F486187
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 936 | 313 | 1872 | 215 |
Family's Representative Sequence
| Representative Sequence | 3300000546|LJNas_1002114|LJNas_10021142 |
| Length | 257 |
| Sequence | MTWTSAFGRGCGVILQAIVNGLALTRISPNVLTFIGLVINTGAAIFFGFANSHNYVRFFLYAGLVIIGAGIFDMVDGRVARQTDQVTVFGAFFDSVIDRYSDVVLFLGLLVFYARGNRFFYVVLTAFVMITSLMVSYTRARSEALIGSCKVGFMERPERVVLIILGALFERWDAMAPALWVLAVLSTITVIHRISYTYTMSKGLRLDAPAAVTSTLISEAQPTPIRPAARPGPVSGTASVSAAEQHELLSAPNAPRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 100 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 101 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 164 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300031010 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 168 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 169 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 173 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 174 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 175 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 183 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 185 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 186 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 187 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 191 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 192 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 196 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 197 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 198 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 199 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 204 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 207 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 208 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 267 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 270 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 271 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 272 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 273 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 274 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 277 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 279 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 280 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 295 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 297 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 303 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 304 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.65 |
| Metatranscriptomes | 2.24 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.43 |
| Nodule | 0 |
| Rhizoplane | 4.38 |
| Rhizosphere | 93.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1002114 | 3300000546 | Bacteria | 2499 |
| 2 | LJNas_1002119 | 3300000546 | Bacteria | 2493 |
| 3 | rootH2_10180936 | 3300003320 | Bacteria | 1743 |
| 4 | rootH1_10163155 | 3300003323 | Bacteria | 1288 |
| 5 | Ga0058863_10169021 | 3300004799 | Bacteria | 4875 |
| 6 | Ga0058861_10010007 | 3300004800 | Bacteria | 3303 |
| 7 | Ga0058862_10206145 | 3300004803 | Unclassified | 1911 |
| 8 | Ga0070658_10000127 | 3300005327 | Bacteria | 67777 |
| 9 | Ga0070658_10005926 | 3300005327 | Bacteria | 9916 |
| 10 | Ga0070658_10012417 | 3300005327 | Bacteria | 6835 |
| 11 | Ga0070658_10027405 | 3300005327 | Bacteria | 4572 |
| 12 | Ga0070658_10049018 | 3300005327 | Bacteria | 3421 |
| 13 | Ga0070658_10155821 | 3300005327 | Bacteria | 1915 |
| 14 | Ga0070658_10194039 | 3300005327 | Bacteria | 1712 |
| 15 | Ga0070658_10242843 | 3300005327 | Unclassified | 1526 |
| 16 | Ga0070658_10274348 | 3300005327 | Bacteria | 1435 |
| 17 | Ga0070658_10761058 | 3300005327 | Bacteria | 841 |
| 18 | Ga0070683_100027547 | 3300005329 | Bacteria | 5126 |
| 19 | Ga0070683_100056915 | 3300005329 | Bacteria | 3631 |
| 20 | Ga0070683_100137189 | 3300005329 | Unclassified | 2317 |
| 21 | Ga0070683_100149503 | 3300005329 | Bacteria | 2214 |
| 22 | Ga0070683_100164107 | 3300005329 | Bacteria | 2108 |
| 23 | Ga0070683_100223887 | 3300005329 | Bacteria | 1788 |
| 24 | Ga0070683_100228318 | 3300005329 | Bacteria | 1770 |
| 25 | Ga0070683_100286227 | 3300005329 | Bacteria | 1568 |
| 26 | Ga0070683_100366160 | 3300005329 | Bacteria | 1373 |
| 27 | Ga0070683_100418645 | 3300005329 | Unclassified | 1278 |
| 28 | Ga0070670_100002219 | 3300005331 | Bacteria | 15961 |
| 29 | Ga0070670_100219085 | 3300005331 | Unclassified | 1655 |
| 30 | Ga0070670_100240335 | 3300005331 | Bacteria | 1577 |
| 31 | Ga0068869_100033425 | 3300005334 | Bacteria | 3631 |
| 32 | Ga0070666_10018134 | 3300005335 | Bacteria | 4521 |
| 33 | Ga0070666_10203719 | 3300005335 | Bacteria | 1392 |
| 34 | Ga0070680_100024372 | 3300005336 | Bacteria | 4833 |
| 35 | Ga0070680_100035320 | 3300005336 | Bacteria | 4035 |
| 36 | Ga0070680_100203560 | 3300005336 | Bacteria | 1669 |
| 37 | Ga0070680_100390111 | 3300005336 | Unclassified | 1186 |
| 38 | Ga0068868_100028922 | 3300005338 | Bacteria | 4242 |
| 39 | Ga0068868_100077548 | 3300005338 | Unclassified | 2658 |
| 40 | Ga0068868_100274002 | 3300005338 | Bacteria | 1426 |
| 41 | Ga0070660_100008310 | 3300005339 | Bacteria | 7256 |
| 42 | Ga0070660_100068432 | 3300005339 | Bacteria | 2767 |
| 43 | Ga0070660_100218581 | 3300005339 | Bacteria | 1548 |
| 44 | Ga0070660_100358250 | 3300005339 | Bacteria | 1202 |
| 45 | Ga0070661_100009496 | 3300005344 | Bacteria | 6738 |
| 46 | Ga0070661_100012609 | 3300005344 | Bacteria | 5915 |
| 47 | Ga0070661_100013673 | 3300005344 | Bacteria | 5700 |
| 48 | Ga0070668_100310919 | 3300005347 | Unclassified | 1324 |
| 49 | Ga0070669_100316061 | 3300005353 | Unclassified | 1260 |
| 50 | Ga0070675_100023019 | 3300005354 | Bacteria | 4977 |
| 51 | Ga0070671_100010048 | 3300005355 | Bacteria | 7602 |
| 52 | Ga0070671_100014408 | 3300005355 | Bacteria | 6387 |
| 53 | Ga0070671_100255009 | 3300005355 | Unclassified | 1490 |
| 54 | Ga0070673_100011090 | 3300005364 | Bacteria | 6142 |
| 55 | Ga0070659_100000543 | 3300005366 | Bacteria | 27518 |
| 56 | Ga0070659_100035327 | 3300005366 | Bacteria | 3892 |
| 57 | Ga0070659_100057835 | 3300005366 | Bacteria | 3058 |
| 58 | Ga0070659_100305228 | 3300005366 | Unclassified | 1328 |
| 59 | Ga0070667_100012156 | 3300005367 | Bacteria | 7125 |
| 60 | Ga0070667_100121784 | 3300005367 | Bacteria | 2269 |
| 61 | Ga0070667_100241161 | 3300005367 | Bacteria | 1614 |
| 62 | Ga0070709_10030959 | 3300005434 | Bacteria | 3215 |
| 63 | Ga0070714_100031767 | 3300005435 | Bacteria | 4407 |
| 64 | Ga0070714_100110219 | 3300005435 | Bacteria | 2436 |
| 65 | Ga0070714_100292635 | 3300005435 | Bacteria | 1516 |
| 66 | Ga0070713_100003297 | 3300005436 | Bacteria | 10639 |
| 67 | Ga0070713_100067778 | 3300005436 | Bacteria | 3006 |
| 68 | Ga0070713_100104847 | 3300005436 | Unclassified | 2455 |
| 69 | Ga0070713_100150844 | 3300005436 | Bacteria | 2068 |
| 70 | Ga0070713_100431299 | 3300005436 | Unclassified | 1235 |
| 71 | Ga0070713_100459287 | 3300005436 | Bacteria | 1197 |
| 72 | Ga0070713_100743432 | 3300005436 | Bacteria | 938 |
| 73 | Ga0070710_10001087 | 3300005437 | Bacteria | 12871 |
| 74 | Ga0070710_10025739 | 3300005437 | Bacteria | 3118 |
| 75 | Ga0070710_10351578 | 3300005437 | Bacteria | 976 |
| 76 | Ga0070711_100012475 | 3300005439 | Bacteria | 5311 |
| 77 | Ga0070711_100207321 | 3300005439 | Bacteria | 1516 |
| 78 | Ga0070708_100019770 | 3300005445 | Bacteria | 5665 |
| 79 | Ga0070708_100047654 | 3300005445 | Bacteria | 3786 |
| 80 | Ga0070708_100087170 | 3300005445 | Unclassified | 2836 |
| 81 | Ga0070663_100020176 | 3300005455 | Bacteria | 4408 |
| 82 | Ga0070663_100031510 | 3300005455 | Bacteria | 3644 |
| 83 | Ga0070663_100526784 | 3300005455 | Bacteria | 985 |
| 84 | Ga0070663_100786076 | 3300005455 | Unclassified | 815 |
| 85 | Ga0070678_100010783 | 3300005456 | Bacteria | 5601 |
| 86 | Ga0070678_100654327 | 3300005456 | Unclassified | 943 |
| 87 | Ga0070662_100037880 | 3300005457 | Bacteria | 3421 |
| 88 | Ga0070662_100075543 | 3300005457 | Bacteria | 2495 |
| 89 | Ga0070681_10003504 | 3300005458 | Bacteria | 14696 |
| 90 | Ga0070681_10009038 | 3300005458 | Bacteria | 9791 |
| 91 | Ga0070681_10089820 | 3300005458 | Bacteria | 3023 |
| 92 | Ga0070681_10101063 | 3300005458 | Bacteria | 2829 |
| 93 | Ga0070681_10129621 | 3300005458 | Unclassified | 2454 |
| 94 | Ga0070681_10167896 | 3300005458 | Bacteria | 2117 |
| 95 | Ga0070681_10171172 | 3300005458 | Bacteria | 2094 |
| 96 | Ga0070681_10259050 | 3300005458 | Bacteria | 1651 |
| 97 | Ga0070681_10261677 | 3300005458 | Bacteria | 1642 |
| 98 | Ga0070681_10317772 | 3300005458 | Bacteria | 1467 |
| 99 | Ga0070681_10366738 | 3300005458 | Bacteria | 1350 |
| 100 | Ga0070681_10430514 | 3300005458 | Bacteria | 1231 |
| 101 | Ga0070681_10789321 | 3300005458 | Bacteria | 866 |
| 102 | Ga0070706_100182487 | 3300005467 | Bacteria | 1960 |
| 103 | Ga0070707_100397264 | 3300005468 | Bacteria | 1339 |
| 104 | Ga0070699_100012791 | 3300005518 | Bacteria | 7234 |
| 105 | Ga0070679_100000142 | 3300005530 | Bacteria | 58286 |
| 106 | Ga0070679_100016723 | 3300005530 | Bacteria | 7087 |
| 107 | Ga0070679_100056106 | 3300005530 | Bacteria | 3924 |
| 108 | Ga0070679_100064308 | 3300005530 | Bacteria | 3656 |
| 109 | Ga0070679_100110681 | 3300005530 | Bacteria | 2733 |
| 110 | Ga0070679_100208872 | 3300005530 | Bacteria | 1917 |
| 111 | Ga0070679_100240901 | 3300005530 | Bacteria | 1766 |
| 112 | Ga0070679_100247945 | 3300005530 | Bacteria | 1737 |
| 113 | Ga0070679_100250736 | 3300005530 | Bacteria | 1726 |
| 114 | Ga0070684_100002371 | 3300005535 | Bacteria | 13891 |
| 115 | Ga0070684_100047389 | 3300005535 | Bacteria | 3724 |
| 116 | Ga0070684_100066748 | 3300005535 | Bacteria | 3158 |
| 117 | Ga0070684_100240322 | 3300005535 | Bacteria | 1655 |
| 118 | Ga0070684_100303732 | 3300005535 | Bacteria | 1465 |
| 119 | Ga0070684_100368000 | 3300005535 | Bacteria | 1323 |
| 120 | Ga0070684_100561323 | 3300005535 | Unclassified | 1060 |
| 121 | Ga0070684_100677841 | 3300005535 | Unclassified | 960 |
| 122 | Ga0070697_100083263 | 3300005536 | Unclassified | 2638 |
| 123 | Ga0068853_100000049 | 3300005539 | Bacteria | 90347 |
| 124 | Ga0068853_100010059 | 3300005539 | Bacteria | 7640 |
| 125 | Ga0068853_100018922 | 3300005539 | Bacteria | 5704 |
| 126 | Ga0068853_100080816 | 3300005539 | Bacteria | 2845 |
| 127 | Ga0068853_100088219 | 3300005539 | Bacteria | 2723 |
| 128 | Ga0068853_100092171 | 3300005539 | Bacteria | 2665 |
| 129 | Ga0068853_100142180 | 3300005539 | Bacteria | 2155 |
| 130 | Ga0068853_100157505 | 3300005539 | Bacteria | 2047 |
| 131 | Ga0068853_100241265 | 3300005539 | Bacteria | 1656 |
| 132 | Ga0068853_100462788 | 3300005539 | Bacteria | 1194 |
| 133 | Ga0070672_100013876 | 3300005543 | Bacteria | 5699 |
| 134 | Ga0070696_100412958 | 3300005546 | Unclassified | 1058 |
| 135 | Ga0070693_100049914 | 3300005547 | Bacteria | 2389 |
| 136 | Ga0070693_100230371 | 3300005547 | Unclassified | 1218 |
| 137 | Ga0070693_100537021 | 3300005547 | Bacteria | 835 |
| 138 | Ga0070693_100707817 | 3300005547 | Bacteria | 738 |
| 139 | Ga0070665_100056890 | 3300005548 | Bacteria | 3921 |
| 140 | Ga0070665_100067885 | 3300005548 | Bacteria | 3575 |
| 141 | Ga0070665_100117300 | 3300005548 | Bacteria | 2664 |
| 142 | Ga0070665_100153535 | 3300005548 | Bacteria | 2304 |
| 143 | Ga0070665_100171343 | 3300005548 | Bacteria | 2171 |
| 144 | Ga0070665_100303658 | 3300005548 | Bacteria | 1599 |
| 145 | Ga0070665_100636490 | 3300005548 | Bacteria | 1080 |
| 146 | Ga0068855_100022355 | 3300005563 | Bacteria | 7578 |
| 147 | Ga0068855_100023539 | 3300005563 | Bacteria | 7375 |
| 148 | Ga0068855_100035182 | 3300005563 | Bacteria | 5966 |
| 149 | Ga0068855_100037164 | 3300005563 | Bacteria | 5793 |
| 150 | Ga0068855_100055757 | 3300005563 | Bacteria | 4640 |
| 151 | Ga0068855_100078538 | 3300005563 | Bacteria | 3828 |
| 152 | Ga0068855_100080052 | 3300005563 | Bacteria | 3788 |
| 153 | Ga0068855_100084975 | 3300005563 | Bacteria | 3662 |
| 154 | Ga0068855_100106836 | 3300005563 | Bacteria | 3216 |
| 155 | Ga0068855_100311221 | 3300005563 | Bacteria | 1742 |
| 156 | Ga0068855_100364912 | 3300005563 | Bacteria | 1588 |
| 157 | Ga0070664_100057431 | 3300005564 | Bacteria | 3308 |
| 158 | Ga0070664_100184694 | 3300005564 | Bacteria | 1855 |
| 159 | Ga0070664_100273595 | 3300005564 | Bacteria | 1522 |
| 160 | Ga0070664_100541751 | 3300005564 | Bacteria | 1076 |
| 161 | Ga0068857_100000158 | 3300005577 | Bacteria | 42040 |
| 162 | Ga0068857_100004818 | 3300005577 | Bacteria | 11435 |
| 163 | Ga0068857_100082502 | 3300005577 | Bacteria | 2872 |
| 164 | Ga0068857_100162791 | 3300005577 | Bacteria | 2025 |
| 165 | Ga0068857_100228357 | 3300005577 | Unclassified | 1702 |
| 166 | Ga0068857_100232001 | 3300005577 | Bacteria | 1688 |
| 167 | Ga0068854_100000055 | 3300005578 | Bacteria | 83740 |
| 168 | Ga0068854_100007803 | 3300005578 | Bacteria | 6846 |
| 169 | Ga0068854_100064011 | 3300005578 | Bacteria | 2671 |
| 170 | Ga0068854_100503875 | 3300005578 | Bacteria | 1020 |
| 171 | Ga0068856_100013601 | 3300005614 | Bacteria | 7876 |
| 172 | Ga0068856_100014141 | 3300005614 | Bacteria | 7717 |
| 173 | Ga0068856_100019029 | 3300005614 | Bacteria | 6663 |
| 174 | Ga0068856_100041249 | 3300005614 | Bacteria | 4535 |
| 175 | Ga0068856_100058066 | 3300005614 | Bacteria | 3821 |
| 176 | Ga0068856_100068915 | 3300005614 | Bacteria | 3497 |
| 177 | Ga0068856_100109057 | 3300005614 | Bacteria | 2764 |
| 178 | Ga0068856_100148226 | 3300005614 | Bacteria | 2354 |
| 179 | Ga0068856_100181827 | 3300005614 | Bacteria | 2116 |
| 180 | Ga0068856_100246876 | 3300005614 | Unclassified | 1800 |
| 181 | Ga0068856_100641779 | 3300005614 | Unclassified | 1082 |
| 182 | Ga0068852_100000023 | 3300005616 | Bacteria | 120576 |
| 183 | Ga0068852_100000650 | 3300005616 | Bacteria | 22747 |
| 184 | Ga0068852_100008476 | 3300005616 | Bacteria | 7579 |
| 185 | Ga0068852_100009589 | 3300005616 | Bacteria | 7195 |
| 186 | Ga0068852_100035040 | 3300005616 | Bacteria | 4182 |
| 187 | Ga0068852_100061504 | 3300005616 | Bacteria | 3264 |
| 188 | Ga0068852_100072000 | 3300005616 | Bacteria | 3037 |
| 189 | Ga0068859_100065862 | 3300005617 | Bacteria | 3656 |
| 190 | Ga0068864_100014372 | 3300005618 | Bacteria | 6575 |
| 191 | Ga0068864_100135149 | 3300005618 | Bacteria | 2219 |
| 192 | Ga0068864_100142631 | 3300005618 | Unclassified | 2162 |
| 193 | Ga0068861_100378888 | 3300005719 | Bacteria | 1249 |
| 194 | Ga0068851_10018899 | 3300005834 | Bacteria | 3327 |
| 195 | Ga0068851_10032688 | 3300005834 | Bacteria | 2589 |
| 196 | Ga0068851_10063947 | 3300005834 | Bacteria | 1890 |
| 197 | Ga0068851_10076541 | 3300005834 | Bacteria | 1740 |
| 198 | Ga0068851_10113056 | 3300005834 | Unclassified | 1451 |
| 199 | Ga0068851_10249383 | 3300005834 | Unclassified | 1007 |
| 200 | Ga0068863_100008200 | 3300005841 | Bacteria | 10209 |
| 201 | Ga0068863_100030571 | 3300005841 | Bacteria | 5142 |
| 202 | Ga0068863_100069588 | 3300005841 | Bacteria | 3327 |
| 203 | Ga0068863_100413225 | 3300005841 | Bacteria | 1321 |
| 204 | Ga0068863_100633869 | 3300005841 | Bacteria | 1059 |
| 205 | Ga0068858_100073258 | 3300005842 | Bacteria | 3180 |
| 206 | Ga0068858_100388765 | 3300005842 | Bacteria | 1339 |
| 207 | Ga0068860_100007235 | 3300005843 | Bacteria | 11099 |
| 208 | Ga0068860_100215561 | 3300005843 | Bacteria | 1863 |
| 209 | Ga0070717_10014729 | 3300006028 | Bacteria | 6016 |
| 210 | Ga0070717_10031517 | 3300006028 | Unclassified | 4266 |
| 211 | Ga0070717_10176321 | 3300006028 | Bacteria | 1861 |
| 212 | Ga0070717_10432299 | 3300006028 | Bacteria | 1185 |
| 213 | Ga0070717_10506575 | 3300006028 | Bacteria | 1091 |
| 214 | Ga0070717_10946406 | 3300006028 | Unclassified | 784 |
| 215 | Ga0070717_11088233 | 3300006028 | Bacteria | 728 |
| 216 | Ga0070716_100026183 | 3300006173 | Bacteria | 3121 |
| 217 | Ga0070716_100060077 | 3300006173 | Bacteria | 2194 |
| 218 | Ga0070716_100069691 | 3300006173 | Bacteria | 2062 |
| 219 | Ga0070716_100253970 | 3300006173 | Unclassified | 1199 |
| 220 | Ga0070712_100033762 | 3300006175 | Bacteria | 3464 |
| 221 | Ga0070712_100424603 | 3300006175 | Unclassified | 1102 |
| 222 | Ga0097621_100009531 | 3300006237 | Bacteria | 7052 |
| 223 | Ga0097621_100034492 | 3300006237 | Bacteria | 4037 |
| 224 | Ga0097621_100087283 | 3300006237 | Bacteria | 2604 |
| 225 | Ga0068871_100028980 | 3300006358 | Unclassified | 4345 |
| 226 | Ga0068871_100037410 | 3300006358 | Bacteria | 3870 |
| 227 | Ga0068871_100714500 | 3300006358 | Unclassified | 919 |
| 228 | Ga0075430_100301558 | 3300006846 | Bacteria | 1325 |
| 229 | Ga0075434_100050253 | 3300006871 | Bacteria | 4141 |
| 230 | Ga0068865_100194829 | 3300006881 | Unclassified | 1569 |
| 231 | Ga0075436_100040657 | 3300006914 | Bacteria | 3208 |
| 232 | Ga0075436_100108968 | 3300006914 | Bacteria | 1932 |
| 233 | Ga0075436_100335447 | 3300006914 | Bacteria | 1088 |
| 234 | Ga0075436_100487932 | 3300006914 | Unclassified | 900 |
| 235 | Ga0097620_100065860 | 3300006931 | Bacteria | 3656 |
| 236 | Ga0099794_10080636 | 3300007265 | Bacteria | 1605 |
| 237 | Ga0105240_10000001 | 3300009093 | Bacteria | 2887840 |
| 238 | Ga0105240_10000203 | 3300009093 | Bacteria | 120858 |
| 239 | Ga0105240_10002494 | 3300009093 | Bacteria | 29572 |
| 240 | Ga0105240_10003537 | 3300009093 | Bacteria | 24233 |
| 241 | Ga0105240_10003873 | 3300009093 | Bacteria | 23103 |
| 242 | Ga0105240_10013349 | 3300009093 | Bacteria | 11287 |
| 243 | Ga0105240_10017631 | 3300009093 | Bacteria | 9616 |
| 244 | Ga0105240_10022791 | 3300009093 | Bacteria | 8296 |
| 245 | Ga0105240_10025072 | 3300009093 | Bacteria | 7849 |
| 246 | Ga0105240_10053947 | 3300009093 | Bacteria | 5041 |
| 247 | Ga0105240_10071210 | 3300009093 | Bacteria | 4300 |
| 248 | Ga0105240_10125952 | 3300009093 | Bacteria | 3078 |
| 249 | Ga0105240_10127164 | 3300009093 | Unclassified | 3061 |
| 250 | Ga0105240_10228961 | 3300009093 | Bacteria | 2161 |
| 251 | Ga0105240_10267247 | 3300009093 | Bacteria | 1971 |
| 252 | Ga0105240_10550702 | 3300009093 | Bacteria | 1276 |
| 253 | Ga0105240_10835884 | 3300009093 | Bacteria | 995 |
| 254 | Ga0105240_11085003 | 3300009093 | Unclassified | 852 |
| 255 | Ga0105245_10003445 | 3300009098 | Bacteria | 14179 |
| 256 | Ga0105245_10014904 | 3300009098 | Bacteria | 6772 |
| 257 | Ga0105245_10016260 | 3300009098 | Bacteria | 6487 |
| 258 | Ga0105245_10051868 | 3300009098 | Bacteria | 3678 |
| 259 | Ga0105245_10197349 | 3300009098 | Unclassified | 1931 |
| 260 | Ga0105247_10034937 | 3300009101 | Bacteria | 3062 |
| 261 | Ga0105243_10245779 | 3300009148 | Unclassified | 1595 |
| 262 | Ga0105241_10001348 | 3300009174 | Bacteria | 18663 |
| 263 | Ga0105241_10022157 | 3300009174 | Bacteria | 4702 |
| 264 | Ga0105241_10050444 | 3300009174 | Bacteria | 3171 |
| 265 | Ga0105241_10074452 | 3300009174 | Bacteria | 2644 |
| 266 | Ga0105241_10098700 | 3300009174 | Bacteria | 2318 |
| 267 | Ga0105241_10710099 | 3300009174 | Bacteria | 919 |
| 268 | Ga0105242_10032800 | 3300009176 | Unclassified | 4154 |
| 269 | Ga0105248_10000003 | 3300009177 | Bacteria | 1019601 |
| 270 | Ga0105248_10003035 | 3300009177 | Bacteria | 18618 |
| 271 | Ga0105248_10012616 | 3300009177 | Bacteria | 9324 |
| 272 | Ga0105248_10019898 | 3300009177 | Bacteria | 7431 |
| 273 | Ga0105248_10082685 | 3300009177 | Bacteria | 3612 |
| 274 | Ga0105237_10013833 | 3300009545 | Bacteria | 8448 |
| 275 | Ga0105237_10055993 | 3300009545 | Bacteria | 3948 |
| 276 | Ga0105237_10095413 | 3300009545 | Bacteria | 2964 |
| 277 | Ga0105237_10120869 | 3300009545 | Bacteria | 2614 |
| 278 | Ga0105237_10197854 | 3300009545 | Bacteria | 2009 |
| 279 | Ga0105237_10252397 | 3300009545 | Bacteria | 1766 |
| 280 | Ga0105237_10338597 | 3300009545 | Bacteria | 1509 |
| 281 | Ga0105237_10760196 | 3300009545 | Unclassified | 976 |
| 282 | Ga0105238_10004199 | 3300009551 | Bacteria | 14300 |
| 283 | Ga0105238_10009838 | 3300009551 | Bacteria | 9578 |
| 284 | Ga0105238_10011748 | 3300009551 | Bacteria | 8826 |
| 285 | Ga0105238_10016124 | 3300009551 | Bacteria | 7558 |
| 286 | Ga0105238_10017544 | 3300009551 | Bacteria | 7279 |
| 287 | Ga0105238_10033244 | 3300009551 | Bacteria | 5249 |
| 288 | Ga0105238_10051566 | 3300009551 | Bacteria | 4138 |
| 289 | Ga0105238_10058807 | 3300009551 | Bacteria | 3852 |
| 290 | Ga0105238_10067744 | 3300009551 | Unclassified | 3570 |
| 291 | Ga0105238_10095478 | 3300009551 | Bacteria | 2960 |
| 292 | Ga0105238_10120932 | 3300009551 | Bacteria | 2598 |
| 293 | Ga0105238_10159775 | 3300009551 | Bacteria | 2229 |
| 294 | Ga0105238_10162974 | 3300009551 | Unclassified | 2206 |
| 295 | Ga0105238_10195748 | 3300009551 | Bacteria | 1997 |
| 296 | Ga0105238_10199759 | 3300009551 | Bacteria | 1975 |
| 297 | Ga0105238_10440891 | 3300009551 | Bacteria | 1299 |
| 298 | Ga0105249_10132004 | 3300009553 | Bacteria | 2385 |
| 299 | Ga0105249_10272198 | 3300009553 | Unclassified | 1687 |
| 300 | Ga0105249_10413466 | 3300009553 | Bacteria | 1381 |
| 301 | Ga0105239_10002793 | 3300010375 | Bacteria | 21861 |
| 302 | Ga0105239_10044315 | 3300010375 | Bacteria | 4877 |
| 303 | Ga0105239_10077477 | 3300010375 | Bacteria | 3658 |
| 304 | Ga0105239_10151970 | 3300010375 | Bacteria | 2584 |
| 305 | Ga0105239_10292429 | 3300010375 | Bacteria | 1834 |
| 306 | Ga0105239_10330250 | 3300010375 | Bacteria | 1720 |
| 307 | Ga0105239_10353290 | 3300010375 | Bacteria | 1660 |
| 308 | Ga0105239_10372854 | 3300010375 | Bacteria | 1613 |
| 309 | Ga0105239_10873417 | 3300010375 | Bacteria | 1032 |
| 310 | Ga0105246_10046125 | 3300011119 | Bacteria | 2971 |
| 311 | Ga0157373_10010582 | 3300013100 | Bacteria | 6786 |
| 312 | Ga0157373_10043823 | 3300013100 | Bacteria | 3195 |
| 313 | Ga0157371_10040562 | 3300013102 | Bacteria | 3324 |
| 314 | Ga0157371_10210629 | 3300013102 | Unclassified | 1395 |
| 315 | Ga0157370_10000082 | 3300013104 | Bacteria | 104481 |
| 316 | Ga0157370_10051902 | 3300013104 | Bacteria | 3916 |
| 317 | Ga0157370_10052517 | 3300013104 | Bacteria | 3891 |
| 318 | Ga0157370_10054612 | 3300013104 | Bacteria | 3808 |
| 319 | Ga0157370_10067409 | 3300013104 | Bacteria | 3383 |
| 320 | Ga0157370_10118953 | 3300013104 | Bacteria | 2467 |
| 321 | Ga0157370_10161932 | 3300013104 | Bacteria | 2081 |
| 322 | Ga0157370_10317155 | 3300013104 | Bacteria | 1438 |
| 323 | Ga0157370_10321274 | 3300013104 | Bacteria | 1428 |
| 324 | Ga0157370_10326642 | 3300013104 | Unclassified | 1415 |
| 325 | Ga0157370_10525410 | 3300013104 | Bacteria | 1086 |
| 326 | Ga0157370_10793616 | 3300013104 | Unclassified | 862 |
| 327 | Ga0157369_10000095 | 3300013105 | Bacteria | 121823 |
| 328 | Ga0157369_10004782 | 3300013105 | Bacteria | 15920 |
| 329 | Ga0157369_10016017 | 3300013105 | Bacteria | 8437 |
| 330 | Ga0157369_10022800 | 3300013105 | Bacteria | 6981 |
| 331 | Ga0157369_10024425 | 3300013105 | Bacteria | 6723 |
| 332 | Ga0157369_10025865 | 3300013105 | Bacteria | 6511 |
| 333 | Ga0157369_10035004 | 3300013105 | Bacteria | 5507 |
| 334 | Ga0157369_10040476 | 3300013105 | Bacteria | 5087 |
| 335 | Ga0157369_10042663 | 3300013105 | Bacteria | 4948 |
| 336 | Ga0157369_10053162 | 3300013105 | Bacteria | 4379 |
| 337 | Ga0157369_10137346 | 3300013105 | Bacteria | 2588 |
| 338 | Ga0157369_10141715 | 3300013105 | Bacteria | 2543 |
| 339 | Ga0157369_10155800 | 3300013105 | Bacteria | 2413 |
| 340 | Ga0157369_10215274 | 3300013105 | Bacteria | 2012 |
| 341 | Ga0157369_10385349 | 3300013105 | Bacteria | 1455 |
| 342 | Ga0157369_10464371 | 3300013105 | Bacteria | 1310 |
| 343 | Ga0157369_10547272 | 3300013105 | Bacteria | 1196 |
| 344 | Ga0157369_11302650 | 3300013105 | Unclassified | 740 |
| 345 | Ga0157374_10006654 | 3300013296 | Bacteria | 9818 |
| 346 | Ga0157374_10013447 | 3300013296 | Bacteria | 7142 |
| 347 | Ga0157374_10013966 | 3300013296 | Bacteria | 7020 |
| 348 | Ga0157374_10022035 | 3300013296 | Bacteria | 5678 |
| 349 | Ga0157374_10024468 | 3300013296 | Bacteria | 5415 |
| 350 | Ga0157374_10111890 | 3300013296 | Bacteria | 2627 |
| 351 | Ga0157374_10120998 | 3300013296 | Bacteria | 2526 |
| 352 | Ga0157374_10137656 | 3300013296 | Bacteria | 2368 |
| 353 | Ga0157374_10155817 | 3300013296 | Bacteria | 2223 |
| 354 | Ga0157374_10577733 | 3300013296 | Unclassified | 1133 |
| 355 | Ga0157374_10658316 | 3300013296 | Unclassified | 1059 |
| 356 | Ga0157374_11111129 | 3300013296 | Bacteria | 811 |
| 357 | Ga0157378_10005859 | 3300013297 | Bacteria | 10764 |
| 358 | Ga0157378_10016744 | 3300013297 | Bacteria | 6423 |
| 359 | Ga0157378_10026752 | 3300013297 | Bacteria | 5086 |
| 360 | Ga0157378_10031303 | 3300013297 | Bacteria | 4700 |
| 361 | Ga0157378_10145631 | 3300013297 | Bacteria | 2203 |
| 362 | Ga0157378_10167630 | 3300013297 | Bacteria | 2058 |
| 363 | Ga0157378_10975965 | 3300013297 | Bacteria | 881 |
| 364 | Ga0163162_10063135 | 3300013306 | Bacteria | 3745 |
| 365 | Ga0163162_10123812 | 3300013306 | Bacteria | 2691 |
| 366 | Ga0157372_10000102 | 3300013307 | Bacteria | 88856 |
| 367 | Ga0157372_10010094 | 3300013307 | Bacteria | 10031 |
| 368 | Ga0157372_10012351 | 3300013307 | Bacteria | 9102 |
| 369 | Ga0157372_10018972 | 3300013307 | Bacteria | 7402 |
| 370 | Ga0157372_10026765 | 3300013307 | Bacteria | 6277 |
| 371 | Ga0157372_10034189 | 3300013307 | Bacteria | 5588 |
| 372 | Ga0157372_10035115 | 3300013307 | Bacteria | 5517 |
| 373 | Ga0157372_10045727 | 3300013307 | Bacteria | 4858 |
| 374 | Ga0157372_10047146 | 3300013307 | Bacteria | 4787 |
| 375 | Ga0157372_10143199 | 3300013307 | Bacteria | 2756 |
| 376 | Ga0157372_10221366 | 3300013307 | Bacteria | 2194 |
| 377 | Ga0157372_10225927 | 3300013307 | Bacteria | 2170 |
| 378 | Ga0157375_10013132 | 3300013308 | Bacteria | 7360 |
| 379 | Ga0157375_10304072 | 3300013308 | Bacteria | 1759 |
| 380 | Ga0163163_10061970 | 3300014325 | Bacteria | 3706 |
| 381 | Ga0163163_10070842 | 3300014325 | Unclassified | 3473 |
| 382 | Ga0163163_10216767 | 3300014325 | Bacteria | 1963 |
| 383 | Ga0182008_10021755 | 3300014497 | Bacteria | 3293 |
| 384 | Ga0157379_10012396 | 3300014968 | Bacteria | 7447 |
| 385 | Ga0157379_10031712 | 3300014968 | Bacteria | 4709 |
| 386 | Ga0157379_10199972 | 3300014968 | Bacteria | 1807 |
| 387 | Ga0157379_10216580 | 3300014968 | Bacteria | 1734 |
| 388 | Ga0157379_10218832 | 3300014968 | Bacteria | 1725 |
| 389 | Ga0157379_10238668 | 3300014968 | Bacteria | 1649 |
| 390 | Ga0157376_10002799 | 3300014969 | Bacteria | 11907 |
| 391 | Ga0157376_10024145 | 3300014969 | Bacteria | 4769 |
| 392 | Ga0157376_10057025 | 3300014969 | Bacteria | 3265 |
| 393 | Ga0157376_10068438 | 3300014969 | Bacteria | 3007 |
| 394 | Ga0157376_10161132 | 3300014969 | Bacteria | 2034 |
| 395 | Ga0157376_10271962 | 3300014969 | Bacteria | 1592 |
| 396 | Ga0157376_10411348 | 3300014969 | Bacteria | 1310 |
| 397 | Ga0157376_10525593 | 3300014969 | Unclassified | 1167 |
| 398 | Ga0182005_1011918 | 3300015265 | Unclassified | 2465 |
| 399 | Ga0163161_10047930 | 3300017792 | Unclassified | 3085 |
| 400 | Ga0206353_10589488 | 3300020082 | Bacteria | 1724 |
| 401 | Ga0154015_1253388 | 3300020610 | Bacteria | 1728 |
| 402 | Ga0154015_1618321 | 3300020610 | Bacteria | 1325 |
| 403 | Ga0213872_10009480 | 3300021361 | Bacteria | 4668 |
| 404 | Ga0213872_10016554 | 3300021361 | Bacteria | 3419 |
| 405 | Ga0213872_10038364 | 3300021361 | Bacteria | 2186 |
| 406 | Ga0224712_10044926 | 3300022467 | Bacteria | 1687 |
| 407 | Ga0224571_100070 | 3300022734 | Bacteria | 3777 |
| 408 | Ga0228598_1000318 | 3300024227 | Bacteria | 9416 |
| 409 | Ga0228598_1000456 | 3300024227 | Bacteria | 8346 |
| 410 | Ga0207697_10048954 | 3300025315 | Unclassified | 1744 |
| 411 | Ga0207656_10024994 | 3300025321 | Bacteria | 2421 |
| 412 | Ga0207656_10030677 | 3300025321 | Bacteria | 2223 |
| 413 | Ga0207656_10035109 | 3300025321 | Bacteria | 2097 |
| 414 | Ga0207656_10069013 | 3300025321 | Unclassified | 1567 |
| 415 | Ga0207656_10089766 | 3300025321 | Bacteria | 1393 |
| 416 | Ga0207692_10000544 | 3300025898 | Bacteria | 13356 |
| 417 | Ga0207710_10011929 | 3300025900 | Bacteria | 3655 |
| 418 | Ga0207680_10190439 | 3300025903 | Bacteria | 1392 |
| 419 | Ga0207647_10007872 | 3300025904 | Bacteria | 7664 |
| 420 | Ga0207647_10033850 | 3300025904 | Unclassified | 3267 |
| 421 | Ga0207647_10169747 | 3300025904 | Bacteria | 1270 |
| 422 | Ga0207685_10040565 | 3300025905 | Bacteria | 1736 |
| 423 | Ga0207699_10047674 | 3300025906 | Bacteria | 2513 |
| 424 | Ga0207699_10166402 | 3300025906 | Bacteria | 1472 |
| 425 | Ga0207699_10429368 | 3300025906 | Bacteria | 945 |
| 426 | Ga0207699_10589477 | 3300025906 | Bacteria | 809 |
| 427 | Ga0207645_10019509 | 3300025907 | Unclassified | 4444 |
| 428 | Ga0207705_10000020 | 3300025909 | Bacteria | 311745 |
| 429 | Ga0207705_10000562 | 3300025909 | Bacteria | 31130 |
| 430 | Ga0207705_10020122 | 3300025909 | Bacteria | 4774 |
| 431 | Ga0207705_10033166 | 3300025909 | Bacteria | 3690 |
| 432 | Ga0207705_10070610 | 3300025909 | Bacteria | 2531 |
| 433 | Ga0207705_10108027 | 3300025909 | Bacteria | 2053 |
| 434 | Ga0207705_10140847 | 3300025909 | Bacteria | 1801 |
| 435 | Ga0207705_10167041 | 3300025909 | Bacteria | 1655 |
| 436 | Ga0207705_10178395 | 3300025909 | Unclassified | 1602 |
| 437 | Ga0207705_10285699 | 3300025909 | Bacteria | 1263 |
| 438 | Ga0207705_10533811 | 3300025909 | Bacteria | 912 |
| 439 | Ga0207684_10244547 | 3300025910 | Bacteria | 1548 |
| 440 | Ga0207654_10000154 | 3300025911 | Bacteria | 43613 |
| 441 | Ga0207654_10008218 | 3300025911 | Bacteria | 5266 |
| 442 | Ga0207654_10074069 | 3300025911 | Bacteria | 2031 |
| 443 | Ga0207654_10086042 | 3300025911 | Bacteria | 1905 |
| 444 | Ga0207654_10086545 | 3300025911 | Unclassified | 1900 |
| 445 | Ga0207707_10053907 | 3300025912 | Bacteria | 3501 |
| 446 | Ga0207707_10075858 | 3300025912 | Bacteria | 2934 |
| 447 | Ga0207707_10092577 | 3300025912 | Bacteria | 2641 |
| 448 | Ga0207707_10122448 | 3300025912 | Bacteria | 2275 |
| 449 | Ga0207707_10125768 | 3300025912 | Bacteria | 2242 |
| 450 | Ga0207707_10129161 | 3300025912 | Bacteria | 2210 |
| 451 | Ga0207707_10296707 | 3300025912 | Bacteria | 1398 |
| 452 | Ga0207707_10341735 | 3300025912 | Unclassified | 1290 |
| 453 | Ga0207707_10489598 | 3300025912 | Bacteria | 1050 |
| 454 | Ga0207695_10000001 | 3300025913 | Bacteria | 2888630 |
| 455 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 456 | Ga0207695_10000303 | 3300025913 | Bacteria | 120876 |
| 457 | Ga0207695_10001162 | 3300025913 | Bacteria | 45655 |
| 458 | Ga0207695_10010711 | 3300025913 | Bacteria | 11195 |
| 459 | Ga0207695_10016845 | 3300025913 | Bacteria | 8531 |
| 460 | Ga0207695_10036140 | 3300025913 | Bacteria | 5344 |
| 461 | Ga0207695_10039924 | 3300025913 | Bacteria | 5040 |
| 462 | Ga0207695_10046202 | 3300025913 | Bacteria | 4616 |
| 463 | Ga0207695_10061989 | 3300025913 | Bacteria | 3863 |
| 464 | Ga0207695_10092962 | 3300025913 | Bacteria | 3026 |
| 465 | Ga0207695_10119326 | 3300025913 | Bacteria | 2607 |
| 466 | Ga0207695_10125766 | 3300025913 | Bacteria | 2526 |
| 467 | Ga0207695_10222845 | 3300025913 | Bacteria | 1793 |
| 468 | Ga0207695_10323636 | 3300025913 | Bacteria | 1431 |
| 469 | Ga0207671_10001283 | 3300025914 | Bacteria | 29524 |
| 470 | Ga0207671_10051157 | 3300025914 | Bacteria | 3061 |
| 471 | Ga0207671_10106061 | 3300025914 | Bacteria | 2133 |
| 472 | Ga0207671_10171809 | 3300025914 | Bacteria | 1684 |
| 473 | Ga0207671_10184214 | 3300025914 | Bacteria | 1626 |
| 474 | Ga0207671_10342543 | 3300025914 | Bacteria | 1185 |
| 475 | Ga0207693_10034660 | 3300025915 | Bacteria | 3982 |
| 476 | Ga0207693_10089471 | 3300025915 | Bacteria | 2413 |
| 477 | Ga0207663_10097909 | 3300025916 | Bacteria | 1963 |
| 478 | Ga0207663_10103697 | 3300025916 | Bacteria | 1916 |
| 479 | Ga0207663_10577885 | 3300025916 | Unclassified | 881 |
| 480 | Ga0207660_10017684 | 3300025917 | Bacteria | 4741 |
| 481 | Ga0207660_10024884 | 3300025917 | Bacteria | 4057 |
| 482 | Ga0207660_10373925 | 3300025917 | Bacteria | 1145 |
| 483 | Ga0207660_10391181 | 3300025917 | Bacteria | 1119 |
| 484 | Ga0207660_10477750 | 3300025917 | Bacteria | 1010 |
| 485 | Ga0207660_10544054 | 3300025917 | Bacteria | 944 |
| 486 | Ga0207657_10001167 | 3300025919 | Bacteria | 27843 |
| 487 | Ga0207657_10011054 | 3300025919 | Bacteria | 8973 |
| 488 | Ga0207657_10012789 | 3300025919 | Bacteria | 8260 |
| 489 | Ga0207657_10015325 | 3300025919 | Bacteria | 7430 |
| 490 | Ga0207657_10057971 | 3300025919 | Bacteria | 3335 |
| 491 | Ga0207657_10177074 | 3300025919 | Bacteria | 1725 |
| 492 | Ga0207657_10384094 | 3300025919 | Bacteria | 1105 |
| 493 | Ga0207649_10008630 | 3300025920 | Bacteria | 5564 |
| 494 | Ga0207649_10023724 | 3300025920 | Bacteria | 3556 |
| 495 | Ga0207649_10060461 | 3300025920 | Bacteria | 2381 |
| 496 | Ga0207649_10073936 | 3300025920 | Bacteria | 2185 |
| 497 | Ga0207652_10003733 | 3300025921 | Bacteria | 12499 |
| 498 | Ga0207652_10012797 | 3300025921 | Bacteria | 6784 |
| 499 | Ga0207652_10064756 | 3300025921 | Bacteria | 3163 |
| 500 | Ga0207652_10074748 | 3300025921 | Bacteria | 2951 |
| 501 | Ga0207652_10107374 | 3300025921 | Bacteria | 2472 |
| 502 | Ga0207652_10122528 | 3300025921 | Bacteria | 2314 |
| 503 | Ga0207652_10214561 | 3300025921 | Bacteria | 1733 |
| 504 | Ga0207652_10262021 | 3300025921 | Bacteria | 1559 |
| 505 | Ga0207646_10027006 | 3300025922 | Bacteria | 5233 |
| 506 | Ga0207646_10061824 | 3300025922 | Bacteria | 3343 |
| 507 | Ga0207646_10381060 | 3300025922 | Bacteria | 1274 |
| 508 | Ga0207681_10372494 | 3300025923 | Unclassified | 1148 |
| 509 | Ga0207694_10000184 | 3300025924 | Bacteria | 64536 |
| 510 | Ga0207694_10000520 | 3300025924 | Bacteria | 34849 |
| 511 | Ga0207694_10002242 | 3300025924 | Bacteria | 15839 |
| 512 | Ga0207694_10005906 | 3300025924 | Bacteria | 9385 |
| 513 | Ga0207694_10015919 | 3300025924 | Bacteria | 5674 |
| 514 | Ga0207694_10105638 | 3300025924 | Unclassified | 2236 |
| 515 | Ga0207694_10264021 | 3300025924 | Unclassified | 1411 |
| 516 | Ga0207650_10007412 | 3300025925 | Bacteria | 7474 |
| 517 | Ga0207650_10142958 | 3300025925 | Bacteria | 1882 |
| 518 | Ga0207650_10245297 | 3300025925 | Bacteria | 1449 |
| 519 | Ga0207659_10055096 | 3300025926 | Bacteria | 2842 |
| 520 | Ga0207687_10017710 | 3300025927 | Bacteria | 4695 |
| 521 | Ga0207687_10021523 | 3300025927 | Bacteria | 4285 |
| 522 | Ga0207687_10024117 | 3300025927 | Bacteria | 4061 |
| 523 | Ga0207687_10024146 | 3300025927 | Bacteria | 4059 |
| 524 | Ga0207687_10227668 | 3300025927 | Bacteria | 1471 |
| 525 | Ga0207700_10029316 | 3300025928 | Bacteria | 3881 |
| 526 | Ga0207700_10050881 | 3300025928 | Bacteria | 3089 |
| 527 | Ga0207700_10104341 | 3300025928 | Bacteria | 2268 |
| 528 | Ga0207700_10190703 | 3300025928 | Bacteria | 1722 |
| 529 | Ga0207700_10619160 | 3300025928 | Unclassified | 964 |
| 530 | Ga0207664_10044693 | 3300025929 | Bacteria | 3470 |
| 531 | Ga0207664_10055740 | 3300025929 | Bacteria | 3137 |
| 532 | Ga0207664_10098498 | 3300025929 | Bacteria | 2411 |
| 533 | Ga0207664_10139131 | 3300025929 | Bacteria | 2051 |
| 534 | Ga0207664_10142063 | 3300025929 | Unclassified | 2032 |
| 535 | Ga0207664_10258537 | 3300025929 | Bacteria | 1522 |
| 536 | Ga0207644_10003660 | 3300025931 | Bacteria | 9965 |
| 537 | Ga0207644_10022921 | 3300025931 | Bacteria | 4270 |
| 538 | Ga0207644_10755678 | 3300025931 | Unclassified | 812 |
| 539 | Ga0207690_10000553 | 3300025932 | Bacteria | 24431 |
| 540 | Ga0207690_10072618 | 3300025932 | Bacteria | 2377 |
| 541 | Ga0207690_10137372 | 3300025932 | Unclassified | 1796 |
| 542 | Ga0207706_10002843 | 3300025933 | Bacteria | 16797 |
| 543 | Ga0207706_10026562 | 3300025933 | Bacteria | 5182 |
| 544 | Ga0207704_10070618 | 3300025938 | Unclassified | 2212 |
| 545 | Ga0207665_10067620 | 3300025939 | Bacteria | 2433 |
| 546 | Ga0207665_10069495 | 3300025939 | Bacteria | 2402 |
| 547 | Ga0207665_10104766 | 3300025939 | Bacteria | 1980 |
| 548 | Ga0207665_10200314 | 3300025939 | Bacteria | 1454 |
| 549 | Ga0207691_10002212 | 3300025940 | Bacteria | 19018 |
| 550 | Ga0207711_10000013 | 3300025941 | Bacteria | 514850 |
| 551 | Ga0207711_10003932 | 3300025941 | Bacteria | 12785 |
| 552 | Ga0207711_10027419 | 3300025941 | Bacteria | 4784 |
| 553 | Ga0207711_10105990 | 3300025941 | Bacteria | 2493 |
| 554 | Ga0207711_10170679 | 3300025941 | Bacteria | 1973 |
| 555 | Ga0207689_10000659 | 3300025942 | Bacteria | 32897 |
| 556 | Ga0207689_10005877 | 3300025942 | Bacteria | 10872 |
| 557 | Ga0207661_10086886 | 3300025944 | Bacteria | 2596 |
| 558 | Ga0207661_10152072 | 3300025944 | Bacteria | 2001 |
| 559 | Ga0207661_10152983 | 3300025944 | Unclassified | 1995 |
| 560 | Ga0207661_10169361 | 3300025944 | Bacteria | 1900 |
| 561 | Ga0207661_10365526 | 3300025944 | Unclassified | 1304 |
| 562 | Ga0207661_10376274 | 3300025944 | Unclassified | 1285 |
| 563 | Ga0207661_10435648 | 3300025944 | Bacteria | 1192 |
| 564 | Ga0207679_10131132 | 3300025945 | Bacteria | 2011 |
| 565 | Ga0207679_10187229 | 3300025945 | Bacteria | 1717 |
| 566 | Ga0207667_10000259 | 3300025949 | Bacteria | 74230 |
| 567 | Ga0207667_10000360 | 3300025949 | Bacteria | 61923 |
| 568 | Ga0207667_10000385 | 3300025949 | Bacteria | 59674 |
| 569 | Ga0207667_10003193 | 3300025949 | Bacteria | 20254 |
| 570 | Ga0207667_10004195 | 3300025949 | Bacteria | 17700 |
| 571 | Ga0207667_10020451 | 3300025949 | Bacteria | 7360 |
| 572 | Ga0207667_10021092 | 3300025949 | Bacteria | 7225 |
| 573 | Ga0207667_10022273 | 3300025949 | Bacteria | 7003 |
| 574 | Ga0207667_10025199 | 3300025949 | Bacteria | 6516 |
| 575 | Ga0207667_10061196 | 3300025949 | Bacteria | 3939 |
| 576 | Ga0207667_10070190 | 3300025949 | Bacteria | 3646 |
| 577 | Ga0207667_10132051 | 3300025949 | Bacteria | 2572 |
| 578 | Ga0207667_10138412 | 3300025949 | Bacteria | 2507 |
| 579 | Ga0207667_10442289 | 3300025949 | Bacteria | 1322 |
| 580 | Ga0207651_10135544 | 3300025960 | Bacteria | 1893 |
| 581 | Ga0207712_10426277 | 3300025961 | Bacteria | 1120 |
| 582 | Ga0207640_10000011 | 3300025981 | Bacteria | 252283 |
| 583 | Ga0207640_10077604 | 3300025981 | Unclassified | 2258 |
| 584 | Ga0207640_10191626 | 3300025981 | Bacteria | 1541 |
| 585 | Ga0207640_10337966 | 3300025981 | Unclassified | 1205 |
| 586 | Ga0207640_10460605 | 3300025981 | Bacteria | 1050 |
| 587 | Ga0207658_10081057 | 3300025986 | Bacteria | 2487 |
| 588 | Ga0207658_10195626 | 3300025986 | Unclassified | 1684 |
| 589 | Ga0207677_10002003 | 3300026023 | Bacteria | 10746 |
| 590 | Ga0207677_10345121 | 3300026023 | Unclassified | 1245 |
| 591 | Ga0207703_10027827 | 3300026035 | Unclassified | 4453 |
| 592 | Ga0207703_10049953 | 3300026035 | Bacteria | 3383 |
| 593 | Ga0207703_10384030 | 3300026035 | Bacteria | 1300 |
| 594 | Ga0207639_10000085 | 3300026041 | Bacteria | 79561 |
| 595 | Ga0207639_10000586 | 3300026041 | Bacteria | 25062 |
| 596 | Ga0207639_10037593 | 3300026041 | Bacteria | 3596 |
| 597 | Ga0207639_10048283 | 3300026041 | Bacteria | 3221 |
| 598 | Ga0207639_10054517 | 3300026041 | Bacteria | 3056 |
| 599 | Ga0207639_10065523 | 3300026041 | Unclassified | 2820 |
| 600 | Ga0207639_10147871 | 3300026041 | Bacteria | 1965 |
| 601 | Ga0207639_10350913 | 3300026041 | Bacteria | 1318 |
| 602 | Ga0207678_10005665 | 3300026067 | Bacteria | 11162 |
| 603 | Ga0207678_10012647 | 3300026067 | Bacteria | 7415 |
| 604 | Ga0207678_10015323 | 3300026067 | Bacteria | 6743 |
| 605 | Ga0207678_10200822 | 3300026067 | Bacteria | 1705 |
| 606 | Ga0207702_10016202 | 3300026078 | Bacteria | 6170 |
| 607 | Ga0207702_10038053 | 3300026078 | Bacteria | 4029 |
| 608 | Ga0207702_10038590 | 3300026078 | Bacteria | 4000 |
| 609 | Ga0207702_10076053 | 3300026078 | Bacteria | 2901 |
| 610 | Ga0207702_10138403 | 3300026078 | Bacteria | 2200 |
| 611 | Ga0207702_10160710 | 3300026078 | Bacteria | 2051 |
| 612 | Ga0207702_10286429 | 3300026078 | Bacteria | 1559 |
| 613 | Ga0207702_10412719 | 3300026078 | Bacteria | 1304 |
| 614 | Ga0207702_10474556 | 3300026078 | Bacteria | 1217 |
| 615 | Ga0207702_10504342 | 3300026078 | Bacteria | 1180 |
| 616 | Ga0207702_10579262 | 3300026078 | Bacteria | 1100 |
| 617 | Ga0207641_10006263 | 3300026088 | Bacteria | 10068 |
| 618 | Ga0207641_10010079 | 3300026088 | Bacteria | 7770 |
| 619 | Ga0207641_10025399 | 3300026088 | Unclassified | 4885 |
| 620 | Ga0207641_11194350 | 3300026088 | Unclassified | 760 |
| 621 | Ga0207648_10449632 | 3300026089 | Bacteria | 1173 |
| 622 | Ga0207676_10071649 | 3300026095 | Bacteria | 2783 |
| 623 | Ga0207676_10081144 | 3300026095 | Bacteria | 2634 |
| 624 | Ga0207674_10000122 | 3300026116 | Bacteria | 90389 |
| 625 | Ga0207674_10005786 | 3300026116 | Bacteria | 14664 |
| 626 | Ga0207674_10005961 | 3300026116 | Bacteria | 14420 |
| 627 | Ga0207674_10112128 | 3300026116 | Bacteria | 2701 |
| 628 | Ga0207674_10134956 | 3300026116 | Bacteria | 2430 |
| 629 | Ga0207674_10158701 | 3300026116 | Bacteria | 2217 |
| 630 | Ga0207674_10239523 | 3300026116 | Bacteria | 1761 |
| 631 | Ga0207674_10289017 | 3300026116 | Unclassified | 1588 |
| 632 | Ga0207674_10348495 | 3300026116 | Bacteria | 1432 |
| 633 | Ga0207675_100469683 | 3300026118 | Bacteria | 1249 |
| 634 | Ga0207683_10000896 | 3300026121 | Bacteria | 27403 |
| 635 | Ga0207698_10000026 | 3300026142 | Bacteria | 121055 |
| 636 | Ga0207698_10000221 | 3300026142 | Bacteria | 35425 |
| 637 | Ga0207698_10012069 | 3300026142 | Bacteria | 5634 |
| 638 | Ga0207698_10036728 | 3300026142 | Bacteria | 3600 |
| 639 | Ga0207698_10040613 | 3300026142 | Unclassified | 3460 |
| 640 | Ga0207698_10097128 | 3300026142 | Bacteria | 2430 |
| 641 | Ga0207698_10105379 | 3300026142 | Bacteria | 2349 |
| 642 | Ga0207698_10116654 | 3300026142 | Bacteria | 2250 |
| 643 | Ga0207698_10140845 | 3300026142 | Bacteria | 2078 |
| 644 | Ga0265356_1001810 | 3300028017 | Unclassified | 3019 |
| 645 | Ga0268266_10030012 | 3300028379 | Bacteria | 4620 |
| 646 | Ga0268266_10075026 | 3300028379 | Bacteria | 2937 |
| 647 | Ga0268266_10122131 | 3300028379 | Bacteria | 2319 |
| 648 | Ga0268266_10443874 | 3300028379 | Bacteria | 1232 |
| 649 | Ga0268266_10508422 | 3300028379 | Bacteria | 1151 |
| 650 | Ga0268264_10000653 | 3300028381 | Bacteria | 40789 |
| 651 | Ga0265319_1093749 | 3300028563 | Bacteria | 946 |
| 652 | Ga0265338_10001900 | 3300028800 | Bacteria | 32656 |
| 653 | Ga0265338_10013731 | 3300028800 | Bacteria | 9108 |
| 654 | Ga0265338_10088176 | 3300028800 | Bacteria | 2576 |
| 655 | Ga0265338_10117288 | 3300028800 | Bacteria | 2131 |
| 656 | Ga0265338_10194152 | 3300028800 | Bacteria | 1536 |
| 657 | Ga0265324_10134710 | 3300029957 | Bacteria | 839 |
| 658 | Ga0265762_1000914 | 3300030760 | Bacteria | 5264 |
| 659 | Ga0265770_1003967 | 3300030878 | Bacteria | 2015 |
| 660 | Ga0265765_1014627 | 3300030879 | Bacteria | 907 |
| 661 | Ga0265771_1001456 | 3300031010 | Bacteria | 1126 |
| 662 | Ga0265760_10066695 | 3300031090 | Bacteria | 1100 |
| 663 | Ga0265330_10000548 | 3300031235 | Bacteria | 24611 |
| 664 | Ga0265330_10000631 | 3300031235 | Bacteria | 22719 |
| 665 | Ga0265330_10008852 | 3300031235 | Bacteria | 4816 |
| 666 | Ga0265330_10028232 | 3300031235 | Bacteria | 2530 |
| 667 | Ga0265330_10055915 | 3300031235 | Bacteria | 1723 |
| 668 | Ga0265332_10007138 | 3300031238 | Bacteria | 5060 |
| 669 | Ga0265332_10080339 | 3300031238 | Bacteria | 1383 |
| 670 | Ga0265328_10008795 | 3300031239 | Bacteria | 4143 |
| 671 | Ga0265328_10031821 | 3300031239 | Bacteria | 1960 |
| 672 | Ga0265328_10113805 | 3300031239 | Bacteria | 1006 |
| 673 | Ga0265320_10061946 | 3300031240 | Bacteria | 1782 |
| 674 | Ga0265325_10000614 | 3300031241 | Bacteria | 25981 |
| 675 | Ga0265325_10000899 | 3300031241 | Bacteria | 21485 |
| 676 | Ga0265325_10009867 | 3300031241 | Bacteria | 5560 |
| 677 | Ga0265325_10026762 | 3300031241 | Unclassified | 3122 |
| 678 | Ga0265325_10027726 | 3300031241 | Bacteria | 3059 |
| 679 | Ga0265325_10041139 | 3300031241 | Unclassified | 2423 |
| 680 | Ga0265325_10150599 | 3300031241 | Bacteria | 1100 |
| 681 | Ga0265340_10002990 | 3300031247 | Bacteria | 9615 |
| 682 | Ga0265340_10048843 | 3300031247 | Bacteria | 2056 |
| 683 | Ga0265339_10000011 | 3300031249 | Bacteria | 206284 |
| 684 | Ga0265339_10004485 | 3300031249 | Bacteria | 9522 |
| 685 | Ga0265339_10021534 | 3300031249 | Bacteria | 3749 |
| 686 | Ga0265339_10028416 | 3300031249 | Bacteria | 3180 |
| 687 | Ga0265339_10039397 | 3300031249 | Bacteria | 2631 |
| 688 | Ga0265339_10046078 | 3300031249 | Bacteria | 2398 |
| 689 | Ga0265339_10074604 | 3300031249 | Bacteria | 1802 |
| 690 | Ga0265331_10034295 | 3300031250 | Bacteria | 2504 |
| 691 | Ga0265331_10056221 | 3300031250 | Bacteria | 1869 |
| 692 | Ga0265316_10002386 | 3300031344 | Bacteria | 19555 |
| 693 | Ga0265316_10006508 | 3300031344 | Bacteria | 11142 |
| 694 | Ga0265316_10013155 | 3300031344 | Bacteria | 7371 |
| 695 | Ga0265316_10018468 | 3300031344 | Bacteria | 5991 |
| 696 | Ga0265316_10174177 | 3300031344 | Bacteria | 1604 |
| 697 | Ga0265316_10369902 | 3300031344 | Bacteria | 1035 |
| 698 | Ga0265316_10407827 | 3300031344 | Bacteria | 978 |
| 699 | Ga0265313_10001746 | 3300031595 | Bacteria | 19959 |
| 700 | Ga0265313_10004925 | 3300031595 | Bacteria | 10006 |
| 701 | Ga0265313_10014026 | 3300031595 | Bacteria | 4769 |
| 702 | Ga0265314_10000151 | 3300031711 | Bacteria | 104088 |
| 703 | Ga0265314_10066976 | 3300031711 | Bacteria | 2421 |
| 704 | Ga0265314_10067265 | 3300031711 | Bacteria | 2414 |
| 705 | Ga0265342_10000977 | 3300031712 | Bacteria | 28306 |
| 706 | Ga0265342_10009076 | 3300031712 | Bacteria | 7053 |
| 707 | Ga0265342_10012334 | 3300031712 | Bacteria | 5791 |
| 708 | Ga0265342_10013306 | 3300031712 | Bacteria | 5529 |
| 709 | Ga0265342_10014774 | 3300031712 | Bacteria | 5171 |
| 710 | Ga0265342_10020074 | 3300031712 | Bacteria | 4294 |
| 711 | Ga0265342_10037153 | 3300031712 | Bacteria | 2972 |
| 712 | Ga0265342_10040434 | 3300031712 | Unclassified | 2828 |
| 713 | Ga0265342_10045754 | 3300031712 | Bacteria | 2633 |
| 714 | Ga0265342_10066928 | 3300031712 | Bacteria | 2103 |
| 715 | Ga0307510_10050521 | 3300033180 | Bacteria | 4409 |
| 716 | Ga0307510_10086828 | 3300033180 | Bacteria | 2998 |
| 717 | Ga0373926_0005964 | 3300035083 | Bacteria | 4032 |
| 718 | Ga0373936_0008999 | 3300035113 | Bacteria | 3766 |
| 719 | Ga0373954_0356053 | 3300035118 | Bacteria | 723 |
| 720 | Ga0373956_0007313 | 3300035119 | Bacteria | 4443 |
| 721 | Ga0373957_0054835 | 3300035120 | Bacteria | 1532 |
| 722 | Ga0373946_0019743 | 3300035171 | Bacteria | 2599 |
| 723 | Ga0373955_0019606 | 3300035172 | Bacteria | 3384 |
| 724 | Ga0373955_0046902 | 3300035172 | Bacteria | 2338 |
| 725 | Ga0373955_0386896 | 3300035172 | Bacteria | 849 |
| 726 | Ga0373924_0000594 | 3300035410 | Bacteria | 11157 |
| 727 | Ga0373924_0070292 | 3300035410 | Bacteria | 1476 |
| 728 | Ga0373935_0114292 | 3300035692 | Bacteria | 1795 |
| 729 | Ga0373933_0144338 | 3300035724 | Bacteria | 1504 |
| 730 | Ga0373933_0190558 | 3300035724 | Bacteria | 1310 |
| 731 | Ga0373947_0031202 | 3300035725 | Bacteria | 3135 |
| 732 | Ga0373937_0000188 | 3300036401 | Bacteria | 60518 |
| 733 | Ga0373937_0004446 | 3300036401 | Bacteria | 11916 |
| 734 | Ga0373937_0375316 | 3300036401 | Bacteria | 1348 |
| 735 | Ga0373937_1288031 | 3300036401 | Bacteria | 679 |
| 736 | Ga0373925_0018342 | 3300037068 | Bacteria | 5086 |
| 737 | Ga0373925_0038621 | 3300037068 | Bacteria | 3530 |
| 738 | Ga0395900_0405899 | 3300037418 | Bacteria | 1326 |
| 739 | Ga0395900_0777166 | 3300037418 | Bacteria | 887 |
| 740 | Ga0395898_0076695 | 3300037466 | Bacteria | 3227 |
| 741 | Ga0395898_0379897 | 3300037466 | Bacteria | 1347 |
| 742 | Ga0395905_0012025 | 3300037471 | Bacteria | 8347 |
| 743 | Ga0395905_0068453 | 3300037471 | Unclassified | 3325 |
| 744 | Ga0395905_0358324 | 3300037471 | Bacteria | 1351 |
| 745 | Ga0395905_0523149 | 3300037471 | Unclassified | 1087 |
| 746 | Ga0395901_0592451 | 3300038443 | Bacteria | 1119 |
| 747 | Ga0395901_0900573 | 3300038443 | Unclassified | 867 |
| 748 | Ga0436360_0569272 | 3300039438 | Bacteria | 4483 |
| 749 | Ga0436360_1128119 | 3300039438 | Bacteria | 1148 |
| 750 | Ga0436361_0010391 | 3300039447 | Bacteria | 16052 |
| 751 | Ga0436361_0061101 | 3300039447 | Bacteria | 18221 |
| 752 | Ga0436361_0448534 | 3300039447 | Bacteria | 1135 |
| 753 | Ga0436361_0639567 | 3300039447 | Bacteria | 2457 |
| 754 | Ga0436361_0879866 | 3300039447 | Bacteria | 8277 |
| 755 | Ga0436361_1162467 | 3300039447 | Bacteria | 6420 |
| 756 | Ga0436363_0162138 | 3300039450 | Bacteria | 4984 |
| 757 | Ga0436363_0461399 | 3300039450 | Unclassified | 1396 |
| 758 | Ga0436362_0240647 | 3300039453 | Unclassified | 950 |
| 759 | Ga0466963_0000107 | 3300044694 | Bacteria | 30205 |
| 760 | Ga0466963_0058277 | 3300044694 | Bacteria | 2575 |
| 761 | Ga0466963_0113690 | 3300044694 | Bacteria | 1859 |
| 762 | Ga0466963_0150175 | 3300044694 | Bacteria | 1617 |
| 763 | Ga0466963_0243937 | 3300044694 | Bacteria | 1260 |
| 764 | Ga0466957_0001754 | 3300044842 | Bacteria | 11410 |
| 765 | Ga0466957_0447897 | 3300044842 | Bacteria | 889 |
| 766 | Ga0466959_0159680 | 3300045049 | Bacteria | 1585 |
| 767 | Ga0451576_1315184 | 3300045051 | Unclassified | 753 |
| 768 | Ga0466958_0047770 | 3300045836 | Bacteria | 2584 |
| 769 | Ga0466958_0105353 | 3300045836 | Bacteria | 1757 |
| 770 | Ga0466967_0010311 | 3300045976 | Bacteria | 6998 |
| 771 | Ga0466967_0012589 | 3300045976 | Bacteria | 6482 |
| 772 | Ga0466967_0422045 | 3300045976 | Bacteria | 1300 |
| 773 | Ga0495603_0000592 | 3300046455 | Bacteria | 20371 |
| 774 | Ga0495629_0061900 | 3300046459 | Bacteria | 2615 |
| 775 | Ga0495638_0158466 | 3300046460 | Bacteria | 1308 |
| 776 | Ga0495651_0034112 | 3300046462 | Bacteria | 3968 |
| 777 | Ga0495650_0000006 | 3300046471 | Bacteria | 721347 |
| 778 | Ga0495650_0002472 | 3300046471 | Bacteria | 14872 |
| 779 | Ga0495650_0049622 | 3300046471 | Bacteria | 1742 |
| 780 | Ga0495580_0004410 | 3300046472 | Bacteria | 11818 |
| 781 | Ga0495580_0020638 | 3300046472 | Bacteria | 4873 |
| 782 | Ga0495580_0053999 | 3300046472 | Bacteria | 2835 |
| 783 | Ga0495580_0083777 | 3300046472 | Bacteria | 2221 |
| 784 | Ga0495662_0099947 | 3300046476 | Unclassified | 1419 |
| 785 | Ga0495664_0034919 | 3300046477 | Bacteria | 2959 |
| 786 | Ga0495585_0004907 | 3300046492 | Bacteria | 8563 |
| 787 | Ga0495585_0170442 | 3300046492 | Bacteria | 1125 |
| 788 | Ga0495594_0001118 | 3300046499 | Bacteria | 13996 |
| 789 | Ga0495596_0004138 | 3300046500 | Bacteria | 7134 |
| 790 | Ga0495583_0023158 | 3300046506 | Bacteria | 3148 |
| 791 | Ga0495583_0046599 | 3300046506 | Bacteria | 1998 |
| 792 | Ga0495606_0255215 | 3300046507 | Bacteria | 971 |
| 793 | Ga0495628_0038045 | 3300046516 | Bacteria | 3854 |
| 794 | Ga0495628_0133928 | 3300046516 | Bacteria | 1895 |
| 795 | Ga0495631_0017357 | 3300046518 | Bacteria | 3407 |
| 796 | Ga0495631_0031194 | 3300046518 | Bacteria | 2414 |
| 797 | Ga0495644_0000058 | 3300046523 | Bacteria | 53865 |
| 798 | Ga0495648_0024978 | 3300046524 | Bacteria | 4055 |
| 799 | Ga0495648_0078985 | 3300046524 | Bacteria | 1880 |
| 800 | Ga0495666_0124858 | 3300046526 | Unclassified | 1204 |
| 801 | Ga0495642_0003827 | 3300046528 | Bacteria | 5902 |
| 802 | Ga0495652_0059042 | 3300046529 | Bacteria | 3247 |
| 803 | Ga0495665_0021330 | 3300046531 | Bacteria | 3480 |
| 804 | Ga0495640_0048324 | 3300046533 | Bacteria | 2941 |
| 805 | Ga0495586_0087692 | 3300046535 | Bacteria | 1716 |
| 806 | Ga0495587_0122827 | 3300046536 | Bacteria | 1487 |
| 807 | Ga0495609_0008526 | 3300046538 | Bacteria | 5018 |
| 808 | Ga0495645_0003905 | 3300046543 | Bacteria | 10164 |
| 809 | Ga0495645_0079147 | 3300046543 | Bacteria | 2362 |
| 810 | Ga0495633_0002138 | 3300046558 | Bacteria | 14165 |
| 811 | Ga0495633_0275420 | 3300046558 | Bacteria | 766 |
| 812 | Ga0495667_0069997 | 3300046559 | Bacteria | 2289 |
| 813 | Ga0495656_0059638 | 3300046615 | Bacteria | 1661 |
| 814 | Ga0495668_0015581 | 3300046616 | Bacteria | 4436 |
| 815 | Ga0495611_0004999 | 3300046648 | Bacteria | 5680 |
| 816 | Ga0495625_0002024 | 3300046660 | Bacteria | 22832 |
| 817 | Ga0495625_0018272 | 3300046660 | Bacteria | 5477 |
| 818 | Ga0495625_0021565 | 3300046660 | Bacteria | 4957 |
| 819 | Ga0495625_0070054 | 3300046660 | Bacteria | 2463 |
| 820 | Ga0495625_0073319 | 3300046660 | Bacteria | 2400 |
| 821 | Ga0495635_0064750 | 3300046663 | Bacteria | 2509 |
| 822 | Ga0495661_0004329 | 3300046665 | Bacteria | 10279 |
| 823 | Ga0495657_0077042 | 3300046675 | Bacteria | 2164 |
| 824 | Ga0495599_0164359 | 3300046678 | Bacteria | 1371 |
| 825 | Ga0495623_0046920 | 3300046679 | Bacteria | 2742 |
| 826 | Ga0495623_0054069 | 3300046679 | Bacteria | 2534 |
| 827 | Ga0495646_0045291 | 3300046680 | Bacteria | 2688 |
| 828 | Ga0495658_0078626 | 3300046683 | Bacteria | 1931 |
| 829 | Ga0495669_0009608 | 3300046684 | Bacteria | 4081 |
| 830 | Ga0495613_0046863 | 3300046689 | Bacteria | 3195 |
| 831 | Ga0495670_0309273 | 3300046691 | Bacteria | 847 |
| 832 | Ga0495589_0141531 | 3300046794 | Bacteria | 1151 |
| 833 | Ga0495581_0039648 | 3300047315 | Bacteria | 2727 |
| 834 | Ga0495604_0060709 | 3300047317 | Bacteria | 2894 |
| 835 | Ga0495674_0020527 | 3300047319 | Bacteria | 6114 |
| 836 | Ga0495672_0078796 | 3300047320 | Bacteria | 1842 |
| 837 | Ga0495683_0090570 | 3300047323 | Bacteria | 1482 |
| 838 | Ga0495679_055291 | 3300047446 | Bacteria | 1179 |
| 839 | Ga0495673_0112129 | 3300047469 | Bacteria | 1089 |
| 840 | Ga0495686_0010491 | 3300047472 | Bacteria | 6584 |
| 841 | Ga0495593_0065122 | 3300047673 | Bacteria | 1901 |
| 842 | Ga0495602_0158783 | 3300048088 | Bacteria | 1768 |
| 843 | Ga0496100_0185172 | 3300048903 | Bacteria | 1508 |
| 844 | Ga0496100_0316737 | 3300048903 | Bacteria | 1171 |
| 845 | Ga0496100_0614737 | 3300048903 | Bacteria | 845 |
| 846 | Ga0496101_0069925 | 3300048904 | Bacteria | 2569 |
| 847 | Ga0496101_0091782 | 3300048904 | Bacteria | 2260 |
| 848 | Ga0496102_0038515 | 3300048905 | Bacteria | 4315 |
| 849 | Ga0496102_0066719 | 3300048905 | Bacteria | 3298 |
| 850 | Ga0496102_0133453 | 3300048905 | Bacteria | 2325 |
| 851 | Ga0496104_0024706 | 3300048907 | Bacteria | 5530 |
| 852 | Ga0496104_0079480 | 3300048907 | Unclassified | 3126 |
| 853 | Ga0496104_0135632 | 3300048907 | Unclassified | 2365 |
| 854 | Ga0496104_0146642 | 3300048907 | Bacteria | 2266 |
| 855 | Ga0496104_0162627 | 3300048907 | Bacteria | 2141 |
| 856 | Ga0496104_0252763 | 3300048907 | Bacteria | 1675 |
| 857 | Ga0496105_0002471 | 3300048908 | Bacteria | 13377 |
| 858 | Ga0496105_0033996 | 3300048908 | Bacteria | 4191 |
| 859 | Ga0496105_0282821 | 3300048908 | Bacteria | 1337 |
| 860 | Ga0496105_0373092 | 3300048908 | Unclassified | 1136 |
| 861 | Ga0496105_0775943 | 3300048908 | Bacteria | 730 |
| 862 | Ga0496107_0192996 | 3300048910 | Bacteria | 1513 |
| 863 | Ga0496107_0496479 | 3300048910 | Unclassified | 905 |
| 864 | Ga0496108_0040547 | 3300048911 | Bacteria | 3882 |
| 865 | Ga0496109_0128025 | 3300048912 | Bacteria | 2368 |
| 866 | Ga0496109_0279182 | 3300048912 | Bacteria | 1574 |
| 867 | Ga0496110_0101070 | 3300048913 | Bacteria | 2585 |
| 868 | Ga0496110_0113142 | 3300048913 | Bacteria | 2440 |
| 869 | Ga0496110_0163040 | 3300048913 | Bacteria | 2021 |
| 870 | Ga0496110_0394608 | 3300048913 | Bacteria | 1261 |
| 871 | Ga0496111_0003574 | 3300048914 | Bacteria | 9634 |
| 872 | Ga0496111_0092455 | 3300048914 | Bacteria | 2217 |
| 873 | Ga0496112_0070886 | 3300048915 | Bacteria | 3444 |
| 874 | Ga0496112_0136322 | 3300048915 | Bacteria | 2424 |
| 875 | Ga0496112_0148272 | 3300048915 | Bacteria | 2314 |
| 876 | Ga0496112_0351270 | 3300048915 | Unclassified | 1417 |
| 877 | Ga0496113_0019388 | 3300048916 | Bacteria | 4756 |
| 878 | Ga0496113_0529772 | 3300048916 | Bacteria | 945 |
| 879 | Ga0496114_0021864 | 3300048917 | Bacteria | 5207 |
| 880 | Ga0496114_0026119 | 3300048917 | Bacteria | 4778 |
| 881 | Ga0496115_0113220 | 3300048918 | Bacteria | 2229 |
| 882 | Ga0496115_0289712 | 3300048918 | Bacteria | 1343 |
| 883 | Ga0496115_0412706 | 3300048918 | Bacteria | 1094 |
| 884 | Ga0496124_0178480 | 3300048927 | Bacteria | 1637 |
| 885 | Ga0496126_0000018 | 3300048929 | Bacteria | 581170 |
| 886 | Ga0496126_0000303 | 3300048929 | Bacteria | 104690 |
| 887 | Ga0496126_0001484 | 3300048929 | Bacteria | 36385 |
| 888 | Ga0496126_0116213 | 3300048929 | Bacteria | 2325 |
| 889 | Ga0496126_0119238 | 3300048929 | Bacteria | 2290 |
| 890 | Ga0496126_0189150 | 3300048929 | Bacteria | 1745 |
| 891 | Ga0495682_0023485 | 3300049460 | Bacteria | 2301 |
| 892 | Ga0501290_023513 | 3300049513 | Bacteria | 855 |
| 893 | Ga0501296_002897 | 3300049519 | Bacteria | 1819 |
| 894 | Ga0501031_0064110 | 3300049568 | Bacteria | 2393 |
| 895 | Ga0501032_0003645 | 3300049569 | Bacteria | 11717 |
| 896 | Ga0501033_0002402 | 3300049570 | Bacteria | 15944 |
| 897 | Ga0501034_0002515 | 3300049571 | Bacteria | 21990 |
| 898 | Ga0501036_0006243 | 3300049572 | Bacteria | 9666 |
| 899 | Ga0501037_0021635 | 3300049573 | Bacteria | 4755 |
| 900 | Ga0501038_0010117 | 3300049574 | Bacteria | 8634 |
| 901 | Ga0501038_0082627 | 3300049574 | Bacteria | 2705 |
| 902 | Ga0501039_0069808 | 3300049575 | Bacteria | 2729 |
| 903 | Ga0501043_0000343 | 3300049579 | Bacteria | 42161 |
| 904 | Ga0501046_0000199 | 3300049580 | Bacteria | 62001 |
| 905 | Ga0501047_0000766 | 3300049581 | Bacteria | 33631 |
| 906 | Ga0501047_0109652 | 3300049581 | Bacteria | 2643 |
| 907 | Ga0501070_0082836 | 3300049586 | Bacteria | 2655 |
| 908 | Ga0501070_0407599 | 3300049586 | Bacteria | 1099 |
| 909 | Ga0501073_0000437 | 3300049589 | Bacteria | 28708 |
| 910 | Ga0501074_0262336 | 3300049590 | Bacteria | 1228 |
| 911 | Ga0501257_026850 | 3300049686 | Bacteria | 1376 |
| 912 | Ga0501080_0017271 | 3300049742 | Bacteria | 6669 |
| 913 | Ga0501080_0365704 | 3300049742 | Bacteria | 1301 |
| 914 | Ga0501283_011542 | 3300049779 | Bacteria | 1316 |
| 915 | Ga0501035_0062126 | 3300049822 | Bacteria | 3323 |
| 916 | Ga0501044_0069580 | 3300049823 | Bacteria | 3582 |
| 917 | Ga0501044_0166125 | 3300049823 | Bacteria | 2181 |
| 918 | nmdc:mga08x19_32893_c1 | 3300050514 | Bacteria | 3271 |
| 919 | nmdc:mga08x19_456197_c1 | 3300050514 | Unclassified | 900 |
| 920 | nmdc:mga08x19_65233_c1 | 3300050514 | Bacteria | 2364 |
| 921 | Ga0495601_0010753 | 3300053077 | Bacteria | 5460 |
| 922 | Ga0495601_0034655 | 3300053077 | Bacteria | 3150 |
| 923 | Ga0500644_0056545 | 3300053088 | Bacteria | 1366 |
| 924 | Ga0500651_0000016 | 3300053093 | Bacteria | 161074 |
| 925 | Ga0500595_010150 | 3300053119 | Bacteria | 3756 |
| 926 | Ga0500595_040244 | 3300053119 | Bacteria | 1508 |
| 927 | Ga0587066_015538 | 3300059490 | Unclassified | 1186 |
| 928 | Ga0587073_0008457 | 3300059492 | Bacteria | 1667 |
| 929 | Ga0587083_0008183 | 3300059505 | Bacteria | 1628 |
| 930 | Ga0587088_017561 | 3300059508 | Unclassified | 1153 |
| 931 | Ga0587090_005110 | 3300059510 | Bacteria | 1628 |
| 932 | Ga0587067_007178 | 3300059640 | Bacteria | 1584 |
| 933 | Ga0587075_010825 | 3300059644 | Bacteria | 1214 |
| 934 | Ga0587107_009325 | 3300059652 | Unclassified | 1156 |
| 935 | Ga0587114_005199 | 3300059655 | Bacteria | 1396 |
| 936 | 2884218668 | 2884215851 | Bacteria | 4554841 |
| 937 | LJNas_1002114 | |||
| 938 | LJNas_1002119 | |||
| 939 | rootH2_10180936 | |||
| 940 | rootH1_10163155 | |||
| 941 | Ga0058863_10169021 | |||
| 942 | Ga0058861_10010007 | |||
| 943 | Ga0058862_10206145 | |||
| 944 | Ga0070658_10000127 | |||
| 945 | Ga0070658_10005926 | |||
| 946 | Ga0070658_10012417 | |||
| 947 | Ga0070658_10027405 | |||
| 948 | Ga0070658_10049018 | |||
| 949 | Ga0070658_10155821 | |||
| 950 | Ga0070658_10194039 | |||
| 951 | Ga0070658_10242843 | |||
| 952 | Ga0070658_10274348 | |||
| 953 | Ga0070658_10761058 | |||
| 954 | Ga0070683_100027547 | |||
| 955 | Ga0070683_100056915 | |||
| 956 | Ga0070683_100137189 | |||
| 957 | Ga0070683_100149503 | |||
| 958 | Ga0070683_100164107 | |||
| 959 | Ga0070683_100223887 | |||
| 960 | Ga0070683_100228318 | |||
| 961 | Ga0070683_100286227 | |||
| 962 | Ga0070683_100366160 | |||
| 963 | Ga0070683_100418645 | |||
| 964 | Ga0070670_100002219 | |||
| 965 | Ga0070670_100219085 | |||
| 966 | Ga0070670_100240335 | |||
| 967 | Ga0068869_100033425 | |||
| 968 | Ga0070666_10018134 | |||
| 969 | Ga0070666_10203719 | |||
| 970 | Ga0070680_100024372 | |||
| 971 | Ga0070680_100035320 | |||
| 972 | Ga0070680_100203560 | |||
| 973 | Ga0070680_100390111 | |||
| 974 | Ga0068868_100028922 | |||
| 975 | Ga0068868_100077548 | |||
| 976 | Ga0068868_100274002 | |||
| 977 | Ga0070660_100008310 | |||
| 978 | Ga0070660_100068432 | |||
| 979 | Ga0070660_100218581 | |||
| 980 | Ga0070660_100358250 | |||
| 981 | Ga0070661_100009496 | |||
| 982 | Ga0070661_100012609 | |||
| 983 | Ga0070661_100013673 | |||
| 984 | Ga0070668_100310919 | |||
| 985 | Ga0070669_100316061 | |||
| 986 | Ga0070675_100023019 | |||
| 987 | Ga0070671_100010048 | |||
| 988 | Ga0070671_100014408 | |||
| 989 | Ga0070671_100255009 | |||
| 990 | Ga0070673_100011090 | |||
| 991 | Ga0070659_100000543 | |||
| 992 | Ga0070659_100035327 | |||
| 993 | Ga0070659_100057835 | |||
| 994 | Ga0070659_100305228 | |||
| 995 | Ga0070667_100012156 | |||
| 996 | Ga0070667_100121784 | |||
| 997 | Ga0070667_100241161 | |||
| 998 | Ga0070709_10030959 | |||
| 999 | Ga0070714_100031767 | |||
| 1000 | Ga0070714_100110219 | |||
| 1001 | Ga0070714_100292635 | |||
| 1002 | Ga0070713_100003297 | |||
| 1003 | Ga0070713_100067778 | |||
| 1004 | Ga0070713_100104847 | |||
| 1005 | Ga0070713_100150844 | |||
| 1006 | Ga0070713_100431299 | |||
| 1007 | Ga0070713_100459287 | |||
| 1008 | Ga0070713_100743432 | |||
| 1009 | Ga0070710_10001087 | |||
| 1010 | Ga0070710_10025739 | |||
| 1011 | Ga0070710_10351578 | |||
| 1012 | Ga0070711_100012475 | |||
| 1013 | Ga0070711_100207321 | |||
| 1014 | Ga0070708_100019770 | |||
| 1015 | Ga0070708_100047654 | |||
| 1016 | Ga0070708_100087170 | |||
| 1017 | Ga0070663_100020176 | |||
| 1018 | Ga0070663_100031510 | |||
| 1019 | Ga0070663_100526784 | |||
| 1020 | Ga0070663_100786076 | |||
| 1021 | Ga0070678_100010783 | |||
| 1022 | Ga0070678_100654327 | |||
| 1023 | Ga0070662_100037880 | |||
| 1024 | Ga0070662_100075543 | |||
| 1025 | Ga0070681_10003504 | |||
| 1026 | Ga0070681_10009038 | |||
| 1027 | Ga0070681_10089820 | |||
| 1028 | Ga0070681_10101063 | |||
| 1029 | Ga0070681_10129621 | |||
| 1030 | Ga0070681_10167896 | |||
| 1031 | Ga0070681_10171172 | |||
| 1032 | Ga0070681_10259050 | |||
| 1033 | Ga0070681_10261677 | |||
| 1034 | Ga0070681_10317772 | |||
| 1035 | Ga0070681_10366738 | |||
| 1036 | Ga0070681_10430514 | |||
| 1037 | Ga0070681_10789321 | |||
| 1038 | Ga0070706_100182487 | |||
| 1039 | Ga0070707_100397264 | |||
| 1040 | Ga0070699_100012791 | |||
| 1041 | Ga0070679_100000142 | |||
| 1042 | Ga0070679_100016723 | |||
| 1043 | Ga0070679_100056106 | |||
| 1044 | Ga0070679_100064308 | |||
| 1045 | Ga0070679_100110681 | |||
| 1046 | Ga0070679_100208872 | |||
| 1047 | Ga0070679_100240901 | |||
| 1048 | Ga0070679_100247945 | |||
| 1049 | Ga0070679_100250736 | |||
| 1050 | Ga0070684_100002371 | |||
| 1051 | Ga0070684_100047389 | |||
| 1052 | Ga0070684_100066748 | |||
| 1053 | Ga0070684_100240322 | |||
| 1054 | Ga0070684_100303732 | |||
| 1055 | Ga0070684_100368000 | |||
| 1056 | Ga0070684_100561323 | |||
| 1057 | Ga0070684_100677841 | |||
| 1058 | Ga0070697_100083263 | |||
| 1059 | Ga0068853_100000049 | |||
| 1060 | Ga0068853_100010059 | |||
| 1061 | Ga0068853_100018922 | |||
| 1062 | Ga0068853_100080816 | |||
| 1063 | Ga0068853_100088219 | |||
| 1064 | Ga0068853_100092171 | |||
| 1065 | Ga0068853_100142180 | |||
| 1066 | Ga0068853_100157505 | |||
| 1067 | Ga0068853_100241265 | |||
| 1068 | Ga0068853_100462788 | |||
| 1069 | Ga0070672_100013876 | |||
| 1070 | Ga0070696_100412958 | |||
| 1071 | Ga0070693_100049914 | |||
| 1072 | Ga0070693_100230371 | |||
| 1073 | Ga0070693_100537021 | |||
| 1074 | Ga0070693_100707817 | |||
| 1075 | Ga0070665_100056890 | |||
| 1076 | Ga0070665_100067885 | |||
| 1077 | Ga0070665_100117300 | |||
| 1078 | Ga0070665_100153535 | |||
| 1079 | Ga0070665_100171343 | |||
| 1080 | Ga0070665_100303658 | |||
| 1081 | Ga0070665_100636490 | |||
| 1082 | Ga0068855_100022355 | |||
| 1083 | Ga0068855_100023539 | |||
| 1084 | Ga0068855_100035182 | |||
| 1085 | Ga0068855_100037164 | |||
| 1086 | Ga0068855_100055757 | |||
| 1087 | Ga0068855_100078538 | |||
| 1088 | Ga0068855_100080052 | |||
| 1089 | Ga0068855_100084975 | |||
| 1090 | Ga0068855_100106836 | |||
| 1091 | Ga0068855_100311221 | |||
| 1092 | Ga0068855_100364912 | |||
| 1093 | Ga0070664_100057431 | |||
| 1094 | Ga0070664_100184694 | |||
| 1095 | Ga0070664_100273595 | |||
| 1096 | Ga0070664_100541751 | |||
| 1097 | Ga0068857_100000158 | |||
| 1098 | Ga0068857_100004818 | |||
| 1099 | Ga0068857_100082502 | |||
| 1100 | Ga0068857_100162791 | |||
| 1101 | Ga0068857_100228357 | |||
| 1102 | Ga0068857_100232001 | |||
| 1103 | Ga0068854_100000055 | |||
| 1104 | Ga0068854_100007803 | |||
| 1105 | Ga0068854_100064011 | |||
| 1106 | Ga0068854_100503875 | |||
| 1107 | Ga0068856_100013601 | |||
| 1108 | Ga0068856_100014141 | |||
| 1109 | Ga0068856_100019029 | |||
| 1110 | Ga0068856_100041249 | |||
| 1111 | Ga0068856_100058066 | |||
| 1112 | Ga0068856_100068915 | |||
| 1113 | Ga0068856_100109057 | |||
| 1114 | Ga0068856_100148226 | |||
| 1115 | Ga0068856_100181827 | |||
| 1116 | Ga0068856_100246876 | |||
| 1117 | Ga0068856_100641779 | |||
| 1118 | Ga0068852_100000023 | |||
| 1119 | Ga0068852_100000650 | |||
| 1120 | Ga0068852_100008476 | |||
| 1121 | Ga0068852_100009589 | |||
| 1122 | Ga0068852_100035040 | |||
| 1123 | Ga0068852_100061504 | |||
| 1124 | Ga0068852_100072000 | |||
| 1125 | Ga0068859_100065862 | |||
| 1126 | Ga0068864_100014372 | |||
| 1127 | Ga0068864_100135149 | |||
| 1128 | Ga0068864_100142631 | |||
| 1129 | Ga0068861_100378888 | |||
| 1130 | Ga0068851_10018899 | |||
| 1131 | Ga0068851_10032688 | |||
| 1132 | Ga0068851_10063947 | |||
| 1133 | Ga0068851_10076541 | |||
| 1134 | Ga0068851_10113056 | |||
| 1135 | Ga0068851_10249383 | |||
| 1136 | Ga0068863_100008200 | |||
| 1137 | Ga0068863_100030571 | |||
| 1138 | Ga0068863_100069588 | |||
| 1139 | Ga0068863_100413225 | |||
| 1140 | Ga0068863_100633869 | |||
| 1141 | Ga0068858_100073258 | |||
| 1142 | Ga0068858_100388765 | |||
| 1143 | Ga0068860_100007235 | |||
| 1144 | Ga0068860_100215561 | |||
| 1145 | Ga0070717_10014729 | |||
| 1146 | Ga0070717_10031517 | |||
| 1147 | Ga0070717_10176321 | |||
| 1148 | Ga0070717_10432299 | |||
| 1149 | Ga0070717_10506575 | |||
| 1150 | Ga0070717_10946406 | |||
| 1151 | Ga0070717_11088233 | |||
| 1152 | Ga0070716_100026183 | |||
| 1153 | Ga0070716_100060077 | |||
| 1154 | Ga0070716_100069691 | |||
| 1155 | Ga0070716_100253970 | |||
| 1156 | Ga0070712_100033762 | |||
| 1157 | Ga0070712_100424603 | |||
| 1158 | Ga0097621_100009531 | |||
| 1159 | Ga0097621_100034492 | |||
| 1160 | Ga0097621_100087283 | |||
| 1161 | Ga0068871_100028980 | |||
| 1162 | Ga0068871_100037410 | |||
| 1163 | Ga0068871_100714500 | |||
| 1164 | Ga0075430_100301558 | |||
| 1165 | Ga0075434_100050253 | |||
| 1166 | Ga0068865_100194829 | |||
| 1167 | Ga0075436_100040657 | |||
| 1168 | Ga0075436_100108968 | |||
| 1169 | Ga0075436_100335447 | |||
| 1170 | Ga0075436_100487932 | |||
| 1171 | Ga0097620_100065860 | |||
| 1172 | Ga0099794_10080636 | |||
| 1173 | Ga0105240_10000001 | |||
| 1174 | Ga0105240_10000203 | |||
| 1175 | Ga0105240_10002494 | |||
| 1176 | Ga0105240_10003537 | |||
| 1177 | Ga0105240_10003873 | |||
| 1178 | Ga0105240_10013349 | |||
| 1179 | Ga0105240_10017631 | |||
| 1180 | Ga0105240_10022791 | |||
| 1181 | Ga0105240_10025072 | |||
| 1182 | Ga0105240_10053947 | |||
| 1183 | Ga0105240_10071210 | |||
| 1184 | Ga0105240_10125952 | |||
| 1185 | Ga0105240_10127164 | |||
| 1186 | Ga0105240_10228961 | |||
| 1187 | Ga0105240_10267247 | |||
| 1188 | Ga0105240_10550702 | |||
| 1189 | Ga0105240_10835884 | |||
| 1190 | Ga0105240_11085003 | |||
| 1191 | Ga0105245_10003445 | |||
| 1192 | Ga0105245_10014904 | |||
| 1193 | Ga0105245_10016260 | |||
| 1194 | Ga0105245_10051868 | |||
| 1195 | Ga0105245_10197349 | |||
| 1196 | Ga0105247_10034937 | |||
| 1197 | Ga0105243_10245779 | |||
| 1198 | Ga0105241_10001348 | |||
| 1199 | Ga0105241_10022157 | |||
| 1200 | Ga0105241_10050444 | |||
| 1201 | Ga0105241_10074452 | |||
| 1202 | Ga0105241_10098700 | |||
| 1203 | Ga0105241_10710099 | |||
| 1204 | Ga0105242_10032800 | |||
| 1205 | Ga0105248_10000003 | |||
| 1206 | Ga0105248_10003035 | |||
| 1207 | Ga0105248_10012616 | |||
| 1208 | Ga0105248_10019898 | |||
| 1209 | Ga0105248_10082685 | |||
| 1210 | Ga0105237_10013833 | |||
| 1211 | Ga0105237_10055993 | |||
| 1212 | Ga0105237_10095413 | |||
| 1213 | Ga0105237_10120869 | |||
| 1214 | Ga0105237_10197854 | |||
| 1215 | Ga0105237_10252397 | |||
| 1216 | Ga0105237_10338597 | |||
| 1217 | Ga0105237_10760196 | |||
| 1218 | Ga0105238_10004199 | |||
| 1219 | Ga0105238_10009838 | |||
| 1220 | Ga0105238_10011748 | |||
| 1221 | Ga0105238_10016124 | |||
| 1222 | Ga0105238_10017544 | |||
| 1223 | Ga0105238_10033244 | |||
| 1224 | Ga0105238_10051566 | |||
| 1225 | Ga0105238_10058807 | |||
| 1226 | Ga0105238_10067744 | |||
| 1227 | Ga0105238_10095478 | |||
| 1228 | Ga0105238_10120932 | |||
| 1229 | Ga0105238_10159775 | |||
| 1230 | Ga0105238_10162974 | |||
| 1231 | Ga0105238_10195748 | |||
| 1232 | Ga0105238_10199759 | |||
| 1233 | Ga0105238_10440891 | |||
| 1234 | Ga0105249_10132004 | |||
| 1235 | Ga0105249_10272198 | |||
| 1236 | Ga0105249_10413466 | |||
| 1237 | Ga0105239_10002793 | |||
| 1238 | Ga0105239_10044315 | |||
| 1239 | Ga0105239_10077477 | |||
| 1240 | Ga0105239_10151970 | |||
| 1241 | Ga0105239_10292429 | |||
| 1242 | Ga0105239_10330250 | |||
| 1243 | Ga0105239_10353290 | |||
| 1244 | Ga0105239_10372854 | |||
| 1245 | Ga0105239_10873417 | |||
| 1246 | Ga0105246_10046125 | |||
| 1247 | Ga0157373_10010582 | |||
| 1248 | Ga0157373_10043823 | |||
| 1249 | Ga0157371_10040562 | |||
| 1250 | Ga0157371_10210629 | |||
| 1251 | Ga0157370_10000082 | |||
| 1252 | Ga0157370_10051902 | |||
| 1253 | Ga0157370_10052517 | |||
| 1254 | Ga0157370_10054612 | |||
| 1255 | Ga0157370_10067409 | |||
| 1256 | Ga0157370_10118953 | |||
| 1257 | Ga0157370_10161932 | |||
| 1258 | Ga0157370_10317155 | |||
| 1259 | Ga0157370_10321274 | |||
| 1260 | Ga0157370_10326642 | |||
| 1261 | Ga0157370_10525410 | |||
| 1262 | Ga0157370_10793616 | |||
| 1263 | Ga0157369_10000095 | |||
| 1264 | Ga0157369_10004782 | |||
| 1265 | Ga0157369_10016017 | |||
| 1266 | Ga0157369_10022800 | |||
| 1267 | Ga0157369_10024425 | |||
| 1268 | Ga0157369_10025865 | |||
| 1269 | Ga0157369_10035004 | |||
| 1270 | Ga0157369_10040476 | |||
| 1271 | Ga0157369_10042663 | |||
| 1272 | Ga0157369_10053162 | |||
| 1273 | Ga0157369_10137346 | |||
| 1274 | Ga0157369_10141715 | |||
| 1275 | Ga0157369_10155800 | |||
| 1276 | Ga0157369_10215274 | |||
| 1277 | Ga0157369_10385349 | |||
| 1278 | Ga0157369_10464371 | |||
| 1279 | Ga0157369_10547272 | |||
| 1280 | Ga0157369_11302650 | |||
| 1281 | Ga0157374_10006654 | |||
| 1282 | Ga0157374_10013447 | |||
| 1283 | Ga0157374_10013966 | |||
| 1284 | Ga0157374_10022035 | |||
| 1285 | Ga0157374_10024468 | |||
| 1286 | Ga0157374_10111890 | |||
| 1287 | Ga0157374_10120998 | |||
| 1288 | Ga0157374_10137656 | |||
| 1289 | Ga0157374_10155817 | |||
| 1290 | Ga0157374_10577733 | |||
| 1291 | Ga0157374_10658316 | |||
| 1292 | Ga0157374_11111129 | |||
| 1293 | Ga0157378_10005859 | |||
| 1294 | Ga0157378_10016744 | |||
| 1295 | Ga0157378_10026752 | |||
| 1296 | Ga0157378_10031303 | |||
| 1297 | Ga0157378_10145631 | |||
| 1298 | Ga0157378_10167630 | |||
| 1299 | Ga0157378_10975965 | |||
| 1300 | Ga0163162_10063135 | |||
| 1301 | Ga0163162_10123812 | |||
| 1302 | Ga0157372_10000102 | |||
| 1303 | Ga0157372_10010094 | |||
| 1304 | Ga0157372_10012351 | |||
| 1305 | Ga0157372_10018972 | |||
| 1306 | Ga0157372_10026765 | |||
| 1307 | Ga0157372_10034189 | |||
| 1308 | Ga0157372_10035115 | |||
| 1309 | Ga0157372_10045727 | |||
| 1310 | Ga0157372_10047146 | |||
| 1311 | Ga0157372_10143199 | |||
| 1312 | Ga0157372_10221366 | |||
| 1313 | Ga0157372_10225927 | |||
| 1314 | Ga0157375_10013132 | |||
| 1315 | Ga0157375_10304072 | |||
| 1316 | Ga0163163_10061970 | |||
| 1317 | Ga0163163_10070842 | |||
| 1318 | Ga0163163_10216767 | |||
| 1319 | Ga0182008_10021755 | |||
| 1320 | Ga0157379_10012396 | |||
| 1321 | Ga0157379_10031712 | |||
| 1322 | Ga0157379_10199972 | |||
| 1323 | Ga0157379_10216580 | |||
| 1324 | Ga0157379_10218832 | |||
| 1325 | Ga0157379_10238668 | |||
| 1326 | Ga0157376_10002799 | |||
| 1327 | Ga0157376_10024145 | |||
| 1328 | Ga0157376_10057025 | |||
| 1329 | Ga0157376_10068438 | |||
| 1330 | Ga0157376_10161132 | |||
| 1331 | Ga0157376_10271962 | |||
| 1332 | Ga0157376_10411348 | |||
| 1333 | Ga0157376_10525593 | |||
| 1334 | Ga0182005_1011918 | |||
| 1335 | Ga0163161_10047930 | |||
| 1336 | Ga0206353_10589488 | |||
| 1337 | Ga0154015_1253388 | |||
| 1338 | Ga0154015_1618321 | |||
| 1339 | Ga0213872_10009480 | |||
| 1340 | Ga0213872_10016554 | |||
| 1341 | Ga0213872_10038364 | |||
| 1342 | Ga0224712_10044926 | |||
| 1343 | Ga0224571_100070 | |||
| 1344 | Ga0228598_1000318 | |||
| 1345 | Ga0228598_1000456 | |||
| 1346 | Ga0207697_10048954 | |||
| 1347 | Ga0207656_10024994 | |||
| 1348 | Ga0207656_10030677 | |||
| 1349 | Ga0207656_10035109 | |||
| 1350 | Ga0207656_10069013 | |||
| 1351 | Ga0207656_10089766 | |||
| 1352 | Ga0207692_10000544 | |||
| 1353 | Ga0207710_10011929 | |||
| 1354 | Ga0207680_10190439 | |||
| 1355 | Ga0207647_10007872 | |||
| 1356 | Ga0207647_10033850 | |||
| 1357 | Ga0207647_10169747 | |||
| 1358 | Ga0207685_10040565 | |||
| 1359 | Ga0207699_10047674 | |||
| 1360 | Ga0207699_10166402 | |||
| 1361 | Ga0207699_10429368 | |||
| 1362 | Ga0207699_10589477 | |||
| 1363 | Ga0207645_10019509 | |||
| 1364 | Ga0207705_10000020 | |||
| 1365 | Ga0207705_10000562 | |||
| 1366 | Ga0207705_10020122 | |||
| 1367 | Ga0207705_10033166 | |||
| 1368 | Ga0207705_10070610 | |||
| 1369 | Ga0207705_10108027 | |||
| 1370 | Ga0207705_10140847 | |||
| 1371 | Ga0207705_10167041 | |||
| 1372 | Ga0207705_10178395 | |||
| 1373 | Ga0207705_10285699 | |||
| 1374 | Ga0207705_10533811 | |||
| 1375 | Ga0207684_10244547 | |||
| 1376 | Ga0207654_10000154 | |||
| 1377 | Ga0207654_10008218 | |||
| 1378 | Ga0207654_10074069 | |||
| 1379 | Ga0207654_10086042 | |||
| 1380 | Ga0207654_10086545 | |||
| 1381 | Ga0207707_10053907 | |||
| 1382 | Ga0207707_10075858 | |||
| 1383 | Ga0207707_10092577 | |||
| 1384 | Ga0207707_10122448 | |||
| 1385 | Ga0207707_10125768 | |||
| 1386 | Ga0207707_10129161 | |||
| 1387 | Ga0207707_10296707 | |||
| 1388 | Ga0207707_10341735 | |||
| 1389 | Ga0207707_10489598 | |||
| 1390 | Ga0207695_10000001 | |||
| 1391 | Ga0207695_10000080 | |||
| 1392 | Ga0207695_10000303 | |||
| 1393 | Ga0207695_10001162 | |||
| 1394 | Ga0207695_10010711 | |||
| 1395 | Ga0207695_10016845 | |||
| 1396 | Ga0207695_10036140 | |||
| 1397 | Ga0207695_10039924 | |||
| 1398 | Ga0207695_10046202 | |||
| 1399 | Ga0207695_10061989 | |||
| 1400 | Ga0207695_10092962 | |||
| 1401 | Ga0207695_10119326 | |||
| 1402 | Ga0207695_10125766 | |||
| 1403 | Ga0207695_10222845 | |||
| 1404 | Ga0207695_10323636 | |||
| 1405 | Ga0207671_10001283 | |||
| 1406 | Ga0207671_10051157 | |||
| 1407 | Ga0207671_10106061 | |||
| 1408 | Ga0207671_10171809 | |||
| 1409 | Ga0207671_10184214 | |||
| 1410 | Ga0207671_10342543 | |||
| 1411 | Ga0207693_10034660 | |||
| 1412 | Ga0207693_10089471 | |||
| 1413 | Ga0207663_10097909 | |||
| 1414 | Ga0207663_10103697 | |||
| 1415 | Ga0207663_10577885 | |||
| 1416 | Ga0207660_10017684 | |||
| 1417 | Ga0207660_10024884 | |||
| 1418 | Ga0207660_10373925 | |||
| 1419 | Ga0207660_10391181 | |||
| 1420 | Ga0207660_10477750 | |||
| 1421 | Ga0207660_10544054 | |||
| 1422 | Ga0207657_10001167 | |||
| 1423 | Ga0207657_10011054 | |||
| 1424 | Ga0207657_10012789 | |||
| 1425 | Ga0207657_10015325 | |||
| 1426 | Ga0207657_10057971 | |||
| 1427 | Ga0207657_10177074 | |||
| 1428 | Ga0207657_10384094 | |||
| 1429 | Ga0207649_10008630 | |||
| 1430 | Ga0207649_10023724 | |||
| 1431 | Ga0207649_10060461 | |||
| 1432 | Ga0207649_10073936 | |||
| 1433 | Ga0207652_10003733 | |||
| 1434 | Ga0207652_10012797 | |||
| 1435 | Ga0207652_10064756 | |||
| 1436 | Ga0207652_10074748 | |||
| 1437 | Ga0207652_10107374 | |||
| 1438 | Ga0207652_10122528 | |||
| 1439 | Ga0207652_10214561 | |||
| 1440 | Ga0207652_10262021 | |||
| 1441 | Ga0207646_10027006 | |||
| 1442 | Ga0207646_10061824 | |||
| 1443 | Ga0207646_10381060 | |||
| 1444 | Ga0207681_10372494 | |||
| 1445 | Ga0207694_10000184 | |||
| 1446 | Ga0207694_10000520 | |||
| 1447 | Ga0207694_10002242 | |||
| 1448 | Ga0207694_10005906 | |||
| 1449 | Ga0207694_10015919 | |||
| 1450 | Ga0207694_10105638 | |||
| 1451 | Ga0207694_10264021 | |||
| 1452 | Ga0207650_10007412 | |||
| 1453 | Ga0207650_10142958 | |||
| 1454 | Ga0207650_10245297 | |||
| 1455 | Ga0207659_10055096 | |||
| 1456 | Ga0207687_10017710 | |||
| 1457 | Ga0207687_10021523 | |||
| 1458 | Ga0207687_10024117 | |||
| 1459 | Ga0207687_10024146 | |||
| 1460 | Ga0207687_10227668 | |||
| 1461 | Ga0207700_10029316 | |||
| 1462 | Ga0207700_10050881 | |||
| 1463 | Ga0207700_10104341 | |||
| 1464 | Ga0207700_10190703 | |||
| 1465 | Ga0207700_10619160 | |||
| 1466 | Ga0207664_10044693 | |||
| 1467 | Ga0207664_10055740 | |||
| 1468 | Ga0207664_10098498 | |||
| 1469 | Ga0207664_10139131 | |||
| 1470 | Ga0207664_10142063 | |||
| 1471 | Ga0207664_10258537 | |||
| 1472 | Ga0207644_10003660 | |||
| 1473 | Ga0207644_10022921 | |||
| 1474 | Ga0207644_10755678 | |||
| 1475 | Ga0207690_10000553 | |||
| 1476 | Ga0207690_10072618 | |||
| 1477 | Ga0207690_10137372 | |||
| 1478 | Ga0207706_10002843 | |||
| 1479 | Ga0207706_10026562 | |||
| 1480 | Ga0207704_10070618 | |||
| 1481 | Ga0207665_10067620 | |||
| 1482 | Ga0207665_10069495 | |||
| 1483 | Ga0207665_10104766 | |||
| 1484 | Ga0207665_10200314 | |||
| 1485 | Ga0207691_10002212 | |||
| 1486 | Ga0207711_10000013 | |||
| 1487 | Ga0207711_10003932 | |||
| 1488 | Ga0207711_10027419 | |||
| 1489 | Ga0207711_10105990 | |||
| 1490 | Ga0207711_10170679 | |||
| 1491 | Ga0207689_10000659 | |||
| 1492 | Ga0207689_10005877 | |||
| 1493 | Ga0207661_10086886 | |||
| 1494 | Ga0207661_10152072 | |||
| 1495 | Ga0207661_10152983 | |||
| 1496 | Ga0207661_10169361 | |||
| 1497 | Ga0207661_10365526 | |||
| 1498 | Ga0207661_10376274 | |||
| 1499 | Ga0207661_10435648 | |||
| 1500 | Ga0207679_10131132 | |||
| 1501 | Ga0207679_10187229 | |||
| 1502 | Ga0207667_10000259 | |||
| 1503 | Ga0207667_10000360 | |||
| 1504 | Ga0207667_10000385 | |||
| 1505 | Ga0207667_10003193 | |||
| 1506 | Ga0207667_10004195 | |||
| 1507 | Ga0207667_10020451 | |||
| 1508 | Ga0207667_10021092 | |||
| 1509 | Ga0207667_10022273 | |||
| 1510 | Ga0207667_10025199 | |||
| 1511 | Ga0207667_10061196 | |||
| 1512 | Ga0207667_10070190 | |||
| 1513 | Ga0207667_10132051 | |||
| 1514 | Ga0207667_10138412 | |||
| 1515 | Ga0207667_10442289 | |||
| 1516 | Ga0207651_10135544 | |||
| 1517 | Ga0207712_10426277 | |||
| 1518 | Ga0207640_10000011 | |||
| 1519 | Ga0207640_10077604 | |||
| 1520 | Ga0207640_10191626 | |||
| 1521 | Ga0207640_10337966 | |||
| 1522 | Ga0207640_10460605 | |||
| 1523 | Ga0207658_10081057 | |||
| 1524 | Ga0207658_10195626 | |||
| 1525 | Ga0207677_10002003 | |||
| 1526 | Ga0207677_10345121 | |||
| 1527 | Ga0207703_10027827 | |||
| 1528 | Ga0207703_10049953 | |||
| 1529 | Ga0207703_10384030 | |||
| 1530 | Ga0207639_10000085 | |||
| 1531 | Ga0207639_10000586 | |||
| 1532 | Ga0207639_10037593 | |||
| 1533 | Ga0207639_10048283 | |||
| 1534 | Ga0207639_10054517 | |||
| 1535 | Ga0207639_10065523 | |||
| 1536 | Ga0207639_10147871 | |||
| 1537 | Ga0207639_10350913 | |||
| 1538 | Ga0207678_10005665 | |||
| 1539 | Ga0207678_10012647 | |||
| 1540 | Ga0207678_10015323 | |||
| 1541 | Ga0207678_10200822 | |||
| 1542 | Ga0207702_10016202 | |||
| 1543 | Ga0207702_10038053 | |||
| 1544 | Ga0207702_10038590 | |||
| 1545 | Ga0207702_10076053 | |||
| 1546 | Ga0207702_10138403 | |||
| 1547 | Ga0207702_10160710 | |||
| 1548 | Ga0207702_10286429 | |||
| 1549 | Ga0207702_10412719 | |||
| 1550 | Ga0207702_10474556 | |||
| 1551 | Ga0207702_10504342 | |||
| 1552 | Ga0207702_10579262 | |||
| 1553 | Ga0207641_10006263 | |||
| 1554 | Ga0207641_10010079 | |||
| 1555 | Ga0207641_10025399 | |||
| 1556 | Ga0207641_11194350 | |||
| 1557 | Ga0207648_10449632 | |||
| 1558 | Ga0207676_10071649 | |||
| 1559 | Ga0207676_10081144 | |||
| 1560 | Ga0207674_10000122 | |||
| 1561 | Ga0207674_10005786 | |||
| 1562 | Ga0207674_10005961 | |||
| 1563 | Ga0207674_10112128 | |||
| 1564 | Ga0207674_10134956 | |||
| 1565 | Ga0207674_10158701 | |||
| 1566 | Ga0207674_10239523 | |||
| 1567 | Ga0207674_10289017 | |||
| 1568 | Ga0207674_10348495 | |||
| 1569 | Ga0207675_100469683 | |||
| 1570 | Ga0207683_10000896 | |||
| 1571 | Ga0207698_10000026 | |||
| 1572 | Ga0207698_10000221 | |||
| 1573 | Ga0207698_10012069 | |||
| 1574 | Ga0207698_10036728 | |||
| 1575 | Ga0207698_10040613 | |||
| 1576 | Ga0207698_10097128 | |||
| 1577 | Ga0207698_10105379 | |||
| 1578 | Ga0207698_10116654 | |||
| 1579 | Ga0207698_10140845 | |||
| 1580 | Ga0265356_1001810 | |||
| 1581 | Ga0268266_10030012 | |||
| 1582 | Ga0268266_10075026 | |||
| 1583 | Ga0268266_10122131 | |||
| 1584 | Ga0268266_10443874 | |||
| 1585 | Ga0268266_10508422 | |||
| 1586 | Ga0268264_10000653 | |||
| 1587 | Ga0265319_1093749 | |||
| 1588 | Ga0265338_10001900 | |||
| 1589 | Ga0265338_10013731 | |||
| 1590 | Ga0265338_10088176 | |||
| 1591 | Ga0265338_10117288 | |||
| 1592 | Ga0265338_10194152 | |||
| 1593 | Ga0265324_10134710 | |||
| 1594 | Ga0265762_1000914 | |||
| 1595 | Ga0265770_1003967 | |||
| 1596 | Ga0265765_1014627 | |||
| 1597 | Ga0265771_1001456 | |||
| 1598 | Ga0265760_10066695 | |||
| 1599 | Ga0265330_10000548 | |||
| 1600 | Ga0265330_10000631 | |||
| 1601 | Ga0265330_10008852 | |||
| 1602 | Ga0265330_10028232 | |||
| 1603 | Ga0265330_10055915 | |||
| 1604 | Ga0265332_10007138 | |||
| 1605 | Ga0265332_10080339 | |||
| 1606 | Ga0265328_10008795 | |||
| 1607 | Ga0265328_10031821 | |||
| 1608 | Ga0265328_10113805 | |||
| 1609 | Ga0265320_10061946 | |||
| 1610 | Ga0265325_10000614 | |||
| 1611 | Ga0265325_10000899 | |||
| 1612 | Ga0265325_10009867 | |||
| 1613 | Ga0265325_10026762 | |||
| 1614 | Ga0265325_10027726 | |||
| 1615 | Ga0265325_10041139 | |||
| 1616 | Ga0265325_10150599 | |||
| 1617 | Ga0265340_10002990 | |||
| 1618 | Ga0265340_10048843 | |||
| 1619 | Ga0265339_10000011 | |||
| 1620 | Ga0265339_10004485 | |||
| 1621 | Ga0265339_10021534 | |||
| 1622 | Ga0265339_10028416 | |||
| 1623 | Ga0265339_10039397 | |||
| 1624 | Ga0265339_10046078 | |||
| 1625 | Ga0265339_10074604 | |||
| 1626 | Ga0265331_10034295 | |||
| 1627 | Ga0265331_10056221 | |||
| 1628 | Ga0265316_10002386 | |||
| 1629 | Ga0265316_10006508 | |||
| 1630 | Ga0265316_10013155 | |||
| 1631 | Ga0265316_10018468 | |||
| 1632 | Ga0265316_10174177 | |||
| 1633 | Ga0265316_10369902 | |||
| 1634 | Ga0265316_10407827 | |||
| 1635 | Ga0265313_10001746 | |||
| 1636 | Ga0265313_10004925 | |||
| 1637 | Ga0265313_10014026 | |||
| 1638 | Ga0265314_10000151 | |||
| 1639 | Ga0265314_10066976 | |||
| 1640 | Ga0265314_10067265 | |||
| 1641 | Ga0265342_10000977 | |||
| 1642 | Ga0265342_10009076 | |||
| 1643 | Ga0265342_10012334 | |||
| 1644 | Ga0265342_10013306 | |||
| 1645 | Ga0265342_10014774 | |||
| 1646 | Ga0265342_10020074 | |||
| 1647 | Ga0265342_10037153 | |||
| 1648 | Ga0265342_10040434 | |||
| 1649 | Ga0265342_10045754 | |||
| 1650 | Ga0265342_10066928 | |||
| 1651 | Ga0307510_10050521 | |||
| 1652 | Ga0307510_10086828 | |||
| 1653 | Ga0373926_0005964 | |||
| 1654 | Ga0373936_0008999 | |||
| 1655 | Ga0373954_0356053 | |||
| 1656 | Ga0373956_0007313 | |||
| 1657 | Ga0373957_0054835 | |||
| 1658 | Ga0373946_0019743 | |||
| 1659 | Ga0373955_0019606 | |||
| 1660 | Ga0373955_0046902 | |||
| 1661 | Ga0373955_0386896 | |||
| 1662 | Ga0373924_0000594 | |||
| 1663 | Ga0373924_0070292 | |||
| 1664 | Ga0373935_0114292 | |||
| 1665 | Ga0373933_0144338 | |||
| 1666 | Ga0373933_0190558 | |||
| 1667 | Ga0373947_0031202 | |||
| 1668 | Ga0373937_0000188 | |||
| 1669 | Ga0373937_0004446 | |||
| 1670 | Ga0373937_0375316 | |||
| 1671 | Ga0373937_1288031 | |||
| 1672 | Ga0373925_0018342 | |||
| 1673 | Ga0373925_0038621 | |||
| 1674 | Ga0395900_0405899 | |||
| 1675 | Ga0395900_0777166 | |||
| 1676 | Ga0395898_0076695 | |||
| 1677 | Ga0395898_0379897 | |||
| 1678 | Ga0395905_0012025 | |||
| 1679 | Ga0395905_0068453 | |||
| 1680 | Ga0395905_0358324 | |||
| 1681 | Ga0395905_0523149 | |||
| 1682 | Ga0395901_0592451 | |||
| 1683 | Ga0395901_0900573 | |||
| 1684 | Ga0436360_0569272 | |||
| 1685 | Ga0436360_1128119 | |||
| 1686 | Ga0436361_0010391 | |||
| 1687 | Ga0436361_0061101 | |||
| 1688 | Ga0436361_0448534 | |||
| 1689 | Ga0436361_0639567 | |||
| 1690 | Ga0436361_0879866 | |||
| 1691 | Ga0436361_1162467 | |||
| 1692 | Ga0436363_0162138 | |||
| 1693 | Ga0436363_0461399 | |||
| 1694 | Ga0436362_0240647 | |||
| 1695 | Ga0466963_0000107 | |||
| 1696 | Ga0466963_0058277 | |||
| 1697 | Ga0466963_0113690 | |||
| 1698 | Ga0466963_0150175 | |||
| 1699 | Ga0466963_0243937 | |||
| 1700 | Ga0466957_0001754 | |||
| 1701 | Ga0466957_0447897 | |||
| 1702 | Ga0466959_0159680 | |||
| 1703 | Ga0451576_1315184 | |||
| 1704 | Ga0466958_0047770 | |||
| 1705 | Ga0466958_0105353 | |||
| 1706 | Ga0466967_0010311 | |||
| 1707 | Ga0466967_0012589 | |||
| 1708 | Ga0466967_0422045 | |||
| 1709 | Ga0495603_0000592 | |||
| 1710 | Ga0495629_0061900 | |||
| 1711 | Ga0495638_0158466 | |||
| 1712 | Ga0495651_0034112 | |||
| 1713 | Ga0495650_0000006 | |||
| 1714 | Ga0495650_0002472 | |||
| 1715 | Ga0495650_0049622 | |||
| 1716 | Ga0495580_0004410 | |||
| 1717 | Ga0495580_0020638 | |||
| 1718 | Ga0495580_0053999 | |||
| 1719 | Ga0495580_0083777 | |||
| 1720 | Ga0495662_0099947 | |||
| 1721 | Ga0495664_0034919 | |||
| 1722 | Ga0495585_0004907 | |||
| 1723 | Ga0495585_0170442 | |||
| 1724 | Ga0495594_0001118 | |||
| 1725 | Ga0495596_0004138 | |||
| 1726 | Ga0495583_0023158 | |||
| 1727 | Ga0495583_0046599 | |||
| 1728 | Ga0495606_0255215 | |||
| 1729 | Ga0495628_0038045 | |||
| 1730 | Ga0495628_0133928 | |||
| 1731 | Ga0495631_0017357 | |||
| 1732 | Ga0495631_0031194 | |||
| 1733 | Ga0495644_0000058 | |||
| 1734 | Ga0495648_0024978 | |||
| 1735 | Ga0495648_0078985 | |||
| 1736 | Ga0495666_0124858 | |||
| 1737 | Ga0495642_0003827 | |||
| 1738 | Ga0495652_0059042 | |||
| 1739 | Ga0495665_0021330 | |||
| 1740 | Ga0495640_0048324 | |||
| 1741 | Ga0495586_0087692 | |||
| 1742 | Ga0495587_0122827 | |||
| 1743 | Ga0495609_0008526 | |||
| 1744 | Ga0495645_0003905 | |||
| 1745 | Ga0495645_0079147 | |||
| 1746 | Ga0495633_0002138 | |||
| 1747 | Ga0495633_0275420 | |||
| 1748 | Ga0495667_0069997 | |||
| 1749 | Ga0495656_0059638 | |||
| 1750 | Ga0495668_0015581 | |||
| 1751 | Ga0495611_0004999 | |||
| 1752 | Ga0495625_0002024 | |||
| 1753 | Ga0495625_0018272 | |||
| 1754 | Ga0495625_0021565 | |||
| 1755 | Ga0495625_0070054 | |||
| 1756 | Ga0495625_0073319 | |||
| 1757 | Ga0495635_0064750 | |||
| 1758 | Ga0495661_0004329 | |||
| 1759 | Ga0495657_0077042 | |||
| 1760 | Ga0495599_0164359 | |||
| 1761 | Ga0495623_0046920 | |||
| 1762 | Ga0495623_0054069 | |||
| 1763 | Ga0495646_0045291 | |||
| 1764 | Ga0495658_0078626 | |||
| 1765 | Ga0495669_0009608 | |||
| 1766 | Ga0495613_0046863 | |||
| 1767 | Ga0495670_0309273 | |||
| 1768 | Ga0495589_0141531 | |||
| 1769 | Ga0495581_0039648 | |||
| 1770 | Ga0495604_0060709 | |||
| 1771 | Ga0495674_0020527 | |||
| 1772 | Ga0495672_0078796 | |||
| 1773 | Ga0495683_0090570 | |||
| 1774 | Ga0495679_055291 | |||
| 1775 | Ga0495673_0112129 | |||
| 1776 | Ga0495686_0010491 | |||
| 1777 | Ga0495593_0065122 | |||
| 1778 | Ga0495602_0158783 | |||
| 1779 | Ga0496100_0185172 | |||
| 1780 | Ga0496100_0316737 | |||
| 1781 | Ga0496100_0614737 | |||
| 1782 | Ga0496101_0069925 | |||
| 1783 | Ga0496101_0091782 | |||
| 1784 | Ga0496102_0038515 | |||
| 1785 | Ga0496102_0066719 | |||
| 1786 | Ga0496102_0133453 | |||
| 1787 | Ga0496104_0024706 | |||
| 1788 | Ga0496104_0079480 | |||
| 1789 | Ga0496104_0135632 | |||
| 1790 | Ga0496104_0146642 | |||
| 1791 | Ga0496104_0162627 | |||
| 1792 | Ga0496104_0252763 | |||
| 1793 | Ga0496105_0002471 | |||
| 1794 | Ga0496105_0033996 | |||
| 1795 | Ga0496105_0282821 | |||
| 1796 | Ga0496105_0373092 | |||
| 1797 | Ga0496105_0775943 | |||
| 1798 | Ga0496107_0192996 | |||
| 1799 | Ga0496107_0496479 | |||
| 1800 | Ga0496108_0040547 | |||
| 1801 | Ga0496109_0128025 | |||
| 1802 | Ga0496109_0279182 | |||
| 1803 | Ga0496110_0101070 | |||
| 1804 | Ga0496110_0113142 | |||
| 1805 | Ga0496110_0163040 | |||
| 1806 | Ga0496110_0394608 | |||
| 1807 | Ga0496111_0003574 | |||
| 1808 | Ga0496111_0092455 | |||
| 1809 | Ga0496112_0070886 | |||
| 1810 | Ga0496112_0136322 | |||
| 1811 | Ga0496112_0148272 | |||
| 1812 | Ga0496112_0351270 | |||
| 1813 | Ga0496113_0019388 | |||
| 1814 | Ga0496113_0529772 | |||
| 1815 | Ga0496114_0021864 | |||
| 1816 | Ga0496114_0026119 | |||
| 1817 | Ga0496115_0113220 | |||
| 1818 | Ga0496115_0289712 | |||
| 1819 | Ga0496115_0412706 | |||
| 1820 | Ga0496124_0178480 | |||
| 1821 | Ga0496126_0000018 | |||
| 1822 | Ga0496126_0000303 | |||
| 1823 | Ga0496126_0001484 | |||
| 1824 | Ga0496126_0116213 | |||
| 1825 | Ga0496126_0119238 | |||
| 1826 | Ga0496126_0189150 | |||
| 1827 | Ga0495682_0023485 | |||
| 1828 | Ga0501290_023513 | |||
| 1829 | Ga0501296_002897 | |||
| 1830 | Ga0501031_0064110 | |||
| 1831 | Ga0501032_0003645 | |||
| 1832 | Ga0501033_0002402 | |||
| 1833 | Ga0501034_0002515 | |||
| 1834 | Ga0501036_0006243 | |||
| 1835 | Ga0501037_0021635 | |||
| 1836 | Ga0501038_0010117 | |||
| 1837 | Ga0501038_0082627 | |||
| 1838 | Ga0501039_0069808 | |||
| 1839 | Ga0501043_0000343 | |||
| 1840 | Ga0501046_0000199 | |||
| 1841 | Ga0501047_0000766 | |||
| 1842 | Ga0501047_0109652 | |||
| 1843 | Ga0501070_0082836 | |||
| 1844 | Ga0501070_0407599 | |||
| 1845 | Ga0501073_0000437 | |||
| 1846 | Ga0501074_0262336 | |||
| 1847 | Ga0501257_026850 | |||
| 1848 | Ga0501080_0017271 | |||
| 1849 | Ga0501080_0365704 | |||
| 1850 | Ga0501283_011542 | |||
| 1851 | Ga0501035_0062126 | |||
| 1852 | Ga0501044_0069580 | |||
| 1853 | Ga0501044_0166125 | |||
| 1854 | nmdc:mga08x19_32893_c1 | |||
| 1855 | nmdc:mga08x19_456197_c1 | |||
| 1856 | nmdc:mga08x19_65233_c1 | |||
| 1857 | Ga0495601_0010753 | |||
| 1858 | Ga0495601_0034655 | |||
| 1859 | Ga0500644_0056545 | |||
| 1860 | Ga0500651_0000016 | |||
| 1861 | Ga0500595_010150 | |||
| 1862 | Ga0500595_040244 | |||
| 1863 | Ga0587066_015538 | |||
| 1864 | Ga0587073_0008457 | |||
| 1865 | Ga0587083_0008183 | |||
| 1866 | Ga0587088_017561 | |||
| 1867 | Ga0587090_005110 | |||
| 1868 | Ga0587067_007178 | |||
| 1869 | Ga0587075_010825 | |||
| 1870 | Ga0587107_009325 | |||
| 1871 | Ga0587114_005199 | |||
| 1872 | 2884218668 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4q7c-assembly1.cif.gz_B | structure of af2299, a cdp-alcohol phosphotransferase | 0.819 | 14 | 196 |
| 4o6m-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) | 0.8144 | 14 | 196 |
| 4q7c-assembly1.cif.gz_A | structure of af2299, a cdp-alcohol phosphotransferase | 0.8141 | 14 | 196 |
| 6wmv-assembly1.cif.gz_A | structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding | 0.8107 | 14 | 199 |
| 5d92-assembly1.cif.gz_A | structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum | 0.8107 | 7 | 205 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76090_8_197_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8282 | 13 | 199 | 1.20.120.1760 |
| 4o6mB02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8237 | 14 | 196 | 1.20.120.1760 |
| 5d92A02 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8105 | 7 | 205 | 1.20.120.1760 |
| af_P76226_9_202_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8045 | 14 | 202 | 1.20.120.1760 |
| af_P76090_8_197_1.20.120.1760 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain | 0.8042 | 13 | 199 | 1.20.120.1760 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N8YT58-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9544 | 17 | 137 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A521XXT1-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9392 | 13 | 145 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7W0LCC3-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9276 | 1 | 137 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-X0WQ27-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9213 | 6 | 145 |
GO:0008654
GO:0016020 GO:0016780 |
| AF-A0A7W0LCC3-F1-model_v4 | CDP-alcohol phosphatidyltransferase family protein | 0.9143 | 1 | 137 |
GO:0008654
GO:0016020 GO:0016780 |