F486444

General Info

Members Datasets Scaffolds Average Seq Length
945 643 599 330

Family's Representative Sequence

Representative Sequence 3300053134|Ga0500658_0005036|Ga0500658_0005036_3304_4428
Length 374
Sequence MLIYFCIADAFISSISFIPFWGHDPLIRSKEMIVMSSIMKTTALILGATGGIGGAVARKLLARGWRIRALNRDAAKASRNEPAFEWVQGDAMNAGDVLRAAEGVGLIVHAVNPPGYRDWETLVLPMLDNTIAAARAVGVRVVLPGNVYNFGPDALPAPTEESPQNPVTKKGAIRVEMEKRLKAASQSGAGAIIVRGGDFFGPGTTANSWFSSGLVTPGKPVGTIRNPARRGIGHQWAYLPDMAETIAQLVERADRLAPFAVYHMEGFWDADGLQMAEAIKRVVGGKAKIGNFPWWIVPLTAPFVPVMREIKEMRYLWKVPVRMRNTKLVAELGKEPQTPIDEAVRASLVALGCLPEPHRQAAAALIGHPSQNAG

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
12 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
13 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
14 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
15 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
16 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
24 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
25 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
26 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
27 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
28 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
29 2519103095 Burkholderia sp. KJ006 Isolate Nodule
30 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
31 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
32 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
33 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
34 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
35 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
36 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
37 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
38 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
39 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
40 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
41 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
42 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
43 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
44 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
45 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
46 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
47 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
48 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
49 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
50 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
51 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
52 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
53 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
54 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
55 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
56 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
57 2643221568 Rhizobium sp. Root564 Isolate Unclassified
58 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
59 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
60 2718217882 Rhizobium sp. N741 Isolate Nodule
61 2718217927 Rhizobium sp. N324 Isolate Nodule
62 2718218009 Rhizobium sp. N561 Isolate Nodule
63 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
64 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
65 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
66 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
67 2718218363 Rhizobium sp. N113 Isolate Nodule
68 2718218365 Rhizobium sp. N731 Isolate Nodule
69 2718218366 Rhizobium sp. N621 Isolate Nodule
70 2718218423 Rhizobium sp. N941 Isolate Nodule
71 2721755514 Rhizobium sp. N6212 Isolate Nodule
72 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
73 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
74 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
75 2721755809 Rhizobium sp. N541 Isolate Nodule
76 2721755810 Rhizobium sp. N871 Isolate Nodule
77 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
78 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
79 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
80 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
81 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
82 2728369365 Rhizobium sp. N1341 Isolate Nodule
83 2728369397 Rhizobium sp. N1314 Isolate Nodule
84 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
85 2738541337 Pelomonas sp. BT06 Isolate Unclassified
86 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
87 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
88 2791355260 Rhizobium sp. L9 Isolate Nodule
89 2791355261 Rhizobium sp. J15 Isolate Nodule
90 2791355262 Rhizobium sp. M1 Isolate Nodule
91 2791355263 Rhizobium chutanense C5 Isolate Nodule
92 2791355264 Rhizobium sp. S9 Isolate Nodule
93 2791355265 Rhizobium sp. H4 Isolate Nodule
94 2791355266 Rhizobium sp. L43 Isolate Nodule
95 2791355267 Rhizobium sp. L18 Isolate Nodule
96 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
97 2802429633 Rhizobium anhuiense J3 Isolate Nodule
98 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
99 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
100 2802429637 Rhizobium anhuiense C15 Isolate Nodule
101 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
102 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
103 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
104 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
105 2818991452 Burkholderia cepacia 561 Isolate Unclassified
106 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
107 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
108 2818991467 Bosea vestrisii 3192 Isolate Unclassified
109 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
110 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
111 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
112 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
113 2838048938 Rhizobium pisi 27/80 Isolate Nodule
114 2838061910 Rhizobium phaseoli L15 Isolate Nodule
115 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
116 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
117 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
118 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
119 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
120 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
121 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
124 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
125 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
126 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
127 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
128 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
129 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
130 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
131 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
132 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
133 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
134 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
135 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
136 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
137 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
138 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
139 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
140 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
141 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
142 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
143 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
144 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
145 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
146 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
147 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
148 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
149 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
150 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
151 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
152 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
153 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
154 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
155 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
156 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
157 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
158 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
159 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
160 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
161 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
162 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
163 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
164 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
165 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
166 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
167 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
168 2904564687 Burkholderia sp. 571 Isolate Unclassified
169 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
170 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
171 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
172 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
173 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
174 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
175 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
176 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
177 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
178 2919085039 Luteibacter sp. 1214 Isolate Unclassified
179 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
180 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
181 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
182 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
183 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
184 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
185 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
186 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
187 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
188 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
189 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
190 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
191 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
192 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
193 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
194 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
195 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
196 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
197 2928163908 Burkholderia sp. 567 Isolate Unclassified
198 2928170801 Burkholderia sp. 572 Isolate Unclassified
199 2928536128 Burkholderia sola 565 Isolate Unclassified
200 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
201 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
202 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
203 2933599457 Rhizobium phaseoli M3 Isolate Nodule
204 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
205 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
206 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
207 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
208 2936381700 Rhizobium chutanense C16 Isolate Unclassified
209 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
210 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
211 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
212 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
213 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
214 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
215 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
216 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
217 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
218 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
219 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
220 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
221 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
222 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
223 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
224 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
225 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
226 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
227 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
228 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
229 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
230 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
231 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
232 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
233 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
234 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
235 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
236 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
237 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
238 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
239 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
240 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
241 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
242 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
243 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
244 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
245 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
246 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
247 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
248 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
249 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
250 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
251 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
252 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
253 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
254 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
255 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
256 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
257 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
258 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
259 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
260 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
261 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
262 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
263 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
264 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
265 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
266 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
267 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
268 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
269 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
270 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
271 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
272 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
273 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
274 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
275 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
276 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
277 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
278 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
279 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
280 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
281 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
282 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
283 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
284 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
285 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
286 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
287 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
288 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
289 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
290 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
291 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
292 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
293 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
294 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
295 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
296 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
297 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
298 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
299 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
300 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
301 2996893221 Rhizobium sp. R635 Isolate Nodule
302 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
303 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
304 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
305 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
306 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
307 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
308 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
309 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
310 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
311 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
312 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
313 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
314 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
315 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
316 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
317 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
318 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
319 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
320 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
321 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
322 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
323 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
324 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
325 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
326 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
327 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
328 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
329 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
330 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
331 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
332 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
333 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
334 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
335 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
336 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
337 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
338 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
339 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
340 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
341 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
342 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
343 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
344 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
345 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
346 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
347 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
348 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
349 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
350 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
351 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
352 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
353 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
354 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
355 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
356 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
357 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
358 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
359 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
360 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
361 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
362 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
363 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
364 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
365 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
366 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
367 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
368 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
369 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
370 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
371 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
372 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
373 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
374 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
375 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
376 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
377 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
378 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
379 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
380 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
381 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
382 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
383 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
384 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
385 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
386 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
387 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
388 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
389 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
390 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
391 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
392 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
393 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
394 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
395 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
396 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
398 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
399 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
400 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
402 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
403 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
404 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
406 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
407 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
408 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
409 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
411 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
412 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
413 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
415 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
416 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
417 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
419 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
420 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
421 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
422 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
451 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
452 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
455 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
456 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
457 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
458 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
459 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
460 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
461 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
462 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
463 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
464 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
465 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
466 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
467 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
468 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
469 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
470 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
471 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
472 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
473 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
474 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
475 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
476 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
477 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
478 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
479 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
480 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
481 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
482 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
483 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
484 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
485 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
486 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
487 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
488 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
489 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
490 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
491 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
492 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
493 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
494 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
495 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
496 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
497 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
498 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
499 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
500 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
501 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
502 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
503 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
504 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
505 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
506 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
507 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
508 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
509 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
510 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
511 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
512 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
513 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
514 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
515 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
516 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
517 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
518 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
519 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
520 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
521 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
522 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
523 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
524 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
525 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
526 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
527 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
528 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
529 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
530 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
531 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
532 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
533 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
534 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
535 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
536 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
537 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
538 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
539 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
540 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
541 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
542 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
543 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
544 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
545 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
546 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
547 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
548 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
549 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
550 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
551 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
552 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
553 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
554 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
555 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
556 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
557 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
558 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
559 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
560 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
561 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
562 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
563 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
564 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
565 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
566 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
567 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
568 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
571 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
572 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
573 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
574 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
575 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
576 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
577 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
578 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
579 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
580 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
581 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
582 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
583 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
584 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
585 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
586 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
587 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
588 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
589 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
590 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
591 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
592 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
593 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
594 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
595 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
596 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
599 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
600 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
601 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
602 641522639 Methylobacterium sp. 4-46 Isolate Nodule
603 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
604 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
605 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
606 8005275841 Rhizobium sp. N4311 Isolate Nodule
607 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
608 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
609 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
610 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
611 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
612 8005382845 Rhizobium sp. R634 Isolate Nodule
613 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
614 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
615 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
616 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
617 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
618 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
619 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
620 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
621 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
622 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
623 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
624 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
625 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
626 8018176218 Rhizobium sp. N122 Isolate Nodule
627 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
628 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
629 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
630 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
631 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
632 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
633 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
634 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
635 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
636 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
637 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
638 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
639 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
640 8056382006 Rhizobium croatiense 13T Isolate Nodule
641 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere
642 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
643 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 63.39
Metatranscriptomes 0
Isolates 36.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 18.62
Nodule 28.47
Rhizoplane 3.7
Rhizosphere 33.33
Stem 0
Stem Tuber 0
Unclassified 15.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000491 3300001979 Bacteria 16940
2 JGI24737J22298_10006149 3300001990 Bacteria 4114
3 JGI25155J39150_1000044 3300002704 Bacteria 86149
4 JGI25156J39149_1000058 3300002705 Bacteria 86233
5 JGI25162J39368_1001111 3300002737 Bacteria 16290
6 JGI25154J39366_1000236 3300002738 Bacteria 36377
7 JGI25158J39367_1000019 3300002739 Bacteria 41617
8 JGI25157J39369_1000078 3300002741 Bacteria 86233
9 JGI25152J39213_1008101 3300002773 Bacteria 2642
10 JGI25152J39213_1009714 3300002773 Bacteria 2262
11 JGI25159J45721_1000393 3300002987 Bacteria 20327
12 JGI25159J45721_1001256 3300002987 Bacteria 10697
13 JGI25151J46595_10001000 3300003187 Bacteria 21370
14 JGI25151J46595_10003303 3300003187 Bacteria 8955
15 JGI25151J46595_10027236 3300003187 Bacteria 2295
16 JGI25165J46597_1002105 3300003214 Bacteria 7259
17 JGI25165J46597_1006815 3300003214 Bacteria 1978
18 JGI25153J46596_10001757 3300003215 Bacteria 12850
19 JGI25153J46596_10005805 3300003215 Bacteria 6416
20 rootH1_10002490 3300003316 Bacteria 42026
21 rootH1_10154918 3300003316 Bacteria 2742
22 rootH2_10104606 3300003320 Bacteria 4147
23 rootL2_10000902 3300003322 Bacteria 25253
24 rootH1_10073995 3300003323 Bacteria 3565
25 rootH1_10091604 3300003323 Bacteria 6396
26 JGI25160J50197_1000001 3300003354 Bacteria 782301
27 JGI25161J50226_1000001 3300003374 Bacteria 655036
28 JGI25161J50226_1000068 3300003374 Bacteria 90522
29 Ga0055532_1000337 3300003758 Bacteria 25555
30 Ga0055532_1000821 3300003758 Bacteria 10645
31 Ga0055532_1000922 3300003758 Bacteria 9520
32 Ga0055525_1000119 3300003759 Bacteria 120272
33 Ga0055527_1000104 3300003760 Bacteria 60485
34 Ga0055527_1000154 3300003760 Bacteria 48442
35 Ga0055535_1000218 3300003761 Bacteria 60485
36 Ga0055535_1000320 3300003761 Bacteria 48442
37 Ga0055542_1000076 3300003762 Bacteria 139662
38 Ga0055542_1000153 3300003762 Bacteria 87342
39 Ga0055542_1003042 3300003762 Bacteria 4847
40 Ga0055529_1000004 3300003763 Bacteria 433331
41 Ga0055529_1000176 3300003763 Bacteria 87107
42 Ga0055526_1000244 3300003771 Bacteria 45976
43 Ga0055526_1001546 3300003771 Bacteria 16285
44 Ga0055526_1007492 3300003771 Bacteria 5654
45 Ga0055526_1008391 3300003771 Bacteria 5166
46 Ga0055526_1033769 3300003771 Bacteria 1413
47 Ga0055537_1000178 3300003773 Bacteria 47461
48 Ga0055524_1000113 3300003775 Bacteria 95090
49 Ga0055524_1002336 3300003775 Bacteria 9864
50 Ga0055524_1004246 3300003775 Bacteria 6666
51 Ga0055524_1013289 3300003775 Bacteria 3111
52 Ga0055528_1000256 3300003790 Bacteria 45159
53 Ga0055528_1000261 3300003790 Bacteria 44757
54 Ga0055528_1001003 3300003790 Bacteria 18727
55 Ga0055528_1001848 3300003790 Bacteria 12070
56 Ga0055528_1015200 3300003790 Bacteria 2794
57 Ga0055528_1020168 3300003790 Bacteria 2174
58 Ga0055530_10002177 3300003791 Bacteria 12983
59 Ga0055540_1000268 3300003792 Bacteria 47109
60 Ga0055540_1004141 3300003792 Bacteria 6702
61 Ga0055540_1010129 3300003792 Bacteria 3165
62 Ga0055540_1016808 3300003792 Bacteria 2063
63 Ga0055540_1020546 3300003792 Bacteria 1742
64 Ga0055531_10000494 3300003794 Bacteria 36120
65 Ga0055531_10015091 3300003794 Bacteria 3429
66 Ga0055543_1000003 3300004625 Bacteria 358656
67 Ga0055543_1000470 3300004625 Bacteria 23657
68 Ga0065165_1000335 3300005262 Bacteria 77037
69 Ga0065165_1006900 3300005262 Bacteria 5770
70 Ga0065714_10069269 3300005288 Bacteria 4300
71 Ga0070658_10002454 3300005327 Bacteria 15511
72 Ga0070658_10023533 3300005327 Bacteria 4943
73 Ga0070666_10000023 3300005335 Bacteria 161603
74 Ga0070660_100000808 3300005339 Bacteria 20758
75 Ga0070660_100002392 3300005339 Bacteria 12893
76 Ga0070661_100020019 3300005344 Bacteria 4770
77 Ga0070661_100072065 3300005344 Bacteria 2542
78 Ga0070668_100063326 3300005347 Bacteria 2866
79 Ga0070669_100100499 3300005353 Bacteria 2181
80 Ga0070674_100016877 3300005356 Bacteria 4581
81 Ga0070659_100000012 3300005366 Bacteria 180004
82 Ga0070667_100007705 3300005367 Bacteria 8929
83 Ga0070667_100021962 3300005367 Bacteria 5296
84 Ga0070667_100328962 3300005367 Bacteria 1380
85 Ga0070663_100000530 3300005455 Bacteria 20177
86 Ga0070678_100000786 3300005456 Bacteria 15935
87 Ga0068867_100056815 3300005459 Bacteria 2896
88 Ga0070672_100010194 3300005543 Bacteria 6509
89 Ga0070672_100053334 3300005543 Bacteria 3161
90 Ga0070665_100010169 3300005548 Bacteria 9515
91 Ga0070665_100174378 3300005548 Bacteria 2151
92 Ga0068855_100068316 3300005563 Bacteria 4137
93 Ga0070664_100060423 3300005564 Bacteria 3227
94 Ga0068857_100107544 3300005577 Bacteria 2505
95 Ga0068857_100132824 3300005577 Bacteria 2246
96 Ga0068854_100028189 3300005578 Bacteria 3878
97 Ga0068854_100055631 3300005578 Bacteria 2849
98 Ga0068852_100064479 3300005616 Bacteria 3193
99 Ga0068851_10113937 3300005834 Bacteria 1446
100 Ga0068858_100130717 3300005842 Bacteria 2354
101 Ga0068860_100017387 3300005843 Bacteria 7006
102 Ga0068862_100133515 3300005844 Bacteria 2198
103 Ga0075365_10008493 3300006038 Bacteria 5840
104 Ga0075363_100018898 3300006048 Bacteria 3439
105 Ga0070712_100180099 3300006175 Bacteria 1646
106 Ga0075362_10007517 3300006177 Bacteria 4130
107 Ga0075369_10005897 3300006186 Bacteria 4604
108 Ga0075369_10017667 3300006186 Bacteria 2896
109 Ga0075369_10112159 3300006186 Bacteria 1229
110 Ga0075366_10003422 3300006195 Bacteria 8362
111 Ga0075370_10004016 3300006353 Bacteria 7072
112 Ga0075370_10048128 3300006353 Bacteria 2415
113 Ga0075370_10084033 3300006353 Bacteria 1832
114 Ga0075370_10104724 3300006353 Bacteria 1640
115 Ga0068865_100023745 3300006881 Bacteria 4019
116 Ga0079104_1000056 3300006946 Bacteria 166276
117 Ga0105244_10033305 3300009036 Bacteria 2717
118 Ga0105240_10001781 3300009093 Bacteria 36346
119 Ga0105240_10143890 3300009093 Bacteria 2847
120 Ga0111539_10076168 3300009094 Bacteria 3950
121 Ga0105243_10000812 3300009148 Bacteria 29753
122 Ga0105241_10003240 3300009174 Bacteria 12103
123 Ga0105237_10001251 3300009545 Bacteria 33932
124 Ga0105237_10030427 3300009545 Bacteria 5483
125 Ga0105237_10081269 3300009545 Bacteria 3231
126 Ga0105237_10128351 3300009545 Bacteria 2530
127 Ga0105237_10804532 3300009545 Bacteria 947
128 Ga0105238_10000331 3300009551 Bacteria 51630
129 Ga0105238_10035972 3300009551 Bacteria 5034
130 Ga0105238_10048861 3300009551 Bacteria 4262
131 Ga0123341_1000028 3300009765 Bacteria 69145
132 Ga0123342_1028435 3300009766 Bacteria 3017
133 Ga0105239_10035459 3300010375 Bacteria 5478
134 Ga0105239_10060729 3300010375 Bacteria 4149
135 Ga0105239_10179572 3300010375 Bacteria 2368
136 Ga0157371_10000197 3300013102 Bacteria 88423
137 Ga0157371_10016751 3300013102 Bacteria 5459
138 Ga0157370_10000248 3300013104 Bacteria 68580
139 Ga0157370_10001042 3300013104 Bacteria 34875
140 Ga0157370_10236176 3300013104 Bacteria 1692
141 Ga0157369_10111065 3300013105 Bacteria 2914
142 Ga0163162_10001650 3300013306 Bacteria 20913
143 Ga0157372_10068297 3300013307 Bacteria 3996
144 Ga0157375_10202886 3300013308 Bacteria 2139
145 Ga0182007_10003611 3300015262 Bacteria 7256
146 Ga0182007_10004059 3300015262 Bacteria 6741
147 Ga0182007_10004378 3300015262 Bacteria 6410
148 Ga0182005_1000173 3300015265 Bacteria 44701
149 Ga0163161_10043529 3300017792 Bacteria 3233
150 Ga0214543_1009579 3300021327 Bacteria 14952
151 Ga0213876_10035238 3300021384 Bacteria 2640
152 Ga0209435_100054 3300025206 Bacteria 86285
153 Ga0209436_100070 3300025208 Bacteria 51558
154 Ga0209566_100442 3300025225 Bacteria 30640
155 Ga0209674_105923 3300025226 Bacteria 1733
156 Ga0209672_100032 3300025228 Bacteria 324684
157 Ga0209672_100042 3300025228 Bacteria 272005
158 Ga0209147_100012 3300025229 Bacteria 681990
159 Ga0209147_100046 3300025229 Bacteria 295158
160 Ga0209147_100052 3300025229 Bacteria 272005
161 Ga0209563_100024 3300025230 Bacteria 601155
162 Ga0209563_101162 3300025230 Bacteria 7390
163 Ga0209437_100098 3300025233 Bacteria 229766
164 Ga0209258_100030 3300025242 Bacteria 470208
165 Ga0209258_100073 3300025242 Bacteria 272005
166 Ga0207425_1001479 3300025245 Bacteria 9779
167 Ga0207425_1012055 3300025245 Bacteria 2041
168 Ga0209646_1000170 3300025246 Bacteria 86285
169 Ga0209026_1000193 3300025250 Bacteria 86285
170 Ga0209148_1000008 3300025254 Bacteria 1504371
171 Ga0209148_1000022 3300025254 Bacteria 681990
172 Ga0209148_1000821 3300025254 Bacteria 22414
173 Ga0209759_1000222 3300025256 Bacteria 86285
174 Ga0209129_1000252 3300025258 Bacteria 55710
175 Ga0209129_1002985 3300025258 Bacteria 7710
176 Ga0209129_1018814 3300025258 Bacteria 1319
177 Ga0209233_1000095 3300025261 Bacteria 303783
178 Ga0209233_1000148 3300025261 Bacteria 185135
179 Ga0209565_1000003 3300025263 Bacteria 1099648
180 Ga0209455_1000002 3300025272 Bacteria 1505459
181 Ga0209455_1000024 3300025272 Bacteria 676133
182 Ga0209455_1000324 3300025272 Bacteria 47295
183 Ga0209673_1000010 3300025273 Bacteria 596656
184 Ga0209673_1000017 3300025273 Bacteria 492994
185 Ga0209673_1000021 3300025273 Bacteria 422978
186 Ga0209673_1000025 3300025273 Bacteria 404572
187 Ga0209673_1001232 3300025273 Bacteria 26878
188 Ga0209673_1004332 3300025273 Bacteria 7651
189 Ga0209673_1007335 3300025273 Bacteria 5109
190 Ga0209673_1024673 3300025273 Bacteria 2015
191 Ga0209130_1000003 3300025284 Bacteria 677988
192 Ga0209130_1000020 3300025284 Bacteria 379297
193 Ga0209675_1000119 3300025291 Bacteria 110218
194 Ga0209675_1028059 3300025291 Bacteria 1373
195 Ga0209676_1025937 3300025292 Bacteria 1871
196 Ga0209025_1000091 3300025294 Bacteria 250401
197 Ga0209025_1002551 3300025294 Bacteria 19004
198 Ga0209025_1004772 3300025294 Bacteria 11509
199 Ga0209025_1016097 3300025294 Bacteria 4449
200 Ga0209564_1000016 3300025295 Bacteria 613131
201 Ga0209564_1000588 3300025295 Bacteria 57321
202 Ga0209564_1000644 3300025295 Bacteria 52727
203 Ga0209564_1000883 3300025295 Bacteria 39645
204 Ga0209564_1007448 3300025295 Bacteria 5651
205 Ga0209564_1012085 3300025295 Bacteria 3798
206 Ga0209758_1000007 3300025297 Bacteria 1270410
207 Ga0209758_1001217 3300025297 Bacteria 32348
208 Ga0209758_1001343 3300025297 Bacteria 29681
209 Ga0209758_1001396 3300025297 Bacteria 28704
210 Ga0209758_1018413 3300025297 Bacteria 3423
211 Ga0209758_1018414 3300025297 Bacteria 3423
212 Ga0209050_1001510 3300025298 Bacteria 24578
213 Ga0209050_1002600 3300025298 Bacteria 14957
214 Ga0209050_1019579 3300025298 Bacteria 2563
215 Ga0209256_1000049 3300025299 Bacteria 310696
216 Ga0209256_1000210 3300025299 Bacteria 110217
217 Ga0209256_1000924 3300025299 Bacteria 35882
218 Ga0209256_1002389 3300025299 Bacteria 15470
219 Ga0209256_1011242 3300025299 Bacteria 3609
220 Ga0209256_1023488 3300025299 Bacteria 1837
221 Ga0207426_1000008 3300025302 Bacteria 848730
222 Ga0207426_1000011 3300025302 Bacteria 791203
223 Ga0209051_1000029 3300025303 Bacteria 403675
224 Ga0209051_1000196 3300025303 Bacteria 107028
225 Ga0209051_1000400 3300025303 Bacteria 60342
226 Ga0209051_1004736 3300025303 Bacteria 8241
227 Ga0209051_1006706 3300025303 Bacteria 6434
228 Ga0209051_1035357 3300025303 Bacteria 1860
229 Ga0209257_1000168 3300025304 Bacteria 171312
230 Ga0209257_1000305 3300025304 Bacteria 107001
231 Ga0209257_1001180 3300025304 Bacteria 33048
232 Ga0207655_1070987 3300025728 Bacteria 1294
233 Ga0207680_10000002 3300025903 Bacteria 1018646
234 Ga0207647_10184401 3300025904 Bacteria 1211
235 Ga0207705_10000489 3300025909 Bacteria 33785
236 Ga0207705_10002172 3300025909 Bacteria 15174
237 Ga0207705_10009527 3300025909 Bacteria 7068
238 Ga0207654_10000273 3300025911 Bacteria 31494
239 Ga0207695_10000037 3300025913 Bacteria 476303
240 Ga0207695_10001076 3300025913 Bacteria 47744
241 Ga0207695_10029433 3300025913 Bacteria 6068
242 Ga0207671_10004383 3300025914 Bacteria 13528
243 Ga0207671_10008263 3300025914 Bacteria 8855
244 Ga0207671_10018796 3300025914 Bacteria 5295
245 Ga0207693_10146142 3300025915 Bacteria 1859
246 Ga0207657_10000013 3300025919 Bacteria 180080
247 Ga0207657_10005166 3300025919 Bacteria 13693
248 Ga0207657_10027577 3300025919 Bacteria 5200
249 Ga0207649_10000443 3300025920 Bacteria 29944
250 Ga0207649_10011842 3300025920 Bacteria 4825
251 Ga0207694_10000253 3300025924 Bacteria 50728
252 Ga0207694_10028372 3300025924 Bacteria 4267
253 Ga0207694_10065008 3300025924 Bacteria 2844
254 Ga0207694_10148721 3300025924 Bacteria 1886
255 Ga0207690_10000048 3300025932 Bacteria 114048
256 Ga0207690_10014663 3300025932 Bacteria 4738
257 Ga0207706_10069437 3300025933 Bacteria 3099
258 Ga0207709_10000005 3300025935 Bacteria 806813
259 Ga0207669_10000251 3300025937 Bacteria 24482
260 Ga0207691_10026111 3300025940 Bacteria 5481
261 Ga0207691_10065584 3300025940 Bacteria 3286
262 Ga0207679_10044049 3300025945 Bacteria 3217
263 Ga0207667_10000001 3300025949 Bacteria 1178522
264 Ga0207667_10007355 3300025949 Bacteria 13250
265 Ga0207667_10038463 3300025949 Bacteria 5110
266 Ga0207667_10074482 3300025949 Bacteria 3527
267 Ga0207668_10049653 3300025972 Bacteria 2886
268 Ga0207668_10238403 3300025972 Bacteria 1470
269 Ga0207640_10001706 3300025981 Bacteria 11781
270 Ga0207640_10026274 3300025981 Bacteria 3533
271 Ga0207658_10003699 3300025986 Bacteria 10780
272 Ga0207658_10327777 3300025986 Bacteria 1327
273 Ga0207639_10025615 3300026041 Bacteria 4278
274 Ga0207639_10205790 3300026041 Bacteria 1691
275 Ga0207678_10001175 3300026067 Bacteria 23968
276 Ga0207702_10156415 3300026078 Bacteria 2078
277 Ga0207648_10031438 3300026089 Bacteria 4694
278 Ga0207674_10171368 3300026116 Bacteria 2124
279 Ga0207674_10382261 3300026116 Bacteria 1361
280 Ga0207683_10008013 3300026121 Bacteria 9032
281 Ga0207698_10008335 3300026142 Bacteria 6547
282 Ga0209281_1000125 3300027111 Bacteria 200371
283 Ga0209281_1001633 3300027111 Bacteria 12012
284 Ga0209371_1000767 3300027312 Bacteria 26697
285 Ga0209371_1007474 3300027312 Bacteria 3801
286 Ga0268266_10000004 3300028379 Bacteria 1495817
287 Ga0268266_10071099 3300028379 Bacteria 3016
288 Ga0268264_10026646 3300028381 Bacteria 4724
289 Ga0307515_10021842 3300028794 Bacteria 11320
290 Ga0307515_10044147 3300028794 Bacteria 6898
291 Ga0265338_10017549 3300028800 Bacteria 7708
292 Ga0268256_1000381 3300030500 Bacteria 41938
293 Ga0268256_1034045 3300030500 Bacteria 1198
294 Ga0316177_1132731 3300030731 Bacteria 1553
295 Ga0265328_10016351 3300031239 Bacteria 2889
296 Ga0265327_10007500 3300031251 Bacteria 8406
297 Ga0307509_10203133 3300031507 Bacteria 1816
298 Ga0307405_10286904 3300031731 Bacteria 1242
299 Ga0307412_10000279 3300031911 Bacteria 32639
300 Ga0307510_10001025 3300033180 Bacteria 29562
301 Ga0307510_10030018 3300033180 Bacteria 6172
302 Ga0307510_10156361 3300033180 Bacteria 1886
303 Ga0373959_0021938 3300034820 Bacteria 1230
304 Ga0373939_0001752 3300035114 Bacteria 5229
305 Ga0373960_0039436 3300035121 Bacteria 1358
306 Ga0373931_0009437 3300035691 Bacteria 4667
307 Ga0395900_0009732 3300037418 Bacteria 9846
308 Ga0395900_0124638 3300037418 Bacteria 2642
309 Ga0395900_0593518 3300037418 Bacteria 1049
310 Ga0395898_0002817 3300037466 Bacteria 19944
311 Ga0395905_0000836 3300037471 Bacteria 40186
312 Ga0395905_0001684 3300037471 Bacteria 26069
313 Ga0395905_0003242 3300037471 Bacteria 17500
314 Ga0436364_0266159 3300037853 Bacteria 1155
315 Ga0436364_1191496 3300037853 Bacteria 2219
316 Ga0395901_0000053 3300038443 Bacteria 163807
317 Ga0395901_0000771 3300038443 Bacteria 35916
318 Ga0395901_0051719 3300038443 Bacteria 4271
319 Ga0436365_1903073 3300039437 Bacteria 5474
320 Ga0436363_0094623 3300039450 Bacteria 3474
321 Ga0451797_1009375 3300041453 Bacteria 4861
322 Ga0451802_0590003 3300041460 Bacteria 3572
323 Ga0451802_0864319 3300041460 Bacteria 3925
324 Ga0451806_273572 3300041462 Bacteria 2348
325 Ga0451807_0250052 3300041486 Bacteria 3812
326 Ga0451807_0394883 3300041486 Bacteria 1838
327 Ga0451833_0097459 3300041491 Bacteria 3501
328 Ga0451837_0500608 3300041494 Bacteria 1238
329 Ga0451837_1125556 3300041494 Bacteria 1399
330 Ga0451849_1051639 3300041505 Bacteria 1866
331 Ga0451843_0511692 3300041509 Bacteria 2904
332 Ga0451853_1537113 3300041512 Bacteria 6622
333 Ga0439448_0046940 3300042005 Bacteria 1408
334 Ga0439449_0019623 3300042007 Bacteria 2534
335 Ga0466969_0048147 3300044656 Bacteria 2108
336 Ga0466972_0031098 3300044658 Bacteria 2627
337 Ga0466973_0073639 3300044659 Bacteria 3025
338 Ga0466965_0002833 3300044683 Bacteria 7472
339 Ga0466965_0074376 3300044683 Bacteria 1712
340 Ga0466966_0024442 3300044684 Bacteria 3951
341 Ga0466966_0030275 3300044684 Bacteria 3514
342 Ga0466961_0068600 3300044693 Bacteria 2251
343 Ga0466963_0000775 3300044694 Bacteria 15854
344 Ga0466971_0027711 3300044719 Bacteria 2537
345 Ga0466968_0001146 3300044735 Bacteria 9394
346 Ga0466968_0054845 3300044735 Bacteria 1709
347 Ga0466970_0004290 3300044765 Bacteria 7016
348 Ga0466957_0007192 3300044842 Bacteria 6295
349 Ga0466957_0014397 3300044842 Bacteria 4605
350 Ga0466957_0103143 3300044842 Bacteria 1800
351 Ga0466959_0038026 3300045049 Bacteria 3557
352 Ga0451576_0046970 3300045051 Bacteria 4542
353 Ga0466958_0112472 3300045836 Bacteria 1700
354 Ga0495591_000038 3300046458 Bacteria 157347
355 Ga0495591_002043 3300046458 Bacteria 11725
356 Ga0495629_0011780 3300046459 Bacteria 6347
357 Ga0495629_0099923 3300046459 Bacteria 2025
358 Ga0495650_0000074 3300046471 Bacteria 251346
359 Ga0495650_0000085 3300046471 Bacteria 235655
360 Ga0495650_0000792 3300046471 Bacteria 38739
361 Ga0495605_0013342 3300046474 Bacteria 4531
362 Ga0495605_0019640 3300046474 Bacteria 3606
363 Ga0495584_0000234 3300046491 Bacteria 39911
364 Ga0495584_0004488 3300046491 Bacteria 7500
365 Ga0495584_0017295 3300046491 Bacteria 3674
366 Ga0495585_0000503 3300046492 Bacteria 37043
367 Ga0495585_0027601 3300046492 Bacteria 3240
368 Ga0495585_0044443 3300046492 Bacteria 2481
369 Ga0495596_0000353 3300046500 Bacteria 29811
370 Ga0495607_0002423 3300046501 Bacteria 15227
371 Ga0495607_0010757 3300046501 Bacteria 6127
372 Ga0495607_0012593 3300046501 Bacteria 5574
373 Ga0495607_0016048 3300046501 Bacteria 4839
374 Ga0495583_0003563 3300046506 Bacteria 11728
375 Ga0495583_0004282 3300046506 Bacteria 10329
376 Ga0495583_0007004 3300046506 Bacteria 7218
377 Ga0495583_0034415 3300046506 Bacteria 2426
378 Ga0495583_0037583 3300046506 Bacteria 2294
379 Ga0495583_0049900 3300046506 Bacteria 1914
380 Ga0495606_0003262 3300046507 Bacteria 17404
381 Ga0495606_0004275 3300046507 Bacteria 14413
382 Ga0495606_0023312 3300046507 Bacteria 4489
383 Ga0495606_0053380 3300046507 Bacteria 2623
384 Ga0495610_0035819 3300046512 Bacteria 2542
385 Ga0495610_0063514 3300046512 Bacteria 1748
386 Ga0495616_0005239 3300046513 Bacteria 8009
387 Ga0495616_0054958 3300046513 Bacteria 1973
388 Ga0495616_0057988 3300046513 Bacteria 1908
389 Ga0495620_0021011 3300046515 Bacteria 3177
390 Ga0495630_0320565 3300046517 Bacteria 1185
391 Ga0495631_0014736 3300046518 Bacteria 3766
392 Ga0495631_0024247 3300046518 Bacteria 2802
393 Ga0495631_0034272 3300046518 Bacteria 2277
394 Ga0495632_0051326 3300046519 Bacteria 2030
395 Ga0495643_0003546 3300046522 Bacteria 11343
396 Ga0495643_0023729 3300046522 Bacteria 3484
397 Ga0495643_0155728 3300046522 Bacteria 1128
398 Ga0495644_0020986 3300046523 Bacteria 2492
399 Ga0495648_0000123 3300046524 Bacteria 92159
400 Ga0495648_0001570 3300046524 Bacteria 22297
401 Ga0495648_0033596 3300046524 Bacteria 3348
402 Ga0495663_0003381 3300046525 Bacteria 4610
403 Ga0495654_0030922 3300046530 Bacteria 2720
404 Ga0495609_0000072 3300046538 Bacteria 125273
405 Ga0495609_0001961 3300046538 Bacteria 13059
406 Ga0495609_0015067 3300046538 Bacteria 3623
407 Ga0495609_0047265 3300046538 Bacteria 1926
408 Ga0495597_0010430 3300046542 Bacteria 4544
409 Ga0495656_0000081 3300046615 Bacteria 42254
410 Ga0495668_0047650 3300046616 Bacteria 2379
411 Ga0495668_0177093 3300046616 Bacteria 1168
412 Ga0495611_0001502 3300046648 Bacteria 11538
413 Ga0495611_0018534 3300046648 Bacteria 2985
414 Ga0495611_0046262 3300046648 Bacteria 1951
415 Ga0495625_0016188 3300046660 Bacteria 5873
416 Ga0495625_0017507 3300046660 Bacteria 5609
417 Ga0495625_0028250 3300046660 Bacteria 4209
418 Ga0495625_0059750 3300046660 Bacteria 2703
419 Ga0495625_0083670 3300046660 Bacteria 2217
420 Ga0495661_0000040 3300046665 Bacteria 151437
421 Ga0495661_0000632 3300046665 Bacteria 35731
422 Ga0495661_0035787 3300046665 Bacteria 3113
423 Ga0495661_0039944 3300046665 Bacteria 2913
424 Ga0495661_0131180 3300046665 Bacteria 1373
425 Ga0495669_0000951 3300046684 Bacteria 12114
426 Ga0495669_0002830 3300046684 Bacteria 7121
427 Ga0495669_0016202 3300046684 Bacteria 3192
428 Ga0495670_0036221 3300046691 Bacteria 2459
429 Ga0495671_0067962 3300046692 Bacteria 1752
430 Ga0495649_0008479 3300046694 Bacteria 6182
431 Ga0495649_0104606 3300046694 Bacteria 1503
432 Ga0495589_0012514 3300046794 Bacteria 4392
433 Ga0495589_0016431 3300046794 Bacteria 3804
434 Ga0495600_0029243 3300046809 Bacteria 3567
435 Ga0495660_0042271 3300046810 Bacteria 2519
436 Ga0495674_0043083 3300047319 Bacteria 4020
437 Ga0495672_0001502 3300047320 Bacteria 22882
438 Ga0495672_0023150 3300047320 Bacteria 4027
439 Ga0495672_0070862 3300047320 Bacteria 1974
440 Ga0495676_0110221 3300047321 Bacteria 2021
441 Ga0495683_0000751 3300047323 Bacteria 23402
442 Ga0495683_0006182 3300047323 Bacteria 6560
443 Ga0495683_0102248 3300047323 Bacteria 1377
444 Ga0495687_000181 3300047443 Bacteria 91455
445 Ga0495687_053514 3300047443 Bacteria 1699
446 Ga0495681_0002457 3300047470 Bacteria 13222
447 Ga0495681_0027576 3300047470 Bacteria 2935
448 Ga0495686_0000051 3300047472 Bacteria 263489
449 Ga0495686_0000209 3300047472 Bacteria 108972
450 Ga0495686_0001880 3300047472 Bacteria 20984
451 Ga0495686_0016214 3300047472 Bacteria 5058
452 Ga0495686_0145844 3300047472 Bacteria 1393
453 Ga0495686_0157979 3300047472 Bacteria 1327
454 Ga0495686_0187695 3300047472 Bacteria 1193
455 Ga0495626_0022835 3300048091 Bacteria 3088
456 Ga0495626_0037916 3300048091 Bacteria 2288
457 Ga0496100_0094115 3300048903 Bacteria 2051
458 Ga0496101_0004154 3300048904 Bacteria 9071
459 Ga0496101_0014663 3300048904 Bacteria 5272
460 Ga0496102_0004598 3300048905 Bacteria 11673
461 Ga0496102_0021862 3300048905 Bacteria 5662
462 Ga0496103_0000784 3300048906 Bacteria 23390
463 Ga0496103_0032993 3300048906 Bacteria 3162
464 Ga0496104_0034197 3300048907 Bacteria 4737
465 Ga0496104_0210622 3300048907 Bacteria 1855
466 Ga0496105_0176741 3300048908 Bacteria 1748
467 Ga0496106_0006670 3300048909 Bacteria 8547
468 Ga0496106_0087170 3300048909 Bacteria 2405
469 Ga0496107_0235483 3300048910 Bacteria 1362
470 Ga0496109_0013161 3300048912 Bacteria 7160
471 Ga0496111_0097400 3300048914 Bacteria 2159
472 Ga0496112_0159356 3300048915 Bacteria 2223
473 Ga0496113_0000633 3300048916 Bacteria 17688
474 Ga0496113_0016669 3300048916 Bacteria 5080
475 Ga0496113_0130020 3300048916 Bacteria 1975
476 Ga0496113_0221706 3300048916 Bacteria 1507
477 Ga0496114_0003146 3300048917 Bacteria 12674
478 Ga0496114_0025174 3300048917 Bacteria 4862
479 Ga0496115_0000783 3300048918 Bacteria 23323
480 Ga0496116_0044240 3300048919 Bacteria 3026
481 Ga0496116_0082733 3300048919 Bacteria 1984
482 Ga0496116_0112599 3300048919 Bacteria 1594
483 Ga0496117_0001166 3300048920 Bacteria 39515
484 Ga0496117_0008212 3300048920 Bacteria 9956
485 Ga0496117_0023913 3300048920 Bacteria 4851
486 Ga0496117_0032207 3300048920 Bacteria 3987
487 Ga0496117_0055217 3300048920 Bacteria 2777
488 Ga0496117_0065309 3300048920 Bacteria 2475
489 Ga0496118_0000039 3300048921 Bacteria 305458
490 Ga0496118_0002904 3300048921 Bacteria 22291
491 Ga0496118_0010634 3300048921 Bacteria 9085
492 Ga0496118_0013144 3300048921 Bacteria 7857
493 Ga0496118_0029235 3300048921 Bacteria 4626
494 Ga0496118_0041646 3300048921 Bacteria 3633
495 Ga0496118_0071453 3300048921 Bacteria 2498
496 Ga0496119_0000678 3300048922 Bacteria 45442
497 Ga0496119_0014493 3300048922 Bacteria 6161
498 Ga0496119_0034908 3300048922 Bacteria 3302
499 Ga0496119_0135895 3300048922 Bacteria 1333
500 Ga0496120_0007629 3300048923 Bacteria 8017
501 Ga0496121_0001367 3300048924 Bacteria 41529
502 Ga0496121_0011982 3300048924 Bacteria 9533
503 Ga0496121_0017363 3300048924 Bacteria 7357
504 Ga0496121_0043649 3300048924 Bacteria 3879
505 Ga0496121_0056235 3300048924 Bacteria 3269
506 Ga0496121_0081336 3300048924 Bacteria 2564
507 Ga0496121_0094326 3300048924 Bacteria 2328
508 Ga0496121_0117822 3300048924 Bacteria 2011
509 Ga0496122_0000279 3300048925 Bacteria 114185
510 Ga0496122_0000287 3300048925 Bacteria 112404
511 Ga0496122_0003383 3300048925 Bacteria 20997
512 Ga0496122_0005139 3300048925 Bacteria 15785
513 Ga0496122_0012084 3300048925 Bacteria 8654
514 Ga0496122_0017366 3300048925 Bacteria 6733
515 Ga0496122_0033588 3300048925 Bacteria 4216
516 Ga0496122_0039175 3300048925 Bacteria 3782
517 Ga0496122_0040356 3300048925 Bacteria 3710
518 Ga0496122_0075124 3300048925 Bacteria 2386
519 Ga0496122_0130055 3300048925 Bacteria 1602
520 Ga0496123_0000146 3300048926 Bacteria 143990
521 Ga0496123_0001342 3300048926 Bacteria 34737
522 Ga0496123_0005602 3300048926 Bacteria 12555
523 Ga0496123_0005726 3300048926 Bacteria 12379
524 Ga0496123_0010773 3300048926 Bacteria 8023
525 Ga0496123_0016107 3300048926 Bacteria 6091
526 Ga0496123_0021444 3300048926 Bacteria 5021
527 Ga0496123_0049229 3300048926 Bacteria 2827
528 Ga0496123_0053468 3300048926 Bacteria 2668
529 Ga0496123_0082517 3300048926 Bacteria 1948
530 Ga0496123_0084908 3300048926 Bacteria 1907
531 Ga0496124_0000043 3300048927 Bacteria 300907
532 Ga0496124_0000232 3300048927 Bacteria 108986
533 Ga0496124_0000343 3300048927 Bacteria 85220
534 Ga0496124_0002777 3300048927 Bacteria 22248
535 Ga0496124_0002928 3300048927 Bacteria 21499
536 Ga0496124_0028074 3300048927 Bacteria 5037
537 Ga0496124_0032533 3300048927 Bacteria 4603
538 Ga0496124_0038378 3300048927 Bacteria 4160
539 Ga0496124_0055799 3300048927 Bacteria 3336
540 Ga0496124_0114468 3300048927 Bacteria 2166
541 Ga0496124_0123284 3300048927 Bacteria 2068
542 Ga0496124_0173271 3300048927 Bacteria 1668
543 Ga0496125_0000525 3300048928 Bacteria 66539
544 Ga0496125_0009938 3300048928 Bacteria 9672
545 Ga0496125_0010075 3300048928 Bacteria 9588
546 Ga0496125_0030997 3300048928 Bacteria 4774
547 Ga0496125_0034181 3300048928 Bacteria 4485
548 Ga0496125_0037628 3300048928 Bacteria 4204
549 Ga0496125_0104313 3300048928 Bacteria 2077
550 Ga0496125_0179631 3300048928 Bacteria 1412
551 Ga0496126_0000890 3300048929 Bacteria 52336
552 Ga0496126_0001437 3300048929 Bacteria 37376
553 Ga0496126_0016491 3300048929 Bacteria 7383
554 Ga0496126_0206978 3300048929 Bacteria 1653
555 Ga0501034_0056018 3300049571 Bacteria 3968
556 Ga0501034_0537780 3300049571 Bacteria 1079
557 Ga0501036_0333037 3300049572 Bacteria 1268
558 Ga0501047_0004596 3300049581 Bacteria 12981
559 Ga0501044_0014603 3300049823 Bacteria 8469
560 Ga0501044_0102610 3300049823 Bacteria 2876
561 Ga0501044_0615272 3300049823 Bacteria 978
562 nmdc:mga03683_2591_c1 3300050489 Bacteria 5645
563 nmdc:mga0yw44_4173_c1 3300050492 Bacteria 6571
564 nmdc:mga06z11_67015_c1 3300050494 Bacteria 1889
565 nmdc:mga07m45_10860_c1 3300050496 Bacteria 4769
566 nmdc:mga07m45_3201_c1 3300050496 Bacteria 7851
567 nmdc:mga07m45_42767_c1 3300050496 Bacteria 2540
568 nmdc:mga08y16_185363_c1 3300050511 Bacteria 2160
569 nmdc:mga0sz30_12277_c1 3300050516 Bacteria 1975
570 nmdc:mga0sz30_12293_c1 3300050516 Bacteria 3328
571 nmdc:mga0sz30_90334_c1 3300050516 Bacteria 1332
572 Ga0495601_0046002 3300053077 Bacteria 2746
573 Ga0495612_0081970 3300053078 Bacteria 1356
574 Ga0500610_0002998 3300053079 Bacteria 6368
575 Ga0495619_0011875 3300053085 Bacteria 5484
576 Ga0500643_060660 3300053087 Bacteria 1063
577 Ga0500556_0000052 3300053104 Bacteria 117825
578 Ga0500569_001663 3300053109 Bacteria 4238
579 Ga0500592_011458 3300053116 Bacteria 1419
580 Ga0500595_004353 3300053119 Bacteria 6371
581 Ga0500618_002324 3300053125 Bacteria 7295
582 Ga0500642_0048629 3300053130 Bacteria 1863
583 Ga0500655_024233 3300053133 Bacteria 1148
584 Ga0500658_0005036 3300053134 Bacteria 4917
585 Ga0500658_0006626 3300053134 Bacteria 4292
586 Ga0500568_0003502 3300053139 Bacteria 8713
587 Ga0500568_0056921 3300053139 Bacteria 1522
588 Ga0500590_075518 3300053148 Bacteria 1667
589 Ga0500619_006419 3300053154 Bacteria 2710
590 Ga0500622_0003787 3300053156 Bacteria 9863
591 Ga0500622_0014724 3300053156 Bacteria 4194
592 Ga0500627_0036194 3300053158 Bacteria 2101
593 Ga0500633_0000648 3300053160 Bacteria 5809
594 Ga0500636_0034674 3300053177 Bacteria 2987
595 Ga0500645_000083 3300053730 Bacteria 76285
596 Ga0500645_027123 3300053730 Bacteria 1738
597 Ga0500596_003000 3300053735 Bacteria 3256
598 Ga0466962_0140248 3300061719 Bacteria 1171
599 Ga0466962_0165628 3300061719 Bacteria 1075

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049572 Ga0501036_0333037 Ga0501036_0333037_481_1251 255
2 3300044684 Ga0466966_0030275 Ga0466966_0030275_1936_2721 256
3 3300009545 Ga0105237_10804532 Ga0105237_108045321 264
4 3300049823 Ga0501044_0615272 Ga0501044_0615272_35_880 265
5 3300048919 Ga0496116_0112599 Ga0496116_0112599_704_1579 287
6 3300048927 Ga0496124_0000043 Ga0496124_0000043_95586_96578 288
7 iso_pu_bacteria 2960674078 2960678882 290
8 iso_pu_bacteria 2928027323 2928029280 291
9 3300005339 Ga0070660_100002392 Ga0070660_10000239212 294
10 3300009545 Ga0105237_10128351 Ga0105237_101283513 294
11 3300010375 Ga0105239_10060729 Ga0105239_100607293 294
12 3300025919 Ga0207657_10005166 Ga0207657_100051669 294
13 3300025949 Ga0207667_10074482 Ga0207667_100744822 294
14 3300048926 Ga0496123_0082517 Ga0496123_0082517_1035_1931 294
15 3300048926 Ga0496123_0084908 Ga0496123_0084908_435_1325 294
16 3300030731 Ga0316177_1132731 Ga0316177_11327312 295
17 3300048927 Ga0496124_0114468 Ga0496124_0114468_65_1009 296
18 3300048928 Ga0496125_0037628 Ga0496125_0037628_3166_4104 297
19 3300005578 Ga0068854_100028189 Ga0068854_1000281892 298
20 3300006175 Ga0070712_100180099 Ga0070712_1001800992 298
21 3300025915 Ga0207693_10146142 Ga0207693_101461422 298
22 3300025981 Ga0207640_10026274 Ga0207640_100262743 298
23 3300031911 Ga0307412_10000279 Ga0307412_1000027923 298
24 3300003323 rootH1_10091604 rootH1_100916045 300
25 3300048920 Ga0496117_0065309 Ga0496117_0065309_555_1520 300
26 3300048921 Ga0496118_0010634 Ga0496118_0010634_6788_7753 300
27 iso_pu_bacteria 2957408893 2957409497 302
28 3300001990 JGI24737J22298_10006149 JGI24737J22298_100061491 305
29 3300003759 Ga0055525_1000119 Ga0055525_1000119113 305
30 3300003762 Ga0055542_1000076 Ga0055542_1000076108 305
31 3300003763 Ga0055529_1000004 Ga0055529_100000436 305
32 3300005327 Ga0070658_10002454 Ga0070658_1000245415 305
33 3300005344 Ga0070661_100072065 Ga0070661_1000720652 305
34 3300005356 Ga0070674_100016877 Ga0070674_1000168775 305
35 3300005456 Ga0070678_100000786 Ga0070678_1000007865 305
36 3300005459 Ga0068867_100056815 Ga0068867_1000568153 305
37 3300005543 Ga0070672_100053334 Ga0070672_1000533342 305
38 3300005834 Ga0068851_10113937 Ga0068851_101139372 305
39 3300006186 Ga0075369_10112159 Ga0075369_101121592 305
40 3300009148 Ga0105243_10000812 Ga0105243_100008123 305
41 3300009174 Ga0105241_10003240 Ga0105241_1000324012 305
42 3300013102 Ga0157371_10000197 Ga0157371_1000019765 305
43 3300013307 Ga0157372_10068297 Ga0157372_100682972 305
44 3300025230 Ga0209563_100024 Ga0209563_100024541 305
45 3300025254 Ga0209148_1000008 Ga0209148_1000008528 305
46 3300025272 Ga0209455_1000002 Ga0209455_1000002896 305
47 3300025297 Ga0209758_1000007 Ga0209758_1000007798 305
48 3300025904 Ga0207647_10184401 Ga0207647_101844011 305
49 3300025909 Ga0207705_10000489 Ga0207705_1000048918 305
50 3300025911 Ga0207654_10000273 Ga0207654_100002734 305
51 3300025914 Ga0207671_10008263 Ga0207671_100082639 305
52 3300025919 Ga0207657_10027577 Ga0207657_100275773 305
53 3300025920 Ga0207649_10000443 Ga0207649_1000044321 305
54 3300025924 Ga0207694_10028372 Ga0207694_100283724 305
55 3300025932 Ga0207690_10014663 Ga0207690_100146634 305
56 3300025933 Ga0207706_10069437 Ga0207706_100694372 305
57 3300025935 Ga0207709_10000005 Ga0207709_10000005499 305
58 3300025937 Ga0207669_10000251 Ga0207669_1000025118 305
59 3300025940 Ga0207691_10065584 Ga0207691_100655842 305
60 3300025949 Ga0207667_10000001 Ga0207667_10000001819 305
61 3300025972 Ga0207668_10238403 Ga0207668_102384031 305
62 3300025981 Ga0207640_10001706 Ga0207640_100017062 305
63 3300026041 Ga0207639_10025615 Ga0207639_100256152 305
64 3300026078 Ga0207702_10156415 Ga0207702_101564152 305
65 3300026089 Ga0207648_10031438 Ga0207648_100314384 305
66 3300026116 Ga0207674_10171368 Ga0207674_101713681 305
67 3300026121 Ga0207683_10008013 Ga0207683_100080135 305
68 3300026142 Ga0207698_10008335 Ga0207698_100083354 305
69 3300031507 Ga0307509_10203133 Ga0307509_102031331 305
70 3300033180 Ga0307510_10156361 Ga0307510_101563612 305
71 3300037471 Ga0395905_0001684 Ga0395905_0001684_1927_3000 305
72 3300042005 Ga0439448_0046940 Ga0439448_0046940_281_1207 305
73 3300046459 Ga0495629_0011780 Ga0495629_0011780_456_1382 305
74 3300046471 Ga0495650_0000792 Ga0495650_0000792_16285_17211 305
75 3300046491 Ga0495584_0017295 Ga0495584_0017295_373_1299 305
76 3300046492 Ga0495585_0027601 Ga0495585_0027601_1249_2175 305
77 3300046506 Ga0495583_0003563 Ga0495583_0003563_6725_7651 305
78 3300046506 Ga0495583_0004282 Ga0495583_0004282_5221_6147 305
79 3300046506 Ga0495583_0034415 Ga0495583_0034415_796_1722 305
80 3300046506 Ga0495583_0049900 Ga0495583_0049900_288_1214 305
81 3300046513 Ga0495616_0057988 Ga0495616_0057988_911_1837 305
82 3300046518 Ga0495631_0014736 Ga0495631_0014736_1106_2032 305
83 3300046524 Ga0495648_0000123 Ga0495648_0000123_73478_74404 305
84 3300046524 Ga0495648_0033596 Ga0495648_0033596_1608_2534 305
85 3300046525 Ga0495663_0003381 Ga0495663_0003381_2996_3922 305
86 3300046648 Ga0495611_0001502 Ga0495611_0001502_5329_6255 305
87 3300046648 Ga0495611_0018534 Ga0495611_0018534_1937_2863 305
88 3300046660 Ga0495625_0016188 Ga0495625_0016188_1518_2444 305
89 3300046660 Ga0495625_0059750 Ga0495625_0059750_460_1386 305
90 3300046665 Ga0495661_0039944 Ga0495661_0039944_560_1486 305
91 3300046665 Ga0495661_0131180 Ga0495661_0131180_92_1018 305
92 3300046684 Ga0495669_0000951 Ga0495669_0000951_6017_6943 305
93 3300046694 Ga0495649_0008479 Ga0495649_0008479_2633_3559 305
94 3300046694 Ga0495649_0104606 Ga0495649_0104606_159_1085 305
95 3300046809 Ga0495600_0029243 Ga0495600_0029243_884_1810 305
96 3300047323 Ga0495683_0000751 Ga0495683_0000751_18453_19379 305
97 3300047443 Ga0495687_000181 Ga0495687_000181_53926_54852 305
98 3300047470 Ga0495681_0027576 Ga0495681_0027576_504_1430 305
99 3300047472 Ga0495686_0157979 Ga0495686_0157979_375_1301 305
100 3300048905 Ga0496102_0004598 Ga0496102_0004598_660_1586 305
101 3300048906 Ga0496103_0000784 Ga0496103_0000784_3805_4731 305
102 3300048907 Ga0496104_0034197 Ga0496104_0034197_3719_4645 305
103 3300048908 Ga0496105_0176741 Ga0496105_0176741_653_1579 305
104 3300048910 Ga0496107_0235483 Ga0496107_0235483_228_1154 305
105 3300048914 Ga0496111_0097400 Ga0496111_0097400_1160_2086 305
106 3300048916 Ga0496113_0221706 Ga0496113_0221706_65_1030 305
107 3300048917 Ga0496114_0025174 Ga0496114_0025174_3780_4706 305
108 3300048918 Ga0496115_0000783 Ga0496115_0000783_18328_19254 305
109 3300048919 Ga0496116_0082733 Ga0496116_0082733_827_1753 305
110 3300048920 Ga0496117_0001166 Ga0496117_0001166_38352_39278 305
111 3300048921 Ga0496118_0000039 Ga0496118_0000039_947_1873 305
112 3300048922 Ga0496119_0034908 Ga0496119_0034908_2157_3083 305
113 3300048924 Ga0496121_0001367 Ga0496121_0001367_40385_41311 305
114 3300048925 Ga0496122_0033588 Ga0496122_0033588_2291_3217 305
115 3300048926 Ga0496123_0010773 Ga0496123_0010773_1476_2402 305
116 3300048927 Ga0496124_0000232 Ga0496124_0000232_19748_20674 305
117 3300048928 Ga0496125_0010075 Ga0496125_0010075_745_1671 305
118 3300048929 Ga0496126_0001437 Ga0496126_0001437_196_1122 305
119 3300053079 Ga0500610_0002998 Ga0500610_0002998_829_1755 305
120 3300053119 Ga0500595_004353 Ga0500595_004353_5338_6264 305
121 3300053130 Ga0500642_0048629 Ga0500642_0048629_45_971 305
122 3300053139 Ga0500568_0056921 Ga0500568_0056921_304_1230 305
123 3300053154 Ga0500619_006419 Ga0500619_006419_1552_2478 305
124 3300053730 Ga0500645_000083 Ga0500645_000083_27706_28632 305
125 3300053735 Ga0500596_003000 Ga0500596_003000_529_1455 305
126 3300005367 Ga0070667_100021962 Ga0070667_1000219624 306
127 3300047472 Ga0495686_0000209 Ga0495686_0000209_107795_108736 306
128 iso_pu_bacteria 2818991467 2819718745 306
129 3300046492 Ga0495585_0000503 Ga0495585_0000503_8550_9503 307
130 3300046665 Ga0495661_0000632 Ga0495661_0000632_19510_20463 307
131 3300025263 Ga0209565_1000003 Ga0209565_100000363 308
132 3300025273 Ga0209673_1000017 Ga0209673_1000017434 308
133 3300025291 Ga0209675_1000119 Ga0209675_100011963 308
134 3300025295 Ga0209564_1000016 Ga0209564_100001652 308
135 3300025299 Ga0209256_1000210 Ga0209256_100021063 308
136 3300046512 Ga0495610_0063514 Ga0495610_0063514_61_1050 308
137 3300048920 Ga0496117_0032207 Ga0496117_0032207_2389_3336 308
138 3300048925 Ga0496122_0017366 Ga0496122_0017366_5403_6350 308
139 3300049581 Ga0501047_0004596 Ga0501047_0004596_7492_8421 308
140 3300049823 Ga0501044_0014603 Ga0501044_0014603_6842_7771 308
141 3300053087 Ga0500643_060660 Ga0500643_060660_12_983 308
142 iso_pu_bacteria 2928968154 2928969942 308
143 3300031731 Ga0307405_10286904 Ga0307405_102869042 310
144 iso_pu_bacteria 2964705432 2964711795 310
145 iso_pu_bacteria 3003665799 3003671281 310
146 3300005577 Ga0068857_100132824 Ga0068857_1001328243 311
147 3300005844 Ga0068862_100133515 Ga0068862_1001335152 311
148 3300048925 Ga0496122_0003383 Ga0496122_0003383_1588_2571 311
149 3300049571 Ga0501034_0056018 Ga0501034_0056018_1123_2109 311
150 3300053148 Ga0500590_075518 Ga0500590_075518_24_971 311
151 iso_pu_bacteria 2919085039 2919087675 311
152 iso_pu_bacteria 2946006987 2946008272 311
153 3300005367 Ga0070667_100007705 Ga0070667_1000077054 312
154 3300005577 Ga0068857_100107544 Ga0068857_1001075443 312
155 3300005578 Ga0068854_100055631 Ga0068854_1000556313 312
156 3300017792 Ga0163161_10043529 Ga0163161_100435293 312
157 3300025986 Ga0207658_10003699 Ga0207658_100036998 312
158 3300026116 Ga0207674_10382261 Ga0207674_103822612 312
159 3300037853 Ga0436364_1191496 Ga0436364_1191496_1210_2208 312
160 3300048916 Ga0496113_0130020 Ga0496113_0130020_254_1213 312
161 3300048922 Ga0496119_0000678 Ga0496119_0000678_41119_42078 312
162 3300048925 Ga0496122_0000287 Ga0496122_0000287_38030_38989 312
163 3300048926 Ga0496123_0001342 Ga0496123_0001342_3500_4459 312
164 3300048927 Ga0496124_0002777 Ga0496124_0002777_1560_2504 312
165 3300048927 Ga0496124_0173271 Ga0496124_0173271_212_1156 312
166 3300048928 Ga0496125_0000525 Ga0496125_0000525_60801_61745 312
167 3300048928 Ga0496125_0179631 Ga0496125_0179631_171_1115 312
168 3300053104 Ga0500556_0000052 Ga0500556_0000052_48223_49182 312
169 3300053116 Ga0500592_011458 Ga0500592_011458_176_1123 312
170 3300053730 Ga0500645_027123 Ga0500645_027123_422_1369 312
171 iso_pu_bacteria 2842914999 2842917992 312
172 iso_pu_bacteria 2946787523 2946788709 312
173 iso_pu_bacteria 8057101203 8057102384 312
174 3300003771 Ga0055526_1000244 Ga0055526_100024435 313
175 3300003773 Ga0055537_1000178 Ga0055537_100017837 313
176 3300003775 Ga0055524_1013289 Ga0055524_10132892 313
177 3300003790 Ga0055528_1000261 Ga0055528_100026134 313
178 3300006186 Ga0075369_10017667 Ga0075369_100176672 313
179 3300009036 Ga0105244_10033305 Ga0105244_100333053 313
180 3300009551 Ga0105238_10048861 Ga0105238_100488614 313
181 3300013104 Ga0157370_10001042 Ga0157370_100010427 313
182 3300013308 Ga0157375_10202886 Ga0157375_102028861 313
183 3300015265 Ga0182005_1000173 Ga0182005_10001737 313
184 3300025728 Ga0207655_1070987 Ga0207655_10709872 313
185 3300025924 Ga0207694_10065008 Ga0207694_100650082 313
186 3300046501 Ga0495607_0002423 Ga0495607_0002423_12591_13544 313
187 3300050516 nmdc:mga0sz30_12293_c1 nmdc:mga0sz30_12293_c1_269_1222 313
188 iso_pu_bacteria 2808606418 2809143736 313
189 3300005288 Ga0065714_10069269 Ga0065714_100692693 314
190 3300005327 Ga0070658_10023533 Ga0070658_100235333 314
191 3300005335 Ga0070666_10000023 Ga0070666_10000023126 314
192 3300005344 Ga0070661_100020019 Ga0070661_1000200193 314
193 3300005347 Ga0070668_100063326 Ga0070668_1000633262 314
194 3300005548 Ga0070665_100010169 Ga0070665_1000101699 314
195 3300005842 Ga0068858_100130717 Ga0068858_1001307172 314
196 3300005843 Ga0068860_100017387 Ga0068860_1000173873 314
197 3300009551 Ga0105238_10000331 Ga0105238_1000033110 314
198 3300013306 Ga0163162_10001650 Ga0163162_1000165019 314
199 3300015262 Ga0182007_10004059 Ga0182007_100040597 314
200 3300025903 Ga0207680_10000002 Ga0207680_10000002121 314
201 3300025909 Ga0207705_10002172 Ga0207705_100021728 314
202 3300025920 Ga0207649_10011842 Ga0207649_100118424 314
203 3300025924 Ga0207694_10000253 Ga0207694_1000025329 314
204 3300025972 Ga0207668_10049653 Ga0207668_100496532 314
205 3300028379 Ga0268266_10000004 Ga0268266_10000004128 314
206 3300028381 Ga0268264_10026646 Ga0268264_100266462 314
207 3300028800 Ga0265338_10017549 Ga0265338_100175493 314
208 3300033180 Ga0307510_10001025 Ga0307510_1000102513 314
209 3300033180 Ga0307510_10030018 Ga0307510_100300185 314
210 3300038443 Ga0395901_0000053 Ga0395901_0000053_78310_79314 314
211 3300039437 Ga0436365_1903073 Ga0436365_1903073_1655_2602 314
212 3300041453 Ga0451797_1009375 Ga0451797_1009375_788_1783 314
213 3300041460 Ga0451802_0864319 Ga0451802_0864319_1655_2650 314
214 3300041486 Ga0451807_0250052 Ga0451807_0250052_1711_2706 314
215 3300044735 Ga0466968_0001146 Ga0466968_0001146_5207_6166 314
216 3300046458 Ga0495591_002043 Ga0495591_002043_426_1481 314
217 3300046471 Ga0495650_0000074 Ga0495650_0000074_186986_187942 314
218 3300046507 Ga0495606_0004275 Ga0495606_0004275_9867_10835 314
219 3300046507 Ga0495606_0053380 Ga0495606_0053380_896_1864 314
220 3300046530 Ga0495654_0030922 Ga0495654_0030922_1233_2201 314
221 3300046660 Ga0495625_0028250 Ga0495625_0028250_3101_4057 314
222 3300047320 Ga0495672_0070862 Ga0495672_0070862_566_1534 314
223 3300048924 Ga0496121_0117822 Ga0496121_0117822_857_1813 314
224 3300048925 Ga0496122_0040356 Ga0496122_0040356_1088_2143 314
225 3300048925 Ga0496122_0130055 Ga0496122_0130055_341_1309 314
226 3300048927 Ga0496124_0000343 Ga0496124_0000343_27728_28777 314
227 3300048927 Ga0496124_0002928 Ga0496124_0002928_5562_6530 314
228 3300048928 Ga0496125_0034181 Ga0496125_0034181_981_1937 314
229 3300048929 Ga0496126_0206978 Ga0496126_0206978_415_1371 314
230 iso_pu_bacteria 2524023250 2524611548 314
231 iso_pu_bacteria 2738541337 2739054544 314
232 3300003758 Ga0055532_1000922 Ga0055532_10009225 315
233 3300003760 Ga0055527_1000104 Ga0055527_100010410 315
234 3300003761 Ga0055535_1000218 Ga0055535_100021810 315
235 3300003762 Ga0055542_1000153 Ga0055542_100015366 315
236 3300003763 Ga0055529_1000176 Ga0055529_100017635 315
237 3300003790 Ga0055528_1015200 Ga0055528_10152002 315
238 3300015262 Ga0182007_10004378 Ga0182007_100043785 315
239 3300025228 Ga0209672_100032 Ga0209672_10003260 315
240 3300025229 Ga0209147_100012 Ga0209147_100012234 315
241 3300025242 Ga0209258_100030 Ga0209258_100030231 315
242 3300025254 Ga0209148_1000022 Ga0209148_1000022393 315
243 3300025272 Ga0209455_1000024 Ga0209455_1000024230 315
244 3300025273 Ga0209673_1000021 Ga0209673_1000021363 315
245 3300025295 Ga0209564_1012085 Ga0209564_10120853 315
246 3300027312 Ga0209371_1000767 Ga0209371_10007673 315
247 3300030500 Ga0268256_1000381 Ga0268256_100038138 315
248 3300037418 Ga0395900_0593518 Ga0395900_0593518_32_1009 315
249 3300044656 Ga0466969_0048147 Ga0466969_0048147_229_1206 315
250 3300044683 Ga0466965_0074376 Ga0466965_0074376_269_1300 315
251 3300044693 Ga0466961_0068600 Ga0466961_0068600_444_1421 315
252 3300045049 Ga0466959_0038026 Ga0466959_0038026_304_1335 315
253 3300046665 Ga0495661_0000040 Ga0495661_0000040_124316_125308 315
254 3300046794 Ga0495589_0016431 Ga0495589_0016431_17_1090 315
255 3300047319 Ga0495674_0043083 Ga0495674_0043083_1317_2288 315
256 3300047320 Ga0495672_0023150 Ga0495672_0023150_2096_3055 315
257 3300048904 Ga0496101_0004154 Ga0496101_0004154_6889_7881 315
258 3300048912 Ga0496109_0013161 Ga0496109_0013161_2025_3017 315
259 3300048916 Ga0496113_0000633 Ga0496113_0000633_13790_14782 315
260 3300048925 Ga0496122_0000279 Ga0496122_0000279_2923_3915 315
261 3300048925 Ga0496122_0012084 Ga0496122_0012084_5405_6412 315
262 3300048926 Ga0496123_0000146 Ga0496123_0000146_140106_141098 315
263 3300048926 Ga0496123_0005602 Ga0496123_0005602_7920_8927 315
264 3300048927 Ga0496124_0032533 Ga0496124_0032533_2132_3139 315
265 3300048928 Ga0496125_0009938 Ga0496125_0009938_4508_5500 315
266 iso_pu_bacteria 2545555834 2545675074 315
267 iso_pu_bacteria 2599185354 2600203907 315
268 iso_pu_bacteria 2791355253 2793280181 315
269 iso_pu_bacteria 2791355263 2793339404 315
270 iso_pu_bacteria 2863421361 2863424083 315
271 iso_pu_bacteria 2904564687 2904567237 315
272 iso_pu_bacteria 2904571731 2904574282 315
273 iso_pu_bacteria 2928536128 2928540596 315
274 iso_pu_bacteria 2995392953 2995395093 315
275 iso_pu_bacteria 641522639 641645879 315
276 iso_pu_bacteria 8020938398 8020942721 315
277 iso_pu_bacteria 8020953355 8020957728 315
278 3300003758 Ga0055532_1000337 Ga0055532_100033728 316
279 3300003760 Ga0055527_1000154 Ga0055527_100015445 316
280 3300003761 Ga0055535_1000320 Ga0055535_100032045 316
281 3300003762 Ga0055542_1003042 Ga0055542_10030422 316
282 3300005339 Ga0070660_100000808 Ga0070660_10000080824 316
283 3300005366 Ga0070659_100000012 Ga0070659_10000001285 316
284 3300005455 Ga0070663_100000530 Ga0070663_1000005308 316
285 3300005563 Ga0068855_100068316 Ga0068855_1000683162 316
286 3300005564 Ga0070664_100060423 Ga0070664_1000604233 316
287 3300005616 Ga0068852_100064479 Ga0068852_1000644792 316
288 3300006353 Ga0075370_10104724 Ga0075370_101047242 316
289 3300009093 Ga0105240_10001781 Ga0105240_100017819 316
290 3300009093 Ga0105240_10143890 Ga0105240_101438902 316
291 3300009545 Ga0105237_10030427 Ga0105237_100304275 316
292 3300009545 Ga0105237_10081269 Ga0105237_100812693 316
293 3300009551 Ga0105238_10035972 Ga0105238_100359724 316
294 3300010375 Ga0105239_10035459 Ga0105239_100354594 316
295 3300013102 Ga0157371_10016751 Ga0157371_100167514 316
296 3300013104 Ga0157370_10236176 Ga0157370_102361762 316
297 3300025228 Ga0209672_100042 Ga0209672_100042119 316
298 3300025229 Ga0209147_100052 Ga0209147_100052119 316
299 3300025242 Ga0209258_100073 Ga0209258_100073119 316
300 3300025254 Ga0209148_1000821 Ga0209148_100082116 316
301 3300025272 Ga0209455_1000324 Ga0209455_100032443 316
302 3300025909 Ga0207705_10009527 Ga0207705_100095275 316
303 3300025913 Ga0207695_10001076 Ga0207695_1000107618 316
304 3300025913 Ga0207695_10029433 Ga0207695_100294332 316
305 3300025914 Ga0207671_10018796 Ga0207671_100187961 316
306 3300025919 Ga0207657_10000013 Ga0207657_1000001367 316
307 3300025924 Ga0207694_10148721 Ga0207694_101487212 316
308 3300025932 Ga0207690_10000048 Ga0207690_1000004887 316
309 3300025945 Ga0207679_10044049 Ga0207679_100440491 316
310 3300025949 Ga0207667_10007355 Ga0207667_1000735511 316
311 3300026067 Ga0207678_10001175 Ga0207678_100011758 316
312 3300031239 Ga0265328_10016351 Ga0265328_100163513 316
313 3300034820 Ga0373959_0021938 Ga0373959_0021938_109_1110 316
314 3300035114 Ga0373939_0001752 Ga0373939_0001752_2844_3845 316
315 3300035121 Ga0373960_0039436 Ga0373960_0039436_191_1192 316
316 3300035691 Ga0373931_0009437 Ga0373931_0009437_2460_3461 316
317 3300037418 Ga0395900_0009732 Ga0395900_0009732_6712_7701 316
318 3300037418 Ga0395900_0124638 Ga0395900_0124638_1286_2278 316
319 3300037466 Ga0395898_0002817 Ga0395898_0002817_6490_7479 316
320 3300038443 Ga0395901_0000771 Ga0395901_0000771_11594_12583 316
321 3300038443 Ga0395901_0051719 Ga0395901_0051719_625_1617 316
322 3300041460 Ga0451802_0590003 Ga0451802_0590003_961_1923 316
323 3300041462 Ga0451806_273572 Ga0451806_273572_783_1745 316
324 3300041486 Ga0451807_0394883 Ga0451807_0394883_574_1536 316
325 3300044658 Ga0466972_0031098 Ga0466972_0031098_539_1507 316
326 3300044659 Ga0466973_0073639 Ga0466973_0073639_1963_2931 316
327 3300044683 Ga0466965_0002833 Ga0466965_0002833_4340_5308 316
328 3300044694 Ga0466963_0000775 Ga0466963_0000775_3768_4736 316
329 3300044719 Ga0466971_0027711 Ga0466971_0027711_158_1126 316
330 3300044735 Ga0466968_0054845 Ga0466968_0054845_609_1577 316
331 3300044842 Ga0466957_0014397 Ga0466957_0014397_801_1769 316
332 3300044842 Ga0466957_0103143 Ga0466957_0103143_647_1702 316
333 3300046471 Ga0495650_0000085 Ga0495650_0000085_141638_142612 316
334 3300046474 Ga0495605_0013342 Ga0495605_0013342_364_1338 316
335 3300046474 Ga0495605_0019640 Ga0495605_0019640_1491_2549 316
336 3300046491 Ga0495584_0004488 Ga0495584_0004488_499_1557 316
337 3300046492 Ga0495585_0044443 Ga0495585_0044443_220_1278 316
338 3300046501 Ga0495607_0010757 Ga0495607_0010757_5030_6064 316
339 3300046501 Ga0495607_0016048 Ga0495607_0016048_1667_2725 316
340 3300046506 Ga0495583_0007004 Ga0495583_0007004_4398_5432 316
341 3300046513 Ga0495616_0005239 Ga0495616_0005239_402_1460 316
342 3300046518 Ga0495631_0024247 Ga0495631_0024247_1569_2627 316
343 3300046522 Ga0495643_0155728 Ga0495643_0155728_84_1109 316
344 3300046523 Ga0495644_0020986 Ga0495644_0020986_283_1341 316
345 3300046524 Ga0495648_0001570 Ga0495648_0001570_9160_10134 316
346 3300046538 Ga0495609_0000072 Ga0495609_0000072_99087_100121 316
347 3300046538 Ga0495609_0001961 Ga0495609_0001961_1831_2805 316
348 3300046538 Ga0495609_0015067 Ga0495609_0015067_220_1278 316
349 3300046616 Ga0495668_0047650 Ga0495668_0047650_171_1229 316
350 3300046660 Ga0495625_0017507 Ga0495625_0017507_1406_2431 316
351 3300046665 Ga0495661_0035787 Ga0495661_0035787_1836_2894 316
352 3300046684 Ga0495669_0002830 Ga0495669_0002830_4550_5608 316
353 3300046794 Ga0495589_0012514 Ga0495589_0012514_1836_2894 316
354 3300046810 Ga0495660_0042271 Ga0495660_0042271_1270_2328 316
355 3300047320 Ga0495672_0001502 Ga0495672_0001502_12261_13235 316
356 3300047321 Ga0495676_0110221 Ga0495676_0110221_446_1420 316
357 3300047323 Ga0495683_0006182 Ga0495683_0006182_800_1774 316
358 3300047470 Ga0495681_0002457 Ga0495681_0002457_8438_9463 316
359 3300048091 Ga0495626_0037916 Ga0495626_0037916_173_1231 316
360 3300048907 Ga0496104_0210622 Ga0496104_0210622_237_1217 316
361 3300048915 Ga0496112_0159356 Ga0496112_0159356_142_1122 316
362 3300048920 Ga0496117_0008212 Ga0496117_0008212_6832_7794 316
363 3300048920 Ga0496117_0055217 Ga0496117_0055217_1170_2150 316
364 3300048921 Ga0496118_0002904 Ga0496118_0002904_10655_11617 316
365 3300048921 Ga0496118_0071453 Ga0496118_0071453_204_1184 316
366 3300048924 Ga0496121_0094326 Ga0496121_0094326_1211_2191 316
367 3300048927 Ga0496124_0038378 Ga0496124_0038378_3103_4119 316
368 3300048929 Ga0496126_0000890 Ga0496126_0000890_21759_22721 316
369 iso_pu_bacteria 2513237087 2513590897 316
370 iso_pu_bacteria 2519103095 2519462200 316
371 iso_pu_bacteria 2551306091 2551725300 316
372 iso_pu_bacteria 2582581311 2585294816 316
373 iso_pu_bacteria 2599185240 2599747478 316
374 iso_pu_bacteria 2599185355 2600209362 316
375 iso_pu_bacteria 2675903129 2676746090 316
376 iso_pu_bacteria 2816332253 2817258121 316
377 iso_pu_bacteria 2816332256 2817281464 316
378 iso_pu_bacteria 2816332286 2817454171 316
379 iso_pu_bacteria 2818991461 2819685061 316
380 iso_pu_bacteria 2928157003 2928158697 316
381 iso_pu_bacteria 2928163908 2928167660 316
382 iso_pu_bacteria 2981990288 2981992183 316
383 iso_pu_bacteria 641736154 642419921 316
384 iso_pu_bacteria 8005382845 8005388991 316
385 iso_pu_bacteria 8020807995 8020813680 316
386 iso_pu_bacteria 8020945358 8020952891 316
387 iso_pu_bacteria 8040167225 8040171125 316
388 iso_pu_bacteria 8040173305 8040179167 316
389 3300003758 Ga0055532_1000821 Ga0055532_10008219 317
390 3300003775 Ga0055524_1000113 Ga0055524_100011332 317
391 3300003791 Ga0055530_10002177 Ga0055530_1000217712 317
392 3300003792 Ga0055540_1000268 Ga0055540_100026847 317
393 3300003792 Ga0055540_1020546 Ga0055540_10205461 317
394 3300003794 Ga0055531_10000494 Ga0055531_1000049427 317
395 3300003794 Ga0055531_10015091 Ga0055531_100150913 317
396 3300005367 Ga0070667_100328962 Ga0070667_1003289622 317
397 3300005543 Ga0070672_100010194 Ga0070672_1000101944 317
398 3300006353 Ga0075370_10004016 Ga0075370_100040168 317
399 3300006946 Ga0079104_1000056 Ga0079104_1000056106 317
400 3300025225 Ga0209566_100442 Ga0209566_10044230 317
401 3300025226 Ga0209674_105923 Ga0209674_1059232 317
402 3300025229 Ga0209147_100046 Ga0209147_100046160 317
403 3300025273 Ga0209673_1024673 Ga0209673_10246732 317
404 3300025298 Ga0209050_1001510 Ga0209050_100151014 317
405 3300025298 Ga0209050_1002600 Ga0209050_10026003 317
406 3300025299 Ga0209256_1000049 Ga0209256_1000049227 317
407 3300025303 Ga0209051_1000029 Ga0209051_1000029249 317
408 3300025303 Ga0209051_1000196 Ga0209051_100019645 317
409 3300025304 Ga0209257_1000168 Ga0209257_100016845 317
410 3300025304 Ga0209257_1000305 Ga0209257_100030574 317
411 3300025940 Ga0207691_10026111 Ga0207691_100261112 317
412 3300025986 Ga0207658_10327777 Ga0207658_103277771 317
413 3300027111 Ga0209281_1000125 Ga0209281_1000125114 317
414 3300028794 Ga0307515_10044147 Ga0307515_100441472 317
415 3300037853 Ga0436364_0266159 Ga0436364_0266159_99_1124 317
416 3300045051 Ga0451576_0046970 Ga0451576_0046970_1307_2323 317
417 3300046459 Ga0495629_0099923 Ga0495629_0099923_548_1531 317
418 3300046500 Ga0495596_0000353 Ga0495596_0000353_16210_17229 317
419 3300046507 Ga0495606_0023312 Ga0495606_0023312_564_1634 317
420 3300046615 Ga0495656_0000081 Ga0495656_0000081_677_1678 317
421 3300046684 Ga0495669_0016202 Ga0495669_0016202_1844_2863 317
422 3300046692 Ga0495671_0067962 Ga0495671_0067962_323_1342 317
423 3300047472 Ga0495686_0000051 Ga0495686_0000051_61322_62353 317
424 3300048917 Ga0496114_0003146 Ga0496114_0003146_109_1101 317
425 3300048925 Ga0496122_0005139 Ga0496122_0005139_6682_7653 317
426 3300048926 Ga0496123_0005726 Ga0496123_0005726_7091_8062 317
427 3300048929 Ga0496126_0016491 Ga0496126_0016491_898_1869 317
428 3300050496 nmdc:mga07m45_10860_c1 nmdc:mga07m45_10860_c1_2132_3139 317
429 3300053077 Ga0495601_0046002 Ga0495601_0046002_415_1434 317
430 3300053078 Ga0495612_0081970 Ga0495612_0081970_151_1170 317
431 3300053085 Ga0495619_0011875 Ga0495619_0011875_2191_3210 317
432 3300053177 Ga0500636_0034674 Ga0500636_0034674_1459_2484 317
433 iso_pu_bacteria 2551306089 2551711956 317
434 iso_pu_bacteria 2599185239 2599734389 317
435 iso_pu_bacteria 2791355261 2793328393 317
436 iso_pu_bacteria 2818991452 2819637449 317
437 iso_pu_bacteria 2928170801 2928174532 317
438 iso_pu_bacteria 8005301065 8005303260 317
439 iso_pu_bacteria 8005688590 8005691967 317
440 iso_pu_bacteria 8018845410 8018850110 317
441 iso_pu_bacteria 8021120328 8021121453 317
442 3300003316 rootH1_10002490 rootH1_1000249016 318
443 3300003322 rootL2_10000902 rootL2_100009026 318
444 3300003771 Ga0055526_1033769 Ga0055526_10337691 318
445 3300003775 Ga0055524_1004246 Ga0055524_10042464 318
446 3300003790 Ga0055528_1000256 Ga0055528_100025620 318
447 3300025230 Ga0209563_101162 Ga0209563_1011623 318
448 3300025273 Ga0209673_1000010 Ga0209673_1000010379 318
449 3300025295 Ga0209564_1007448 Ga0209564_10074485 318
450 3300025299 Ga0209256_1002389 Ga0209256_100238914 318
451 3300039450 Ga0436363_0094623 Ga0436363_0094623_461_1468 318
452 3300044684 Ga0466966_0024442 Ga0466966_0024442_704_1714 318
453 3300046458 Ga0495591_000038 Ga0495591_000038_49538_50611 318
454 3300046491 Ga0495584_0000234 Ga0495584_0000234_25484_26557 318
455 3300049823 Ga0501044_0102610 Ga0501044_0102610_70_1134 318
456 3300061719 Ga0466962_0140248 Ga0466962_0140248_56_1063 318
457 3300061719 Ga0466962_0165628 Ga0466962_0165628_51_1061 318
458 iso_pu_bacteria 2509276021 2509391897 318
459 iso_pu_bacteria 2509276033 2509447247 318
460 iso_pu_bacteria 2510065057 2510308190 318
461 iso_pu_bacteria 2510461076 2510895511 318
462 iso_pu_bacteria 2511231052 2511500185 318
463 iso_pu_bacteria 2513237084 2513567842 318
464 iso_pu_bacteria 2513237085 2513577084 318
465 iso_pu_bacteria 2513237091 2513619865 318
466 iso_pu_bacteria 2513237093 2513633249 318
467 iso_pu_bacteria 2513237103 2513707745 318
468 iso_pu_bacteria 2513237140 2513886208 318
469 iso_pu_bacteria 2513237143 2513905845 318
470 iso_pu_bacteria 2513237162 2514018175 318
471 iso_pu_bacteria 2515075009 2515113188 318
472 iso_pu_bacteria 2515154113 2515638036 318
473 iso_pu_bacteria 2515154114 2515645795 318
474 iso_pu_bacteria 2515154116 2515655217 318
475 iso_pu_bacteria 2515154134 2515739618 318
476 iso_pu_bacteria 2516653046 2516897712 318
477 iso_pu_bacteria 2516653077 2517036850 318
478 iso_pu_bacteria 2516653085 2517077214 318
479 iso_pu_bacteria 2517093000 2517095962 318
480 iso_pu_bacteria 2517287029 2517407585 318
481 iso_pu_bacteria 2585427526 2585524641 318
482 iso_pu_bacteria 2585427528 2585538329 318
483 iso_pu_bacteria 2585427593 2585836282 318
484 iso_pu_bacteria 2718217882 2719181928 318
485 iso_pu_bacteria 2718217927 2719386540 318
486 iso_pu_bacteria 2718218009 2719732645 318
487 iso_pu_bacteria 2718218232 2720614177 318
488 iso_pu_bacteria 2718218233 2720620945 318
489 iso_pu_bacteria 2718218235 2720632269 318
490 iso_pu_bacteria 2718218269 2720775997 318
491 iso_pu_bacteria 2718218363 2721148019 318
492 iso_pu_bacteria 2718218366 2721164855 318
493 iso_pu_bacteria 2718218423 2721400244 318
494 iso_pu_bacteria 2721755514 2722841025 318
495 iso_pu_bacteria 2721755556 2723027595 318
496 iso_pu_bacteria 2721755684 2723561224 318
497 iso_pu_bacteria 2721755685 2723567847 318
498 iso_pu_bacteria 2721755809 2724039057 318
499 iso_pu_bacteria 2721755810 2724045401 318
500 iso_pu_bacteria 2721755819 2724090604 318
501 iso_pu_bacteria 2721755822 2724105112 318
502 iso_pu_bacteria 2721755823 2724110939 318
503 iso_pu_bacteria 2724679232 2725951471 318
504 iso_pu_bacteria 2728369352 2730108531 318
505 iso_pu_bacteria 2728369365 2730165163 318
506 iso_pu_bacteria 2738541333 2739032969 318
507 iso_pu_bacteria 2791355259 2793315959 318
508 iso_pu_bacteria 2791355260 2793319308 318
509 iso_pu_bacteria 2791355262 2793335349 318
510 iso_pu_bacteria 2791355264 2793347118 318
511 iso_pu_bacteria 2791355265 2793351712 318
512 iso_pu_bacteria 2791355266 2793362009 318
513 iso_pu_bacteria 2791355267 2793367763 318
514 iso_pu_bacteria 2802429606 2805932855 318
515 iso_pu_bacteria 2802429633 2806045108 318
516 iso_pu_bacteria 2802429635 2806056936 318
517 iso_pu_bacteria 2802429636 2806064317 318
518 iso_pu_bacteria 2802429637 2806071584 318
519 iso_pu_bacteria 2838016132 2838021585 318
520 iso_pu_bacteria 2838022645 2838023723 318
521 iso_pu_bacteria 2838042994 2838045097 318
522 iso_pu_bacteria 2838048938 2838053420 318
523 iso_pu_bacteria 2838061910 2838065542 318
524 iso_pu_bacteria 2838068647 2838070019 318
525 iso_pu_bacteria 2838680041 2838683326 318
526 iso_pu_bacteria 2838686498 2838686913 318
527 iso_pu_bacteria 2838694306 2838697730 318
528 iso_pu_bacteria 2838707686 2838710846 318
529 iso_pu_bacteria 2838729681 2838730129 318
530 iso_pu_bacteria 2838742623 2838742856 318
531 iso_pu_bacteria 2841851746 2841852359 318
532 iso_pu_bacteria 2841864319 2841867085 318
533 iso_pu_bacteria 2842077413 2842079019 318
534 iso_pu_bacteria 2842110456 2842113133 318
535 iso_pu_bacteria 2842118031 2842118471 318
536 iso_pu_bacteria 2842156927 2842158183 318
537 iso_pu_bacteria 2842163707 2842168658 318
538 iso_pu_bacteria 2842180545 2842181803 318
539 iso_pu_bacteria 2842198810 2842199237 318
540 iso_pu_bacteria 2842217011 2842218074 318
541 iso_pu_bacteria 2842229732 2842230147 318
542 iso_pu_bacteria 2842237096 2842240382 318
543 iso_pu_bacteria 2842243621 2842244035 318
544 iso_pu_bacteria 2842257432 2842257880 318
545 iso_pu_bacteria 2842264693 2842270830 318
546 iso_pu_bacteria 2842271015 2842271549 318
547 iso_pu_bacteria 2842291075 2842292681 318
548 iso_pu_bacteria 2842304105 2842305180 318
549 iso_pu_bacteria 2842311132 2842317060 318
550 iso_pu_bacteria 2842341865 2842347389 318
551 iso_pu_bacteria 2842363717 2842370197 318
552 iso_pu_bacteria 2842370503 2842373957 318
553 iso_pu_bacteria 2842377471 2842379079 318
554 iso_pu_bacteria 2842384541 2842384981 318
555 iso_pu_bacteria 2842395702 2842400217 318
556 iso_pu_bacteria 2842422224 2842423633 318
557 iso_pu_bacteria 2842428310 2842434713 318
558 iso_pu_bacteria 2842434925 2842441091 318
559 iso_pu_bacteria 2842441272 2842447709 318
560 iso_pu_bacteria 2842447887 2842449422 318
561 iso_pu_bacteria 2842462802 2842469074 318
562 iso_pu_bacteria 2842469257 2842475638 318
563 iso_pu_bacteria 2842495871 2842496621 318
564 iso_pu_bacteria 2844454524 2844458210 318
565 iso_pu_bacteria 2855825444 2855830368 318
566 iso_pu_bacteria 2855839649 2855845853 318
567 iso_pu_bacteria 2857516855 2857517295 318
568 iso_pu_bacteria 2858800743 2858805253 318
569 iso_pu_bacteria 2896384573 2896390652 318
570 iso_pu_bacteria 2915986958 2915989298 318
571 iso_pu_bacteria 2915993759 2915995483 318
572 iso_pu_bacteria 2916007675 2916012565 318
573 iso_pu_bacteria 2916014648 2916019219 318
574 iso_pu_bacteria 2916021584 2916026127 318
575 iso_pu_bacteria 2916035215 2916037241 318
576 iso_pu_bacteria 2916041962 2916047821 318
577 iso_pu_bacteria 2916048683 2916053865 318
578 iso_pu_bacteria 2921201388 2921202557 318
579 iso_pu_bacteria 2921208531 2921214074 318
580 iso_pu_bacteria 2921237296 2921241701 318
581 iso_pu_bacteria 2921244191 2921249683 318
582 iso_pu_bacteria 2921282425 2921284971 318
583 iso_pu_bacteria 2921296804 2921297483 318
584 iso_pu_bacteria 2924144063 2924144300 318
585 iso_pu_bacteria 2924150972 2924151515 318
586 iso_pu_bacteria 2924158325 2924159393 318
587 iso_pu_bacteria 2924193448 2924196694 318
588 iso_pu_bacteria 2924200457 2924201248 318
589 iso_pu_bacteria 2924207177 2924212446 318
590 iso_pu_bacteria 2924228884 2924233623 318
591 iso_pu_bacteria 2933570622 2933570987 318
592 iso_pu_bacteria 2933586486 2933588810 318
593 iso_pu_bacteria 2933599457 2933600825 318
594 iso_pu_bacteria 2935894831 2935896884 318
595 iso_pu_bacteria 2935901341 2935901820 318
596 iso_pu_bacteria 2936367885 2936371905 318
597 iso_pu_bacteria 2936375103 2936379740 318
598 iso_pu_bacteria 2936381700 2936387486 318
599 iso_pu_bacteria 2937002841 2937007811 318
600 iso_pu_bacteria 2937009748 2937014663 318
601 iso_pu_bacteria 2937016420 2937020142 318
602 iso_pu_bacteria 2937049772 2937051608 318
603 iso_pu_bacteria 2937056579 2937059488 318
604 iso_pu_bacteria 2937063883 2937067397 318
605 iso_pu_bacteria 2937091812 2937096347 318
606 iso_pu_bacteria 2937098957 2937105794 318
607 iso_pu_bacteria 2937106411 2937108978 318
608 iso_pu_bacteria 2937113482 2937116897 318
609 iso_pu_bacteria 2937119839 2937124883 318
610 iso_pu_bacteria 2957382221 2957385460 318
611 iso_pu_bacteria 2957402308 2957405972 318
612 iso_pu_bacteria 2957415311 2957418720 318
613 iso_pu_bacteria 2957422303 2957424407 318
614 iso_pu_bacteria 2957430029 2957430207 318
615 iso_pu_bacteria 2957450854 2957455142 318
616 iso_pu_bacteria 2957457609 2957460089 318
617 iso_pu_bacteria 2957464669 2957464917 318
618 iso_pu_bacteria 2957471148 2957475318 318
619 iso_pu_bacteria 2957484790 2957490399 318
620 iso_pu_bacteria 2957491536 2957492289 318
621 iso_pu_bacteria 2960584000 2960590701 318
622 iso_pu_bacteria 2960597568 2960601345 318
623 iso_pu_bacteria 2960603979 2960606284 318
624 iso_pu_bacteria 2960610863 2960616011 318
625 iso_pu_bacteria 2960617483 2960623675 318
626 iso_pu_bacteria 2960637947 2960643994 318
627 iso_pu_bacteria 2960652885 2960658468 318
628 iso_pu_bacteria 2960667422 2960672485 318
629 iso_pu_bacteria 2960687367 2960691683 318
630 iso_pu_bacteria 2964607997 2964610346 318
631 iso_pu_bacteria 2964621998 2964624508 318
632 iso_pu_bacteria 2964636051 2964642184 318
633 iso_pu_bacteria 2964643177 2964649666 318
634 iso_pu_bacteria 2964649959 2964655723 318
635 iso_pu_bacteria 2964656573 2964661199 318
636 iso_pu_bacteria 2964663802 2964669554 318
637 iso_pu_bacteria 2964670856 2964670887 318
638 iso_pu_bacteria 2964678106 2964681941 318
639 iso_pu_bacteria 2964685014 2964690302 318
640 iso_pu_bacteria 2964691889 2964695019 318
641 iso_pu_bacteria 2964698721 2964704260 318
642 iso_pu_bacteria 2964712639 2964713741 318
643 iso_pu_bacteria 2964719344 2964725340 318
644 iso_pu_bacteria 2967664464 2967666066 318
645 iso_pu_bacteria 2967671571 2967675113 318
646 iso_pu_bacteria 2967678726 2967685414 318
647 iso_pu_bacteria 2967693043 2967694218 318
648 iso_pu_bacteria 2967699805 2967700402 318
649 iso_pu_bacteria 2967714385 2967716017 318
650 iso_pu_bacteria 2967721400 2967727048 318
651 iso_pu_bacteria 2967735183 2967739763 318
652 iso_pu_bacteria 2967742019 2967745345 318
653 iso_pu_bacteria 2967748971 2967750324 318
654 iso_pu_bacteria 2967762386 2967767458 318
655 iso_pu_bacteria 2967769361 2967770144 318
656 iso_pu_bacteria 2970019648 2970019893 318
657 iso_pu_bacteria 2970033650 2970037397 318
658 iso_pu_bacteria 2970040964 2970043143 318
659 iso_pu_bacteria 2970047711 2970050226 318
660 iso_pu_bacteria 2970054988 2970060625 318
661 iso_pu_bacteria 2970061556 2970064365 318
662 iso_pu_bacteria 2970068827 2970072707 318
663 iso_pu_bacteria 2970076120 2970076608 318
664 iso_pu_bacteria 2970082768 2970087439 318
665 iso_pu_bacteria 2970088815 2970095175 318
666 iso_pu_bacteria 2970109326 2970114088 318
667 iso_pu_bacteria 2970116247 2970119947 318
668 iso_pu_bacteria 2970129317 2970130853 318
669 iso_pu_bacteria 2970149975 2970154835 318
670 iso_pu_bacteria 2970156795 2970158203 318
671 iso_pu_bacteria 2970164137 2970165241 318
672 iso_pu_bacteria 2970170962 2970175309 318
673 iso_pu_bacteria 2970184632 2970184815 318
674 iso_pu_bacteria 2977516862 2977523023 318
675 iso_pu_bacteria 2977523885 2977524311 318
676 iso_pu_bacteria 2977537788 2977539241 318
677 iso_pu_bacteria 2977551784 2977558797 318
678 iso_pu_bacteria 2977558990 2977564202 318
679 iso_pu_bacteria 2977565890 2977571163 318
680 iso_pu_bacteria 2977572785 2977576826 318
681 iso_pu_bacteria 2977579622 2977580571 318
682 iso_pu_bacteria 2996893221 2996895013 318
683 iso_pu_bacteria 639633055 639649309 318
684 iso_pu_bacteria 648276728 648738534 318
685 iso_pu_bacteria 8003992118 8003997652 318
686 iso_pu_bacteria 8005275841 8005281344 318
687 iso_pu_bacteria 8005282627 8005284684 318
688 iso_pu_bacteria 8005289223 8005295650 318
689 iso_pu_bacteria 8005307578 8005309527 318
690 iso_pu_bacteria 8005376324 8005381061 318
691 iso_pu_bacteria 8005430974 8005437414 318
692 iso_pu_bacteria 8005460587 8005463871 318
693 iso_pu_bacteria 8005497431 8005501028 318
694 iso_pu_bacteria 8005556819 8005556886 318
695 iso_pu_bacteria 8005563573 8005568130 318
696 iso_pu_bacteria 8005570704 8005573329 318
697 iso_pu_bacteria 8005619151 8005622395 318
698 iso_pu_bacteria 8005626139 8005629895 318
699 iso_pu_bacteria 8005668836 8005672445 318
700 iso_pu_bacteria 8005695170 8005697538 318
701 iso_pu_bacteria 8018163183 8018164440 318
702 iso_pu_bacteria 8018176218 8018176920 318
703 iso_pu_bacteria 8023680758 8023683033 318
704 iso_pu_bacteria 8024479707 8024482735 318
705 iso_pu_bacteria 8039098773 8039100099 318
706 iso_pu_bacteria 8056375014 8056378270 318
707 iso_pu_bacteria 8056382006 8056384288 318
708 iso_pu_bacteria 8057874678 8057878450 318
709 3300003316 rootH1_10154918 rootH1_101549181 319
710 3300021327 Ga0214543_1009579 Ga0214543_100957918 319
711 3300021384 Ga0213876_10035238 Ga0213876_100352383 319
712 3300025258 Ga0209129_1000252 Ga0209129_100025248 319
713 3300025294 Ga0209025_1002551 Ga0209025_100255114 319
714 3300025294 Ga0209025_1004772 Ga0209025_10047726 319
715 3300027111 Ga0209281_1001633 Ga0209281_100163316 319
716 3300048909 Ga0496106_0087170 Ga0496106_0087170_162_1166 319
717 3300048924 Ga0496121_0056235 Ga0496121_0056235_1098_2102 319
718 3300048925 Ga0496122_0075124 Ga0496122_0075124_173_1177 319
719 3300048926 Ga0496123_0049229 Ga0496123_0049229_194_1198 319
720 iso_pu_bacteria 2512047086 2512532903 319
721 iso_pu_bacteria 2515154107 2515611381 319
722 iso_pu_bacteria 2524023207 2524453632 319
723 iso_pu_bacteria 2643221568 2643856664 319
724 iso_pu_bacteria 2852387548 2852390386 319
725 iso_pu_bacteria 2920760137 2920765944 319
726 iso_pu_bacteria 2936996657 2936997986 319
727 iso_pu_bacteria 2984587000 2984590102 319
728 iso_pu_bacteria 8046767195 8046771812 319
729 iso_pu_bacteria 8057575449 8057575570 319
730 3300003320 rootH2_10104606 rootH2_101046064 320
731 3300005548 Ga0070665_100174378 Ga0070665_1001743781 320
732 3300046507 Ga0495606_0003262 Ga0495606_0003262_10345_11313 320
733 3300047472 Ga0495686_0001880 Ga0495686_0001880_4385_5371 320
734 3300047472 Ga0495686_0145844 Ga0495686_0145844_169_1137 320
735 3300047472 Ga0495686_0187695 Ga0495686_0187695_163_1131 320
736 3300049571 Ga0501034_0537780 Ga0501034_0537780_20_985 320
737 iso_pu_bacteria 2510917022 2511136751 320
738 iso_pu_bacteria 2510917030 2511199160 320
739 iso_pu_bacteria 2582581298 2585222990 320
740 iso_pu_bacteria 2582581307 2585271259 320
741 iso_pu_bacteria 2585427529 2585545573 320
742 iso_pu_bacteria 2585427531 2585559004 320
743 iso_pu_bacteria 2585427609 2585904049 320
744 iso_pu_bacteria 2585428125 2587980833 320
745 iso_pu_bacteria 2842509118 2842510972 320
746 iso_pu_bacteria 2919100787 2919106326 320
747 iso_pu_bacteria 3005445848 3005448585 320
748 3300003187 JGI25151J46595_10003303 JGI25151J46595_100033037 321
749 3300006881 Ga0068865_100023745 Ga0068865_1000237453 321
750 3300037471 Ga0395905_0003242 Ga0395905_0003242_3826_4842 321
751 3300041505 Ga0451849_1051639 Ga0451849_1051639_133_1161 321
752 3300053133 Ga0500655_024233 Ga0500655_024233_111_1079 321
753 iso_pu_bacteria 2582581308 2585279197 321
754 iso_pu_bacteria 2582581315 2585323200 321
755 iso_pu_bacteria 2582581316 2585331305 321
756 iso_pu_bacteria 2585427527 2585531318 321
757 iso_pu_bacteria 2585427530 2585552759 321
758 iso_pu_bacteria 2615840626 2616311364 321
759 iso_pu_bacteria 2615840698 2616554378 321
760 iso_pu_bacteria 2617270742 2617383681 321
761 iso_pu_bacteria 2667528174 2671111300 321
762 iso_pu_bacteria 2818991453 2819641423 321
763 iso_pu_bacteria 2838029111 2838033679 321
764 iso_pu_bacteria 2842475841 2842480426 321
765 iso_pu_bacteria 2842482326 2842483942 321
766 iso_pu_bacteria 2842502639 2842505353 321
767 iso_pu_bacteria 2919408235 2919410131 321
768 iso_pu_bacteria 8005682033 8005682760 321
769 3300003187 JGI25151J46595_10001000 JGI25151J46595_1000100016 322
770 3300003215 JGI25153J46596_10005805 JGI25153J46596_100058055 322
771 3300003323 rootH1_10073995 rootH1_100739955 322
772 3300003771 Ga0055526_1007492 Ga0055526_10074926 322
773 3300003771 Ga0055526_1008391 Ga0055526_10083912 322
774 3300003790 Ga0055528_1001003 Ga0055528_100100317 322
775 3300003790 Ga0055528_1020168 Ga0055528_10201681 322
776 3300003792 Ga0055540_1004141 Ga0055540_10041414 322
777 3300003792 Ga0055540_1016808 Ga0055540_10168082 322
778 3300006038 Ga0075365_10008493 Ga0075365_100084932 322
779 3300006048 Ga0075363_100018898 Ga0075363_1000188984 322
780 3300006177 Ga0075362_10007517 Ga0075362_100075172 322
781 3300006186 Ga0075369_10005897 Ga0075369_100058971 322
782 3300006195 Ga0075366_10003422 Ga0075366_100034226 322
783 3300006353 Ga0075370_10048128 Ga0075370_100481283 322
784 3300009094 Ga0111539_10076168 Ga0111539_100761683 322
785 3300009765 Ga0123341_1000028 Ga0123341_100002831 322
786 3300009766 Ga0123342_1028435 Ga0123342_10284353 322
787 3300013105 Ga0157369_10111065 Ga0157369_101110652 322
788 3300025245 Ga0207425_1001479 Ga0207425_10014792 322
789 3300025258 Ga0209129_1018814 Ga0209129_10188142 322
790 3300025273 Ga0209673_1000025 Ga0209673_1000025305 322
791 3300025273 Ga0209673_1001232 Ga0209673_10012322 322
792 3300025273 Ga0209673_1004332 Ga0209673_10043325 322
793 3300025273 Ga0209673_1007335 Ga0209673_10073352 322
794 3300025291 Ga0209675_1028059 Ga0209675_10280592 322
795 3300025292 Ga0209676_1025937 Ga0209676_10259372 322
796 3300025294 Ga0209025_1000091 Ga0209025_100009132 322
797 3300025295 Ga0209564_1000644 Ga0209564_100064458 322
798 3300025295 Ga0209564_1000883 Ga0209564_100088332 322
799 3300025297 Ga0209758_1001343 Ga0209758_10013436 322
800 3300025297 Ga0209758_1001396 Ga0209758_10013965 322
801 3300025298 Ga0209050_1019579 Ga0209050_10195792 322
802 3300025299 Ga0209256_1000924 Ga0209256_100092412 322
803 3300025299 Ga0209256_1023488 Ga0209256_10234882 322
804 3300025303 Ga0209051_1000400 Ga0209051_100040039 322
805 3300025303 Ga0209051_1006706 Ga0209051_10067062 322
806 3300025303 Ga0209051_1035357 Ga0209051_10353572 322
807 3300025304 Ga0209257_1001180 Ga0209257_100118010 322
808 3300028794 Ga0307515_10021842 Ga0307515_1002184210 322
809 3300037471 Ga0395905_0000836 Ga0395905_0000836_19070_20086 322
810 3300041491 Ga0451833_0097459 Ga0451833_0097459_1169_2200 322
811 3300041494 Ga0451837_0500608 Ga0451837_0500608_39_1070 322
812 3300041494 Ga0451837_1125556 Ga0451837_1125556_299_1330 322
813 3300041509 Ga0451843_0511692 Ga0451843_0511692_600_1631 322
814 3300041512 Ga0451853_1537113 Ga0451853_1537113_567_1598 322
815 3300046501 Ga0495607_0012593 Ga0495607_0012593_2574_3605 322
816 3300046506 Ga0495583_0037583 Ga0495583_0037583_401_1432 322
817 3300046512 Ga0495610_0035819 Ga0495610_0035819_238_1269 322
818 3300046513 Ga0495616_0054958 Ga0495616_0054958_930_1961 322
819 3300046515 Ga0495620_0021011 Ga0495620_0021011_1464_2495 322
820 3300046517 Ga0495630_0320565 Ga0495630_0320565_115_1098 322
821 3300046518 Ga0495631_0034272 Ga0495631_0034272_1020_2051 322
822 3300046519 Ga0495632_0051326 Ga0495632_0051326_189_1220 322
823 3300046522 Ga0495643_0003546 Ga0495643_0003546_2084_3115 322
824 3300046538 Ga0495609_0047265 Ga0495609_0047265_18_1049 322
825 3300046542 Ga0495597_0010430 Ga0495597_0010430_2345_3376 322
826 3300046616 Ga0495668_0177093 Ga0495668_0177093_88_1119 322
827 3300046648 Ga0495611_0046262 Ga0495611_0046262_53_1084 322
828 3300046660 Ga0495625_0083670 Ga0495625_0083670_1081_2112 322
829 3300046691 Ga0495670_0036221 Ga0495670_0036221_196_1227 322
830 3300047323 Ga0495683_0102248 Ga0495683_0102248_166_1197 322
831 3300047472 Ga0495686_0016214 Ga0495686_0016214_2330_3361 322
832 3300048091 Ga0495626_0022835 Ga0495626_0022835_629_1660 322
833 3300048909 Ga0496106_0006670 Ga0496106_0006670_4417_5442 322
834 3300048921 Ga0496118_0013144 Ga0496118_0013144_4580_5608 322
835 3300050489 nmdc:mga03683_2591_c1 nmdc:mga03683_2591_c1_145_1167 322
836 3300050492 nmdc:mga0yw44_4173_c1 nmdc:mga0yw44_4173_c1_1064_2095 322
837 3300050494 nmdc:mga06z11_67015_c1 nmdc:mga06z11_67015_c1_460_1482 322
838 3300050496 nmdc:mga07m45_3201_c1 nmdc:mga07m45_3201_c1_4282_5304 322
839 3300050496 nmdc:mga07m45_42767_c1 nmdc:mga07m45_42767_c1_1353_2384 322
840 3300050511 nmdc:mga08y16_185363_c1 nmdc:mga08y16_185363_c1_83_1135 322
841 3300050516 nmdc:mga0sz30_12277_c1 nmdc:mga0sz30_12277_c1_872_1903 322
842 3300053109 Ga0500569_001663 Ga0500569_001663_1728_2759 322
843 3300053134 Ga0500658_0005036 Ga0500658_0005036_3304_4428 322
844 3300053134 Ga0500658_0006626 Ga0500658_0006626_851_1876 322
845 3300053139 Ga0500568_0003502 Ga0500568_0003502_4619_5644 322
846 3300053156 Ga0500622_0014724 Ga0500622_0014724_179_1210 322
847 3300053158 Ga0500627_0036194 Ga0500627_0036194_159_1190 322
848 3300053160 Ga0500633_0000648 Ga0500633_0000648_513_1538 322
849 iso_pu_bacteria 2718218365 2721159470 322
850 iso_pu_bacteria 2728369397 2730299102 322
851 3300002987 JGI25159J45721_1001256 JGI25159J45721_10012562 323
852 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001492 323
853 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001265 323
854 3300004625 Ga0055543_1000003 Ga0055543_1000003281 323
855 3300005262 Ga0065165_1000335 Ga0065165_100033542 323
856 3300025284 Ga0209130_1000003 Ga0209130_1000003282 323
857 3300025302 Ga0207426_1000011 Ga0207426_1000011493 323
858 3300031251 Ga0265327_10007500 Ga0265327_100075003 323
859 3300042007 Ga0439449_0019623 Ga0439449_0019623_478_1521 323
860 3300046522 Ga0495643_0023729 Ga0495643_0023729_1713_2696 323
861 3300048922 Ga0496119_0135895 Ga0496119_0135895_304_1287 323
862 3300048924 Ga0496121_0043649 Ga0496121_0043649_866_1849 323
863 3300048928 Ga0496125_0104313 Ga0496125_0104313_565_1548 323
864 3300002739 JGI25158J39367_1000019 JGI25158J39367_100001942 324
865 3300002773 JGI25152J39213_1008101 JGI25152J39213_10081013 324
866 3300002773 JGI25152J39213_1009714 JGI25152J39213_10097143 324
867 3300002987 JGI25159J45721_1000393 JGI25159J45721_100039312 324
868 3300003187 JGI25151J46595_10027236 JGI25151J46595_100272363 324
869 3300003215 JGI25153J46596_10001757 JGI25153J46596_100017575 324
870 3300003374 JGI25161J50226_1000068 JGI25161J50226_100006866 324
871 3300003771 Ga0055526_1001546 Ga0055526_100154612 324
872 3300003775 Ga0055524_1002336 Ga0055524_10023362 324
873 3300003790 Ga0055528_1001848 Ga0055528_10018484 324
874 3300003792 Ga0055540_1010129 Ga0055540_10101292 324
875 3300004625 Ga0055543_1000470 Ga0055543_100047016 324
876 3300005262 Ga0065165_1006900 Ga0065165_10069004 324
877 3300005353 Ga0070669_100100499 Ga0070669_1001004992 324
878 3300006353 Ga0075370_10084033 Ga0075370_100840331 324
879 3300025208 Ga0209436_100070 Ga0209436_10007014 324
880 3300025245 Ga0207425_1012055 Ga0207425_10120552 324
881 3300025258 Ga0209129_1002985 Ga0209129_10029852 324
882 3300025284 Ga0209130_1000020 Ga0209130_1000020118 324
883 3300025294 Ga0209025_1016097 Ga0209025_10160972 324
884 3300025295 Ga0209564_1000588 Ga0209564_100058824 324
885 3300025297 Ga0209758_1001217 Ga0209758_10012175 324
886 3300025297 Ga0209758_1018413 Ga0209758_10184133 324
887 3300025297 Ga0209758_1018414 Ga0209758_10184143 324
888 3300025299 Ga0209256_1011242 Ga0209256_10112422 324
889 3300025302 Ga0207426_1000008 Ga0207426_1000008187 324
890 3300025303 Ga0209051_1004736 Ga0209051_10047368 324
891 3300047443 Ga0495687_053514 Ga0495687_053514_700_1686 324
892 3300048921 Ga0496118_0041646 Ga0496118_0041646_1740_2768 324
893 3300048924 Ga0496121_0017363 Ga0496121_0017363_3133_4158 324
894 3300048924 Ga0496121_0081336 Ga0496121_0081336_1330_2358 324
895 3300048925 Ga0496122_0039175 Ga0496122_0039175_1747_2775 324
896 3300048926 Ga0496123_0016107 Ga0496123_0016107_3154_4182 324
897 3300048927 Ga0496124_0123284 Ga0496124_0123284_976_2001 324
898 3300050516 nmdc:mga0sz30_90334_c1 nmdc:mga0sz30_90334_c1_81_1109 324
899 3300053156 Ga0500622_0003787 Ga0500622_0003787_5759_6784 324
900 3300001979 JGI24740J21852_10000491 JGI24740J21852_1000049115 325
901 3300002704 JGI25155J39150_1000044 JGI25155J39150_100004486 325
902 3300002705 JGI25156J39149_1000058 JGI25156J39149_10000585 325
903 3300002737 JGI25162J39368_1001111 JGI25162J39368_100111110 325
904 3300002738 JGI25154J39366_1000236 JGI25154J39366_10002365 325
905 3300002741 JGI25157J39369_1000078 JGI25157J39369_10000785 325
906 3300003214 JGI25165J46597_1002105 JGI25165J46597_10021056 325
907 3300003214 JGI25165J46597_1006815 JGI25165J46597_10068152 325
908 3300009545 Ga0105237_10001251 Ga0105237_100012513 325
909 3300010375 Ga0105239_10179572 Ga0105239_101795722 325
910 3300013104 Ga0157370_10000248 Ga0157370_1000024836 325
911 3300015262 Ga0182007_10003611 Ga0182007_100036115 325
912 3300025206 Ga0209435_100054 Ga0209435_10005489 325
913 3300025233 Ga0209437_100098 Ga0209437_10009839 325
914 3300025246 Ga0209646_1000170 Ga0209646_100017089 325
915 3300025250 Ga0209026_1000193 Ga0209026_100019389 325
916 3300025256 Ga0209759_1000222 Ga0209759_100022289 325
917 3300025261 Ga0209233_1000095 Ga0209233_1000095156 325
918 3300025261 Ga0209233_1000148 Ga0209233_10001486 325
919 3300025913 Ga0207695_10000037 Ga0207695_10000037389 325
920 3300025914 Ga0207671_10004383 Ga0207671_100043835 325
921 3300025949 Ga0207667_10038463 Ga0207667_100384634 325
922 3300026041 Ga0207639_10205790 Ga0207639_102057902 325
923 3300027312 Ga0209371_1007474 Ga0209371_10074741 325
924 3300028379 Ga0268266_10071099 Ga0268266_100710992 325
925 3300030500 Ga0268256_1034045 Ga0268256_10340451 325
926 3300044765 Ga0466970_0004290 Ga0466970_0004290_3580_4569 325
927 3300044842 Ga0466957_0007192 Ga0466957_0007192_1973_2962 325
928 3300045836 Ga0466958_0112472 Ga0466958_0112472_695_1684 325
929 3300048903 Ga0496100_0094115 Ga0496100_0094115_823_1863 325
930 3300048904 Ga0496101_0014663 Ga0496101_0014663_2475_3515 325
931 3300048905 Ga0496102_0021862 Ga0496102_0021862_412_1452 325
932 3300048906 Ga0496103_0032993 Ga0496103_0032993_158_1198 325
933 3300048916 Ga0496113_0016669 Ga0496113_0016669_558_1598 325
934 3300048919 Ga0496116_0044240 Ga0496116_0044240_316_1356 325
935 3300048920 Ga0496117_0023913 Ga0496117_0023913_18_995 325
936 3300048921 Ga0496118_0029235 Ga0496118_0029235_18_995 325
937 3300048922 Ga0496119_0014493 Ga0496119_0014493_545_1585 325
938 3300048923 Ga0496120_0007629 Ga0496120_0007629_3632_4672 325
939 3300048924 Ga0496121_0011982 Ga0496121_0011982_3755_4795 325
940 3300048926 Ga0496123_0021444 Ga0496123_0021444_3555_4595 325
941 3300048926 Ga0496123_0053468 Ga0496123_0053468_1620_2609 325
942 3300048927 Ga0496124_0028074 Ga0496124_0028074_3767_4807 325
943 3300048927 Ga0496124_0055799 Ga0496124_0055799_634_1623 325
944 3300048928 Ga0496125_0030997 Ga0496125_0030997_192_1232 325
945 3300053125 Ga0500618_002324 Ga0500618_002324_2442_3431 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

43

264

0.77

PF13460

NAD_binding_10

NAD(P)H-binding

47

209

0.77

PF05368

NmrA

NmrA-like family

43

154

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
5f5l-assembly1.cif.gz_A the structure of monooxygenase ksta11 in the biosynthetic pathway of kosinostatin 0.8353 8 314
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8304 8 318
4yra-assembly6.cif.gz_I mouse tdh in the apo form 0.8303 8 317
3m2p-assembly2.cif.gz_C the crystal structure of udp-n-acetylglucosamine 4-epimerase from bacillus cereus 0.8222 8 318
4yra-assembly6.cif.gz_I mouse tdh in the apo form 0.8197 8 317
ID Description Score Start End Superfamily
af_A0A1D6I798_6_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9014 8 82 3.40.50.720
af_I1KG15_128_276_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8834 7 104 3.40.50.720
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8826 7 104 3.40.50.20
af_A0A1D6GVM8_196_300_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8686 5 105 3.40.50.20
af_A0A0P0VRA9_18_110_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8416 4 82 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A346YN02-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9875 8 324 GO:0004029
GO:0005737
AF-N6UCK9-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9771 1 325 GO:0004029
GO:0005737
AF-A3RSK7-F1-model_v4 deleted 0.977 3 322
AF-N6UCK9-F1-model_v4 NAD-dependent epimerase/dehydratase 0.9741 1 325 GO:0004029
GO:0005737
AF-A0A829MUP5-F1-model_v4 deleted 0.9734 8 325

Feature Viewer

pLDDT pTM Quality
89.11 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map