F486271
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 939 | 237 | 1878 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10157805|rootL2_101578053 |
| Length | 106 |
| Sequence | MAIYPSRLRSRGSVGDLVMHRVHDWVGRKDRHPVAVDAIVQRADGSTSPAKVTNCSEEGCRLESDEDFRIGERLQIAIPRMGQMKAQVRWTVPGGAGAKFLVESDF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 5 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 6 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 7 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 8 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 9 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 47 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 105 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 175 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 176 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 177 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 186 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 187 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 188 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 190 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 194 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 195 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 196 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 197 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 198 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 199 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 200 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 201 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 202 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 203 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 204 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 205 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 219 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 220 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 225 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 226 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 227 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 228 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 233 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 234 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 235 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 236 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 237 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.36 |
| Metatranscriptomes | 0.64 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 2.56 |
| Rhizosphere | 96.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10157805 | 3300003322 | Bacteria | 1313 |
| 2 | JGI24736J21556_1073555 | 3300001904 | Unclassified | 534 |
| 3 | JGI24741J21665_1041917 | 3300001915 | Bacteria | 675 |
| 4 | JGI24752J21851_1031047 | 3300001976 | Bacteria | 705 |
| 5 | JGI24740J21852_10020550 | 3300001979 | Bacteria | 2301 |
| 6 | JGI24740J21852_10178487 | 3300001979 | Unclassified | 526 |
| 7 | JGI24739J22299_10006992 | 3300001989 | Bacteria | 4249 |
| 8 | JGI24739J22299_10016475 | 3300001989 | Bacteria | 2673 |
| 9 | JGI24737J22298_10000702 | 3300001990 | Bacteria | 11769 |
| 10 | JGI24737J22298_10002055 | 3300001990 | Bacteria | 7201 |
| 11 | JGI24737J22298_10010330 | 3300001990 | Bacteria | 3083 |
| 12 | JGI24737J22298_10024149 | 3300001990 | Bacteria | 1926 |
| 13 | JGI24737J22298_10242731 | 3300001990 | Unclassified | 532 |
| 14 | JGI24735J21928_10011641 | 3300002067 | Bacteria | 2787 |
| 15 | JGI24735J21928_10081923 | 3300002067 | Bacteria | 924 |
| 16 | JGI24735J21928_10095118 | 3300002067 | Bacteria | 855 |
| 17 | JGI24735J21928_10170704 | 3300002067 | Bacteria | 629 |
| 18 | JGI24745J21846_1025547 | 3300002073 | Bacteria | 703 |
| 19 | JGI24744J21845_10000004 | 3300002077 | Bacteria | 25863 |
| 20 | rootL2_10214130 | 3300003322 | Bacteria | 1363 |
| 21 | rootH1_10208980 | 3300003323 | Bacteria | 1796 |
| 22 | rootH1_10227087 | 3300003323 | Bacteria | 1127 |
| 23 | Ga0065712_10527711 | 3300005290 | Bacteria | 631 |
| 24 | Ga0065715_10847934 | 3300005293 | Bacteria | 592 |
| 25 | Ga0070658_10000360 | 3300005327 | Bacteria | 39619 |
| 26 | Ga0070658_10010794 | 3300005327 | Bacteria | 7322 |
| 27 | Ga0070658_10011538 | 3300005327 | Bacteria | 7087 |
| 28 | Ga0070658_10054773 | 3300005327 | Bacteria | 3238 |
| 29 | Ga0070658_10089314 | 3300005327 | Bacteria | 2537 |
| 30 | Ga0070658_10093510 | 3300005327 | Bacteria | 2480 |
| 31 | Ga0070658_10105720 | 3300005327 | Bacteria | 2329 |
| 32 | Ga0070658_10259916 | 3300005327 | Bacteria | 1474 |
| 33 | Ga0070658_10269979 | 3300005327 | Bacteria | 1446 |
| 34 | Ga0070658_10456954 | 3300005327 | Bacteria | 1101 |
| 35 | Ga0070658_10471825 | 3300005327 | Bacteria | 1082 |
| 36 | Ga0070658_10476802 | 3300005327 | Bacteria | 1076 |
| 37 | Ga0070658_10732803 | 3300005327 | Unclassified | 858 |
| 38 | Ga0070658_10742259 | 3300005327 | Unclassified | 852 |
| 39 | Ga0070658_10867335 | 3300005327 | Unclassified | 785 |
| 40 | Ga0070658_10906644 | 3300005327 | Unclassified | 766 |
| 41 | Ga0070658_11388505 | 3300005327 | Unclassified | 609 |
| 42 | Ga0070658_11681546 | 3300005327 | Unclassified | 549 |
| 43 | Ga0070676_10444421 | 3300005328 | Bacteria | 910 |
| 44 | Ga0070676_11177824 | 3300005328 | Unclassified | 582 |
| 45 | Ga0070683_100011780 | 3300005329 | Bacteria | 7573 |
| 46 | Ga0070683_100019038 | 3300005329 | Bacteria | 6091 |
| 47 | Ga0070683_100093059 | 3300005329 | Bacteria | 2831 |
| 48 | Ga0070683_100996313 | 3300005329 | Bacteria | 804 |
| 49 | Ga0070690_100007577 | 3300005330 | Bacteria | 6215 |
| 50 | Ga0070690_100168977 | 3300005330 | Bacteria | 1504 |
| 51 | Ga0070690_100334765 | 3300005330 | Bacteria | 1094 |
| 52 | Ga0070670_100068941 | 3300005331 | Bacteria | 3036 |
| 53 | Ga0070670_100078790 | 3300005331 | Bacteria | 2831 |
| 54 | Ga0070670_100098556 | 3300005331 | Bacteria | 2515 |
| 55 | Ga0070670_100176639 | 3300005331 | Bacteria | 1853 |
| 56 | Ga0070670_100473686 | 3300005331 | Bacteria | 1111 |
| 57 | Ga0070670_100670483 | 3300005331 | Bacteria | 931 |
| 58 | Ga0070670_101353379 | 3300005331 | Unclassified | 652 |
| 59 | Ga0070677_10038663 | 3300005333 | Bacteria | 1869 |
| 60 | Ga0068869_100021048 | 3300005334 | Bacteria | 4483 |
| 61 | Ga0070666_10001622 | 3300005335 | Bacteria | 13683 |
| 62 | Ga0070666_10003180 | 3300005335 | Bacteria | 9977 |
| 63 | Ga0070666_10056745 | 3300005335 | Bacteria | 2645 |
| 64 | Ga0070666_10129081 | 3300005335 | Bacteria | 1756 |
| 65 | Ga0070666_10399007 | 3300005335 | Bacteria | 989 |
| 66 | Ga0070666_10700866 | 3300005335 | Unclassified | 742 |
| 67 | Ga0070680_100002423 | 3300005336 | Bacteria | 13822 |
| 68 | Ga0070680_100002971 | 3300005336 | Bacteria | 12608 |
| 69 | Ga0070680_100085008 | 3300005336 | Bacteria | 2613 |
| 70 | Ga0070680_100374080 | 3300005336 | Bacteria | 1212 |
| 71 | Ga0070680_100681729 | 3300005336 | Bacteria | 884 |
| 72 | Ga0070680_101243546 | 3300005336 | Bacteria | 644 |
| 73 | Ga0070682_100031502 | 3300005337 | Bacteria | 3208 |
| 74 | Ga0070682_100056715 | 3300005337 | Bacteria | 2465 |
| 75 | Ga0070682_100878345 | 3300005337 | Unclassified | 735 |
| 76 | Ga0068868_100002897 | 3300005338 | Bacteria | 11908 |
| 77 | Ga0068868_100101780 | 3300005338 | Bacteria | 2325 |
| 78 | Ga0068868_100176966 | 3300005338 | Bacteria | 1768 |
| 79 | Ga0068868_102089420 | 3300005338 | Bacteria | 539 |
| 80 | Ga0070660_100000075 | 3300005339 | Bacteria | 59407 |
| 81 | Ga0070660_100019365 | 3300005339 | Bacteria | 4986 |
| 82 | Ga0070660_100079835 | 3300005339 | Bacteria | 2567 |
| 83 | Ga0070660_100095850 | 3300005339 | Bacteria | 2345 |
| 84 | Ga0070660_100122059 | 3300005339 | Bacteria | 2080 |
| 85 | Ga0070660_100177331 | 3300005339 | Unclassified | 1724 |
| 86 | Ga0070660_100181443 | 3300005339 | Bacteria | 1703 |
| 87 | Ga0070660_100272554 | 3300005339 | Unclassified | 1383 |
| 88 | Ga0070660_100554343 | 3300005339 | Bacteria | 959 |
| 89 | Ga0070660_100680497 | 3300005339 | Bacteria | 862 |
| 90 | Ga0070660_100695355 | 3300005339 | Bacteria | 852 |
| 91 | Ga0070660_100751509 | 3300005339 | Bacteria | 819 |
| 92 | Ga0070660_101393287 | 3300005339 | Bacteria | 595 |
| 93 | Ga0070660_101461774 | 3300005339 | Bacteria | 581 |
| 94 | Ga0070660_101577294 | 3300005339 | Bacteria | 558 |
| 95 | Ga0070689_101167696 | 3300005340 | Bacteria | 690 |
| 96 | Ga0070687_100226249 | 3300005343 | Bacteria | 1149 |
| 97 | Ga0070661_100000273 | 3300005344 | Bacteria | 41798 |
| 98 | Ga0070661_100018410 | 3300005344 | Bacteria | 4964 |
| 99 | Ga0070661_100027213 | 3300005344 | Bacteria | 4116 |
| 100 | Ga0070661_100117784 | 3300005344 | Unclassified | 1987 |
| 101 | Ga0070661_100141897 | 3300005344 | Unclassified | 1811 |
| 102 | Ga0070661_100167807 | 3300005344 | Bacteria | 1666 |
| 103 | Ga0070661_100201887 | 3300005344 | Bacteria | 1519 |
| 104 | Ga0070661_100220454 | 3300005344 | Bacteria | 1455 |
| 105 | Ga0070661_100244692 | 3300005344 | Bacteria | 1382 |
| 106 | Ga0070661_100271526 | 3300005344 | Unclassified | 1313 |
| 107 | Ga0070661_100890236 | 3300005344 | Bacteria | 734 |
| 108 | Ga0070692_10079658 | 3300005345 | Bacteria | 1762 |
| 109 | Ga0070669_100168378 | 3300005353 | Bacteria | 1707 |
| 110 | Ga0070675_100471179 | 3300005354 | Bacteria | 1128 |
| 111 | Ga0070671_100025722 | 3300005355 | Bacteria | 4832 |
| 112 | Ga0070671_100043305 | 3300005355 | Bacteria | 3741 |
| 113 | Ga0070671_100173762 | 3300005355 | Bacteria | 1822 |
| 114 | Ga0070671_100176990 | 3300005355 | Bacteria | 1805 |
| 115 | Ga0070671_100350740 | 3300005355 | Unclassified | 1259 |
| 116 | Ga0070671_100495666 | 3300005355 | Bacteria | 1050 |
| 117 | Ga0070671_101554429 | 3300005355 | Unclassified | 586 |
| 118 | Ga0070674_100013394 | 3300005356 | Bacteria | 5068 |
| 119 | Ga0070674_100044299 | 3300005356 | Bacteria | 3033 |
| 120 | Ga0070674_100123457 | 3300005356 | Bacteria | 1920 |
| 121 | Ga0070674_100585159 | 3300005356 | Bacteria | 941 |
| 122 | Ga0070673_100031710 | 3300005364 | Bacteria | 3970 |
| 123 | Ga0070673_100051318 | 3300005364 | Bacteria | 3230 |
| 124 | Ga0070673_100117383 | 3300005364 | Unclassified | 2214 |
| 125 | Ga0070673_101055081 | 3300005364 | Bacteria | 758 |
| 126 | Ga0070673_101477173 | 3300005364 | Bacteria | 641 |
| 127 | Ga0070659_100000084 | 3300005366 | Bacteria | 71138 |
| 128 | Ga0070659_100016687 | 3300005366 | Bacteria | 5515 |
| 129 | Ga0070659_100027551 | 3300005366 | Bacteria | 4379 |
| 130 | Ga0070659_100049784 | 3300005366 | Bacteria | 3295 |
| 131 | Ga0070659_100205816 | 3300005366 | Unclassified | 1621 |
| 132 | Ga0070659_100296122 | 3300005366 | Unclassified | 1348 |
| 133 | Ga0070659_100310888 | 3300005366 | Unclassified | 1316 |
| 134 | Ga0070659_100353558 | 3300005366 | Bacteria | 1233 |
| 135 | Ga0070659_100374327 | 3300005366 | Bacteria | 1199 |
| 136 | Ga0070659_100469987 | 3300005366 | Bacteria | 1069 |
| 137 | Ga0070659_100477484 | 3300005366 | Bacteria | 1060 |
| 138 | Ga0070659_100705080 | 3300005366 | Bacteria | 873 |
| 139 | Ga0070659_100753702 | 3300005366 | Bacteria | 845 |
| 140 | Ga0070659_101127211 | 3300005366 | Bacteria | 692 |
| 141 | Ga0070659_101257257 | 3300005366 | Bacteria | 656 |
| 142 | Ga0070659_101466206 | 3300005366 | Unclassified | 607 |
| 143 | Ga0070659_101832268 | 3300005366 | Unclassified | 544 |
| 144 | Ga0070667_100001607 | 3300005367 | Bacteria | 20221 |
| 145 | Ga0070667_100007596 | 3300005367 | Bacteria | 8991 |
| 146 | Ga0070667_100057710 | 3300005367 | Bacteria | 3282 |
| 147 | Ga0070667_100180681 | 3300005367 | Bacteria | 1865 |
| 148 | Ga0070667_100450066 | 3300005367 | Bacteria | 1177 |
| 149 | Ga0070667_100507830 | 3300005367 | Unclassified | 1105 |
| 150 | Ga0070709_10092501 | 3300005434 | Bacteria | 1998 |
| 151 | Ga0070709_10490972 | 3300005434 | Bacteria | 931 |
| 152 | Ga0070714_100059708 | 3300005435 | Bacteria | 3271 |
| 153 | Ga0070714_100098855 | 3300005435 | Bacteria | 2568 |
| 154 | Ga0070714_100136374 | 3300005435 | Bacteria | 2198 |
| 155 | Ga0070714_100255451 | 3300005435 | Bacteria | 1622 |
| 156 | Ga0070714_100381215 | 3300005435 | Bacteria | 1329 |
| 157 | Ga0070714_101254985 | 3300005435 | Bacteria | 723 |
| 158 | Ga0070713_100150083 | 3300005436 | Bacteria | 2072 |
| 159 | Ga0070713_100266651 | 3300005436 | Bacteria | 1567 |
| 160 | Ga0070713_101247285 | 3300005436 | Bacteria | 720 |
| 161 | Ga0070710_10769517 | 3300005437 | Bacteria | 685 |
| 162 | Ga0070701_10376754 | 3300005438 | Bacteria | 893 |
| 163 | Ga0070663_100008206 | 3300005455 | Bacteria | 6411 |
| 164 | Ga0070663_100014657 | 3300005455 | Bacteria | 5037 |
| 165 | Ga0070663_100026523 | 3300005455 | Bacteria | 3926 |
| 166 | Ga0070663_100043601 | 3300005455 | Bacteria | 3158 |
| 167 | Ga0070663_100088422 | 3300005455 | Bacteria | 2291 |
| 168 | Ga0070663_102049139 | 3300005455 | Unclassified | 515 |
| 169 | Ga0070678_100036760 | 3300005456 | Bacteria | 3431 |
| 170 | Ga0070678_100745354 | 3300005456 | Bacteria | 886 |
| 171 | Ga0070678_102175269 | 3300005456 | Bacteria | 526 |
| 172 | Ga0070662_100000058 | 3300005457 | Bacteria | 59818 |
| 173 | Ga0070662_100030923 | 3300005457 | Bacteria | 3752 |
| 174 | Ga0070662_100031111 | 3300005457 | Bacteria | 3742 |
| 175 | Ga0070662_100059087 | 3300005457 | Bacteria | 2793 |
| 176 | Ga0070662_100188902 | 3300005457 | Bacteria | 1628 |
| 177 | Ga0070662_100192113 | 3300005457 | Bacteria | 1615 |
| 178 | Ga0070662_100369156 | 3300005457 | Unclassified | 1179 |
| 179 | Ga0070662_100471841 | 3300005457 | Unclassified | 1044 |
| 180 | Ga0070662_100650140 | 3300005457 | Bacteria | 889 |
| 181 | Ga0070662_100716849 | 3300005457 | Bacteria | 847 |
| 182 | Ga0070681_10427285 | 3300005458 | Bacteria | 1237 |
| 183 | Ga0070681_10499370 | 3300005458 | Bacteria | 1130 |
| 184 | Ga0070681_10521852 | 3300005458 | Bacteria | 1101 |
| 185 | Ga0070681_11069930 | 3300005458 | Bacteria | 727 |
| 186 | Ga0068867_100019316 | 3300005459 | Bacteria | 4857 |
| 187 | Ga0068867_100024987 | 3300005459 | Bacteria | 4284 |
| 188 | Ga0068867_100168634 | 3300005459 | Bacteria | 1732 |
| 189 | Ga0070685_10395986 | 3300005466 | Unclassified | 955 |
| 190 | Ga0070679_100137586 | 3300005530 | Bacteria | 2423 |
| 191 | Ga0070679_100158330 | 3300005530 | Bacteria | 2239 |
| 192 | Ga0070679_100202800 | 3300005530 | Unclassified | 1949 |
| 193 | Ga0070679_100302323 | 3300005530 | Bacteria | 1550 |
| 194 | Ga0070679_100501670 | 3300005530 | Bacteria | 1157 |
| 195 | Ga0070679_100980781 | 3300005530 | Bacteria | 789 |
| 196 | Ga0070679_101308722 | 3300005530 | Unclassified | 670 |
| 197 | Ga0070679_102026760 | 3300005530 | Unclassified | 525 |
| 198 | Ga0070684_100075442 | 3300005535 | Bacteria | 2974 |
| 199 | Ga0070684_100942783 | 3300005535 | Unclassified | 809 |
| 200 | Ga0070684_101146842 | 3300005535 | Bacteria | 731 |
| 201 | Ga0070684_101548157 | 3300005535 | Unclassified | 625 |
| 202 | Ga0068853_100000223 | 3300005539 | Bacteria | 40165 |
| 203 | Ga0068853_100020340 | 3300005539 | Bacteria | 5519 |
| 204 | Ga0068853_100022536 | 3300005539 | Bacteria | 5260 |
| 205 | Ga0068853_100071374 | 3300005539 | Bacteria | 3024 |
| 206 | Ga0068853_100083913 | 3300005539 | Bacteria | 2791 |
| 207 | Ga0068853_100242620 | 3300005539 | Bacteria | 1652 |
| 208 | Ga0068853_101714885 | 3300005539 | Unclassified | 609 |
| 209 | Ga0068853_102008914 | 3300005539 | Unclassified | 561 |
| 210 | Ga0068853_102136845 | 3300005539 | Bacteria | 543 |
| 211 | Ga0070672_100056132 | 3300005543 | Bacteria | 3087 |
| 212 | Ga0070672_100073704 | 3300005543 | Bacteria | 2721 |
| 213 | Ga0070672_100146801 | 3300005543 | Bacteria | 1949 |
| 214 | Ga0070686_100023854 | 3300005544 | Bacteria | 3662 |
| 215 | Ga0070686_100405969 | 3300005544 | Bacteria | 1037 |
| 216 | Ga0070696_100817735 | 3300005546 | Bacteria | 768 |
| 217 | Ga0070693_100002223 | 3300005547 | Bacteria | 8916 |
| 218 | Ga0070665_100079149 | 3300005548 | Bacteria | 3293 |
| 219 | Ga0070665_100099738 | 3300005548 | Bacteria | 2908 |
| 220 | Ga0070665_100228969 | 3300005548 | Bacteria | 1859 |
| 221 | Ga0070665_100443637 | 3300005548 | Bacteria | 1307 |
| 222 | Ga0068855_100004348 | 3300005563 | Bacteria | 17327 |
| 223 | Ga0068855_100023983 | 3300005563 | Bacteria | 7304 |
| 224 | Ga0068855_100039869 | 3300005563 | Bacteria | 5575 |
| 225 | Ga0068855_100116987 | 3300005563 | Bacteria | 3055 |
| 226 | Ga0068855_100147289 | 3300005563 | Plasmid | 2679 |
| 227 | Ga0068855_100213675 | 3300005563 | Unclassified | 2166 |
| 228 | Ga0068855_100313019 | 3300005563 | Bacteria | 1737 |
| 229 | Ga0068855_100320342 | 3300005563 | Unclassified | 1714 |
| 230 | Ga0068855_101376758 | 3300005563 | Unclassified | 728 |
| 231 | Ga0070664_100000032 | 3300005564 | Bacteria | 88298 |
| 232 | Ga0070664_100015597 | 3300005564 | Bacteria | 6217 |
| 233 | Ga0070664_100050167 | 3300005564 | Bacteria | 3531 |
| 234 | Ga0070664_100135378 | 3300005564 | Bacteria | 2166 |
| 235 | Ga0070664_100484632 | 3300005564 | Unclassified | 1138 |
| 236 | Ga0070664_100789200 | 3300005564 | Unclassified | 888 |
| 237 | Ga0070664_100829024 | 3300005564 | Bacteria | 865 |
| 238 | Ga0068857_100012095 | 3300005577 | Bacteria | 7505 |
| 239 | Ga0068857_100076016 | 3300005577 | Bacteria | 2994 |
| 240 | Ga0068857_100139794 | 3300005577 | Unclassified | 2188 |
| 241 | Ga0068857_101023700 | 3300005577 | Bacteria | 795 |
| 242 | Ga0068857_101137918 | 3300005577 | Bacteria | 754 |
| 243 | Ga0068857_101165179 | 3300005577 | Bacteria | 746 |
| 244 | Ga0068857_101470018 | 3300005577 | Bacteria | 664 |
| 245 | Ga0068854_100049084 | 3300005578 | Bacteria | 3014 |
| 246 | Ga0068854_100074313 | 3300005578 | Bacteria | 2493 |
| 247 | Ga0068854_100125183 | 3300005578 | Bacteria | 1956 |
| 248 | Ga0068854_100579092 | 3300005578 | Bacteria | 956 |
| 249 | Ga0068854_100586567 | 3300005578 | Bacteria | 950 |
| 250 | Ga0068854_100770055 | 3300005578 | Bacteria | 836 |
| 251 | Ga0068854_101101403 | 3300005578 | Unclassified | 707 |
| 252 | Ga0068854_101395462 | 3300005578 | Unclassified | 633 |
| 253 | Ga0068856_100000161 | 3300005614 | Bacteria | 69696 |
| 254 | Ga0068856_100035924 | 3300005614 | Bacteria | 4858 |
| 255 | Ga0068856_100067469 | 3300005614 | Bacteria | 3535 |
| 256 | Ga0068856_100074140 | 3300005614 | Bacteria | 3369 |
| 257 | Ga0068856_100182382 | 3300005614 | Bacteria | 2113 |
| 258 | Ga0068856_100250923 | 3300005614 | Bacteria | 1784 |
| 259 | Ga0068856_100297808 | 3300005614 | Bacteria | 1630 |
| 260 | Ga0068856_100347423 | 3300005614 | Unclassified | 1502 |
| 261 | Ga0068856_100487969 | 3300005614 | Bacteria | 1253 |
| 262 | Ga0068856_100632855 | 3300005614 | Bacteria | 1090 |
| 263 | Ga0068856_102147130 | 3300005614 | Bacteria | 568 |
| 264 | Ga0070702_100087052 | 3300005615 | Bacteria | 1886 |
| 265 | Ga0070702_100208902 | 3300005615 | Bacteria | 1298 |
| 266 | Ga0068852_100002629 | 3300005616 | Bacteria | 12411 |
| 267 | Ga0068852_100004056 | 3300005616 | Bacteria | 10303 |
| 268 | Ga0068852_100006769 | 3300005616 | Bacteria | 8317 |
| 269 | Ga0068852_100007392 | 3300005616 | Bacteria | 8016 |
| 270 | Ga0068852_100012497 | 3300005616 | Bacteria | 6450 |
| 271 | Ga0068852_100013368 | 3300005616 | Bacteria | 6283 |
| 272 | Ga0068852_100019632 | 3300005616 | Bacteria | 5355 |
| 273 | Ga0068852_100019960 | 3300005616 | Bacteria | 5320 |
| 274 | Ga0068852_100142492 | 3300005616 | Bacteria | 2219 |
| 275 | Ga0068852_100159246 | 3300005616 | Unclassified | 2106 |
| 276 | Ga0068852_100227897 | 3300005616 | Bacteria | 1775 |
| 277 | Ga0068852_100251125 | 3300005616 | Bacteria | 1695 |
| 278 | Ga0068852_100306136 | 3300005616 | Bacteria | 1540 |
| 279 | Ga0068852_100447613 | 3300005616 | Unclassified | 1278 |
| 280 | Ga0068852_101335113 | 3300005616 | Unclassified | 739 |
| 281 | Ga0068852_102571436 | 3300005616 | Unclassified | 529 |
| 282 | Ga0068859_100108019 | 3300005617 | Bacteria | 2844 |
| 283 | Ga0068859_100124699 | 3300005617 | Bacteria | 2644 |
| 284 | Ga0068859_100838576 | 3300005617 | Bacteria | 1006 |
| 285 | Ga0068859_101176912 | 3300005617 | Unclassified | 844 |
| 286 | Ga0068864_100143306 | 3300005618 | Bacteria | 2157 |
| 287 | Ga0068864_100313760 | 3300005618 | Bacteria | 1471 |
| 288 | Ga0068864_101240976 | 3300005618 | Bacteria | 745 |
| 289 | Ga0068866_10003449 | 3300005718 | Bacteria | 6470 |
| 290 | Ga0068866_10006265 | 3300005718 | Bacteria | 4951 |
| 291 | Ga0068866_10030919 | 3300005718 | Plasmid | 2574 |
| 292 | Ga0068866_10281867 | 3300005718 | Bacteria | 1030 |
| 293 | Ga0068861_100220678 | 3300005719 | Bacteria | 1602 |
| 294 | Ga0068851_10054608 | 3300005834 | Bacteria | 2035 |
| 295 | Ga0068851_10141711 | 3300005834 | Bacteria | 1308 |
| 296 | Ga0068851_10204961 | 3300005834 | Bacteria | 1102 |
| 297 | Ga0068851_10230832 | 3300005834 | Unclassified | 1043 |
| 298 | Ga0068851_10967504 | 3300005834 | Bacteria | 536 |
| 299 | Ga0068870_10041427 | 3300005840 | Bacteria | 2393 |
| 300 | Ga0068863_100007726 | 3300005841 | Bacteria | 10514 |
| 301 | Ga0068863_100009099 | 3300005841 | Bacteria | 9696 |
| 302 | Ga0068863_100594432 | 3300005841 | Bacteria | 1095 |
| 303 | Ga0068863_101655714 | 3300005841 | Unclassified | 649 |
| 304 | Ga0068858_100001074 | 3300005842 | Bacteria | 28281 |
| 305 | Ga0068858_100017888 | 3300005842 | Bacteria | 6638 |
| 306 | Ga0068858_100022059 | 3300005842 | Bacteria | 5946 |
| 307 | Ga0068858_100742978 | 3300005842 | Bacteria | 956 |
| 308 | Ga0068860_100052156 | 3300005843 | Bacteria | 3891 |
| 309 | Ga0068862_100361771 | 3300005844 | Bacteria | 1349 |
| 310 | Ga0081539_10022578 | 3300005985 | Bacteria | 4157 |
| 311 | Ga0081539_10088500 | 3300005985 | Bacteria | 1606 |
| 312 | Ga0070717_10207669 | 3300006028 | Bacteria | 1718 |
| 313 | Ga0070715_10092585 | 3300006163 | Bacteria | 1394 |
| 314 | Ga0070716_100012739 | 3300006173 | Bacteria | 4269 |
| 315 | Ga0075366_10269574 | 3300006195 | Bacteria | 1040 |
| 316 | Ga0097621_100006259 | 3300006237 | Bacteria | 8445 |
| 317 | Ga0097621_100246967 | 3300006237 | Bacteria | 1562 |
| 318 | Ga0068871_100096674 | 3300006358 | Bacteria | 2468 |
| 319 | Ga0068871_100119204 | 3300006358 | Bacteria | 2227 |
| 320 | Ga0068871_102108658 | 3300006358 | Unclassified | 537 |
| 321 | Ga0068871_102231530 | 3300006358 | Unclassified | 522 |
| 322 | Ga0068865_100007849 | 3300006881 | Bacteria | 6583 |
| 323 | Ga0068865_100159066 | 3300006881 | Bacteria | 1721 |
| 324 | Ga0068865_100241026 | 3300006881 | Bacteria | 1423 |
| 325 | Ga0068865_101882989 | 3300006881 | Unclassified | 541 |
| 326 | Ga0097620_100108023 | 3300006931 | Bacteria | 2844 |
| 327 | Ga0097620_100124702 | 3300006931 | Bacteria | 2644 |
| 328 | Ga0097620_100838638 | 3300006931 | Bacteria | 1006 |
| 329 | Ga0097620_101176473 | 3300006931 | Unclassified | 844 |
| 330 | Ga0105240_10017996 | 3300009093 | Bacteria | 9505 |
| 331 | Ga0105240_10130001 | 3300009093 | Bacteria | 3021 |
| 332 | Ga0105240_10156342 | 3300009093 | Bacteria | 2711 |
| 333 | Ga0105240_10616388 | 3300009093 | Unclassified | 1193 |
| 334 | Ga0105240_11017219 | 3300009093 | Unclassified | 885 |
| 335 | Ga0105240_11501579 | 3300009093 | Bacteria | 706 |
| 336 | Ga0105245_10033030 | 3300009098 | Bacteria | 4583 |
| 337 | Ga0105245_10486365 | 3300009098 | Bacteria | 1248 |
| 338 | Ga0105245_10525659 | 3300009098 | Bacteria | 1202 |
| 339 | Ga0105247_11719539 | 3300009101 | Unclassified | 519 |
| 340 | Ga0105243_10048795 | 3300009148 | Bacteria | 3338 |
| 341 | Ga0105243_10213010 | 3300009148 | Bacteria | 1702 |
| 342 | Ga0105243_10680607 | 3300009148 | Bacteria | 1000 |
| 343 | Ga0105241_10099640 | 3300009174 | Bacteria | 2308 |
| 344 | Ga0105241_10328602 | 3300009174 | Bacteria | 1321 |
| 345 | Ga0105241_11402902 | 3300009174 | Bacteria | 669 |
| 346 | Ga0105241_11423647 | 3300009174 | Bacteria | 664 |
| 347 | Ga0105241_12407296 | 3300009174 | Unclassified | 526 |
| 348 | Ga0105242_10612672 | 3300009176 | Bacteria | 1053 |
| 349 | Ga0105242_11300085 | 3300009176 | Bacteria | 751 |
| 350 | Ga0105248_10000223 | 3300009177 | Bacteria | 65010 |
| 351 | Ga0105248_10004318 | 3300009177 | Bacteria | 15721 |
| 352 | Ga0105248_10050541 | 3300009177 | Bacteria | 4663 |
| 353 | Ga0105248_11836065 | 3300009177 | Unclassified | 688 |
| 354 | Ga0105248_12103673 | 3300009177 | Bacteria | 642 |
| 355 | Ga0105237_10177130 | 3300009545 | Bacteria | 2133 |
| 356 | Ga0105237_10289176 | 3300009545 | Bacteria | 1642 |
| 357 | Ga0105237_12627037 | 3300009545 | Bacteria | 514 |
| 358 | Ga0105238_10019233 | 3300009551 | Bacteria | 6957 |
| 359 | Ga0105238_10022229 | 3300009551 | Bacteria | 6465 |
| 360 | Ga0105238_10026989 | 3300009551 | Bacteria | 5854 |
| 361 | Ga0105238_10168750 | 3300009551 | Unclassified | 2164 |
| 362 | Ga0105238_10287025 | 3300009551 | Bacteria | 1627 |
| 363 | Ga0105238_10482207 | 3300009551 | Unclassified | 1239 |
| 364 | Ga0105238_10590124 | 3300009551 | Unclassified | 1118 |
| 365 | Ga0105249_10198291 | 3300009553 | Bacteria | 1963 |
| 366 | Ga0105239_10113502 | 3300010375 | Bacteria | 3005 |
| 367 | Ga0105239_10408587 | 3300010375 | Bacteria | 1537 |
| 368 | Ga0105239_10675252 | 3300010375 | Unclassified | 1180 |
| 369 | Ga0105239_10893376 | 3300010375 | Bacteria | 1020 |
| 370 | Ga0105246_10113306 | 3300011119 | Bacteria | 1997 |
| 371 | Ga0105246_10218958 | 3300011119 | Bacteria | 1491 |
| 372 | Ga0157373_10010901 | 3300013100 | Bacteria | 6691 |
| 373 | Ga0157373_10012891 | 3300013100 | Bacteria | 6138 |
| 374 | Ga0157373_10028480 | 3300013100 | Bacteria | 4030 |
| 375 | Ga0157373_10063659 | 3300013100 | Bacteria | 2611 |
| 376 | Ga0157373_10179651 | 3300013100 | Bacteria | 1490 |
| 377 | Ga0157373_10202368 | 3300013100 | Unclassified | 1400 |
| 378 | Ga0157373_10235423 | 3300013100 | Bacteria | 1294 |
| 379 | Ga0157373_10377730 | 3300013100 | Bacteria | 1013 |
| 380 | Ga0157373_10716279 | 3300013100 | Unclassified | 734 |
| 381 | Ga0157373_10762035 | 3300013100 | Bacteria | 712 |
| 382 | Ga0157373_11093559 | 3300013100 | Unclassified | 598 |
| 383 | Ga0157373_11422584 | 3300013100 | Unclassified | 528 |
| 384 | Ga0157371_10003769 | 3300013102 | Bacteria | 13567 |
| 385 | Ga0157371_10061528 | 3300013102 | Bacteria | 2662 |
| 386 | Ga0157371_10062405 | 3300013102 | Bacteria | 2642 |
| 387 | Ga0157371_10090271 | 3300013102 | Bacteria | 2171 |
| 388 | Ga0157371_10122297 | 3300013102 | Bacteria | 1851 |
| 389 | Ga0157371_10155451 | 3300013102 | Bacteria | 1632 |
| 390 | Ga0157371_10260999 | 3300013102 | Bacteria | 1249 |
| 391 | Ga0157371_10304461 | 3300013102 | Bacteria | 1154 |
| 392 | Ga0157371_11062292 | 3300013102 | Bacteria | 620 |
| 393 | Ga0157371_11110508 | 3300013102 | Unclassified | 607 |
| 394 | Ga0157370_10023267 | 3300013104 | Bacteria | 6153 |
| 395 | Ga0157370_10034226 | 3300013104 | Bacteria | 4949 |
| 396 | Ga0157370_10239913 | 3300013104 | Bacteria | 1677 |
| 397 | Ga0157370_10275822 | 3300013104 | Bacteria | 1554 |
| 398 | Ga0157370_10292751 | 3300013104 | Bacteria | 1504 |
| 399 | Ga0157370_10299069 | 3300013104 | Bacteria | 1486 |
| 400 | Ga0157370_10326277 | 3300013104 | Unclassified | 1415 |
| 401 | Ga0157370_10363149 | 3300013104 | Bacteria | 1334 |
| 402 | Ga0157370_10540770 | 3300013104 | Unclassified | 1068 |
| 403 | Ga0157370_10743072 | 3300013104 | Bacteria | 894 |
| 404 | Ga0157370_10987785 | 3300013104 | Unclassified | 762 |
| 405 | Ga0157370_11125365 | 3300013104 | Bacteria | 709 |
| 406 | Ga0157370_11273941 | 3300013104 | Bacteria | 663 |
| 407 | Ga0157369_10021714 | 3300013105 | Bacteria | 7180 |
| 408 | Ga0157369_10033184 | 3300013105 | Bacteria | 5675 |
| 409 | Ga0157369_10042136 | 3300013105 | Bacteria | 4981 |
| 410 | Ga0157369_10072075 | 3300013105 | Bacteria | 3708 |
| 411 | Ga0157369_10100004 | 3300013105 | Bacteria | 3091 |
| 412 | Ga0157369_10157715 | 3300013105 | Bacteria | 2396 |
| 413 | Ga0157369_10292231 | 3300013105 | Bacteria | 1696 |
| 414 | Ga0157369_10323601 | 3300013105 | Bacteria | 1603 |
| 415 | Ga0157369_10338801 | 3300013105 | Bacteria | 1562 |
| 416 | Ga0157369_10515872 | 3300013105 | Unclassified | 1236 |
| 417 | Ga0157369_10744503 | 3300013105 | Unclassified | 1008 |
| 418 | Ga0157369_10762021 | 3300013105 | Bacteria | 995 |
| 419 | Ga0157369_11475581 | 3300013105 | Unclassified | 692 |
| 420 | Ga0157369_12097503 | 3300013105 | Bacteria | 573 |
| 421 | Ga0157374_10005747 | 3300013296 | Bacteria | 10467 |
| 422 | Ga0157374_10228306 | 3300013296 | Bacteria | 1828 |
| 423 | Ga0157374_10284170 | 3300013296 | Bacteria | 1634 |
| 424 | Ga0157374_10869068 | 3300013296 | Bacteria | 919 |
| 425 | Ga0157374_11766701 | 3300013296 | Unclassified | 643 |
| 426 | Ga0157374_12026576 | 3300013296 | Bacteria | 602 |
| 427 | Ga0157374_12587223 | 3300013296 | Unclassified | 535 |
| 428 | Ga0157374_12590908 | 3300013296 | Unclassified | 535 |
| 429 | Ga0157374_12931003 | 3300013296 | Unclassified | 504 |
| 430 | Ga0157378_10007118 | 3300013297 | Bacteria | 9768 |
| 431 | Ga0157378_10507491 | 3300013297 | Bacteria | 1205 |
| 432 | Ga0157378_10520546 | 3300013297 | Unclassified | 1191 |
| 433 | Ga0163162_10366564 | 3300013306 | Bacteria | 1574 |
| 434 | Ga0163162_10894240 | 3300013306 | Bacteria | 1001 |
| 435 | Ga0163162_11090113 | 3300013306 | Bacteria | 905 |
| 436 | Ga0163162_13382643 | 3300013306 | Bacteria | 509 |
| 437 | Ga0157372_10006912 | 3300013307 | Bacteria | 12075 |
| 438 | Ga0157372_10249641 | 3300013307 | Bacteria | 2059 |
| 439 | Ga0157372_10273795 | 3300013307 | Bacteria | 1962 |
| 440 | Ga0157372_10277428 | 3300013307 | Bacteria | 1949 |
| 441 | Ga0157372_10367128 | 3300013307 | Unclassified | 1677 |
| 442 | Ga0157372_10486348 | 3300013307 | Bacteria | 1439 |
| 443 | Ga0157372_10597325 | 3300013307 | Unclassified | 1286 |
| 444 | Ga0157372_10696224 | 3300013307 | Bacteria | 1182 |
| 445 | Ga0157372_11145974 | 3300013307 | Bacteria | 899 |
| 446 | Ga0157372_11212212 | 3300013307 | Bacteria | 872 |
| 447 | Ga0157375_10193331 | 3300013308 | Bacteria | 2190 |
| 448 | Ga0157375_10743264 | 3300013308 | Unclassified | 1133 |
| 449 | Ga0157375_13013432 | 3300013308 | Bacteria | 562 |
| 450 | Ga0163163_10000567 | 3300014325 | Bacteria | 32441 |
| 451 | Ga0163163_10008571 | 3300014325 | Bacteria | 9090 |
| 452 | Ga0163163_10062428 | 3300014325 | Bacteria | 3692 |
| 453 | Ga0182008_10767755 | 3300014497 | Bacteria | 557 |
| 454 | Ga0157377_10019379 | 3300014745 | Bacteria | 3553 |
| 455 | Ga0157377_10065979 | 3300014745 | Bacteria | 2080 |
| 456 | Ga0157377_10582915 | 3300014745 | Bacteria | 795 |
| 457 | Ga0157379_10024931 | 3300014968 | Bacteria | 5308 |
| 458 | Ga0157379_10239101 | 3300014968 | Bacteria | 1647 |
| 459 | Ga0157379_10533428 | 3300014968 | Unclassified | 1090 |
| 460 | Ga0157376_10020068 | 3300014969 | Bacteria | 5163 |
| 461 | Ga0157376_11336599 | 3300014969 | Bacteria | 747 |
| 462 | Ga0163161_10269952 | 3300017792 | Bacteria | 1331 |
| 463 | Ga0197907_10478957 | 3300020069 | Bacteria | 1621 |
| 464 | Ga0206356_11572649 | 3300020070 | Bacteria | 726 |
| 465 | Ga0206354_10208199 | 3300020081 | Bacteria | 1084 |
| 466 | Ga0206353_10572295 | 3300020082 | Bacteria | 2354 |
| 467 | Ga0206353_11031360 | 3300020082 | Unclassified | 801 |
| 468 | Ga0154015_1465743 | 3300020610 | Unclassified | 823 |
| 469 | Ga0207697_10003778 | 3300025315 | Bacteria | 7394 |
| 470 | Ga0207697_10059208 | 3300025315 | Bacteria | 1591 |
| 471 | Ga0207697_10307896 | 3300025315 | Bacteria | 703 |
| 472 | Ga0207656_10023908 | 3300025321 | Bacteria | 2465 |
| 473 | Ga0207656_10138408 | 3300025321 | Bacteria | 1146 |
| 474 | Ga0207656_10335238 | 3300025321 | Unclassified | 753 |
| 475 | Ga0207682_10036179 | 3300025893 | Bacteria | 1997 |
| 476 | Ga0207692_10787831 | 3300025898 | Bacteria | 621 |
| 477 | Ga0207642_10042844 | 3300025899 | Bacteria | 1992 |
| 478 | Ga0207642_10278569 | 3300025899 | Unclassified | 961 |
| 479 | Ga0207688_10254581 | 3300025901 | Bacteria | 1064 |
| 480 | Ga0207680_10000287 | 3300025903 | Bacteria | 24123 |
| 481 | Ga0207680_10041730 | 3300025903 | Bacteria | 2680 |
| 482 | Ga0207680_10236971 | 3300025903 | Bacteria | 1256 |
| 483 | Ga0207680_10552436 | 3300025903 | Unclassified | 822 |
| 484 | Ga0207647_10003794 | 3300025904 | Bacteria | 11294 |
| 485 | Ga0207647_10008997 | 3300025904 | Bacteria | 7115 |
| 486 | Ga0207647_10019349 | 3300025904 | Bacteria | 4581 |
| 487 | Ga0207647_10023074 | 3300025904 | Unclassified | 4121 |
| 488 | Ga0207647_10045629 | 3300025904 | Bacteria | 2733 |
| 489 | Ga0207647_10066456 | 3300025904 | Bacteria | 2186 |
| 490 | Ga0207647_10066970 | 3300025904 | Bacteria | 2177 |
| 491 | Ga0207647_10070721 | 3300025904 | Bacteria | 2107 |
| 492 | Ga0207647_10163392 | 3300025904 | Unclassified | 1298 |
| 493 | Ga0207647_10231201 | 3300025904 | Bacteria | 1064 |
| 494 | Ga0207685_10152897 | 3300025905 | Bacteria | 1046 |
| 495 | Ga0207699_10482121 | 3300025906 | Bacteria | 893 |
| 496 | Ga0207645_10033907 | 3300025907 | Bacteria | 3281 |
| 497 | Ga0207645_10073666 | 3300025907 | Bacteria | 2186 |
| 498 | Ga0207643_10060108 | 3300025908 | Bacteria | 2169 |
| 499 | Ga0207705_10000918 | 3300025909 | Bacteria | 24102 |
| 500 | Ga0207705_10012563 | 3300025909 | Bacteria | 6113 |
| 501 | Ga0207705_10015670 | 3300025909 | Bacteria | 5443 |
| 502 | Ga0207705_10023108 | 3300025909 | Bacteria | 4435 |
| 503 | Ga0207705_10044895 | 3300025909 | Bacteria | 3176 |
| 504 | Ga0207705_10085327 | 3300025909 | Bacteria | 2307 |
| 505 | Ga0207705_10091904 | 3300025909 | Bacteria | 2223 |
| 506 | Ga0207705_10123152 | 3300025909 | Bacteria | 1926 |
| 507 | Ga0207705_10140540 | 3300025909 | Unclassified | 1803 |
| 508 | Ga0207705_10253663 | 3300025909 | Bacteria | 1342 |
| 509 | Ga0207705_10365303 | 3300025909 | Bacteria | 1113 |
| 510 | Ga0207705_10433818 | 3300025909 | Bacteria | 1018 |
| 511 | Ga0207705_10561613 | 3300025909 | Bacteria | 887 |
| 512 | Ga0207705_10602250 | 3300025909 | Unclassified | 854 |
| 513 | Ga0207705_10674502 | 3300025909 | Unclassified | 804 |
| 514 | Ga0207705_11321065 | 3300025909 | Bacteria | 550 |
| 515 | Ga0207705_11372556 | 3300025909 | Unclassified | 538 |
| 516 | Ga0207654_10209945 | 3300025911 | Bacteria | 1286 |
| 517 | Ga0207654_10338516 | 3300025911 | Bacteria | 1033 |
| 518 | Ga0207654_10875981 | 3300025911 | Bacteria | 650 |
| 519 | Ga0207707_10118853 | 3300025912 | Bacteria | 2310 |
| 520 | Ga0207707_10511657 | 3300025912 | Bacteria | 1023 |
| 521 | Ga0207707_10518416 | 3300025912 | Bacteria | 1015 |
| 522 | Ga0207707_11309197 | 3300025912 | Unclassified | 582 |
| 523 | Ga0207695_10049744 | 3300025913 | Bacteria | 4415 |
| 524 | Ga0207695_10063061 | 3300025913 | Bacteria | 3822 |
| 525 | Ga0207695_10512850 | 3300025913 | Unclassified | 1081 |
| 526 | Ga0207695_11009951 | 3300025913 | Bacteria | 712 |
| 527 | Ga0207671_10225195 | 3300025914 | Unclassified | 1470 |
| 528 | Ga0207671_11583317 | 3300025914 | Bacteria | 504 |
| 529 | Ga0207693_11180290 | 3300025915 | Bacteria | 578 |
| 530 | Ga0207660_10001398 | 3300025917 | Bacteria | 16217 |
| 531 | Ga0207660_10006350 | 3300025917 | Bacteria | 7663 |
| 532 | Ga0207660_10006640 | 3300025917 | Bacteria | 7503 |
| 533 | Ga0207660_10106419 | 3300025917 | Bacteria | 2103 |
| 534 | Ga0207660_10511452 | 3300025917 | Unclassified | 975 |
| 535 | Ga0207660_10724947 | 3300025917 | Unclassified | 811 |
| 536 | Ga0207660_10748107 | 3300025917 | Bacteria | 798 |
| 537 | Ga0207662_10301999 | 3300025918 | Bacteria | 1064 |
| 538 | Ga0207657_10000164 | 3300025919 | Bacteria | 67184 |
| 539 | Ga0207657_10007625 | 3300025919 | Bacteria | 11074 |
| 540 | Ga0207657_10033835 | 3300025919 | Bacteria | 4602 |
| 541 | Ga0207657_10061106 | 3300025919 | Bacteria | 3232 |
| 542 | Ga0207657_10173193 | 3300025919 | Bacteria | 1747 |
| 543 | Ga0207657_10276050 | 3300025919 | Bacteria | 1335 |
| 544 | Ga0207657_10370099 | 3300025919 | Unclassified | 1129 |
| 545 | Ga0207657_10411257 | 3300025919 | Bacteria | 1064 |
| 546 | Ga0207657_10903918 | 3300025919 | Bacteria | 680 |
| 547 | Ga0207657_11405103 | 3300025919 | Bacteria | 524 |
| 548 | Ga0207657_11437389 | 3300025919 | Bacteria | 517 |
| 549 | Ga0207649_10000580 | 3300025920 | Bacteria | 25006 |
| 550 | Ga0207649_10022229 | 3300025920 | Bacteria | 3664 |
| 551 | Ga0207649_10045008 | 3300025920 | Bacteria | 2704 |
| 552 | Ga0207649_10136792 | 3300025920 | Bacteria | 1671 |
| 553 | Ga0207649_10245683 | 3300025920 | Unclassified | 1287 |
| 554 | Ga0207649_10334684 | 3300025920 | Bacteria | 1116 |
| 555 | Ga0207649_10769729 | 3300025920 | Bacteria | 750 |
| 556 | Ga0207649_10895062 | 3300025920 | Unclassified | 696 |
| 557 | Ga0207649_11148704 | 3300025920 | Bacteria | 613 |
| 558 | Ga0207649_11649739 | 3300025920 | Bacteria | 507 |
| 559 | Ga0207652_10132261 | 3300025921 | Bacteria | 2226 |
| 560 | Ga0207652_10366114 | 3300025921 | Bacteria | 1301 |
| 561 | Ga0207652_10479551 | 3300025921 | Unclassified | 1120 |
| 562 | Ga0207652_10854953 | 3300025921 | Bacteria | 805 |
| 563 | Ga0207652_11003061 | 3300025921 | Bacteria | 734 |
| 564 | Ga0207652_11119167 | 3300025921 | Bacteria | 688 |
| 565 | Ga0207652_11701178 | 3300025921 | Unclassified | 535 |
| 566 | Ga0207694_10049595 | 3300025924 | Bacteria | 3250 |
| 567 | Ga0207694_10158941 | 3300025924 | Bacteria | 1824 |
| 568 | Ga0207694_10492265 | 3300025924 | Unclassified | 1026 |
| 569 | Ga0207694_10521014 | 3300025924 | Bacteria | 996 |
| 570 | Ga0207650_10138526 | 3300025925 | Bacteria | 1911 |
| 571 | Ga0207650_10393342 | 3300025925 | Bacteria | 1146 |
| 572 | Ga0207650_10470169 | 3300025925 | Unclassified | 1048 |
| 573 | Ga0207650_10539614 | 3300025925 | Bacteria | 977 |
| 574 | Ga0207650_10576611 | 3300025925 | Bacteria | 945 |
| 575 | Ga0207650_11133076 | 3300025925 | Unclassified | 666 |
| 576 | Ga0207687_10036427 | 3300025927 | Bacteria | 3352 |
| 577 | Ga0207687_10250839 | 3300025927 | Bacteria | 1407 |
| 578 | Ga0207687_10345042 | 3300025927 | Bacteria | 1211 |
| 579 | Ga0207700_10396930 | 3300025928 | Bacteria | 1208 |
| 580 | Ga0207700_10941376 | 3300025928 | Bacteria | 773 |
| 581 | Ga0207664_10084768 | 3300025929 | Unclassified | 2585 |
| 582 | Ga0207664_10089287 | 3300025929 | Bacteria | 2523 |
| 583 | Ga0207664_10135833 | 3300025929 | Bacteria | 2075 |
| 584 | Ga0207664_10180777 | 3300025929 | Bacteria | 1810 |
| 585 | Ga0207664_10320700 | 3300025929 | Bacteria | 1367 |
| 586 | Ga0207644_10005888 | 3300025931 | Bacteria | 7995 |
| 587 | Ga0207644_10006480 | 3300025931 | Bacteria | 7628 |
| 588 | Ga0207644_10016999 | 3300025931 | Bacteria | 4903 |
| 589 | Ga0207644_10071350 | 3300025931 | Bacteria | 2541 |
| 590 | Ga0207644_10181759 | 3300025931 | Bacteria | 1649 |
| 591 | Ga0207644_10292406 | 3300025931 | Bacteria | 1310 |
| 592 | Ga0207644_10516442 | 3300025931 | Bacteria | 986 |
| 593 | Ga0207690_10000800 | 3300025932 | Bacteria | 20216 |
| 594 | Ga0207690_10018159 | 3300025932 | Bacteria | 4310 |
| 595 | Ga0207690_10020753 | 3300025932 | Bacteria | 4064 |
| 596 | Ga0207690_10042089 | 3300025932 | Bacteria | 2997 |
| 597 | Ga0207690_10051299 | 3300025932 | Bacteria | 2758 |
| 598 | Ga0207690_10094844 | 3300025932 | Bacteria | 2118 |
| 599 | Ga0207690_10211186 | 3300025932 | Bacteria | 1480 |
| 600 | Ga0207690_10274819 | 3300025932 | Bacteria | 1310 |
| 601 | Ga0207690_10281564 | 3300025932 | Bacteria | 1295 |
| 602 | Ga0207690_10297109 | 3300025932 | Bacteria | 1263 |
| 603 | Ga0207690_11423640 | 3300025932 | Bacteria | 580 |
| 604 | Ga0207706_10000196 | 3300025933 | Bacteria | 67184 |
| 605 | Ga0207706_10003926 | 3300025933 | Bacteria | 14108 |
| 606 | Ga0207706_10013419 | 3300025933 | Bacteria | 7449 |
| 607 | Ga0207706_10034227 | 3300025933 | Bacteria | 4519 |
| 608 | Ga0207706_10134560 | 3300025933 | Bacteria | 2174 |
| 609 | Ga0207706_10178221 | 3300025933 | Bacteria | 1867 |
| 610 | Ga0207706_10337841 | 3300025933 | Unclassified | 1310 |
| 611 | Ga0207706_10378266 | 3300025933 | Bacteria | 1229 |
| 612 | Ga0207706_10562754 | 3300025933 | Bacteria | 981 |
| 613 | Ga0207686_10028787 | 3300025934 | Bacteria | 3269 |
| 614 | Ga0207709_10195001 | 3300025935 | Unclassified | 1442 |
| 615 | Ga0207709_10690821 | 3300025935 | Unclassified | 816 |
| 616 | Ga0207670_10419432 | 3300025936 | Bacteria | 1073 |
| 617 | Ga0207669_10005269 | 3300025937 | Bacteria | 5781 |
| 618 | Ga0207669_10009926 | 3300025937 | Bacteria | 4559 |
| 619 | Ga0207669_11229098 | 3300025937 | Unclassified | 635 |
| 620 | Ga0207704_10007617 | 3300025938 | Bacteria | 5128 |
| 621 | Ga0207704_11158538 | 3300025938 | Bacteria | 658 |
| 622 | Ga0207704_11738527 | 3300025938 | Unclassified | 536 |
| 623 | Ga0207665_10009018 | 3300025939 | Bacteria | 6546 |
| 624 | Ga0207691_10002202 | 3300025940 | Bacteria | 19068 |
| 625 | Ga0207691_10092007 | 3300025940 | Bacteria | 2716 |
| 626 | Ga0207691_10110841 | 3300025940 | Bacteria | 2441 |
| 627 | Ga0207691_10558306 | 3300025940 | Bacteria | 970 |
| 628 | Ga0207711_10000698 | 3300025941 | Bacteria | 33120 |
| 629 | Ga0207711_10002328 | 3300025941 | Bacteria | 17021 |
| 630 | Ga0207711_10045200 | 3300025941 | Bacteria | 3763 |
| 631 | Ga0207661_10003155 | 3300025944 | Bacteria | 11437 |
| 632 | Ga0207661_10007562 | 3300025944 | Bacteria | 7728 |
| 633 | Ga0207661_10438241 | 3300025944 | Bacteria | 1189 |
| 634 | Ga0207661_10477090 | 3300025944 | Bacteria | 1138 |
| 635 | Ga0207679_10001145 | 3300025945 | Bacteria | 16891 |
| 636 | Ga0207679_10112924 | 3300025945 | Bacteria | 2148 |
| 637 | Ga0207679_10203180 | 3300025945 | Bacteria | 1656 |
| 638 | Ga0207679_10220290 | 3300025945 | Unclassified | 1596 |
| 639 | Ga0207679_10364540 | 3300025945 | Bacteria | 1263 |
| 640 | Ga0207679_11014433 | 3300025945 | Bacteria | 761 |
| 641 | Ga0207667_10001975 | 3300025949 | Bacteria | 25689 |
| 642 | Ga0207667_10018331 | 3300025949 | Bacteria | 7852 |
| 643 | Ga0207667_10023290 | 3300025949 | Bacteria | 6820 |
| 644 | Ga0207667_10053191 | 3300025949 | Bacteria | 4261 |
| 645 | Ga0207667_10067034 | 3300025949 | Bacteria | 3739 |
| 646 | Ga0207667_10156891 | 3300025949 | Bacteria | 2341 |
| 647 | Ga0207667_10296202 | 3300025949 | Unclassified | 1653 |
| 648 | Ga0207667_11261599 | 3300025949 | Unclassified | 716 |
| 649 | Ga0207651_10115111 | 3300025960 | Bacteria | 2027 |
| 650 | Ga0207651_10175477 | 3300025960 | Unclassified | 1694 |
| 651 | Ga0207651_10177634 | 3300025960 | Bacteria | 1685 |
| 652 | Ga0207651_10200657 | 3300025960 | Bacteria | 1598 |
| 653 | Ga0207651_11072316 | 3300025960 | Bacteria | 721 |
| 654 | Ga0207651_11460592 | 3300025960 | Unclassified | 616 |
| 655 | Ga0207640_10005994 | 3300025981 | Bacteria | 6642 |
| 656 | Ga0207640_10346299 | 3300025981 | Unclassified | 1192 |
| 657 | Ga0207640_10714884 | 3300025981 | Bacteria | 860 |
| 658 | Ga0207640_10783481 | 3300025981 | Unclassified | 825 |
| 659 | Ga0207640_11093532 | 3300025981 | Bacteria | 705 |
| 660 | Ga0207640_11678701 | 3300025981 | Bacteria | 573 |
| 661 | Ga0207658_10005314 | 3300025986 | Bacteria | 8857 |
| 662 | Ga0207658_10175377 | 3300025986 | Bacteria | 1770 |
| 663 | Ga0207658_10581622 | 3300025986 | Bacteria | 1004 |
| 664 | Ga0207658_10636090 | 3300025986 | Bacteria | 961 |
| 665 | Ga0207677_10018678 | 3300026023 | Bacteria | 4165 |
| 666 | Ga0207677_10180194 | 3300026023 | Bacteria | 1661 |
| 667 | Ga0207703_10003591 | 3300026035 | Bacteria | 12960 |
| 668 | Ga0207703_10024596 | 3300026035 | Bacteria | 4737 |
| 669 | Ga0207703_10211821 | 3300026035 | Bacteria | 1728 |
| 670 | Ga0207703_10588425 | 3300026035 | Bacteria | 1052 |
| 671 | Ga0207639_10001229 | 3300026041 | Bacteria | 17375 |
| 672 | Ga0207639_10061145 | 3300026041 | Bacteria | 2908 |
| 673 | Ga0207639_10094925 | 3300026041 | Bacteria | 2395 |
| 674 | Ga0207639_10248525 | 3300026041 | Bacteria | 1550 |
| 675 | Ga0207639_10429037 | 3300026041 | Bacteria | 1196 |
| 676 | Ga0207639_10655179 | 3300026041 | Bacteria | 972 |
| 677 | Ga0207639_10670197 | 3300026041 | Unclassified | 961 |
| 678 | Ga0207639_10698357 | 3300026041 | Unclassified | 941 |
| 679 | Ga0207639_11519495 | 3300026041 | Unclassified | 628 |
| 680 | Ga0207639_11893089 | 3300026041 | Bacteria | 557 |
| 681 | Ga0207678_10024328 | 3300026067 | Bacteria | 5290 |
| 682 | Ga0207678_10031160 | 3300026067 | Bacteria | 4652 |
| 683 | Ga0207678_10050837 | 3300026067 | Bacteria | 3580 |
| 684 | Ga0207678_10085319 | 3300026067 | Bacteria | 2700 |
| 685 | Ga0207678_10097767 | 3300026067 | Bacteria | 2508 |
| 686 | Ga0207678_10208546 | 3300026067 | Bacteria | 1671 |
| 687 | Ga0207678_10639422 | 3300026067 | Bacteria | 934 |
| 688 | Ga0207702_10000435 | 3300026078 | Bacteria | 47593 |
| 689 | Ga0207702_10043242 | 3300026078 | Bacteria | 3782 |
| 690 | Ga0207702_10043415 | 3300026078 | Bacteria | 3774 |
| 691 | Ga0207702_10170790 | 3300026078 | Bacteria | 1994 |
| 692 | Ga0207702_10324304 | 3300026078 | Bacteria | 1467 |
| 693 | Ga0207702_10458873 | 3300026078 | Bacteria | 1237 |
| 694 | Ga0207702_10686697 | 3300026078 | Unclassified | 1008 |
| 695 | Ga0207702_11178948 | 3300026078 | Bacteria | 760 |
| 696 | Ga0207702_11634994 | 3300026078 | Bacteria | 637 |
| 697 | Ga0207641_10033682 | 3300026088 | Bacteria | 4256 |
| 698 | Ga0207641_10240094 | 3300026088 | Bacteria | 1688 |
| 699 | Ga0207641_10509249 | 3300026088 | Bacteria | 1170 |
| 700 | Ga0207641_10689133 | 3300026088 | Bacteria | 1005 |
| 701 | Ga0207648_10001874 | 3300026089 | Bacteria | 22999 |
| 702 | Ga0207648_10008888 | 3300026089 | Bacteria | 9671 |
| 703 | Ga0207648_10154875 | 3300026089 | Bacteria | 2023 |
| 704 | Ga0207648_11654631 | 3300026089 | Unclassified | 601 |
| 705 | Ga0207676_10177325 | 3300026095 | Bacteria | 1863 |
| 706 | Ga0207676_10219653 | 3300026095 | Unclassified | 1691 |
| 707 | Ga0207676_10673513 | 3300026095 | Bacteria | 1000 |
| 708 | Ga0207676_11140898 | 3300026095 | Bacteria | 771 |
| 709 | Ga0207674_10000756 | 3300026116 | Bacteria | 42260 |
| 710 | Ga0207674_10003272 | 3300026116 | Bacteria | 19933 |
| 711 | Ga0207674_10056300 | 3300026116 | Bacteria | 3994 |
| 712 | Ga0207674_10061108 | 3300026116 | Bacteria | 3807 |
| 713 | Ga0207674_10779655 | 3300026116 | Bacteria | 923 |
| 714 | Ga0207674_10868806 | 3300026116 | Bacteria | 869 |
| 715 | Ga0207675_100124947 | 3300026118 | Bacteria | 2437 |
| 716 | Ga0207683_10013533 | 3300026121 | Bacteria | 6960 |
| 717 | Ga0207683_10014201 | 3300026121 | Bacteria | 6786 |
| 718 | Ga0207683_10344798 | 3300026121 | Bacteria | 1366 |
| 719 | Ga0207698_10001464 | 3300026142 | Bacteria | 13732 |
| 720 | Ga0207698_10003125 | 3300026142 | Bacteria | 9926 |
| 721 | Ga0207698_10003161 | 3300026142 | Bacteria | 9874 |
| 722 | Ga0207698_10013595 | 3300026142 | Bacteria | 5378 |
| 723 | Ga0207698_10017161 | 3300026142 | Bacteria | 4905 |
| 724 | Ga0207698_10042185 | 3300026142 | Plasmid | 3406 |
| 725 | Ga0207698_10105002 | 3300026142 | Bacteria | 2353 |
| 726 | Ga0207698_10112025 | 3300026142 | Unclassified | 2289 |
| 727 | Ga0207698_10749205 | 3300026142 | Bacteria | 975 |
| 728 | Ga0207698_10942604 | 3300026142 | Unclassified | 872 |
| 729 | Ga0207698_11250480 | 3300026142 | Unclassified | 757 |
| 730 | Ga0207698_11598902 | 3300026142 | Unclassified | 667 |
| 731 | Ga0268266_10008238 | 3300028379 | Bacteria | 9288 |
| 732 | Ga0268266_10106998 | 3300028379 | Bacteria | 2473 |
| 733 | Ga0268266_10368764 | 3300028379 | Bacteria | 1352 |
| 734 | Ga0268266_10440684 | 3300028379 | Bacteria | 1237 |
| 735 | Ga0268266_11218970 | 3300028379 | Bacteria | 728 |
| 736 | Ga0268264_10492551 | 3300028381 | Bacteria | 1194 |
| 737 | Ga0307410_10006430 | 3300031852 | Bacteria | 6339 |
| 738 | Ga0307414_11402617 | 3300032004 | Bacteria | 649 |
| 739 | Ga0307411_11247616 | 3300032005 | Bacteria | 675 |
| 740 | Ga0373938_0006944 | 3300034957 | Bacteria | 1977 |
| 741 | Ga0373949_0068215 | 3300035090 | Bacteria | 927 |
| 742 | Ga0373952_0154150 | 3300035092 | Bacteria | 646 |
| 743 | Ga0373941_0026486 | 3300035115 | Bacteria | 1684 |
| 744 | Ga0373946_0387157 | 3300035171 | Unclassified | 704 |
| 745 | Ga0373955_0049871 | 3300035172 | Bacteria | 2274 |
| 746 | Ga0373961_0192424 | 3300035241 | Unclassified | 716 |
| 747 | Ga0373931_0015714 | 3300035691 | Bacteria | 3715 |
| 748 | Ga0373931_0159163 | 3300035691 | Bacteria | 1322 |
| 749 | Ga0373935_0019409 | 3300035692 | Bacteria | 4145 |
| 750 | Ga0373935_0932790 | 3300035692 | Bacteria | 644 |
| 751 | Ga0373933_0602993 | 3300035724 | Bacteria | 721 |
| 752 | Ga0373947_0076420 | 3300035725 | Bacteria | 2064 |
| 753 | Ga0373937_0076548 | 3300036401 | Bacteria | 3090 |
| 754 | Ga0373925_0180268 | 3300037068 | Bacteria | 1672 |
| 755 | Ga0395899_0028811 | 3300037312 | Bacteria | 4178 |
| 756 | Ga0395899_0037566 | 3300037312 | Bacteria | 3630 |
| 757 | Ga0395899_0057768 | 3300037312 | Unclassified | 2863 |
| 758 | Ga0395899_0061643 | 3300037312 | Bacteria | 2762 |
| 759 | Ga0395899_0094928 | 3300037312 | Bacteria | 2157 |
| 760 | Ga0395899_0141785 | 3300037312 | Bacteria | 1709 |
| 761 | Ga0395899_0177513 | 3300037312 | Bacteria | 1497 |
| 762 | Ga0395899_0185988 | 3300037312 | Bacteria | 1456 |
| 763 | Ga0395899_0223151 | 3300037312 | Unclassified | 1304 |
| 764 | Ga0395899_0368600 | 3300037312 | Bacteria | 957 |
| 765 | Ga0395899_0461055 | 3300037312 | Unclassified | 830 |
| 766 | Ga0395899_0464567 | 3300037312 | Unclassified | 826 |
| 767 | Ga0395900_0000968 | 3300037418 | Bacteria | 37351 |
| 768 | Ga0395900_0023882 | 3300037418 | Bacteria | 6256 |
| 769 | Ga0395900_0032807 | 3300037418 | Bacteria | 5342 |
| 770 | Ga0395900_0063743 | 3300037418 | Bacteria | 3788 |
| 771 | Ga0395900_0066736 | 3300037418 | Bacteria | 3697 |
| 772 | Ga0395900_0101219 | 3300037418 | Bacteria | 2959 |
| 773 | Ga0395900_0115340 | 3300037418 | Bacteria | 2756 |
| 774 | Ga0395900_0121333 | 3300037418 | Bacteria | 2681 |
| 775 | Ga0395900_0178814 | 3300037418 | Bacteria | 2157 |
| 776 | Ga0395900_0189284 | 3300037418 | Unclassified | 2088 |
| 777 | Ga0395900_0256630 | 3300037418 | Bacteria | 1747 |
| 778 | Ga0395900_0336599 | 3300037418 | Bacteria | 1486 |
| 779 | Ga0395900_0341256 | 3300037418 | Bacteria | 1473 |
| 780 | Ga0395900_0382138 | 3300037418 | Bacteria | 1376 |
| 781 | Ga0395900_0415746 | 3300037418 | Bacteria | 1306 |
| 782 | Ga0395900_0534741 | 3300037418 | Unclassified | 1118 |
| 783 | Ga0395900_0572950 | 3300037418 | Bacteria | 1071 |
| 784 | Ga0395900_0598419 | 3300037418 | Bacteria | 1043 |
| 785 | Ga0395900_0692685 | 3300037418 | Bacteria | 953 |
| 786 | Ga0395900_0769337 | 3300037418 | Unclassified | 892 |
| 787 | Ga0395900_1051818 | 3300037418 | Bacteria | 732 |
| 788 | Ga0395900_1064365 | 3300037418 | Bacteria | 727 |
| 789 | Ga0395900_1229547 | 3300037418 | Bacteria | 664 |
| 790 | Ga0395900_1580847 | 3300037418 | Bacteria | 567 |
| 791 | Ga0395900_1680963 | 3300037418 | Bacteria | 546 |
| 792 | Ga0395898_0041568 | 3300037466 | Bacteria | 4540 |
| 793 | Ga0395898_0050167 | 3300037466 | Bacteria | 4085 |
| 794 | Ga0395898_0112662 | 3300037466 | Bacteria | 2607 |
| 795 | Ga0395898_0174407 | 3300037466 | Unclassified | 2055 |
| 796 | Ga0395898_0216214 | 3300037466 | Bacteria | 1828 |
| 797 | Ga0395898_0290430 | 3300037466 | Bacteria | 1560 |
| 798 | Ga0395898_0324906 | 3300037466 | Bacteria | 1467 |
| 799 | Ga0395898_0444387 | 3300037466 | Bacteria | 1235 |
| 800 | Ga0395898_0693158 | 3300037466 | Bacteria | 960 |
| 801 | Ga0395898_0779910 | 3300037466 | Bacteria | 896 |
| 802 | Ga0395898_0938688 | 3300037466 | Bacteria | 802 |
| 803 | Ga0395898_0956398 | 3300037466 | Bacteria | 793 |
| 804 | Ga0395898_1089494 | 3300037466 | Bacteria | 732 |
| 805 | Ga0395905_0000735 | 3300037471 | Bacteria | 43152 |
| 806 | Ga0395905_0002672 | 3300037471 | Bacteria | 19545 |
| 807 | Ga0395905_0003694 | 3300037471 | Bacteria | 16206 |
| 808 | Ga0395905_0004891 | 3300037471 | Bacteria | 13804 |
| 809 | Ga0395905_0008410 | 3300037471 | Bacteria | 10176 |
| 810 | Ga0395905_0012725 | 3300037471 | Bacteria | 8092 |
| 811 | Ga0395905_0017502 | 3300037471 | Bacteria | 6804 |
| 812 | Ga0395905_0028144 | 3300037471 | Bacteria | 5297 |
| 813 | Ga0395905_0063359 | 3300037471 | Bacteria | 3459 |
| 814 | Ga0395905_0101267 | 3300037471 | Bacteria | 2704 |
| 815 | Ga0395905_0140417 | 3300037471 | Bacteria | 2273 |
| 816 | Ga0395905_0142939 | 3300037471 | Bacteria | 2251 |
| 817 | Ga0395905_0152396 | 3300037471 | Bacteria | 2174 |
| 818 | Ga0395905_0161533 | 3300037471 | Bacteria | 2105 |
| 819 | Ga0395905_0166807 | 3300037471 | Bacteria | 2069 |
| 820 | Ga0395905_0222029 | 3300037471 | Bacteria | 1768 |
| 821 | Ga0395905_0228417 | 3300037471 | Bacteria | 1740 |
| 822 | Ga0395905_0236847 | 3300037471 | Bacteria | 1706 |
| 823 | Ga0395905_0260416 | 3300037471 | Bacteria | 1619 |
| 824 | Ga0395905_0288990 | 3300037471 | Bacteria | 1526 |
| 825 | Ga0395905_0318230 | 3300037471 | Bacteria | 1445 |
| 826 | Ga0395905_0326290 | 3300037471 | Bacteria | 1425 |
| 827 | Ga0395905_0342052 | 3300037471 | Bacteria | 1387 |
| 828 | Ga0395905_0376406 | 3300037471 | Bacteria | 1313 |
| 829 | Ga0395905_0451104 | 3300037471 | Unclassified | 1184 |
| 830 | Ga0395905_0642354 | 3300037471 | Bacteria | 963 |
| 831 | Ga0395905_0697385 | 3300037471 | Bacteria | 917 |
| 832 | Ga0395905_0786718 | 3300037471 | Unclassified | 854 |
| 833 | Ga0395905_1122646 | 3300037471 | Bacteria | 689 |
| 834 | Ga0395905_1337753 | 3300037471 | Bacteria | 620 |
| 835 | Ga0395905_1345400 | 3300037471 | Bacteria | 618 |
| 836 | Ga0395905_1764064 | 3300037471 | Unclassified | 524 |
| 837 | Ga0395901_0001666 | 3300038443 | Bacteria | 22932 |
| 838 | Ga0395901_0021575 | 3300038443 | Bacteria | 6598 |
| 839 | Ga0395901_0024408 | 3300038443 | Bacteria | 6205 |
| 840 | Ga0395901_0042065 | 3300038443 | Bacteria | 4736 |
| 841 | Ga0395901_0066183 | 3300038443 | Bacteria | 3764 |
| 842 | Ga0395901_0072397 | 3300038443 | Bacteria | 3593 |
| 843 | Ga0395901_0100300 | 3300038443 | Bacteria | 3037 |
| 844 | Ga0395901_0161583 | 3300038443 | Bacteria | 2352 |
| 845 | Ga0395901_0176174 | 3300038443 | Bacteria | 2243 |
| 846 | Ga0395901_0310737 | 3300038443 | Bacteria | 1632 |
| 847 | Ga0395901_0312403 | 3300038443 | Bacteria | 1627 |
| 848 | Ga0395901_0312815 | 3300038443 | Bacteria | 1626 |
| 849 | Ga0395901_0353680 | 3300038443 | Bacteria | 1516 |
| 850 | Ga0395901_0446407 | 3300038443 | Unclassified | 1323 |
| 851 | Ga0395901_0461646 | 3300038443 | Bacteria | 1297 |
| 852 | Ga0395901_0494669 | 3300038443 | Unclassified | 1246 |
| 853 | Ga0395901_0565992 | 3300038443 | Bacteria | 1150 |
| 854 | Ga0395901_0566540 | 3300038443 | Bacteria | 1149 |
| 855 | Ga0395901_0593752 | 3300038443 | Bacteria | 1117 |
| 856 | Ga0395901_0805085 | 3300038443 | Bacteria | 928 |
| 857 | Ga0395901_1547457 | 3300038443 | Unclassified | 618 |
| 858 | Ga0439448_0006644 | 3300042005 | Bacteria | 3331 |
| 859 | Ga0439448_0328268 | 3300042005 | Bacteria | 545 |
| 860 | Ga0439455_0107494 | 3300042012 | Bacteria | 774 |
| 861 | Ga0439458_0000453 | 3300042157 | Bacteria | 10395 |
| 862 | Ga0466972_0033759 | 3300044658 | Bacteria | 2510 |
| 863 | Ga0466965_0139515 | 3300044683 | Bacteria | 1261 |
| 864 | Ga0466965_0284410 | 3300044683 | Bacteria | 894 |
| 865 | Ga0466965_0456871 | 3300044683 | Bacteria | 712 |
| 866 | Ga0466965_0821532 | 3300044683 | Bacteria | 539 |
| 867 | Ga0466966_0379991 | 3300044684 | Unclassified | 849 |
| 868 | Ga0466966_0517702 | 3300044684 | Unclassified | 718 |
| 869 | Ga0466963_0010124 | 3300044694 | Bacteria | 5701 |
| 870 | Ga0466963_0050703 | 3300044694 | Bacteria | 2747 |
| 871 | Ga0466963_0103589 | 3300044694 | Bacteria | 1950 |
| 872 | Ga0466963_0269818 | 3300044694 | Bacteria | 1195 |
| 873 | Ga0466963_0710480 | 3300044694 | Unclassified | 709 |
| 874 | Ga0466964_0361377 | 3300044706 | Bacteria | 749 |
| 875 | Ga0466971_0072186 | 3300044719 | Bacteria | 1568 |
| 876 | Ga0466970_0010656 | 3300044765 | Bacteria | 4670 |
| 877 | Ga0466970_0609497 | 3300044765 | Bacteria | 634 |
| 878 | Ga0466957_0056794 | 3300044842 | Bacteria | 2394 |
| 879 | Ga0466957_0207915 | 3300044842 | Bacteria | 1288 |
| 880 | Ga0466957_0547203 | 3300044842 | Bacteria | 806 |
| 881 | Ga0466960_0060572 | 3300044901 | Bacteria | 1855 |
| 882 | Ga0466959_0167747 | 3300045049 | Bacteria | 1541 |
| 883 | Ga0466959_0774549 | 3300045049 | Bacteria | 642 |
| 884 | Ga0466958_0162475 | 3300045836 | Bacteria | 1411 |
| 885 | Ga0466958_0179127 | 3300045836 | Bacteria | 1345 |
| 886 | Ga0466958_0811361 | 3300045836 | Unclassified | 610 |
| 887 | Ga0466967_0107054 | 3300045976 | Bacteria | 2564 |
| 888 | Ga0466967_0171399 | 3300045976 | Bacteria | 2042 |
| 889 | Ga0466967_0197445 | 3300045976 | Bacteria | 1904 |
| 890 | Ga0466967_0215753 | 3300045976 | Bacteria | 1821 |
| 891 | Ga0466967_0244191 | 3300045976 | Unclassified | 1713 |
| 892 | Ga0466967_0525779 | 3300045976 | Bacteria | 1163 |
| 893 | Ga0466967_0705137 | 3300045976 | Unclassified | 1000 |
| 894 | Ga0466967_1006508 | 3300045976 | Unclassified | 830 |
| 895 | Ga0466967_1008410 | 3300045976 | Unclassified | 829 |
| 896 | Ga0466967_1065187 | 3300045976 | Bacteria | 805 |
| 897 | Ga0466967_1634347 | 3300045976 | Bacteria | 642 |
| 898 | Ga0495621_0037949 | 3300046539 | Bacteria | 1678 |
| 899 | Ga0495597_0068625 | 3300046542 | Bacteria | 1532 |
| 900 | Ga0495669_0236115 | 3300046684 | Bacteria | 877 |
| 901 | Ga0495669_0663752 | 3300046684 | Unclassified | 507 |
| 902 | Ga0495687_060666 | 3300047443 | Bacteria | 1559 |
| 903 | Ga0495677_0277453 | 3300047445 | Unclassified | 657 |
| 904 | Ga0495593_0404834 | 3300047673 | Bacteria | 682 |
| 905 | Ga0495602_0049589 | 3300048088 | Bacteria | 3759 |
| 906 | Ga0496100_0011923 | 3300048903 | Bacteria | 4965 |
| 907 | Ga0496101_0007221 | 3300048904 | Bacteria | 7188 |
| 908 | Ga0496102_1290225 | 3300048905 | Unclassified | 649 |
| 909 | Ga0496103_0017726 | 3300048906 | Bacteria | 4264 |
| 910 | Ga0496106_0415573 | 3300048909 | Bacteria | 1081 |
| 911 | Ga0496107_0020486 | 3300048910 | Bacteria | 4671 |
| 912 | Ga0496107_0367019 | 3300048910 | Bacteria | 1071 |
| 913 | Ga0496107_0850343 | 3300048910 | Bacteria | 666 |
| 914 | Ga0496108_0041843 | 3300048911 | Bacteria | 3825 |
| 915 | Ga0496108_0672418 | 3300048911 | Bacteria | 899 |
| 916 | Ga0496109_0139509 | 3300048912 | Bacteria | 2266 |
| 917 | Ga0496110_0488178 | 3300048913 | Unclassified | 1122 |
| 918 | Ga0496111_0005109 | 3300048914 | Bacteria | 8353 |
| 919 | Ga0496111_0020626 | 3300048914 | Bacteria | 4590 |
| 920 | Ga0496111_0655373 | 3300048914 | Bacteria | 766 |
| 921 | Ga0496112_0005386 | 3300048915 | Bacteria | 11058 |
| 922 | Ga0496112_0111099 | 3300048915 | Bacteria | 2711 |
| 923 | Ga0496112_0356227 | 3300048915 | Unclassified | 1405 |
| 924 | Ga0496112_0458429 | 3300048915 | Bacteria | 1212 |
| 925 | Ga0496112_1458857 | 3300048915 | Bacteria | 598 |
| 926 | Ga0496112_1891247 | 3300048915 | Bacteria | 508 |
| 927 | Ga0496113_0026435 | 3300048916 | Bacteria | 4150 |
| 928 | Ga0496114_0040037 | 3300048917 | Bacteria | 3879 |
| 929 | Ga0496115_0001337 | 3300048918 | Bacteria | 17576 |
| 930 | Ga0501068_1137511 | 3300049584 | Bacteria | 517 |
| 931 | Ga0501069_0763583 | 3300049585 | Bacteria | 585 |
| 932 | Ga0501233_117199 | 3300049668 | Unclassified | 717 |
| 933 | Ga0501249_044547 | 3300049679 | Bacteria | 1011 |
| 934 | Ga0501245_017590 | 3300049708 | Bacteria | 1093 |
| 935 | Ga0501268_064558 | 3300049765 | Bacteria | 731 |
| 936 | nmdc:mga0k408_554028_c1 | 3300050493 | Bacteria | 679 |
| 937 | Ga0466962_0026319 | 3300061719 | Bacteria | 2793 |
| 938 | Ga0466962_0081554 | 3300061719 | Bacteria | 1547 |
| 939 | Ga0466962_0229920 | 3300061719 | Bacteria | 909 |
| 940 | rootL2_10157805 | |||
| 941 | JGI24736J21556_1073555 | |||
| 942 | JGI24741J21665_1041917 | |||
| 943 | JGI24752J21851_1031047 | |||
| 944 | JGI24740J21852_10020550 | |||
| 945 | JGI24740J21852_10178487 | |||
| 946 | JGI24739J22299_10006992 | |||
| 947 | JGI24739J22299_10016475 | |||
| 948 | JGI24737J22298_10000702 | |||
| 949 | JGI24737J22298_10002055 | |||
| 950 | JGI24737J22298_10010330 | |||
| 951 | JGI24737J22298_10024149 | |||
| 952 | JGI24737J22298_10242731 | |||
| 953 | JGI24735J21928_10011641 | |||
| 954 | JGI24735J21928_10081923 | |||
| 955 | JGI24735J21928_10095118 | |||
| 956 | JGI24735J21928_10170704 | |||
| 957 | JGI24745J21846_1025547 | |||
| 958 | JGI24744J21845_10000004 | |||
| 959 | rootL2_10214130 | |||
| 960 | rootH1_10208980 | |||
| 961 | rootH1_10227087 | |||
| 962 | Ga0065712_10527711 | |||
| 963 | Ga0065715_10847934 | |||
| 964 | Ga0070658_10000360 | |||
| 965 | Ga0070658_10010794 | |||
| 966 | Ga0070658_10011538 | |||
| 967 | Ga0070658_10054773 | |||
| 968 | Ga0070658_10089314 | |||
| 969 | Ga0070658_10093510 | |||
| 970 | Ga0070658_10105720 | |||
| 971 | Ga0070658_10259916 | |||
| 972 | Ga0070658_10269979 | |||
| 973 | Ga0070658_10456954 | |||
| 974 | Ga0070658_10471825 | |||
| 975 | Ga0070658_10476802 | |||
| 976 | Ga0070658_10732803 | |||
| 977 | Ga0070658_10742259 | |||
| 978 | Ga0070658_10867335 | |||
| 979 | Ga0070658_10906644 | |||
| 980 | Ga0070658_11388505 | |||
| 981 | Ga0070658_11681546 | |||
| 982 | Ga0070676_10444421 | |||
| 983 | Ga0070676_11177824 | |||
| 984 | Ga0070683_100011780 | |||
| 985 | Ga0070683_100019038 | |||
| 986 | Ga0070683_100093059 | |||
| 987 | Ga0070683_100996313 | |||
| 988 | Ga0070690_100007577 | |||
| 989 | Ga0070690_100168977 | |||
| 990 | Ga0070690_100334765 | |||
| 991 | Ga0070670_100068941 | |||
| 992 | Ga0070670_100078790 | |||
| 993 | Ga0070670_100098556 | |||
| 994 | Ga0070670_100176639 | |||
| 995 | Ga0070670_100473686 | |||
| 996 | Ga0070670_100670483 | |||
| 997 | Ga0070670_101353379 | |||
| 998 | Ga0070677_10038663 | |||
| 999 | Ga0068869_100021048 | |||
| 1000 | Ga0070666_10001622 | |||
| 1001 | Ga0070666_10003180 | |||
| 1002 | Ga0070666_10056745 | |||
| 1003 | Ga0070666_10129081 | |||
| 1004 | Ga0070666_10399007 | |||
| 1005 | Ga0070666_10700866 | |||
| 1006 | Ga0070680_100002423 | |||
| 1007 | Ga0070680_100002971 | |||
| 1008 | Ga0070680_100085008 | |||
| 1009 | Ga0070680_100374080 | |||
| 1010 | Ga0070680_100681729 | |||
| 1011 | Ga0070680_101243546 | |||
| 1012 | Ga0070682_100031502 | |||
| 1013 | Ga0070682_100056715 | |||
| 1014 | Ga0070682_100878345 | |||
| 1015 | Ga0068868_100002897 | |||
| 1016 | Ga0068868_100101780 | |||
| 1017 | Ga0068868_100176966 | |||
| 1018 | Ga0068868_102089420 | |||
| 1019 | Ga0070660_100000075 | |||
| 1020 | Ga0070660_100019365 | |||
| 1021 | Ga0070660_100079835 | |||
| 1022 | Ga0070660_100095850 | |||
| 1023 | Ga0070660_100122059 | |||
| 1024 | Ga0070660_100177331 | |||
| 1025 | Ga0070660_100181443 | |||
| 1026 | Ga0070660_100272554 | |||
| 1027 | Ga0070660_100554343 | |||
| 1028 | Ga0070660_100680497 | |||
| 1029 | Ga0070660_100695355 | |||
| 1030 | Ga0070660_100751509 | |||
| 1031 | Ga0070660_101393287 | |||
| 1032 | Ga0070660_101461774 | |||
| 1033 | Ga0070660_101577294 | |||
| 1034 | Ga0070689_101167696 | |||
| 1035 | Ga0070687_100226249 | |||
| 1036 | Ga0070661_100000273 | |||
| 1037 | Ga0070661_100018410 | |||
| 1038 | Ga0070661_100027213 | |||
| 1039 | Ga0070661_100117784 | |||
| 1040 | Ga0070661_100141897 | |||
| 1041 | Ga0070661_100167807 | |||
| 1042 | Ga0070661_100201887 | |||
| 1043 | Ga0070661_100220454 | |||
| 1044 | Ga0070661_100244692 | |||
| 1045 | Ga0070661_100271526 | |||
| 1046 | Ga0070661_100890236 | |||
| 1047 | Ga0070692_10079658 | |||
| 1048 | Ga0070669_100168378 | |||
| 1049 | Ga0070675_100471179 | |||
| 1050 | Ga0070671_100025722 | |||
| 1051 | Ga0070671_100043305 | |||
| 1052 | Ga0070671_100173762 | |||
| 1053 | Ga0070671_100176990 | |||
| 1054 | Ga0070671_100350740 | |||
| 1055 | Ga0070671_100495666 | |||
| 1056 | Ga0070671_101554429 | |||
| 1057 | Ga0070674_100013394 | |||
| 1058 | Ga0070674_100044299 | |||
| 1059 | Ga0070674_100123457 | |||
| 1060 | Ga0070674_100585159 | |||
| 1061 | Ga0070673_100031710 | |||
| 1062 | Ga0070673_100051318 | |||
| 1063 | Ga0070673_100117383 | |||
| 1064 | Ga0070673_101055081 | |||
| 1065 | Ga0070673_101477173 | |||
| 1066 | Ga0070659_100000084 | |||
| 1067 | Ga0070659_100016687 | |||
| 1068 | Ga0070659_100027551 | |||
| 1069 | Ga0070659_100049784 | |||
| 1070 | Ga0070659_100205816 | |||
| 1071 | Ga0070659_100296122 | |||
| 1072 | Ga0070659_100310888 | |||
| 1073 | Ga0070659_100353558 | |||
| 1074 | Ga0070659_100374327 | |||
| 1075 | Ga0070659_100469987 | |||
| 1076 | Ga0070659_100477484 | |||
| 1077 | Ga0070659_100705080 | |||
| 1078 | Ga0070659_100753702 | |||
| 1079 | Ga0070659_101127211 | |||
| 1080 | Ga0070659_101257257 | |||
| 1081 | Ga0070659_101466206 | |||
| 1082 | Ga0070659_101832268 | |||
| 1083 | Ga0070667_100001607 | |||
| 1084 | Ga0070667_100007596 | |||
| 1085 | Ga0070667_100057710 | |||
| 1086 | Ga0070667_100180681 | |||
| 1087 | Ga0070667_100450066 | |||
| 1088 | Ga0070667_100507830 | |||
| 1089 | Ga0070709_10092501 | |||
| 1090 | Ga0070709_10490972 | |||
| 1091 | Ga0070714_100059708 | |||
| 1092 | Ga0070714_100098855 | |||
| 1093 | Ga0070714_100136374 | |||
| 1094 | Ga0070714_100255451 | |||
| 1095 | Ga0070714_100381215 | |||
| 1096 | Ga0070714_101254985 | |||
| 1097 | Ga0070713_100150083 | |||
| 1098 | Ga0070713_100266651 | |||
| 1099 | Ga0070713_101247285 | |||
| 1100 | Ga0070710_10769517 | |||
| 1101 | Ga0070701_10376754 | |||
| 1102 | Ga0070663_100008206 | |||
| 1103 | Ga0070663_100014657 | |||
| 1104 | Ga0070663_100026523 | |||
| 1105 | Ga0070663_100043601 | |||
| 1106 | Ga0070663_100088422 | |||
| 1107 | Ga0070663_102049139 | |||
| 1108 | Ga0070678_100036760 | |||
| 1109 | Ga0070678_100745354 | |||
| 1110 | Ga0070678_102175269 | |||
| 1111 | Ga0070662_100000058 | |||
| 1112 | Ga0070662_100030923 | |||
| 1113 | Ga0070662_100031111 | |||
| 1114 | Ga0070662_100059087 | |||
| 1115 | Ga0070662_100188902 | |||
| 1116 | Ga0070662_100192113 | |||
| 1117 | Ga0070662_100369156 | |||
| 1118 | Ga0070662_100471841 | |||
| 1119 | Ga0070662_100650140 | |||
| 1120 | Ga0070662_100716849 | |||
| 1121 | Ga0070681_10427285 | |||
| 1122 | Ga0070681_10499370 | |||
| 1123 | Ga0070681_10521852 | |||
| 1124 | Ga0070681_11069930 | |||
| 1125 | Ga0068867_100019316 | |||
| 1126 | Ga0068867_100024987 | |||
| 1127 | Ga0068867_100168634 | |||
| 1128 | Ga0070685_10395986 | |||
| 1129 | Ga0070679_100137586 | |||
| 1130 | Ga0070679_100158330 | |||
| 1131 | Ga0070679_100202800 | |||
| 1132 | Ga0070679_100302323 | |||
| 1133 | Ga0070679_100501670 | |||
| 1134 | Ga0070679_100980781 | |||
| 1135 | Ga0070679_101308722 | |||
| 1136 | Ga0070679_102026760 | |||
| 1137 | Ga0070684_100075442 | |||
| 1138 | Ga0070684_100942783 | |||
| 1139 | Ga0070684_101146842 | |||
| 1140 | Ga0070684_101548157 | |||
| 1141 | Ga0068853_100000223 | |||
| 1142 | Ga0068853_100020340 | |||
| 1143 | Ga0068853_100022536 | |||
| 1144 | Ga0068853_100071374 | |||
| 1145 | Ga0068853_100083913 | |||
| 1146 | Ga0068853_100242620 | |||
| 1147 | Ga0068853_101714885 | |||
| 1148 | Ga0068853_102008914 | |||
| 1149 | Ga0068853_102136845 | |||
| 1150 | Ga0070672_100056132 | |||
| 1151 | Ga0070672_100073704 | |||
| 1152 | Ga0070672_100146801 | |||
| 1153 | Ga0070686_100023854 | |||
| 1154 | Ga0070686_100405969 | |||
| 1155 | Ga0070696_100817735 | |||
| 1156 | Ga0070693_100002223 | |||
| 1157 | Ga0070665_100079149 | |||
| 1158 | Ga0070665_100099738 | |||
| 1159 | Ga0070665_100228969 | |||
| 1160 | Ga0070665_100443637 | |||
| 1161 | Ga0068855_100004348 | |||
| 1162 | Ga0068855_100023983 | |||
| 1163 | Ga0068855_100039869 | |||
| 1164 | Ga0068855_100116987 | |||
| 1165 | Ga0068855_100147289 | |||
| 1166 | Ga0068855_100213675 | |||
| 1167 | Ga0068855_100313019 | |||
| 1168 | Ga0068855_100320342 | |||
| 1169 | Ga0068855_101376758 | |||
| 1170 | Ga0070664_100000032 | |||
| 1171 | Ga0070664_100015597 | |||
| 1172 | Ga0070664_100050167 | |||
| 1173 | Ga0070664_100135378 | |||
| 1174 | Ga0070664_100484632 | |||
| 1175 | Ga0070664_100789200 | |||
| 1176 | Ga0070664_100829024 | |||
| 1177 | Ga0068857_100012095 | |||
| 1178 | Ga0068857_100076016 | |||
| 1179 | Ga0068857_100139794 | |||
| 1180 | Ga0068857_101023700 | |||
| 1181 | Ga0068857_101137918 | |||
| 1182 | Ga0068857_101165179 | |||
| 1183 | Ga0068857_101470018 | |||
| 1184 | Ga0068854_100049084 | |||
| 1185 | Ga0068854_100074313 | |||
| 1186 | Ga0068854_100125183 | |||
| 1187 | Ga0068854_100579092 | |||
| 1188 | Ga0068854_100586567 | |||
| 1189 | Ga0068854_100770055 | |||
| 1190 | Ga0068854_101101403 | |||
| 1191 | Ga0068854_101395462 | |||
| 1192 | Ga0068856_100000161 | |||
| 1193 | Ga0068856_100035924 | |||
| 1194 | Ga0068856_100067469 | |||
| 1195 | Ga0068856_100074140 | |||
| 1196 | Ga0068856_100182382 | |||
| 1197 | Ga0068856_100250923 | |||
| 1198 | Ga0068856_100297808 | |||
| 1199 | Ga0068856_100347423 | |||
| 1200 | Ga0068856_100487969 | |||
| 1201 | Ga0068856_100632855 | |||
| 1202 | Ga0068856_102147130 | |||
| 1203 | Ga0070702_100087052 | |||
| 1204 | Ga0070702_100208902 | |||
| 1205 | Ga0068852_100002629 | |||
| 1206 | Ga0068852_100004056 | |||
| 1207 | Ga0068852_100006769 | |||
| 1208 | Ga0068852_100007392 | |||
| 1209 | Ga0068852_100012497 | |||
| 1210 | Ga0068852_100013368 | |||
| 1211 | Ga0068852_100019632 | |||
| 1212 | Ga0068852_100019960 | |||
| 1213 | Ga0068852_100142492 | |||
| 1214 | Ga0068852_100159246 | |||
| 1215 | Ga0068852_100227897 | |||
| 1216 | Ga0068852_100251125 | |||
| 1217 | Ga0068852_100306136 | |||
| 1218 | Ga0068852_100447613 | |||
| 1219 | Ga0068852_101335113 | |||
| 1220 | Ga0068852_102571436 | |||
| 1221 | Ga0068859_100108019 | |||
| 1222 | Ga0068859_100124699 | |||
| 1223 | Ga0068859_100838576 | |||
| 1224 | Ga0068859_101176912 | |||
| 1225 | Ga0068864_100143306 | |||
| 1226 | Ga0068864_100313760 | |||
| 1227 | Ga0068864_101240976 | |||
| 1228 | Ga0068866_10003449 | |||
| 1229 | Ga0068866_10006265 | |||
| 1230 | Ga0068866_10030919 | |||
| 1231 | Ga0068866_10281867 | |||
| 1232 | Ga0068861_100220678 | |||
| 1233 | Ga0068851_10054608 | |||
| 1234 | Ga0068851_10141711 | |||
| 1235 | Ga0068851_10204961 | |||
| 1236 | Ga0068851_10230832 | |||
| 1237 | Ga0068851_10967504 | |||
| 1238 | Ga0068870_10041427 | |||
| 1239 | Ga0068863_100007726 | |||
| 1240 | Ga0068863_100009099 | |||
| 1241 | Ga0068863_100594432 | |||
| 1242 | Ga0068863_101655714 | |||
| 1243 | Ga0068858_100001074 | |||
| 1244 | Ga0068858_100017888 | |||
| 1245 | Ga0068858_100022059 | |||
| 1246 | Ga0068858_100742978 | |||
| 1247 | Ga0068860_100052156 | |||
| 1248 | Ga0068862_100361771 | |||
| 1249 | Ga0081539_10022578 | |||
| 1250 | Ga0081539_10088500 | |||
| 1251 | Ga0070717_10207669 | |||
| 1252 | Ga0070715_10092585 | |||
| 1253 | Ga0070716_100012739 | |||
| 1254 | Ga0075366_10269574 | |||
| 1255 | Ga0097621_100006259 | |||
| 1256 | Ga0097621_100246967 | |||
| 1257 | Ga0068871_100096674 | |||
| 1258 | Ga0068871_100119204 | |||
| 1259 | Ga0068871_102108658 | |||
| 1260 | Ga0068871_102231530 | |||
| 1261 | Ga0068865_100007849 | |||
| 1262 | Ga0068865_100159066 | |||
| 1263 | Ga0068865_100241026 | |||
| 1264 | Ga0068865_101882989 | |||
| 1265 | Ga0097620_100108023 | |||
| 1266 | Ga0097620_100124702 | |||
| 1267 | Ga0097620_100838638 | |||
| 1268 | Ga0097620_101176473 | |||
| 1269 | Ga0105240_10017996 | |||
| 1270 | Ga0105240_10130001 | |||
| 1271 | Ga0105240_10156342 | |||
| 1272 | Ga0105240_10616388 | |||
| 1273 | Ga0105240_11017219 | |||
| 1274 | Ga0105240_11501579 | |||
| 1275 | Ga0105245_10033030 | |||
| 1276 | Ga0105245_10486365 | |||
| 1277 | Ga0105245_10525659 | |||
| 1278 | Ga0105247_11719539 | |||
| 1279 | Ga0105243_10048795 | |||
| 1280 | Ga0105243_10213010 | |||
| 1281 | Ga0105243_10680607 | |||
| 1282 | Ga0105241_10099640 | |||
| 1283 | Ga0105241_10328602 | |||
| 1284 | Ga0105241_11402902 | |||
| 1285 | Ga0105241_11423647 | |||
| 1286 | Ga0105241_12407296 | |||
| 1287 | Ga0105242_10612672 | |||
| 1288 | Ga0105242_11300085 | |||
| 1289 | Ga0105248_10000223 | |||
| 1290 | Ga0105248_10004318 | |||
| 1291 | Ga0105248_10050541 | |||
| 1292 | Ga0105248_11836065 | |||
| 1293 | Ga0105248_12103673 | |||
| 1294 | Ga0105237_10177130 | |||
| 1295 | Ga0105237_10289176 | |||
| 1296 | Ga0105237_12627037 | |||
| 1297 | Ga0105238_10019233 | |||
| 1298 | Ga0105238_10022229 | |||
| 1299 | Ga0105238_10026989 | |||
| 1300 | Ga0105238_10168750 | |||
| 1301 | Ga0105238_10287025 | |||
| 1302 | Ga0105238_10482207 | |||
| 1303 | Ga0105238_10590124 | |||
| 1304 | Ga0105249_10198291 | |||
| 1305 | Ga0105239_10113502 | |||
| 1306 | Ga0105239_10408587 | |||
| 1307 | Ga0105239_10675252 | |||
| 1308 | Ga0105239_10893376 | |||
| 1309 | Ga0105246_10113306 | |||
| 1310 | Ga0105246_10218958 | |||
| 1311 | Ga0157373_10010901 | |||
| 1312 | Ga0157373_10012891 | |||
| 1313 | Ga0157373_10028480 | |||
| 1314 | Ga0157373_10063659 | |||
| 1315 | Ga0157373_10179651 | |||
| 1316 | Ga0157373_10202368 | |||
| 1317 | Ga0157373_10235423 | |||
| 1318 | Ga0157373_10377730 | |||
| 1319 | Ga0157373_10716279 | |||
| 1320 | Ga0157373_10762035 | |||
| 1321 | Ga0157373_11093559 | |||
| 1322 | Ga0157373_11422584 | |||
| 1323 | Ga0157371_10003769 | |||
| 1324 | Ga0157371_10061528 | |||
| 1325 | Ga0157371_10062405 | |||
| 1326 | Ga0157371_10090271 | |||
| 1327 | Ga0157371_10122297 | |||
| 1328 | Ga0157371_10155451 | |||
| 1329 | Ga0157371_10260999 | |||
| 1330 | Ga0157371_10304461 | |||
| 1331 | Ga0157371_11062292 | |||
| 1332 | Ga0157371_11110508 | |||
| 1333 | Ga0157370_10023267 | |||
| 1334 | Ga0157370_10034226 | |||
| 1335 | Ga0157370_10239913 | |||
| 1336 | Ga0157370_10275822 | |||
| 1337 | Ga0157370_10292751 | |||
| 1338 | Ga0157370_10299069 | |||
| 1339 | Ga0157370_10326277 | |||
| 1340 | Ga0157370_10363149 | |||
| 1341 | Ga0157370_10540770 | |||
| 1342 | Ga0157370_10743072 | |||
| 1343 | Ga0157370_10987785 | |||
| 1344 | Ga0157370_11125365 | |||
| 1345 | Ga0157370_11273941 | |||
| 1346 | Ga0157369_10021714 | |||
| 1347 | Ga0157369_10033184 | |||
| 1348 | Ga0157369_10042136 | |||
| 1349 | Ga0157369_10072075 | |||
| 1350 | Ga0157369_10100004 | |||
| 1351 | Ga0157369_10157715 | |||
| 1352 | Ga0157369_10292231 | |||
| 1353 | Ga0157369_10323601 | |||
| 1354 | Ga0157369_10338801 | |||
| 1355 | Ga0157369_10515872 | |||
| 1356 | Ga0157369_10744503 | |||
| 1357 | Ga0157369_10762021 | |||
| 1358 | Ga0157369_11475581 | |||
| 1359 | Ga0157369_12097503 | |||
| 1360 | Ga0157374_10005747 | |||
| 1361 | Ga0157374_10228306 | |||
| 1362 | Ga0157374_10284170 | |||
| 1363 | Ga0157374_10869068 | |||
| 1364 | Ga0157374_11766701 | |||
| 1365 | Ga0157374_12026576 | |||
| 1366 | Ga0157374_12587223 | |||
| 1367 | Ga0157374_12590908 | |||
| 1368 | Ga0157374_12931003 | |||
| 1369 | Ga0157378_10007118 | |||
| 1370 | Ga0157378_10507491 | |||
| 1371 | Ga0157378_10520546 | |||
| 1372 | Ga0163162_10366564 | |||
| 1373 | Ga0163162_10894240 | |||
| 1374 | Ga0163162_11090113 | |||
| 1375 | Ga0163162_13382643 | |||
| 1376 | Ga0157372_10006912 | |||
| 1377 | Ga0157372_10249641 | |||
| 1378 | Ga0157372_10273795 | |||
| 1379 | Ga0157372_10277428 | |||
| 1380 | Ga0157372_10367128 | |||
| 1381 | Ga0157372_10486348 | |||
| 1382 | Ga0157372_10597325 | |||
| 1383 | Ga0157372_10696224 | |||
| 1384 | Ga0157372_11145974 | |||
| 1385 | Ga0157372_11212212 | |||
| 1386 | Ga0157375_10193331 | |||
| 1387 | Ga0157375_10743264 | |||
| 1388 | Ga0157375_13013432 | |||
| 1389 | Ga0163163_10000567 | |||
| 1390 | Ga0163163_10008571 | |||
| 1391 | Ga0163163_10062428 | |||
| 1392 | Ga0182008_10767755 | |||
| 1393 | Ga0157377_10019379 | |||
| 1394 | Ga0157377_10065979 | |||
| 1395 | Ga0157377_10582915 | |||
| 1396 | Ga0157379_10024931 | |||
| 1397 | Ga0157379_10239101 | |||
| 1398 | Ga0157379_10533428 | |||
| 1399 | Ga0157376_10020068 | |||
| 1400 | Ga0157376_11336599 | |||
| 1401 | Ga0163161_10269952 | |||
| 1402 | Ga0197907_10478957 | |||
| 1403 | Ga0206356_11572649 | |||
| 1404 | Ga0206354_10208199 | |||
| 1405 | Ga0206353_10572295 | |||
| 1406 | Ga0206353_11031360 | |||
| 1407 | Ga0154015_1465743 | |||
| 1408 | Ga0207697_10003778 | |||
| 1409 | Ga0207697_10059208 | |||
| 1410 | Ga0207697_10307896 | |||
| 1411 | Ga0207656_10023908 | |||
| 1412 | Ga0207656_10138408 | |||
| 1413 | Ga0207656_10335238 | |||
| 1414 | Ga0207682_10036179 | |||
| 1415 | Ga0207692_10787831 | |||
| 1416 | Ga0207642_10042844 | |||
| 1417 | Ga0207642_10278569 | |||
| 1418 | Ga0207688_10254581 | |||
| 1419 | Ga0207680_10000287 | |||
| 1420 | Ga0207680_10041730 | |||
| 1421 | Ga0207680_10236971 | |||
| 1422 | Ga0207680_10552436 | |||
| 1423 | Ga0207647_10003794 | |||
| 1424 | Ga0207647_10008997 | |||
| 1425 | Ga0207647_10019349 | |||
| 1426 | Ga0207647_10023074 | |||
| 1427 | Ga0207647_10045629 | |||
| 1428 | Ga0207647_10066456 | |||
| 1429 | Ga0207647_10066970 | |||
| 1430 | Ga0207647_10070721 | |||
| 1431 | Ga0207647_10163392 | |||
| 1432 | Ga0207647_10231201 | |||
| 1433 | Ga0207685_10152897 | |||
| 1434 | Ga0207699_10482121 | |||
| 1435 | Ga0207645_10033907 | |||
| 1436 | Ga0207645_10073666 | |||
| 1437 | Ga0207643_10060108 | |||
| 1438 | Ga0207705_10000918 | |||
| 1439 | Ga0207705_10012563 | |||
| 1440 | Ga0207705_10015670 | |||
| 1441 | Ga0207705_10023108 | |||
| 1442 | Ga0207705_10044895 | |||
| 1443 | Ga0207705_10085327 | |||
| 1444 | Ga0207705_10091904 | |||
| 1445 | Ga0207705_10123152 | |||
| 1446 | Ga0207705_10140540 | |||
| 1447 | Ga0207705_10253663 | |||
| 1448 | Ga0207705_10365303 | |||
| 1449 | Ga0207705_10433818 | |||
| 1450 | Ga0207705_10561613 | |||
| 1451 | Ga0207705_10602250 | |||
| 1452 | Ga0207705_10674502 | |||
| 1453 | Ga0207705_11321065 | |||
| 1454 | Ga0207705_11372556 | |||
| 1455 | Ga0207654_10209945 | |||
| 1456 | Ga0207654_10338516 | |||
| 1457 | Ga0207654_10875981 | |||
| 1458 | Ga0207707_10118853 | |||
| 1459 | Ga0207707_10511657 | |||
| 1460 | Ga0207707_10518416 | |||
| 1461 | Ga0207707_11309197 | |||
| 1462 | Ga0207695_10049744 | |||
| 1463 | Ga0207695_10063061 | |||
| 1464 | Ga0207695_10512850 | |||
| 1465 | Ga0207695_11009951 | |||
| 1466 | Ga0207671_10225195 | |||
| 1467 | Ga0207671_11583317 | |||
| 1468 | Ga0207693_11180290 | |||
| 1469 | Ga0207660_10001398 | |||
| 1470 | Ga0207660_10006350 | |||
| 1471 | Ga0207660_10006640 | |||
| 1472 | Ga0207660_10106419 | |||
| 1473 | Ga0207660_10511452 | |||
| 1474 | Ga0207660_10724947 | |||
| 1475 | Ga0207660_10748107 | |||
| 1476 | Ga0207662_10301999 | |||
| 1477 | Ga0207657_10000164 | |||
| 1478 | Ga0207657_10007625 | |||
| 1479 | Ga0207657_10033835 | |||
| 1480 | Ga0207657_10061106 | |||
| 1481 | Ga0207657_10173193 | |||
| 1482 | Ga0207657_10276050 | |||
| 1483 | Ga0207657_10370099 | |||
| 1484 | Ga0207657_10411257 | |||
| 1485 | Ga0207657_10903918 | |||
| 1486 | Ga0207657_11405103 | |||
| 1487 | Ga0207657_11437389 | |||
| 1488 | Ga0207649_10000580 | |||
| 1489 | Ga0207649_10022229 | |||
| 1490 | Ga0207649_10045008 | |||
| 1491 | Ga0207649_10136792 | |||
| 1492 | Ga0207649_10245683 | |||
| 1493 | Ga0207649_10334684 | |||
| 1494 | Ga0207649_10769729 | |||
| 1495 | Ga0207649_10895062 | |||
| 1496 | Ga0207649_11148704 | |||
| 1497 | Ga0207649_11649739 | |||
| 1498 | Ga0207652_10132261 | |||
| 1499 | Ga0207652_10366114 | |||
| 1500 | Ga0207652_10479551 | |||
| 1501 | Ga0207652_10854953 | |||
| 1502 | Ga0207652_11003061 | |||
| 1503 | Ga0207652_11119167 | |||
| 1504 | Ga0207652_11701178 | |||
| 1505 | Ga0207694_10049595 | |||
| 1506 | Ga0207694_10158941 | |||
| 1507 | Ga0207694_10492265 | |||
| 1508 | Ga0207694_10521014 | |||
| 1509 | Ga0207650_10138526 | |||
| 1510 | Ga0207650_10393342 | |||
| 1511 | Ga0207650_10470169 | |||
| 1512 | Ga0207650_10539614 | |||
| 1513 | Ga0207650_10576611 | |||
| 1514 | Ga0207650_11133076 | |||
| 1515 | Ga0207687_10036427 | |||
| 1516 | Ga0207687_10250839 | |||
| 1517 | Ga0207687_10345042 | |||
| 1518 | Ga0207700_10396930 | |||
| 1519 | Ga0207700_10941376 | |||
| 1520 | Ga0207664_10084768 | |||
| 1521 | Ga0207664_10089287 | |||
| 1522 | Ga0207664_10135833 | |||
| 1523 | Ga0207664_10180777 | |||
| 1524 | Ga0207664_10320700 | |||
| 1525 | Ga0207644_10005888 | |||
| 1526 | Ga0207644_10006480 | |||
| 1527 | Ga0207644_10016999 | |||
| 1528 | Ga0207644_10071350 | |||
| 1529 | Ga0207644_10181759 | |||
| 1530 | Ga0207644_10292406 | |||
| 1531 | Ga0207644_10516442 | |||
| 1532 | Ga0207690_10000800 | |||
| 1533 | Ga0207690_10018159 | |||
| 1534 | Ga0207690_10020753 | |||
| 1535 | Ga0207690_10042089 | |||
| 1536 | Ga0207690_10051299 | |||
| 1537 | Ga0207690_10094844 | |||
| 1538 | Ga0207690_10211186 | |||
| 1539 | Ga0207690_10274819 | |||
| 1540 | Ga0207690_10281564 | |||
| 1541 | Ga0207690_10297109 | |||
| 1542 | Ga0207690_11423640 | |||
| 1543 | Ga0207706_10000196 | |||
| 1544 | Ga0207706_10003926 | |||
| 1545 | Ga0207706_10013419 | |||
| 1546 | Ga0207706_10034227 | |||
| 1547 | Ga0207706_10134560 | |||
| 1548 | Ga0207706_10178221 | |||
| 1549 | Ga0207706_10337841 | |||
| 1550 | Ga0207706_10378266 | |||
| 1551 | Ga0207706_10562754 | |||
| 1552 | Ga0207686_10028787 | |||
| 1553 | Ga0207709_10195001 | |||
| 1554 | Ga0207709_10690821 | |||
| 1555 | Ga0207670_10419432 | |||
| 1556 | Ga0207669_10005269 | |||
| 1557 | Ga0207669_10009926 | |||
| 1558 | Ga0207669_11229098 | |||
| 1559 | Ga0207704_10007617 | |||
| 1560 | Ga0207704_11158538 | |||
| 1561 | Ga0207704_11738527 | |||
| 1562 | Ga0207665_10009018 | |||
| 1563 | Ga0207691_10002202 | |||
| 1564 | Ga0207691_10092007 | |||
| 1565 | Ga0207691_10110841 | |||
| 1566 | Ga0207691_10558306 | |||
| 1567 | Ga0207711_10000698 | |||
| 1568 | Ga0207711_10002328 | |||
| 1569 | Ga0207711_10045200 | |||
| 1570 | Ga0207661_10003155 | |||
| 1571 | Ga0207661_10007562 | |||
| 1572 | Ga0207661_10438241 | |||
| 1573 | Ga0207661_10477090 | |||
| 1574 | Ga0207679_10001145 | |||
| 1575 | Ga0207679_10112924 | |||
| 1576 | Ga0207679_10203180 | |||
| 1577 | Ga0207679_10220290 | |||
| 1578 | Ga0207679_10364540 | |||
| 1579 | Ga0207679_11014433 | |||
| 1580 | Ga0207667_10001975 | |||
| 1581 | Ga0207667_10018331 | |||
| 1582 | Ga0207667_10023290 | |||
| 1583 | Ga0207667_10053191 | |||
| 1584 | Ga0207667_10067034 | |||
| 1585 | Ga0207667_10156891 | |||
| 1586 | Ga0207667_10296202 | |||
| 1587 | Ga0207667_11261599 | |||
| 1588 | Ga0207651_10115111 | |||
| 1589 | Ga0207651_10175477 | |||
| 1590 | Ga0207651_10177634 | |||
| 1591 | Ga0207651_10200657 | |||
| 1592 | Ga0207651_11072316 | |||
| 1593 | Ga0207651_11460592 | |||
| 1594 | Ga0207640_10005994 | |||
| 1595 | Ga0207640_10346299 | |||
| 1596 | Ga0207640_10714884 | |||
| 1597 | Ga0207640_10783481 | |||
| 1598 | Ga0207640_11093532 | |||
| 1599 | Ga0207640_11678701 | |||
| 1600 | Ga0207658_10005314 | |||
| 1601 | Ga0207658_10175377 | |||
| 1602 | Ga0207658_10581622 | |||
| 1603 | Ga0207658_10636090 | |||
| 1604 | Ga0207677_10018678 | |||
| 1605 | Ga0207677_10180194 | |||
| 1606 | Ga0207703_10003591 | |||
| 1607 | Ga0207703_10024596 | |||
| 1608 | Ga0207703_10211821 | |||
| 1609 | Ga0207703_10588425 | |||
| 1610 | Ga0207639_10001229 | |||
| 1611 | Ga0207639_10061145 | |||
| 1612 | Ga0207639_10094925 | |||
| 1613 | Ga0207639_10248525 | |||
| 1614 | Ga0207639_10429037 | |||
| 1615 | Ga0207639_10655179 | |||
| 1616 | Ga0207639_10670197 | |||
| 1617 | Ga0207639_10698357 | |||
| 1618 | Ga0207639_11519495 | |||
| 1619 | Ga0207639_11893089 | |||
| 1620 | Ga0207678_10024328 | |||
| 1621 | Ga0207678_10031160 | |||
| 1622 | Ga0207678_10050837 | |||
| 1623 | Ga0207678_10085319 | |||
| 1624 | Ga0207678_10097767 | |||
| 1625 | Ga0207678_10208546 | |||
| 1626 | Ga0207678_10639422 | |||
| 1627 | Ga0207702_10000435 | |||
| 1628 | Ga0207702_10043242 | |||
| 1629 | Ga0207702_10043415 | |||
| 1630 | Ga0207702_10170790 | |||
| 1631 | Ga0207702_10324304 | |||
| 1632 | Ga0207702_10458873 | |||
| 1633 | Ga0207702_10686697 | |||
| 1634 | Ga0207702_11178948 | |||
| 1635 | Ga0207702_11634994 | |||
| 1636 | Ga0207641_10033682 | |||
| 1637 | Ga0207641_10240094 | |||
| 1638 | Ga0207641_10509249 | |||
| 1639 | Ga0207641_10689133 | |||
| 1640 | Ga0207648_10001874 | |||
| 1641 | Ga0207648_10008888 | |||
| 1642 | Ga0207648_10154875 | |||
| 1643 | Ga0207648_11654631 | |||
| 1644 | Ga0207676_10177325 | |||
| 1645 | Ga0207676_10219653 | |||
| 1646 | Ga0207676_10673513 | |||
| 1647 | Ga0207676_11140898 | |||
| 1648 | Ga0207674_10000756 | |||
| 1649 | Ga0207674_10003272 | |||
| 1650 | Ga0207674_10056300 | |||
| 1651 | Ga0207674_10061108 | |||
| 1652 | Ga0207674_10779655 | |||
| 1653 | Ga0207674_10868806 | |||
| 1654 | Ga0207675_100124947 | |||
| 1655 | Ga0207683_10013533 | |||
| 1656 | Ga0207683_10014201 | |||
| 1657 | Ga0207683_10344798 | |||
| 1658 | Ga0207698_10001464 | |||
| 1659 | Ga0207698_10003125 | |||
| 1660 | Ga0207698_10003161 | |||
| 1661 | Ga0207698_10013595 | |||
| 1662 | Ga0207698_10017161 | |||
| 1663 | Ga0207698_10042185 | |||
| 1664 | Ga0207698_10105002 | |||
| 1665 | Ga0207698_10112025 | |||
| 1666 | Ga0207698_10749205 | |||
| 1667 | Ga0207698_10942604 | |||
| 1668 | Ga0207698_11250480 | |||
| 1669 | Ga0207698_11598902 | |||
| 1670 | Ga0268266_10008238 | |||
| 1671 | Ga0268266_10106998 | |||
| 1672 | Ga0268266_10368764 | |||
| 1673 | Ga0268266_10440684 | |||
| 1674 | Ga0268266_11218970 | |||
| 1675 | Ga0268264_10492551 | |||
| 1676 | Ga0307410_10006430 | |||
| 1677 | Ga0307414_11402617 | |||
| 1678 | Ga0307411_11247616 | |||
| 1679 | Ga0373938_0006944 | |||
| 1680 | Ga0373949_0068215 | |||
| 1681 | Ga0373952_0154150 | |||
| 1682 | Ga0373941_0026486 | |||
| 1683 | Ga0373946_0387157 | |||
| 1684 | Ga0373955_0049871 | |||
| 1685 | Ga0373961_0192424 | |||
| 1686 | Ga0373931_0015714 | |||
| 1687 | Ga0373931_0159163 | |||
| 1688 | Ga0373935_0019409 | |||
| 1689 | Ga0373935_0932790 | |||
| 1690 | Ga0373933_0602993 | |||
| 1691 | Ga0373947_0076420 | |||
| 1692 | Ga0373937_0076548 | |||
| 1693 | Ga0373925_0180268 | |||
| 1694 | Ga0395899_0028811 | |||
| 1695 | Ga0395899_0037566 | |||
| 1696 | Ga0395899_0057768 | |||
| 1697 | Ga0395899_0061643 | |||
| 1698 | Ga0395899_0094928 | |||
| 1699 | Ga0395899_0141785 | |||
| 1700 | Ga0395899_0177513 | |||
| 1701 | Ga0395899_0185988 | |||
| 1702 | Ga0395899_0223151 | |||
| 1703 | Ga0395899_0368600 | |||
| 1704 | Ga0395899_0461055 | |||
| 1705 | Ga0395899_0464567 | |||
| 1706 | Ga0395900_0000968 | |||
| 1707 | Ga0395900_0023882 | |||
| 1708 | Ga0395900_0032807 | |||
| 1709 | Ga0395900_0063743 | |||
| 1710 | Ga0395900_0066736 | |||
| 1711 | Ga0395900_0101219 | |||
| 1712 | Ga0395900_0115340 | |||
| 1713 | Ga0395900_0121333 | |||
| 1714 | Ga0395900_0178814 | |||
| 1715 | Ga0395900_0189284 | |||
| 1716 | Ga0395900_0256630 | |||
| 1717 | Ga0395900_0336599 | |||
| 1718 | Ga0395900_0341256 | |||
| 1719 | Ga0395900_0382138 | |||
| 1720 | Ga0395900_0415746 | |||
| 1721 | Ga0395900_0534741 | |||
| 1722 | Ga0395900_0572950 | |||
| 1723 | Ga0395900_0598419 | |||
| 1724 | Ga0395900_0692685 | |||
| 1725 | Ga0395900_0769337 | |||
| 1726 | Ga0395900_1051818 | |||
| 1727 | Ga0395900_1064365 | |||
| 1728 | Ga0395900_1229547 | |||
| 1729 | Ga0395900_1580847 | |||
| 1730 | Ga0395900_1680963 | |||
| 1731 | Ga0395898_0041568 | |||
| 1732 | Ga0395898_0050167 | |||
| 1733 | Ga0395898_0112662 | |||
| 1734 | Ga0395898_0174407 | |||
| 1735 | Ga0395898_0216214 | |||
| 1736 | Ga0395898_0290430 | |||
| 1737 | Ga0395898_0324906 | |||
| 1738 | Ga0395898_0444387 | |||
| 1739 | Ga0395898_0693158 | |||
| 1740 | Ga0395898_0779910 | |||
| 1741 | Ga0395898_0938688 | |||
| 1742 | Ga0395898_0956398 | |||
| 1743 | Ga0395898_1089494 | |||
| 1744 | Ga0395905_0000735 | |||
| 1745 | Ga0395905_0002672 | |||
| 1746 | Ga0395905_0003694 | |||
| 1747 | Ga0395905_0004891 | |||
| 1748 | Ga0395905_0008410 | |||
| 1749 | Ga0395905_0012725 | |||
| 1750 | Ga0395905_0017502 | |||
| 1751 | Ga0395905_0028144 | |||
| 1752 | Ga0395905_0063359 | |||
| 1753 | Ga0395905_0101267 | |||
| 1754 | Ga0395905_0140417 | |||
| 1755 | Ga0395905_0142939 | |||
| 1756 | Ga0395905_0152396 | |||
| 1757 | Ga0395905_0161533 | |||
| 1758 | Ga0395905_0166807 | |||
| 1759 | Ga0395905_0222029 | |||
| 1760 | Ga0395905_0228417 | |||
| 1761 | Ga0395905_0236847 | |||
| 1762 | Ga0395905_0260416 | |||
| 1763 | Ga0395905_0288990 | |||
| 1764 | Ga0395905_0318230 | |||
| 1765 | Ga0395905_0326290 | |||
| 1766 | Ga0395905_0342052 | |||
| 1767 | Ga0395905_0376406 | |||
| 1768 | Ga0395905_0451104 | |||
| 1769 | Ga0395905_0642354 | |||
| 1770 | Ga0395905_0697385 | |||
| 1771 | Ga0395905_0786718 | |||
| 1772 | Ga0395905_1122646 | |||
| 1773 | Ga0395905_1337753 | |||
| 1774 | Ga0395905_1345400 | |||
| 1775 | Ga0395905_1764064 | |||
| 1776 | Ga0395901_0001666 | |||
| 1777 | Ga0395901_0021575 | |||
| 1778 | Ga0395901_0024408 | |||
| 1779 | Ga0395901_0042065 | |||
| 1780 | Ga0395901_0066183 | |||
| 1781 | Ga0395901_0072397 | |||
| 1782 | Ga0395901_0100300 | |||
| 1783 | Ga0395901_0161583 | |||
| 1784 | Ga0395901_0176174 | |||
| 1785 | Ga0395901_0310737 | |||
| 1786 | Ga0395901_0312403 | |||
| 1787 | Ga0395901_0312815 | |||
| 1788 | Ga0395901_0353680 | |||
| 1789 | Ga0395901_0446407 | |||
| 1790 | Ga0395901_0461646 | |||
| 1791 | Ga0395901_0494669 | |||
| 1792 | Ga0395901_0565992 | |||
| 1793 | Ga0395901_0566540 | |||
| 1794 | Ga0395901_0593752 | |||
| 1795 | Ga0395901_0805085 | |||
| 1796 | Ga0395901_1547457 | |||
| 1797 | Ga0439448_0006644 | |||
| 1798 | Ga0439448_0328268 | |||
| 1799 | Ga0439455_0107494 | |||
| 1800 | Ga0439458_0000453 | |||
| 1801 | Ga0466972_0033759 | |||
| 1802 | Ga0466965_0139515 | |||
| 1803 | Ga0466965_0284410 | |||
| 1804 | Ga0466965_0456871 | |||
| 1805 | Ga0466965_0821532 | |||
| 1806 | Ga0466966_0379991 | |||
| 1807 | Ga0466966_0517702 | |||
| 1808 | Ga0466963_0010124 | |||
| 1809 | Ga0466963_0050703 | |||
| 1810 | Ga0466963_0103589 | |||
| 1811 | Ga0466963_0269818 | |||
| 1812 | Ga0466963_0710480 | |||
| 1813 | Ga0466964_0361377 | |||
| 1814 | Ga0466971_0072186 | |||
| 1815 | Ga0466970_0010656 | |||
| 1816 | Ga0466970_0609497 | |||
| 1817 | Ga0466957_0056794 | |||
| 1818 | Ga0466957_0207915 | |||
| 1819 | Ga0466957_0547203 | |||
| 1820 | Ga0466960_0060572 | |||
| 1821 | Ga0466959_0167747 | |||
| 1822 | Ga0466959_0774549 | |||
| 1823 | Ga0466958_0162475 | |||
| 1824 | Ga0466958_0179127 | |||
| 1825 | Ga0466958_0811361 | |||
| 1826 | Ga0466967_0107054 | |||
| 1827 | Ga0466967_0171399 | |||
| 1828 | Ga0466967_0197445 | |||
| 1829 | Ga0466967_0215753 | |||
| 1830 | Ga0466967_0244191 | |||
| 1831 | Ga0466967_0525779 | |||
| 1832 | Ga0466967_0705137 | |||
| 1833 | Ga0466967_1006508 | |||
| 1834 | Ga0466967_1008410 | |||
| 1835 | Ga0466967_1065187 | |||
| 1836 | Ga0466967_1634347 | |||
| 1837 | Ga0495621_0037949 | |||
| 1838 | Ga0495597_0068625 | |||
| 1839 | Ga0495669_0236115 | |||
| 1840 | Ga0495669_0663752 | |||
| 1841 | Ga0495687_060666 | |||
| 1842 | Ga0495677_0277453 | |||
| 1843 | Ga0495593_0404834 | |||
| 1844 | Ga0495602_0049589 | |||
| 1845 | Ga0496100_0011923 | |||
| 1846 | Ga0496101_0007221 | |||
| 1847 | Ga0496102_1290225 | |||
| 1848 | Ga0496103_0017726 | |||
| 1849 | Ga0496106_0415573 | |||
| 1850 | Ga0496107_0020486 | |||
| 1851 | Ga0496107_0367019 | |||
| 1852 | Ga0496107_0850343 | |||
| 1853 | Ga0496108_0041843 | |||
| 1854 | Ga0496108_0672418 | |||
| 1855 | Ga0496109_0139509 | |||
| 1856 | Ga0496110_0488178 | |||
| 1857 | Ga0496111_0005109 | |||
| 1858 | Ga0496111_0020626 | |||
| 1859 | Ga0496111_0655373 | |||
| 1860 | Ga0496112_0005386 | |||
| 1861 | Ga0496112_0111099 | |||
| 1862 | Ga0496112_0356227 | |||
| 1863 | Ga0496112_0458429 | |||
| 1864 | Ga0496112_1458857 | |||
| 1865 | Ga0496112_1891247 | |||
| 1866 | Ga0496113_0026435 | |||
| 1867 | Ga0496114_0040037 | |||
| 1868 | Ga0496115_0001337 | |||
| 1869 | Ga0501068_1137511 | |||
| 1870 | Ga0501069_0763583 | |||
| 1871 | Ga0501233_117199 | |||
| 1872 | Ga0501249_044547 | |||
| 1873 | Ga0501245_017590 | |||
| 1874 | Ga0501268_064558 | |||
| 1875 | nmdc:mga0k408_554028_c1 | |||
| 1876 | Ga0466962_0026319 | |||
| 1877 | Ga0466962_0081554 | |||
| 1878 | Ga0466962_0229920 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3vr5-assembly1.cif.gz_F | crystal structure of nucleotide-free enterococcus hirae v1-atpase [ev1(l)] | 0.859 | 34 | 82 |
| 8igv-assembly1.cif.gz_D | hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat | 0.8578 | 34 | 82 |
| 8igv-assembly1.cif.gz_E | hexameric ring complex of engineered v1-atpase bound to 5 adps: a3(de)3_(adp-pi)1cat(adp)2cat,2non-cat | 0.8567 | 34 | 82 |
| 7mie-assembly1.cif.gz_A | crystal structure of the borreliella burgdorferi plza protein in complex with c-di-gmp | 0.8539 | 17 | 82 |
| 7vw7-assembly1.cif.gz_D | crystal structure of the 2 adp-alf4-bound v1 complex | 0.8508 | 34 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5kndD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8494 | 34 | 82 | 3.40.50.12240 |
| 4i86B00 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.8353 | 15 | 86 | 2.40.10.220 |
| af_A0A1D6GI91_64_262_3.40.1280.10 | Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain | 0.8223 | 50 | 84 | 3.40.1280.10 |
| af_P37653_690_796_2.40.10.220 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.8148 | 8 | 87 | 2.40.10.220 |
| 3kygA02 | Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains | 0.8111 | 15 | 86 | 2.40.10.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C2UAH2-F1-model_v4 | PilZ domain-containing protein | 0.9707 | 15 | 84 |
GO:0035438
|
| AF-A0A839Z112-F1-model_v4 | PilZ domain-containing protein | 0.9605 | 15 | 84 |
GO:0035438
|
| AF-A0A7W9B9Z6-F1-model_v4 | PilZ domain-containing protein | 0.9462 | 15 | 82 |
GO:0035438
|
| AF-A0A0Q4I5Z3-F1-model_v4 | deleted | 0.9456 | 17 | 82 |
|
| AF-A0A537MGI1-F1-model_v4 | PilZ domain-containing protein | 0.9446 | 15 | 82 |
GO:0035438
|