578
1515 Ga0495630_0005899
1516 Ga0495630_0178212
1517 Ga0495630_0392934
1518 Ga0495630_0440195
1519 Ga0495631_0065306
1520 Ga0495631_0131155
1521 Ga0495663_0021663
1522 Ga0495663_0131459
1523 Ga0495666_0016257
1524 Ga0495642_0019597
1525 Ga0495652_0011511
1526 Ga0495652_0351503
1527 Ga0495665_0000215
1528 Ga0495640_0001520
1529 Ga0495640_0077065
1530 Ga0495640_0121419
1531 Ga0495586_0031050
1532 Ga0495587_0031722
1533 Ga0495645_0048974
1534 Ga0495645_0124477
1535 Ga0495633_0096293
1536 Ga0495667_0010495
1537 Ga0495667_0064213
1538 Ga0495667_0114859
1539 Ga0495656_0018519
1540 Ga0495656_0097357
1541 Ga0495656_0233335
1542 Ga0495668_0170136
1543 Ga0495634_0092617
1544 Ga0495634_0095954
1545 Ga0495635_0026331
1546 Ga0495635_0076575
1547 Ga0495588_0194974
1548 Ga0495657_0019467
1549 Ga0495657_0079758
1550 Ga0495599_0007133
1551 Ga0495599_0322564
1552 Ga0495623_0066176
1553 Ga0495623_0159882
1554 Ga0495646_0053245
1555 Ga0495647_0002559
1556 Ga0495647_0038562
1557 Ga0495647_0129918
1558 Ga0495658_0002471
1559 Ga0495658_0070177
1560 Ga0495669_0077130
1561 Ga0495613_0003963
1562 Ga0495613_0017401
1563 Ga0495613_0156435
1564 Ga0495624_0012694
1565 Ga0495624_0092240
1566 Ga0495624_0102098
1567 Ga0495589_0072813
1568 Ga0495600_0043498
1569 Ga0495600_0045091
1570 Ga0495600_0081775
1571 Ga0495600_0274613
1572 Ga0495581_0000868
1573 Ga0495581_0000983
1574 Ga0495581_0038723
1575 Ga0495604_0009004
1576 Ga0495604_0049521
1577 Ga0495604_0071262
1578 Ga0495636_0097569
1579 Ga0495674_0030284
1580 Ga0495674_0034362
1581 Ga0495676_0001001
1582 Ga0495676_0005250
1583 Ga0495676_0107890
1584 Ga0495676_0129607
1585 Ga0495680_0005597
1586 Ga0495680_0013355
1587 Ga0495680_0019813
1588 Ga0495680_0021298
1589 Ga0495675_0024052
1590 Ga0495675_0065903
1591 Ga0495677_0029620
1592 Ga0495684_0006596
1593 Ga0495684_0010019
1594 Ga0495684_0098690
1595 Ga0495684_0136795
1596 Ga0495593_0001317
1597 Ga0495602_0046294
1598 Ga0495602_0061923
1599 Ga0495614_0004961
1600 Ga0496100_0010105
1601 Ga0496100_0034248
1602 Ga0496100_0041546
1603 Ga0496100_0047907
1604 Ga0496100_0111711
1605 Ga0496100_0231365
1606 Ga0496101_0008544
1607 Ga0496101_0032186
1608 Ga0496101_0104500
1609 Ga0496101_0143111
1610 Ga0496102_0001674
1611 Ga0496102_0042632
1612 Ga0496102_0077064
1613 Ga0496102_0215871
1614 Ga0496102_0400651
1615 Ga0496103_0002323
1616 Ga0496103_0021878
1617 Ga0496104_0007540
1618 Ga0496104_0017150
1619 Ga0496104_0049510
1620 Ga0496104_0082996
1621 Ga0496104_0137627
1622 Ga0496105_0001400
1623 Ga0496105_0012621
1624 Ga0496105_0027248
1625 Ga0496105_0081371
1626 Ga0496105_0207689
1627 Ga0496105_0271681
1628 Ga0496105_0435698
1629 Ga0496106_0011021
1630 Ga0496106_0062443
1631 Ga0496106_0142117
1632 Ga0496107_0004559
1633 Ga0496107_0052198
1634 Ga0496107_0081781
1635 Ga0496107_0207358
1636 Ga0496108_0020923
1637 Ga0496108_0026529
1638 Ga0496108_0144184
1639 Ga0496108_0174729
1640 Ga0496108_0238673
1641 Ga0496109_0001613
1642 Ga0496109_0002720
1643 Ga0496109_0003819
1644 Ga0496109_0025935
1645 Ga0496109_0035376
1646 Ga0496109_0092183
1647 Ga0496109_0126977
1648 Ga0496109_0142327
1649 Ga0496109_0147556
1650 Ga0496109_0498634
1651 Ga0496110_0020938
1652 Ga0496110_0076003
1653 Ga0496110_0076957
1654 Ga0496110_0191785
1655 Ga0496110_0257113
1656 Ga0496110_0264365
1657 Ga0496110_0631362
1658 Ga0496111_0000230
1659 Ga0496111_0002628
1660 Ga0496111_0222511
1661 Ga0496111_0315425
1662 Ga0496111_0573571
1663 Ga0496112_0016767
1664 Ga0496112_0026222
1665 Ga0496112_0046356
1666 Ga0496112_0051598
1667 Ga0496112_0090676
1668 Ga0496112_0211134
1669 Ga0496112_0252077
1670 Ga0496112_0286890
1671 Ga0496112_0615405
1672 Ga0496113_0083585
1673 Ga0496113_0091067
1674 Ga0496113_0121550
1675 Ga0496113_0213324
1676 Ga0496113_0237434
1677 Ga0496113_0369969
1678 Ga0496114_0001692
1679 Ga0496114_0009498
1680 Ga0496114_0012600
1681 Ga0496114_0050427
1682 Ga0496114_0167410
1683 Ga0496115_0001932
1684 Ga0496115_0005218
1685 Ga0496115_0005222
1686 Ga0496115_0006918
1687 Ga0496115_0040455
1688 Ga0496115_0105769
1689 Ga0496122_0238014
1690 Ga0501031_0000445
1691 Ga0501031_0012499
1692 Ga0501031_0058633
1693 Ga0501032_0000876
1694 Ga0501032_0064563
1695 Ga0501033_0000294
1696 Ga0501033_0000948
1697 Ga0501033_0014207
1698 Ga0501034_0003200
1699 Ga0501034_0666796
1700 Ga0501036_0001590
1701 Ga0501036_0003535
1702 Ga0501036_0005562
1703 Ga0501036_0012995
1704 Ga0501037_0000378
1705 Ga0501037_0005219
1706 Ga0501037_0005716
1707 Ga0501038_0000087
1708 Ga0501038_0001030
1709 Ga0501038_0008491
1710 Ga0501038_0132419
1711 Ga0501039_0001020
1712 Ga0501039_0002129
1713 Ga0501039_0003991
1714 Ga0501039_0103067
1715 Ga0501039_0246188
1716 Ga0501040_0000007
1717 Ga0501040_0000954
1718 Ga0501040_0006120
1719 Ga0501040_0008385
1720 Ga0501040_0017844
1721 Ga0501040_0040161
1722 Ga0501040_0259194
1723 Ga0501040_0375145
1724 Ga0501041_0000005
1725 Ga0501041_0001093
1726 Ga0501041_0001786
1727 Ga0501041_0002281
1728 Ga0501041_0312647
1729 Ga0501042_0003216
1730 Ga0501042_0003964
1731 Ga0501042_0010225
1732 Ga0501042_0034208
1733 Ga0501042_0140790
1734 Ga0501042_0314211
1735 Ga0501043_0000998
1736 Ga0501043_0002596
1737 Ga0501043_0048746
1738 Ga0501046_0001278
1739 Ga0501046_0002426
1740 Ga0501046_0017453
1741 Ga0501046_0028136
1742 Ga0501046_0053780
1743 Ga0501047_0000592
1744 Ga0501047_0084809
1745 Ga0501048_0000018
1746 Ga0501048_0001926
1747 Ga0501048_0010488
1748 Ga0501048_0030135
1749 Ga0501067_0000808
1750 Ga0501067_0009559
1751 Ga0501067_0046231
1752 Ga0501067_0251210
1753 Ga0501068_0000134
1754 Ga0501068_0001631
1755 Ga0501068_0005123
1756 Ga0501068_0011873
1757 Ga0501068_0089746
1758 Ga0501069_0000426
1759 Ga0501069_0007694
1760 Ga0501069_0009322
1761 Ga0501069_0015243
1762 Ga0501069_0088960
1763 Ga0501069_0124989
1764 Ga0501070_0002768
1765 Ga0501070_0004569
1766 Ga0501070_0005855
1767 Ga0501070_0293181
1768 Ga0501070_0489327
1769 Ga0501071_0000005
1770 Ga0501071_0001995
1771 Ga0501071_0003729
1772 Ga0501071_0089097
1773 Ga0501072_0000269
1774 Ga0501072_0004831
1775 Ga0501072_0011678
1776 Ga0501072_0012028
1777 Ga0501072_0038239
1778 Ga0501072_0092159
1779 Ga0501072_0368844
1780 Ga0501073_0000550
1781 Ga0501073_0001327
1782 Ga0501073_0033451
1783 Ga0501074_0000503
1784 Ga0501074_0001138
1785 Ga0501074_0060672
1786 Ga0501074_0075006
1787 Ga0501074_0150225
1788 Ga0501075_0000009
1789 Ga0501075_0000193
1790 Ga0501075_0020469
1791 Ga0501075_0050851
1792 Ga0501075_0126450
1793 Ga0501075_0313886
1794 Ga0501076_0000028
1795 Ga0501076_0001292
1796 Ga0501076_0004133
1797 Ga0501076_0019547
1798 Ga0501076_0342452
1799 Ga0501076_0578190
1800 Ga0501077_0000006
1801 Ga0501077_0001176
1802 Ga0501077_0005443
1803 Ga0501077_0020007
1804 Ga0501079_0000881
1805 Ga0501079_0000929
1806 Ga0501079_0003399
1807 Ga0501079_0007488
1808 Ga0501079_0025921
1809 Ga0501079_0096299
1810 Ga0501079_0133505
1811 Ga0501080_0000626
1812 Ga0501080_0001089
1813 Ga0501080_0032292
1814 Ga0501080_0296810
1815 Ga0501081_0000003
1816 Ga0501081_0000159
1817 Ga0501081_0001137
1818 Ga0501081_0001281
1819 Ga0501081_0176860
1820 Ga0501081_0353352
1821 Ga0501083_0000816
1822 Ga0501083_0001673
1823 Ga0501083_0008047
1824 Ga0501083_0216452
1825 Ga0501035_0000175
1826 Ga0501035_0078473
1827 Ga0501035_0083328
1828 Ga0501044_0006303
1829 Ga0501044_0038039
1830 Ga0501044_0047928
1831 Ga0501044_0486546
1832 Ga0501045_0000009
1833 Ga0501045_0000585
1834 Ga0501045_0002161
1835 Ga0501045_0002370
1836 Ga0501045_0150860
1837 Ga0501045_0333865
1838 nmdc:mga05p37_11001_c1
1839 nmdc:mga05p37_228180_c1
1840 nmdc:mga05p37_43470_c1
1841 nmdc:mga05p37_613470_c1
1842 nmdc:mga05p37_663035_c1
1843 nmdc:mga05p37_765488_c1
1844 nmdc:mga09592_1116_c1
1845 nmdc:mga0qj67_546827_c1
1846 nmdc:mga0qj67_58145_c1
1847 nmdc:mga0qj67_76093_c1
1848 nmdc:mga0qj67_9898_c1
1849 nmdc:mga06r32_133490_c1
1850 nmdc:mga06r32_325329_c1
1851 nmdc:mga08y16_267648_c1
1852 nmdc:mga08y16_273891_c1
1853 nmdc:mga08y16_328075_c1
1854 nmdc:mga0n895_434154_c1
1855 nmdc:mga0n895_851867_c1
1856 nmdc:mga0rr50_481469_c1
1857 nmdc:mga0a205_169830_c1
1858 nmdc:mga0a205_389828_c1
1859 nmdc:mga0a205_54850_c1
1860 Ga0495601_0063919
1861 Ga0495601_0066823
1862 Ga0495612_0011495
1863 Ga0495612_0020933
1864 Ga0495612_0085111
1865 Ga0495595_0006454
1866 Ga0495595_0013656
1867 Ga0495595_0077560
1868 Ga0495619_0003097
1869 Ga0495619_0004791
1870 Ga0495619_0025587
1871 Ga0495619_0069309
1872 Ga0501084_0001358
1873 Ga0501084_0005874
1874 Ga0501084_0007802
1875 Ga0501084_0050734
1876 Ga0501084_0065108
1877 Ga0501084_0091250
1878 Ga0501084_0293985
1879 Ga0501084_0515238
1880 Ga0501082_0000063
1881 Ga0501082_0001009
1882 Ga0501082_0001714
1883 Ga0501082_0047272
1884 Ga0501082_0174255
1885 Ga0501082_0179897
1886 Ga0530510_0000014
1887 Ga0530510_0001148
1888 Ga0530510_0001637
1889 Ga0530510_0031133
1890 Ga0530510_0062221
1891 Ga0530510_0187208
1892 Ga0530510_0237292

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

9

224

0.87

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

48

253

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbw-assembly1.cif.gz_A the structure of atp-bound abca1 0.7773 59 253
8bi0-assembly1.cif.gz_A abcg2 turnover-2 state with tariquidar bound 0.7394 7 252
8ee6-assembly1.cif.gz_A cryo-em structure of human abca7 in pe/ch nanodiscs 0.7245 58 253
7lkz-assembly1.cif.gz_A structure of atp-bound human abca4 0.7156 59 254
8bht-assembly1.cif.gz_A abcg2 turnover-1 state with tariquidar bound 0.7118 4 252
ID Description Score Start End Superfamily
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.849 46 251 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.8051 36 250 3.40.1710.10
af_Q9VMM9_322_706_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7741 32 247 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6862 46 251 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.6772 36 250 3.40.1710.10
ID Description Score Start End GO Terms
AF-A0A538G3Q1-F1-model_v4 Transport permease protein 0.9895 1 258 GO:0043190
GO:0140359
AF-A0A7W0G9Y8-F1-model_v4 Transport permease protein 0.9882 3 258 GO:0043190
GO:0140359
AF-A0A538I9E5-F1-model_v4 ABC-2 type transporter transmembrane domain-containing protein 0.9857 2 258 GO:0043190
GO:0140359
AF-A0A538G3Q1-F1-model_v4 Transport permease protein 0.9857 1 258 GO:0043190
GO:0140359
AF-A0A2W5ZCK5-F1-model_v4 Transport permease protein 0.9856 7 258 GO:0043190
GO:0140359

Map