F486187

General Info

Members Datasets Scaffolds Average Seq Length
936 313 1872 215

Family's Representative Sequence

Representative Sequence 3300000546|LJNas_1002114|LJNas_10021142
Length 257
Sequence MTWTSAFGRGCGVILQAIVNGLALTRISPNVLTFIGLVINTGAAIFFGFANSHNYVRFFLYAGLVIIGAGIFDMVDGRVARQTDQVTVFGAFFDSVIDRYSDVVLFLGLLVFYARGNRFFYVVLTAFVMITSLMVSYTRARSEALIGSCKVGFMERPERVVLIILGALFERWDAMAPALWVLAVLSTITVIHRISYTYTMSKGLRLDAPAAVTSTLISEAQPTPIRPAARPGPVSGTASVSAAEQHELLSAPNAPRA

Samples

Sample ID Description Type Environment
1 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
100 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
163 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031010 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
173 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
174 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
175 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
176 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
185 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
186 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
195 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
199 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
215 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
219 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
220 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
221 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
226 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
227 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
255 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
256 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
257 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
258 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
259 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
260 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
263 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
264 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
265 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
279 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
280 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
297 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
304 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 2.24
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.43
Nodule 0
Rhizoplane 4.38
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 11.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1002114 3300000546 Bacteria 2499
2 LJNas_1002119 3300000546 Bacteria 2493
3 rootH2_10180936 3300003320 Bacteria 1743
4 rootH1_10163155 3300003323 Bacteria 1288
5 Ga0058863_10169021 3300004799 Bacteria 4875
6 Ga0058861_10010007 3300004800 Bacteria 3303
7 Ga0058862_10206145 3300004803 Unclassified 1911
8 Ga0070658_10000127 3300005327 Bacteria 67777
9 Ga0070658_10005926 3300005327 Bacteria 9916
10 Ga0070658_10012417 3300005327 Bacteria 6835
11 Ga0070658_10027405 3300005327 Bacteria 4572
12 Ga0070658_10049018 3300005327 Bacteria 3421
13 Ga0070658_10155821 3300005327 Bacteria 1915
14 Ga0070658_10194039 3300005327 Bacteria 1712
15 Ga0070658_10242843 3300005327 Unclassified 1526
16 Ga0070658_10274348 3300005327 Bacteria 1435
17 Ga0070658_10761058 3300005327 Bacteria 841
18 Ga0070683_100027547 3300005329 Bacteria 5126
19 Ga0070683_100056915 3300005329 Bacteria 3631
20 Ga0070683_100137189 3300005329 Unclassified 2317
21 Ga0070683_100149503 3300005329 Bacteria 2214
22 Ga0070683_100164107 3300005329 Bacteria 2108
23 Ga0070683_100223887 3300005329 Bacteria 1788
24 Ga0070683_100228318 3300005329 Bacteria 1770
25 Ga0070683_100286227 3300005329 Bacteria 1568
26 Ga0070683_100366160 3300005329 Bacteria 1373
27 Ga0070683_100418645 3300005329 Unclassified 1278
28 Ga0070670_100002219 3300005331 Bacteria 15961
29 Ga0070670_100219085 3300005331 Unclassified 1655
30 Ga0070670_100240335 3300005331 Bacteria 1577
31 Ga0068869_100033425 3300005334 Bacteria 3631
32 Ga0070666_10018134 3300005335 Bacteria 4521
33 Ga0070666_10203719 3300005335 Bacteria 1392
34 Ga0070680_100024372 3300005336 Bacteria 4833
35 Ga0070680_100035320 3300005336 Bacteria 4035
36 Ga0070680_100203560 3300005336 Bacteria 1669
37 Ga0070680_100390111 3300005336 Unclassified 1186
38 Ga0068868_100028922 3300005338 Bacteria 4242
39 Ga0068868_100077548 3300005338 Unclassified 2658
40 Ga0068868_100274002 3300005338 Bacteria 1426
41 Ga0070660_100008310 3300005339 Bacteria 7256
42 Ga0070660_100068432 3300005339 Bacteria 2767
43 Ga0070660_100218581 3300005339 Bacteria 1548
44 Ga0070660_100358250 3300005339 Bacteria 1202
45 Ga0070661_100009496 3300005344 Bacteria 6738
46 Ga0070661_100012609 3300005344 Bacteria 5915
47 Ga0070661_100013673 3300005344 Bacteria 5700
48 Ga0070668_100310919 3300005347 Unclassified 1324
49 Ga0070669_100316061 3300005353 Unclassified 1260
50 Ga0070675_100023019 3300005354 Bacteria 4977
51 Ga0070671_100010048 3300005355 Bacteria 7602
52 Ga0070671_100014408 3300005355 Bacteria 6387
53 Ga0070671_100255009 3300005355 Unclassified 1490
54 Ga0070673_100011090 3300005364 Bacteria 6142
55 Ga0070659_100000543 3300005366 Bacteria 27518
56 Ga0070659_100035327 3300005366 Bacteria 3892
57 Ga0070659_100057835 3300005366 Bacteria 3058
58 Ga0070659_100305228 3300005366 Unclassified 1328
59 Ga0070667_100012156 3300005367 Bacteria 7125
60 Ga0070667_100121784 3300005367 Bacteria 2269
61 Ga0070667_100241161 3300005367 Bacteria 1614
62 Ga0070709_10030959 3300005434 Bacteria 3215
63 Ga0070714_100031767 3300005435 Bacteria 4407
64 Ga0070714_100110219 3300005435 Bacteria 2436
65 Ga0070714_100292635 3300005435 Bacteria 1516
66 Ga0070713_100003297 3300005436 Bacteria 10639
67 Ga0070713_100067778 3300005436 Bacteria 3006
68 Ga0070713_100104847 3300005436 Unclassified 2455
69 Ga0070713_100150844 3300005436 Bacteria 2068
70 Ga0070713_100431299 3300005436 Unclassified 1235
71 Ga0070713_100459287 3300005436 Bacteria 1197
72 Ga0070713_100743432 3300005436 Bacteria 938
73 Ga0070710_10001087 3300005437 Bacteria 12871
74 Ga0070710_10025739 3300005437 Bacteria 3118
75 Ga0070710_10351578 3300005437 Bacteria 976
76 Ga0070711_100012475 3300005439 Bacteria 5311
77 Ga0070711_100207321 3300005439 Bacteria 1516
78 Ga0070708_100019770 3300005445 Bacteria 5665
79 Ga0070708_100047654 3300005445 Bacteria 3786
80 Ga0070708_100087170 3300005445 Unclassified 2836
81 Ga0070663_100020176 3300005455 Bacteria 4408
82 Ga0070663_100031510 3300005455 Bacteria 3644
83 Ga0070663_100526784 3300005455 Bacteria 985
84 Ga0070663_100786076 3300005455 Unclassified 815
85 Ga0070678_100010783 3300005456 Bacteria 5601
86 Ga0070678_100654327 3300005456 Unclassified 943
87 Ga0070662_100037880 3300005457 Bacteria 3421
88 Ga0070662_100075543 3300005457 Bacteria 2495
89 Ga0070681_10003504 3300005458 Bacteria 14696
90 Ga0070681_10009038 3300005458 Bacteria 9791
91 Ga0070681_10089820 3300005458 Bacteria 3023
92 Ga0070681_10101063 3300005458 Bacteria 2829
93 Ga0070681_10129621 3300005458 Unclassified 2454
94 Ga0070681_10167896 3300005458 Bacteria 2117
95 Ga0070681_10171172 3300005458 Bacteria 2094
96 Ga0070681_10259050 3300005458 Bacteria 1651
97 Ga0070681_10261677 3300005458 Bacteria 1642
98 Ga0070681_10317772 3300005458 Bacteria 1467
99 Ga0070681_10366738 3300005458 Bacteria 1350
100 Ga0070681_10430514 3300005458 Bacteria 1231
101 Ga0070681_10789321 3300005458 Bacteria 866
102 Ga0070706_100182487 3300005467 Bacteria 1960
103 Ga0070707_100397264 3300005468 Bacteria 1339
104 Ga0070699_100012791 3300005518 Bacteria 7234
105 Ga0070679_100000142 3300005530 Bacteria 58286
106 Ga0070679_100016723 3300005530 Bacteria 7087
107 Ga0070679_100056106 3300005530 Bacteria 3924
108 Ga0070679_100064308 3300005530 Bacteria 3656
109 Ga0070679_100110681 3300005530 Bacteria 2733
110 Ga0070679_100208872 3300005530 Bacteria 1917
111 Ga0070679_100240901 3300005530 Bacteria 1766
112 Ga0070679_100247945 3300005530 Bacteria 1737
113 Ga0070679_100250736 3300005530 Bacteria 1726
114 Ga0070684_100002371 3300005535 Bacteria 13891
115 Ga0070684_100047389 3300005535 Bacteria 3724
116 Ga0070684_100066748 3300005535 Bacteria 3158
117 Ga0070684_100240322 3300005535 Bacteria 1655
118 Ga0070684_100303732 3300005535 Bacteria 1465
119 Ga0070684_100368000 3300005535 Bacteria 1323
120 Ga0070684_100561323 3300005535 Unclassified 1060
121 Ga0070684_100677841 3300005535 Unclassified 960
122 Ga0070697_100083263 3300005536 Unclassified 2638
123 Ga0068853_100000049 3300005539 Bacteria 90347
124 Ga0068853_100010059 3300005539 Bacteria 7640
125 Ga0068853_100018922 3300005539 Bacteria 5704
126 Ga0068853_100080816 3300005539 Bacteria 2845
127 Ga0068853_100088219 3300005539 Bacteria 2723
128 Ga0068853_100092171 3300005539 Bacteria 2665
129 Ga0068853_100142180 3300005539 Bacteria 2155
130 Ga0068853_100157505 3300005539 Bacteria 2047
131 Ga0068853_100241265 3300005539 Bacteria 1656
132 Ga0068853_100462788 3300005539 Bacteria 1194
133 Ga0070672_100013876 3300005543 Bacteria 5699
134 Ga0070696_100412958 3300005546 Unclassified 1058
135 Ga0070693_100049914 3300005547 Bacteria 2389
136 Ga0070693_100230371 3300005547 Unclassified 1218
137 Ga0070693_100537021 3300005547 Bacteria 835
138 Ga0070693_100707817 3300005547 Bacteria 738
139 Ga0070665_100056890 3300005548 Bacteria 3921
140 Ga0070665_100067885 3300005548 Bacteria 3575
141 Ga0070665_100117300 3300005548 Bacteria 2664
142 Ga0070665_100153535 3300005548 Bacteria 2304
143 Ga0070665_100171343 3300005548 Bacteria 2171
144 Ga0070665_100303658 3300005548 Bacteria 1599
145 Ga0070665_100636490 3300005548 Bacteria 1080
146 Ga0068855_100022355 3300005563 Bacteria 7578
147 Ga0068855_100023539 3300005563 Bacteria 7375
148 Ga0068855_100035182 3300005563 Bacteria 5966
149 Ga0068855_100037164 3300005563 Bacteria 5793
150 Ga0068855_100055757 3300005563 Bacteria 4640
151 Ga0068855_100078538 3300005563 Bacteria 3828
152 Ga0068855_100080052 3300005563 Bacteria 3788
153 Ga0068855_100084975 3300005563 Bacteria 3662
154 Ga0068855_100106836 3300005563 Bacteria 3216
155 Ga0068855_100311221 3300005563 Bacteria 1742
156 Ga0068855_100364912 3300005563 Bacteria 1588
157 Ga0070664_100057431 3300005564 Bacteria 3308
158 Ga0070664_100184694 3300005564 Bacteria 1855
159 Ga0070664_100273595 3300005564 Bacteria 1522
160 Ga0070664_100541751 3300005564 Bacteria 1076
161 Ga0068857_100000158 3300005577 Bacteria 42040
162 Ga0068857_100004818 3300005577 Bacteria 11435
163 Ga0068857_100082502 3300005577 Bacteria 2872
164 Ga0068857_100162791 3300005577 Bacteria 2025
165 Ga0068857_100228357 3300005577 Unclassified 1702
166 Ga0068857_100232001 3300005577 Bacteria 1688
167 Ga0068854_100000055 3300005578 Bacteria 83740
168 Ga0068854_100007803 3300005578 Bacteria 6846
169 Ga0068854_100064011 3300005578 Bacteria 2671
170 Ga0068854_100503875 3300005578 Bacteria 1020
171 Ga0068856_100013601 3300005614 Bacteria 7876
172 Ga0068856_100014141 3300005614 Bacteria 7717
173 Ga0068856_100019029 3300005614 Bacteria 6663
174 Ga0068856_100041249 3300005614 Bacteria 4535
175 Ga0068856_100058066 3300005614 Bacteria 3821
176 Ga0068856_100068915 3300005614 Bacteria 3497
177 Ga0068856_100109057 3300005614 Bacteria 2764
178 Ga0068856_100148226 3300005614 Bacteria 2354
179 Ga0068856_100181827 3300005614 Bacteria 2116
180 Ga0068856_100246876 3300005614 Unclassified 1800
181 Ga0068856_100641779 3300005614 Unclassified 1082
182 Ga0068852_100000023 3300005616 Bacteria 120576
183 Ga0068852_100000650 3300005616 Bacteria 22747
184 Ga0068852_100008476 3300005616 Bacteria 7579
185 Ga0068852_100009589 3300005616 Bacteria 7195
186 Ga0068852_100035040 3300005616 Bacteria 4182
187 Ga0068852_100061504 3300005616 Bacteria 3264
188 Ga0068852_100072000 3300005616 Bacteria 3037
189 Ga0068859_100065862 3300005617 Bacteria 3656
190 Ga0068864_100014372 3300005618 Bacteria 6575
191 Ga0068864_100135149 3300005618 Bacteria 2219
192 Ga0068864_100142631 3300005618 Unclassified 2162
193 Ga0068861_100378888 3300005719 Bacteria 1249
194 Ga0068851_10018899 3300005834 Bacteria 3327
195 Ga0068851_10032688 3300005834 Bacteria 2589
196 Ga0068851_10063947 3300005834 Bacteria 1890
197 Ga0068851_10076541 3300005834 Bacteria 1740
198 Ga0068851_10113056 3300005834 Unclassified 1451
199 Ga0068851_10249383 3300005834 Unclassified 1007
200 Ga0068863_100008200 3300005841 Bacteria 10209
201 Ga0068863_100030571 3300005841 Bacteria 5142
202 Ga0068863_100069588 3300005841 Bacteria 3327
203 Ga0068863_100413225 3300005841 Bacteria 1321
204 Ga0068863_100633869 3300005841 Bacteria 1059
205 Ga0068858_100073258 3300005842 Bacteria 3180
206 Ga0068858_100388765 3300005842 Bacteria 1339
207 Ga0068860_100007235 3300005843 Bacteria 11099
208 Ga0068860_100215561 3300005843 Bacteria 1863
209 Ga0070717_10014729 3300006028 Bacteria 6016
210 Ga0070717_10031517 3300006028 Unclassified 4266
211 Ga0070717_10176321 3300006028 Bacteria 1861
212 Ga0070717_10432299 3300006028 Bacteria 1185
213 Ga0070717_10506575 3300006028 Bacteria 1091
214 Ga0070717_10946406 3300006028 Unclassified 784
215 Ga0070717_11088233 3300006028 Bacteria 728
216 Ga0070716_100026183 3300006173 Bacteria 3121
217 Ga0070716_100060077 3300006173 Bacteria 2194
218 Ga0070716_100069691 3300006173 Bacteria 2062
219 Ga0070716_100253970 3300006173 Unclassified 1199
220 Ga0070712_100033762 3300006175 Bacteria 3464
221 Ga0070712_100424603 3300006175 Unclassified 1102
222 Ga0097621_100009531 3300006237 Bacteria 7052
223 Ga0097621_100034492 3300006237 Bacteria 4037
224 Ga0097621_100087283 3300006237 Bacteria 2604
225 Ga0068871_100028980 3300006358 Unclassified 4345
226 Ga0068871_100037410 3300006358 Bacteria 3870
227 Ga0068871_100714500 3300006358 Unclassified 919
228 Ga0075430_100301558 3300006846 Bacteria 1325
229 Ga0075434_100050253 3300006871 Bacteria 4141
230 Ga0068865_100194829 3300006881 Unclassified 1569
231 Ga0075436_100040657 3300006914 Bacteria 3208
232 Ga0075436_100108968 3300006914 Bacteria 1932
233 Ga0075436_100335447 3300006914 Bacteria 1088
234 Ga0075436_100487932 3300006914 Unclassified 900
235 Ga0097620_100065860 3300006931 Bacteria 3656
236 Ga0099794_10080636 3300007265 Bacteria 1605
237 Ga0105240_10000001 3300009093 Bacteria 2887840
238 Ga0105240_10000203 3300009093 Bacteria 120858
239 Ga0105240_10002494 3300009093 Bacteria 29572
240 Ga0105240_10003537 3300009093 Bacteria 24233
241 Ga0105240_10003873 3300009093 Bacteria 23103
242 Ga0105240_10013349 3300009093 Bacteria 11287
243 Ga0105240_10017631 3300009093 Bacteria 9616
244 Ga0105240_10022791 3300009093 Bacteria 8296
245 Ga0105240_10025072 3300009093 Bacteria 7849
246 Ga0105240_10053947 3300009093 Bacteria 5041
247 Ga0105240_10071210 3300009093 Bacteria 4300
248 Ga0105240_10125952 3300009093 Bacteria 3078
249 Ga0105240_10127164 3300009093 Unclassified 3061
250 Ga0105240_10228961 3300009093 Bacteria 2161
251 Ga0105240_10267247 3300009093 Bacteria 1971
252 Ga0105240_10550702 3300009093 Bacteria 1276
253 Ga0105240_10835884 3300009093 Bacteria 995
254 Ga0105240_11085003 3300009093 Unclassified 852
255 Ga0105245_10003445 3300009098 Bacteria 14179
256 Ga0105245_10014904 3300009098 Bacteria 6772
257 Ga0105245_10016260 3300009098 Bacteria 6487
258 Ga0105245_10051868 3300009098 Bacteria 3678
259 Ga0105245_10197349 3300009098 Unclassified 1931
260 Ga0105247_10034937 3300009101 Bacteria 3062
261 Ga0105243_10245779 3300009148 Unclassified 1595
262 Ga0105241_10001348 3300009174 Bacteria 18663
263 Ga0105241_10022157 3300009174 Bacteria 4702
264 Ga0105241_10050444 3300009174 Bacteria 3171
265 Ga0105241_10074452 3300009174 Bacteria 2644
266 Ga0105241_10098700 3300009174 Bacteria 2318
267 Ga0105241_10710099 3300009174 Bacteria 919
268 Ga0105242_10032800 3300009176 Unclassified 4154
269 Ga0105248_10000003 3300009177 Bacteria 1019601
270 Ga0105248_10003035 3300009177 Bacteria 18618
271 Ga0105248_10012616 3300009177 Bacteria 9324
272 Ga0105248_10019898 3300009177 Bacteria 7431
273 Ga0105248_10082685 3300009177 Bacteria 3612
274 Ga0105237_10013833 3300009545 Bacteria 8448
275 Ga0105237_10055993 3300009545 Bacteria 3948
276 Ga0105237_10095413 3300009545 Bacteria 2964
277 Ga0105237_10120869 3300009545 Bacteria 2614
278 Ga0105237_10197854 3300009545 Bacteria 2009
279 Ga0105237_10252397 3300009545 Bacteria 1766
280 Ga0105237_10338597 3300009545 Bacteria 1509
281 Ga0105237_10760196 3300009545 Unclassified 976
282 Ga0105238_10004199 3300009551 Bacteria 14300
283 Ga0105238_10009838 3300009551 Bacteria 9578
284 Ga0105238_10011748 3300009551 Bacteria 8826
285 Ga0105238_10016124 3300009551 Bacteria 7558
286 Ga0105238_10017544 3300009551 Bacteria 7279
287 Ga0105238_10033244 3300009551 Bacteria 5249
288 Ga0105238_10051566 3300009551 Bacteria 4138
289 Ga0105238_10058807 3300009551 Bacteria 3852
290 Ga0105238_10067744 3300009551 Unclassified 3570
291 Ga0105238_10095478 3300009551 Bacteria 2960
292 Ga0105238_10120932 3300009551 Bacteria 2598
293 Ga0105238_10159775 3300009551 Bacteria 2229
294 Ga0105238_10162974 3300009551 Unclassified 2206
295 Ga0105238_10195748 3300009551 Bacteria 1997
296 Ga0105238_10199759 3300009551 Bacteria 1975
297 Ga0105238_10440891 3300009551 Bacteria 1299
298 Ga0105249_10132004 3300009553 Bacteria 2385
299 Ga0105249_10272198 3300009553 Unclassified 1687
300 Ga0105249_10413466 3300009553 Bacteria 1381
301 Ga0105239_10002793 3300010375 Bacteria 21861
302 Ga0105239_10044315 3300010375 Bacteria 4877
303 Ga0105239_10077477 3300010375 Bacteria 3658
304 Ga0105239_10151970 3300010375 Bacteria 2584
305 Ga0105239_10292429 3300010375 Bacteria 1834
306 Ga0105239_10330250 3300010375 Bacteria 1720
307 Ga0105239_10353290 3300010375 Bacteria 1660
308 Ga0105239_10372854 3300010375 Bacteria 1613
309 Ga0105239_10873417 3300010375 Bacteria 1032
310 Ga0105246_10046125 3300011119 Bacteria 2971
311 Ga0157373_10010582 3300013100 Bacteria 6786
312 Ga0157373_10043823 3300013100 Bacteria 3195
313 Ga0157371_10040562 3300013102 Bacteria 3324
314 Ga0157371_10210629 3300013102 Unclassified 1395
315 Ga0157370_10000082 3300013104 Bacteria 104481
316 Ga0157370_10051902 3300013104 Bacteria 3916
317 Ga0157370_10052517 3300013104 Bacteria 3891
318 Ga0157370_10054612 3300013104 Bacteria 3808
319 Ga0157370_10067409 3300013104 Bacteria 3383
320 Ga0157370_10118953 3300013104 Bacteria 2467
321 Ga0157370_10161932 3300013104 Bacteria 2081
322 Ga0157370_10317155 3300013104 Bacteria 1438
323 Ga0157370_10321274 3300013104 Bacteria 1428
324 Ga0157370_10326642 3300013104 Unclassified 1415
325 Ga0157370_10525410 3300013104 Bacteria 1086
326 Ga0157370_10793616 3300013104 Unclassified 862
327 Ga0157369_10000095 3300013105 Bacteria 121823
328 Ga0157369_10004782 3300013105 Bacteria 15920
329 Ga0157369_10016017 3300013105 Bacteria 8437
330 Ga0157369_10022800 3300013105 Bacteria 6981
331 Ga0157369_10024425 3300013105 Bacteria 6723
332 Ga0157369_10025865 3300013105 Bacteria 6511
333 Ga0157369_10035004 3300013105 Bacteria 5507
334 Ga0157369_10040476 3300013105 Bacteria 5087
335 Ga0157369_10042663 3300013105 Bacteria 4948
336 Ga0157369_10053162 3300013105 Bacteria 4379
337 Ga0157369_10137346 3300013105 Bacteria 2588
338 Ga0157369_10141715 3300013105 Bacteria 2543
339 Ga0157369_10155800 3300013105 Bacteria 2413
340 Ga0157369_10215274 3300013105 Bacteria 2012
341 Ga0157369_10385349 3300013105 Bacteria 1455
342 Ga0157369_10464371 3300013105 Bacteria 1310
343 Ga0157369_10547272 3300013105 Bacteria 1196
344 Ga0157369_11302650 3300013105 Unclassified 740
345 Ga0157374_10006654 3300013296 Bacteria 9818
346 Ga0157374_10013447 3300013296 Bacteria 7142
347 Ga0157374_10013966 3300013296 Bacteria 7020
348 Ga0157374_10022035 3300013296 Bacteria 5678
349 Ga0157374_10024468 3300013296 Bacteria 5415
350 Ga0157374_10111890 3300013296 Bacteria 2627
351 Ga0157374_10120998 3300013296 Bacteria 2526
352 Ga0157374_10137656 3300013296 Bacteria 2368
353 Ga0157374_10155817 3300013296 Bacteria 2223
354 Ga0157374_10577733 3300013296 Unclassified 1133
355 Ga0157374_10658316 3300013296 Unclassified 1059
356 Ga0157374_11111129 3300013296 Bacteria 811
357 Ga0157378_10005859 3300013297 Bacteria 10764
358 Ga0157378_10016744 3300013297 Bacteria 6423
359 Ga0157378_10026752 3300013297 Bacteria 5086
360 Ga0157378_10031303 3300013297 Bacteria 4700
361 Ga0157378_10145631 3300013297 Bacteria 2203
362 Ga0157378_10167630 3300013297 Bacteria 2058
363 Ga0157378_10975965 3300013297 Bacteria 881
364 Ga0163162_10063135 3300013306 Bacteria 3745
365 Ga0163162_10123812 3300013306 Bacteria 2691
366 Ga0157372_10000102 3300013307 Bacteria 88856
367 Ga0157372_10010094 3300013307 Bacteria 10031
368 Ga0157372_10012351 3300013307 Bacteria 9102
369 Ga0157372_10018972 3300013307 Bacteria 7402
370 Ga0157372_10026765 3300013307 Bacteria 6277
371 Ga0157372_10034189 3300013307 Bacteria 5588
372 Ga0157372_10035115 3300013307 Bacteria 5517
373 Ga0157372_10045727 3300013307 Bacteria 4858
374 Ga0157372_10047146 3300013307 Bacteria 4787
375 Ga0157372_10143199 3300013307 Bacteria 2756
376 Ga0157372_10221366 3300013307 Bacteria 2194
377 Ga0157372_10225927 3300013307 Bacteria 2170
378 Ga0157375_10013132 3300013308 Bacteria 7360
379 Ga0157375_10304072 3300013308 Bacteria 1759
380 Ga0163163_10061970 3300014325 Bacteria 3706
381 Ga0163163_10070842 3300014325 Unclassified 3473
382 Ga0163163_10216767 3300014325 Bacteria 1963
383 Ga0182008_10021755 3300014497 Bacteria 3293
384 Ga0157379_10012396 3300014968 Bacteria 7447
385 Ga0157379_10031712 3300014968 Bacteria 4709
386 Ga0157379_10199972 3300014968 Bacteria 1807
387 Ga0157379_10216580 3300014968 Bacteria 1734
388 Ga0157379_10218832 3300014968 Bacteria 1725
389 Ga0157379_10238668 3300014968 Bacteria 1649
390 Ga0157376_10002799 3300014969 Bacteria 11907
391 Ga0157376_10024145 3300014969 Bacteria 4769
392 Ga0157376_10057025 3300014969 Bacteria 3265
393 Ga0157376_10068438 3300014969 Bacteria 3007
394 Ga0157376_10161132 3300014969 Bacteria 2034
395 Ga0157376_10271962 3300014969 Bacteria 1592
396 Ga0157376_10411348 3300014969 Bacteria 1310
397 Ga0157376_10525593 3300014969 Unclassified 1167
398 Ga0182005_1011918 3300015265 Unclassified 2465
399 Ga0163161_10047930 3300017792 Unclassified 3085
400 Ga0206353_10589488 3300020082 Bacteria 1724
401 Ga0154015_1253388 3300020610 Bacteria 1728
402 Ga0154015_1618321 3300020610 Bacteria 1325
403 Ga0213872_10009480 3300021361 Bacteria 4668
404 Ga0213872_10016554 3300021361 Bacteria 3419
405 Ga0213872_10038364 3300021361 Bacteria 2186
406 Ga0224712_10044926 3300022467 Bacteria 1687
407 Ga0224571_100070 3300022734 Bacteria 3777
408 Ga0228598_1000318 3300024227 Bacteria 9416
409 Ga0228598_1000456 3300024227 Bacteria 8346
410 Ga0207697_10048954 3300025315 Unclassified 1744
411 Ga0207656_10024994 3300025321 Bacteria 2421
412 Ga0207656_10030677 3300025321 Bacteria 2223
413 Ga0207656_10035109 3300025321 Bacteria 2097
414 Ga0207656_10069013 3300025321 Unclassified 1567
415 Ga0207656_10089766 3300025321 Bacteria 1393
416 Ga0207692_10000544 3300025898 Bacteria 13356
417 Ga0207710_10011929 3300025900 Bacteria 3655
418 Ga0207680_10190439 3300025903 Bacteria 1392
419 Ga0207647_10007872 3300025904 Bacteria 7664
420 Ga0207647_10033850 3300025904 Unclassified 3267
421 Ga0207647_10169747 3300025904 Bacteria 1270
422 Ga0207685_10040565 3300025905 Bacteria 1736
423 Ga0207699_10047674 3300025906 Bacteria 2513
424 Ga0207699_10166402 3300025906 Bacteria 1472
425 Ga0207699_10429368 3300025906 Bacteria 945
426 Ga0207699_10589477 3300025906 Bacteria 809
427 Ga0207645_10019509 3300025907 Unclassified 4444
428 Ga0207705_10000020 3300025909 Bacteria 311745
429 Ga0207705_10000562 3300025909 Bacteria 31130
430 Ga0207705_10020122 3300025909 Bacteria 4774
431 Ga0207705_10033166 3300025909 Bacteria 3690
432 Ga0207705_10070610 3300025909 Bacteria 2531
433 Ga0207705_10108027 3300025909 Bacteria 2053
434 Ga0207705_10140847 3300025909 Bacteria 1801
435 Ga0207705_10167041 3300025909 Bacteria 1655
436 Ga0207705_10178395 3300025909 Unclassified 1602
437 Ga0207705_10285699 3300025909 Bacteria 1263
438 Ga0207705_10533811 3300025909 Bacteria 912
439 Ga0207684_10244547 3300025910 Bacteria 1548
440 Ga0207654_10000154 3300025911 Bacteria 43613
441 Ga0207654_10008218 3300025911 Bacteria 5266
442 Ga0207654_10074069 3300025911 Bacteria 2031
443 Ga0207654_10086042 3300025911 Bacteria 1905
444 Ga0207654_10086545 3300025911 Unclassified 1900
445 Ga0207707_10053907 3300025912 Bacteria 3501
446 Ga0207707_10075858 3300025912 Bacteria 2934
447 Ga0207707_10092577 3300025912 Bacteria 2641
448 Ga0207707_10122448 3300025912 Bacteria 2275
449 Ga0207707_10125768 3300025912 Bacteria 2242
450 Ga0207707_10129161 3300025912 Bacteria 2210
451 Ga0207707_10296707 3300025912 Bacteria 1398
452 Ga0207707_10341735 3300025912 Unclassified 1290
453 Ga0207707_10489598 3300025912 Bacteria 1050
454 Ga0207695_10000001 3300025913 Bacteria 2888630
455 Ga0207695_10000080 3300025913 Bacteria 287868
456 Ga0207695_10000303 3300025913 Bacteria 120876
457 Ga0207695_10001162 3300025913 Bacteria 45655
458 Ga0207695_10010711 3300025913 Bacteria 11195
459 Ga0207695_10016845 3300025913 Bacteria 8531
460 Ga0207695_10036140 3300025913 Bacteria 5344
461 Ga0207695_10039924 3300025913 Bacteria 5040
462 Ga0207695_10046202 3300025913 Bacteria 4616
463 Ga0207695_10061989 3300025913 Bacteria 3863
464 Ga0207695_10092962 3300025913 Bacteria 3026
465 Ga0207695_10119326 3300025913 Bacteria 2607
466 Ga0207695_10125766 3300025913 Bacteria 2526
467 Ga0207695_10222845 3300025913 Bacteria 1793
468 Ga0207695_10323636 3300025913 Bacteria 1431
469 Ga0207671_10001283 3300025914 Bacteria 29524
470 Ga0207671_10051157 3300025914 Bacteria 3061
471 Ga0207671_10106061 3300025914 Bacteria 2133
472 Ga0207671_10171809 3300025914 Bacteria 1684
473 Ga0207671_10184214 3300025914 Bacteria 1626
474 Ga0207671_10342543 3300025914 Bacteria 1185
475 Ga0207693_10034660 3300025915 Bacteria 3982
476 Ga0207693_10089471 3300025915 Bacteria 2413
477 Ga0207663_10097909 3300025916 Bacteria 1963
478 Ga0207663_10103697 3300025916 Bacteria 1916
479 Ga0207663_10577885 3300025916 Unclassified 881
480 Ga0207660_10017684 3300025917 Bacteria 4741
481 Ga0207660_10024884 3300025917 Bacteria 4057
482 Ga0207660_10373925 3300025917 Bacteria 1145
483 Ga0207660_10391181 3300025917 Bacteria 1119
484 Ga0207660_10477750 3300025917 Bacteria 1010
485 Ga0207660_10544054 3300025917 Bacteria 944
486 Ga0207657_10001167 3300025919 Bacteria 27843
487 Ga0207657_10011054 3300025919 Bacteria 8973
488 Ga0207657_10012789 3300025919 Bacteria 8260
489 Ga0207657_10015325 3300025919 Bacteria 7430
490 Ga0207657_10057971 3300025919 Bacteria 3335
491 Ga0207657_10177074 3300025919 Bacteria 1725
492 Ga0207657_10384094 3300025919 Bacteria 1105
493 Ga0207649_10008630 3300025920 Bacteria 5564
494 Ga0207649_10023724 3300025920 Bacteria 3556
495 Ga0207649_10060461 3300025920 Bacteria 2381
496 Ga0207649_10073936 3300025920 Bacteria 2185
497 Ga0207652_10003733 3300025921 Bacteria 12499
498 Ga0207652_10012797 3300025921 Bacteria 6784
499 Ga0207652_10064756 3300025921 Bacteria 3163
500 Ga0207652_10074748 3300025921 Bacteria 2951
501 Ga0207652_10107374 3300025921 Bacteria 2472
502 Ga0207652_10122528 3300025921 Bacteria 2314
503 Ga0207652_10214561 3300025921 Bacteria 1733
504 Ga0207652_10262021 3300025921 Bacteria 1559
505 Ga0207646_10027006 3300025922 Bacteria 5233
506 Ga0207646_10061824 3300025922 Bacteria 3343
507 Ga0207646_10381060 3300025922 Bacteria 1274
508 Ga0207681_10372494 3300025923 Unclassified 1148
509 Ga0207694_10000184 3300025924 Bacteria 64536
510 Ga0207694_10000520 3300025924 Bacteria 34849
511 Ga0207694_10002242 3300025924 Bacteria 15839
512 Ga0207694_10005906 3300025924 Bacteria 9385
513 Ga0207694_10015919 3300025924 Bacteria 5674
514 Ga0207694_10105638 3300025924 Unclassified 2236
515 Ga0207694_10264021 3300025924 Unclassified 1411
516 Ga0207650_10007412 3300025925 Bacteria 7474
517 Ga0207650_10142958 3300025925 Bacteria 1882
518 Ga0207650_10245297 3300025925 Bacteria 1449
519 Ga0207659_10055096 3300025926 Bacteria 2842
520 Ga0207687_10017710 3300025927 Bacteria 4695
521 Ga0207687_10021523 3300025927 Bacteria 4285
522 Ga0207687_10024117 3300025927 Bacteria 4061
523 Ga0207687_10024146 3300025927 Bacteria 4059
524 Ga0207687_10227668 3300025927 Bacteria 1471
525 Ga0207700_10029316 3300025928 Bacteria 3881
526 Ga0207700_10050881 3300025928 Bacteria 3089
527 Ga0207700_10104341 3300025928 Bacteria 2268
528 Ga0207700_10190703 3300025928 Bacteria 1722
529 Ga0207700_10619160 3300025928 Unclassified 964
530 Ga0207664_10044693 3300025929 Bacteria 3470
531 Ga0207664_10055740 3300025929 Bacteria 3137
532 Ga0207664_10098498 3300025929 Bacteria 2411
533 Ga0207664_10139131 3300025929 Bacteria 2051
534 Ga0207664_10142063 3300025929 Unclassified 2032
535 Ga0207664_10258537 3300025929 Bacteria 1522
536 Ga0207644_10003660 3300025931 Bacteria 9965
537 Ga0207644_10022921 3300025931 Bacteria 4270
538 Ga0207644_10755678 3300025931 Unclassified 812
539 Ga0207690_10000553 3300025932 Bacteria 24431
540 Ga0207690_10072618 3300025932 Bacteria 2377
541 Ga0207690_10137372 3300025932 Unclassified 1796
542 Ga0207706_10002843 3300025933 Bacteria 16797
543 Ga0207706_10026562 3300025933 Bacteria 5182
544 Ga0207704_10070618 3300025938 Unclassified 2212
545 Ga0207665_10067620 3300025939 Bacteria 2433
546 Ga0207665_10069495 3300025939 Bacteria 2402
547 Ga0207665_10104766 3300025939 Bacteria 1980
548 Ga0207665_10200314 3300025939 Bacteria 1454
549 Ga0207691_10002212 3300025940 Bacteria 19018
550 Ga0207711_10000013 3300025941 Bacteria 514850
551 Ga0207711_10003932 3300025941 Bacteria 12785
552 Ga0207711_10027419 3300025941 Bacteria 4784
553 Ga0207711_10105990 3300025941 Bacteria 2493
554 Ga0207711_10170679 3300025941 Bacteria 1973
555 Ga0207689_10000659 3300025942 Bacteria 32897
556 Ga0207689_10005877 3300025942 Bacteria 10872
557 Ga0207661_10086886 3300025944 Bacteria 2596
558 Ga0207661_10152072 3300025944 Bacteria 2001
559 Ga0207661_10152983 3300025944 Unclassified 1995
560 Ga0207661_10169361 3300025944 Bacteria 1900
561 Ga0207661_10365526 3300025944 Unclassified 1304
562 Ga0207661_10376274 3300025944 Unclassified 1285
563 Ga0207661_10435648 3300025944 Bacteria 1192
564 Ga0207679_10131132 3300025945 Bacteria 2011
565 Ga0207679_10187229 3300025945 Bacteria 1717
566 Ga0207667_10000259 3300025949 Bacteria 74230
567 Ga0207667_10000360 3300025949 Bacteria 61923
568 Ga0207667_10000385 3300025949 Bacteria 59674
569 Ga0207667_10003193 3300025949 Bacteria 20254
570 Ga0207667_10004195 3300025949 Bacteria 17700
571 Ga0207667_10020451 3300025949 Bacteria 7360
572 Ga0207667_10021092 3300025949 Bacteria 7225
573 Ga0207667_10022273 3300025949 Bacteria 7003
574 Ga0207667_10025199 3300025949 Bacteria 6516
575 Ga0207667_10061196 3300025949 Bacteria 3939
576 Ga0207667_10070190 3300025949 Bacteria 3646
577 Ga0207667_10132051 3300025949 Bacteria 2572
578 Ga0207667_10138412 3300025949 Bacteria 2507
579 Ga0207667_10442289 3300025949 Bacteria 1322
580 Ga0207651_10135544 3300025960 Bacteria 1893
581 Ga0207712_10426277 3300025961 Bacteria 1120
582 Ga0207640_10000011 3300025981 Bacteria 252283
583 Ga0207640_10077604 3300025981 Unclassified 2258
584 Ga0207640_10191626 3300025981 Bacteria 1541
585 Ga0207640_10337966 3300025981 Unclassified 1205
586 Ga0207640_10460605 3300025981 Bacteria 1050
587 Ga0207658_10081057 3300025986 Bacteria 2487
588 Ga0207658_10195626 3300025986 Unclassified 1684
589 Ga0207677_10002003 3300026023 Bacteria 10746
590 Ga0207677_10345121 3300026023 Unclassified 1245
591 Ga0207703_10027827 3300026035 Unclassified 4453
592 Ga0207703_10049953 3300026035 Bacteria 3383
593 Ga0207703_10384030 3300026035 Bacteria 1300
594 Ga0207639_10000085 3300026041 Bacteria 79561
595 Ga0207639_10000586 3300026041 Bacteria 25062
596 Ga0207639_10037593 3300026041 Bacteria 3596
597 Ga0207639_10048283 3300026041 Bacteria 3221
598 Ga0207639_10054517 3300026041 Bacteria 3056
599 Ga0207639_10065523 3300026041 Unclassified 2820
600 Ga0207639_10147871 3300026041 Bacteria 1965
601 Ga0207639_10350913 3300026041 Bacteria 1318
602 Ga0207678_10005665 3300026067 Bacteria 11162
603 Ga0207678_10012647 3300026067 Bacteria 7415
604 Ga0207678_10015323 3300026067 Bacteria 6743
605 Ga0207678_10200822 3300026067 Bacteria 1705
606 Ga0207702_10016202 3300026078 Bacteria 6170
607 Ga0207702_10038053 3300026078 Bacteria 4029
608 Ga0207702_10038590 3300026078 Bacteria 4000
609 Ga0207702_10076053 3300026078 Bacteria 2901
610 Ga0207702_10138403 3300026078 Bacteria 2200
611 Ga0207702_10160710 3300026078 Bacteria 2051
612 Ga0207702_10286429 3300026078 Bacteria 1559
613 Ga0207702_10412719 3300026078 Bacteria 1304
614 Ga0207702_10474556 3300026078 Bacteria 1217
615 Ga0207702_10504342 3300026078 Bacteria 1180
616 Ga0207702_10579262 3300026078 Bacteria 1100
617 Ga0207641_10006263 3300026088 Bacteria 10068
618 Ga0207641_10010079 3300026088 Bacteria 7770
619 Ga0207641_10025399 3300026088 Unclassified 4885
620 Ga0207641_11194350 3300026088 Unclassified 760
621 Ga0207648_10449632 3300026089 Bacteria 1173
622 Ga0207676_10071649 3300026095 Bacteria 2783
623 Ga0207676_10081144 3300026095 Bacteria 2634
624 Ga0207674_10000122 3300026116 Bacteria 90389
625 Ga0207674_10005786 3300026116 Bacteria 14664
626 Ga0207674_10005961 3300026116 Bacteria 14420
627 Ga0207674_10112128 3300026116 Bacteria 2701
628 Ga0207674_10134956 3300026116 Bacteria 2430
629 Ga0207674_10158701 3300026116 Bacteria 2217
630 Ga0207674_10239523 3300026116 Bacteria 1761
631 Ga0207674_10289017 3300026116 Unclassified 1588
632 Ga0207674_10348495 3300026116 Bacteria 1432
633 Ga0207675_100469683 3300026118 Bacteria 1249
634 Ga0207683_10000896 3300026121 Bacteria 27403
635 Ga0207698_10000026 3300026142 Bacteria 121055
636 Ga0207698_10000221 3300026142 Bacteria 35425
637 Ga0207698_10012069 3300026142 Bacteria 5634
638 Ga0207698_10036728 3300026142 Bacteria 3600
639 Ga0207698_10040613 3300026142 Unclassified 3460
640 Ga0207698_10097128 3300026142 Bacteria 2430
641 Ga0207698_10105379 3300026142 Bacteria 2349
642 Ga0207698_10116654 3300026142 Bacteria 2250
643 Ga0207698_10140845 3300026142 Bacteria 2078
644 Ga0265356_1001810 3300028017 Unclassified 3019
645 Ga0268266_10030012 3300028379 Bacteria 4620
646 Ga0268266_10075026 3300028379 Bacteria 2937
647 Ga0268266_10122131 3300028379 Bacteria 2319
648 Ga0268266_10443874 3300028379 Bacteria 1232
649 Ga0268266_10508422 3300028379 Bacteria 1151
650 Ga0268264_10000653 3300028381 Bacteria 40789
651 Ga0265319_1093749 3300028563 Bacteria 946
652 Ga0265338_10001900 3300028800 Bacteria 32656
653 Ga0265338_10013731 3300028800 Bacteria 9108
654 Ga0265338_10088176 3300028800 Bacteria 2576
655 Ga0265338_10117288 3300028800 Bacteria 2131
656 Ga0265338_10194152 3300028800 Bacteria 1536
657 Ga0265324_10134710 3300029957 Bacteria 839
658 Ga0265762_1000914 3300030760 Bacteria 5264
659 Ga0265770_1003967 3300030878 Bacteria 2015
660 Ga0265765_1014627 3300030879 Bacteria 907
661 Ga0265771_1001456 3300031010 Bacteria 1126
662 Ga0265760_10066695 3300031090 Bacteria 1100
663 Ga0265330_10000548 3300031235 Bacteria 24611
664 Ga0265330_10000631 3300031235 Bacteria 22719
665 Ga0265330_10008852 3300031235 Bacteria 4816
666 Ga0265330_10028232 3300031235 Bacteria 2530
667 Ga0265330_10055915 3300031235 Bacteria 1723
668 Ga0265332_10007138 3300031238 Bacteria 5060
669 Ga0265332_10080339 3300031238 Bacteria 1383
670 Ga0265328_10008795 3300031239 Bacteria 4143
671 Ga0265328_10031821 3300031239 Bacteria 1960
672 Ga0265328_10113805 3300031239 Bacteria 1006
673 Ga0265320_10061946 3300031240 Bacteria 1782
674 Ga0265325_10000614 3300031241 Bacteria 25981
675 Ga0265325_10000899 3300031241 Bacteria 21485
676 Ga0265325_10009867 3300031241 Bacteria 5560
677 Ga0265325_10026762 3300031241 Unclassified 3122
678 Ga0265325_10027726 3300031241 Bacteria 3059
679 Ga0265325_10041139 3300031241 Unclassified 2423
680 Ga0265325_10150599 3300031241 Bacteria 1100
681 Ga0265340_10002990 3300031247 Bacteria 9615
682 Ga0265340_10048843 3300031247 Bacteria 2056
683 Ga0265339_10000011 3300031249 Bacteria 206284
684 Ga0265339_10004485 3300031249 Bacteria 9522
685 Ga0265339_10021534 3300031249 Bacteria 3749
686 Ga0265339_10028416 3300031249 Bacteria 3180
687 Ga0265339_10039397 3300031249 Bacteria 2631
688 Ga0265339_10046078 3300031249 Bacteria 2398
689 Ga0265339_10074604 3300031249 Bacteria 1802
690 Ga0265331_10034295 3300031250 Bacteria 2504
691 Ga0265331_10056221 3300031250 Bacteria 1869
692 Ga0265316_10002386 3300031344 Bacteria 19555
693 Ga0265316_10006508 3300031344 Bacteria 11142
694 Ga0265316_10013155 3300031344 Bacteria 7371
695 Ga0265316_10018468 3300031344 Bacteria 5991
696 Ga0265316_10174177 3300031344 Bacteria 1604
697 Ga0265316_10369902 3300031344 Bacteria 1035
698 Ga0265316_10407827 3300031344 Bacteria 978
699 Ga0265313_10001746 3300031595 Bacteria 19959
700 Ga0265313_10004925 3300031595 Bacteria 10006
701 Ga0265313_10014026 3300031595 Bacteria 4769
702 Ga0265314_10000151 3300031711 Bacteria 104088
703 Ga0265314_10066976 3300031711 Bacteria 2421
704 Ga0265314_10067265 3300031711 Bacteria 2414
705 Ga0265342_10000977 3300031712 Bacteria 28306
706 Ga0265342_10009076 3300031712 Bacteria 7053
707 Ga0265342_10012334 3300031712 Bacteria 5791
708 Ga0265342_10013306 3300031712 Bacteria 5529
709 Ga0265342_10014774 3300031712 Bacteria 5171
710 Ga0265342_10020074 3300031712 Bacteria 4294
711 Ga0265342_10037153 3300031712 Bacteria 2972
712 Ga0265342_10040434 3300031712 Unclassified 2828
713 Ga0265342_10045754 3300031712 Bacteria 2633
714 Ga0265342_10066928 3300031712 Bacteria 2103
715 Ga0307510_10050521 3300033180 Bacteria 4409
716 Ga0307510_10086828 3300033180 Bacteria 2998
717 Ga0373926_0005964 3300035083 Bacteria 4032
718 Ga0373936_0008999 3300035113 Bacteria 3766
719 Ga0373954_0356053 3300035118 Bacteria 723
720 Ga0373956_0007313 3300035119 Bacteria 4443
721 Ga0373957_0054835 3300035120 Bacteria 1532
722 Ga0373946_0019743 3300035171 Bacteria 2599
723 Ga0373955_0019606 3300035172 Bacteria 3384
724 Ga0373955_0046902 3300035172 Bacteria 2338
725 Ga0373955_0386896 3300035172 Bacteria 849
726 Ga0373924_0000594 3300035410 Bacteria 11157
727 Ga0373924_0070292 3300035410 Bacteria 1476
728 Ga0373935_0114292 3300035692 Bacteria 1795
729 Ga0373933_0144338 3300035724 Bacteria 1504
730 Ga0373933_0190558 3300035724 Bacteria 1310
731 Ga0373947_0031202 3300035725 Bacteria 3135
732 Ga0373937_0000188 3300036401 Bacteria 60518
733 Ga0373937_0004446 3300036401 Bacteria 11916
734 Ga0373937_0375316 3300036401 Bacteria 1348
735 Ga0373937_1288031 3300036401 Bacteria 679
736 Ga0373925_0018342 3300037068 Bacteria 5086
737 Ga0373925_0038621 3300037068 Bacteria 3530
738 Ga0395900_0405899 3300037418 Bacteria 1326
739 Ga0395900_0777166 3300037418 Bacteria 887
740 Ga0395898_0076695 3300037466 Bacteria 3227
741 Ga0395898_0379897 3300037466 Bacteria 1347
742 Ga0395905_0012025 3300037471 Bacteria 8347
743 Ga0395905_0068453 3300037471 Unclassified 3325
744 Ga0395905_0358324 3300037471 Bacteria 1351
745 Ga0395905_0523149 3300037471 Unclassified 1087
746 Ga0395901_0592451 3300038443 Bacteria 1119
747 Ga0395901_0900573 3300038443 Unclassified 867
748 Ga0436360_0569272 3300039438 Bacteria 4483
749 Ga0436360_1128119 3300039438 Bacteria 1148
750 Ga0436361_0010391 3300039447 Bacteria 16052
751 Ga0436361_0061101 3300039447 Bacteria 18221
752 Ga0436361_0448534 3300039447 Bacteria 1135
753 Ga0436361_0639567 3300039447 Bacteria 2457
754 Ga0436361_0879866 3300039447 Bacteria 8277
755 Ga0436361_1162467 3300039447 Bacteria 6420
756 Ga0436363_0162138 3300039450 Bacteria 4984
757 Ga0436363_0461399 3300039450 Unclassified 1396
758 Ga0436362_0240647 3300039453 Unclassified 950
759 Ga0466963_0000107 3300044694 Bacteria 30205
760 Ga0466963_0058277 3300044694 Bacteria 2575
761 Ga0466963_0113690 3300044694 Bacteria 1859
762 Ga0466963_0150175 3300044694 Bacteria 1617
763 Ga0466963_0243937 3300044694 Bacteria 1260
764 Ga0466957_0001754 3300044842 Bacteria 11410
765 Ga0466957_0447897 3300044842 Bacteria 889
766 Ga0466959_0159680 3300045049 Bacteria 1585
767 Ga0451576_1315184 3300045051 Unclassified 753
768 Ga0466958_0047770 3300045836 Bacteria 2584
769 Ga0466958_0105353 3300045836 Bacteria 1757
770 Ga0466967_0010311 3300045976 Bacteria 6998
771 Ga0466967_0012589 3300045976 Bacteria 6482
772 Ga0466967_0422045 3300045976 Bacteria 1300
773 Ga0495603_0000592 3300046455 Bacteria 20371
774 Ga0495629_0061900 3300046459 Bacteria 2615
775 Ga0495638_0158466 3300046460 Bacteria 1308
776 Ga0495651_0034112 3300046462 Bacteria 3968
777 Ga0495650_0000006 3300046471 Bacteria 721347
778 Ga0495650_0002472 3300046471 Bacteria 14872
779 Ga0495650_0049622 3300046471 Bacteria 1742
780 Ga0495580_0004410 3300046472 Bacteria 11818
781 Ga0495580_0020638 3300046472 Bacteria 4873
782 Ga0495580_0053999 3300046472 Bacteria 2835
783 Ga0495580_0083777 3300046472 Bacteria 2221
784 Ga0495662_0099947 3300046476 Unclassified 1419
785 Ga0495664_0034919 3300046477 Bacteria 2959
786 Ga0495585_0004907 3300046492 Bacteria 8563
787 Ga0495585_0170442 3300046492 Bacteria 1125
788 Ga0495594_0001118 3300046499 Bacteria 13996
789 Ga0495596_0004138 3300046500 Bacteria 7134
790 Ga0495583_0023158 3300046506 Bacteria 3148
791 Ga0495583_0046599 3300046506 Bacteria 1998
792 Ga0495606_0255215 3300046507 Bacteria 971
793 Ga0495628_0038045 3300046516 Bacteria 3854
794 Ga0495628_0133928 3300046516 Bacteria 1895
795 Ga0495631_0017357 3300046518 Bacteria 3407
796 Ga0495631_0031194 3300046518 Bacteria 2414
797 Ga0495644_0000058 3300046523 Bacteria 53865
798 Ga0495648_0024978 3300046524 Bacteria 4055
799 Ga0495648_0078985 3300046524 Bacteria 1880
800 Ga0495666_0124858 3300046526 Unclassified 1204
801 Ga0495642_0003827 3300046528 Bacteria 5902
802 Ga0495652_0059042 3300046529 Bacteria 3247
803 Ga0495665_0021330 3300046531 Bacteria 3480
804 Ga0495640_0048324 3300046533 Bacteria 2941
805 Ga0495586_0087692 3300046535 Bacteria 1716
806 Ga0495587_0122827 3300046536 Bacteria 1487
807 Ga0495609_0008526 3300046538 Bacteria 5018
808 Ga0495645_0003905 3300046543 Bacteria 10164
809 Ga0495645_0079147 3300046543 Bacteria 2362
810 Ga0495633_0002138 3300046558 Bacteria 14165
811 Ga0495633_0275420 3300046558 Bacteria 766
812 Ga0495667_0069997 3300046559 Bacteria 2289
813 Ga0495656_0059638 3300046615 Bacteria 1661
814 Ga0495668_0015581 3300046616 Bacteria 4436
815 Ga0495611_0004999 3300046648 Bacteria 5680
816 Ga0495625_0002024 3300046660 Bacteria 22832
817 Ga0495625_0018272 3300046660 Bacteria 5477
818 Ga0495625_0021565 3300046660 Bacteria 4957
819 Ga0495625_0070054 3300046660 Bacteria 2463
820 Ga0495625_0073319 3300046660 Bacteria 2400
821 Ga0495635_0064750 3300046663 Bacteria 2509
822 Ga0495661_0004329 3300046665 Bacteria 10279
823 Ga0495657_0077042 3300046675 Bacteria 2164
824 Ga0495599_0164359 3300046678 Bacteria 1371
825 Ga0495623_0046920 3300046679 Bacteria 2742
826 Ga0495623_0054069 3300046679 Bacteria 2534
827 Ga0495646_0045291 3300046680 Bacteria 2688
828 Ga0495658_0078626 3300046683 Bacteria 1931
829 Ga0495669_0009608 3300046684 Bacteria 4081
830 Ga0495613_0046863 3300046689 Bacteria 3195
831 Ga0495670_0309273 3300046691 Bacteria 847
832 Ga0495589_0141531 3300046794 Bacteria 1151
833 Ga0495581_0039648 3300047315 Bacteria 2727
834 Ga0495604_0060709 3300047317 Bacteria 2894
835 Ga0495674_0020527 3300047319 Bacteria 6114
836 Ga0495672_0078796 3300047320 Bacteria 1842
837 Ga0495683_0090570 3300047323 Bacteria 1482
838 Ga0495679_055291 3300047446 Bacteria 1179
839 Ga0495673_0112129 3300047469 Bacteria 1089
840 Ga0495686_0010491 3300047472 Bacteria 6584
841 Ga0495593_0065122 3300047673 Bacteria 1901
842 Ga0495602_0158783 3300048088 Bacteria 1768
843 Ga0496100_0185172 3300048903 Bacteria 1508
844 Ga0496100_0316737 3300048903 Bacteria 1171
845 Ga0496100_0614737 3300048903 Bacteria 845
846 Ga0496101_0069925 3300048904 Bacteria 2569
847 Ga0496101_0091782 3300048904 Bacteria 2260
848 Ga0496102_0038515 3300048905 Bacteria 4315
849 Ga0496102_0066719 3300048905 Bacteria 3298
850 Ga0496102_0133453 3300048905 Bacteria 2325
851 Ga0496104_0024706 3300048907 Bacteria 5530
852 Ga0496104_0079480 3300048907 Unclassified 3126
853 Ga0496104_0135632 3300048907 Unclassified 2365
854 Ga0496104_0146642 3300048907 Bacteria 2266
855 Ga0496104_0162627 3300048907 Bacteria 2141
856 Ga0496104_0252763 3300048907 Bacteria 1675
857 Ga0496105_0002471 3300048908 Bacteria 13377
858 Ga0496105_0033996 3300048908 Bacteria 4191
859 Ga0496105_0282821 3300048908 Bacteria 1337
860 Ga0496105_0373092 3300048908 Unclassified 1136
861 Ga0496105_0775943 3300048908 Bacteria 730
862 Ga0496107_0192996 3300048910 Bacteria 1513
863 Ga0496107_0496479 3300048910 Unclassified 905
864 Ga0496108_0040547 3300048911 Bacteria 3882
865 Ga0496109_0128025 3300048912 Bacteria 2368
866 Ga0496109_0279182 3300048912 Bacteria 1574
867 Ga0496110_0101070 3300048913 Bacteria 2585
868 Ga0496110_0113142 3300048913 Bacteria 2440
869 Ga0496110_0163040 3300048913 Bacteria 2021
870 Ga0496110_0394608 3300048913 Bacteria 1261
871 Ga0496111_0003574 3300048914 Bacteria 9634
872 Ga0496111_0092455 3300048914 Bacteria 2217
873 Ga0496112_0070886 3300048915 Bacteria 3444
874 Ga0496112_0136322 3300048915 Bacteria 2424
875 Ga0496112_0148272 3300048915 Bacteria 2314
876 Ga0496112_0351270 3300048915 Unclassified 1417
877 Ga0496113_0019388 3300048916 Bacteria 4756
878 Ga0496113_0529772 3300048916 Bacteria 945
879 Ga0496114_0021864 3300048917 Bacteria 5207
880 Ga0496114_0026119 3300048917 Bacteria 4778
881 Ga0496115_0113220 3300048918 Bacteria 2229
882 Ga0496115_0289712 3300048918 Bacteria 1343
883 Ga0496115_0412706 3300048918 Bacteria 1094
884 Ga0496124_0178480 3300048927 Bacteria 1637
885 Ga0496126_0000018 3300048929 Bacteria 581170
886 Ga0496126_0000303 3300048929 Bacteria 104690
887 Ga0496126_0001484 3300048929 Bacteria 36385
888 Ga0496126_0116213 3300048929 Bacteria 2325
889 Ga0496126_0119238 3300048929 Bacteria 2290
890 Ga0496126_0189150 3300048929 Bacteria 1745
891 Ga0495682_0023485 3300049460 Bacteria 2301
892 Ga0501290_023513 3300049513 Bacteria 855
893 Ga0501296_002897 3300049519 Bacteria 1819
894 Ga0501031_0064110 3300049568 Bacteria 2393
895 Ga0501032_0003645 3300049569 Bacteria 11717
896 Ga0501033_0002402 3300049570 Bacteria 15944
897 Ga0501034_0002515 3300049571 Bacteria 21990
898 Ga0501036_0006243 3300049572 Bacteria 9666
899 Ga0501037_0021635 3300049573 Bacteria 4755
900 Ga0501038_0010117 3300049574 Bacteria 8634
901 Ga0501038_0082627 3300049574 Bacteria 2705
902 Ga0501039_0069808 3300049575 Bacteria 2729
903 Ga0501043_0000343 3300049579 Bacteria 42161
904 Ga0501046_0000199 3300049580 Bacteria 62001
905 Ga0501047_0000766 3300049581 Bacteria 33631
906 Ga0501047_0109652 3300049581 Bacteria 2643
907 Ga0501070_0082836 3300049586 Bacteria 2655
908 Ga0501070_0407599 3300049586 Bacteria 1099
909 Ga0501073_0000437 3300049589 Bacteria 28708
910 Ga0501074_0262336 3300049590 Bacteria 1228
911 Ga0501257_026850 3300049686 Bacteria 1376
912 Ga0501080_0017271 3300049742 Bacteria 6669
913 Ga0501080_0365704 3300049742 Bacteria 1301
914 Ga0501283_011542 3300049779 Bacteria 1316
915 Ga0501035_0062126 3300049822 Bacteria 3323
916 Ga0501044_0069580 3300049823 Bacteria 3582
917 Ga0501044_0166125 3300049823 Bacteria 2181
918 nmdc:mga08x19_32893_c1 3300050514 Bacteria 3271
919 nmdc:mga08x19_456197_c1 3300050514 Unclassified 900
920 nmdc:mga08x19_65233_c1 3300050514 Bacteria 2364
921 Ga0495601_0010753 3300053077 Bacteria 5460
922 Ga0495601_0034655 3300053077 Bacteria 3150
923 Ga0500644_0056545 3300053088 Bacteria 1366
924 Ga0500651_0000016 3300053093 Bacteria 161074
925 Ga0500595_010150 3300053119 Bacteria 3756
926 Ga0500595_040244 3300053119 Bacteria 1508
927 Ga0587066_015538 3300059490 Unclassified 1186
928 Ga0587073_0008457 3300059492 Bacteria 1667
929 Ga0587083_0008183 3300059505 Bacteria 1628
930 Ga0587088_017561 3300059508 Unclassified 1153
931 Ga0587090_005110 3300059510 Bacteria 1628
932 Ga0587067_007178 3300059640 Bacteria 1584
933 Ga0587075_010825 3300059644 Bacteria 1214
934 Ga0587107_009325 3300059652 Unclassified 1156
935 Ga0587114_005199 3300059655 Bacteria 1396
936 2884218668 2884215851 Bacteria 4554841
937 LJNas_1002114
938 LJNas_1002119
939 rootH2_10180936
940 rootH1_10163155
941 Ga0058863_10169021
942 Ga0058861_10010007
943 Ga0058862_10206145
944 Ga0070658_10000127
945 Ga0070658_10005926
946 Ga0070658_10012417
947 Ga0070658_10027405
948 Ga0070658_10049018
949 Ga0070658_10155821
950 Ga0070658_10194039
951 Ga0070658_10242843
952 Ga0070658_10274348
953 Ga0070658_10761058
954 Ga0070683_100027547
955 Ga0070683_100056915
956 Ga0070683_100137189
957 Ga0070683_100149503
958 Ga0070683_100164107
959 Ga0070683_100223887
960 Ga0070683_100228318
961 Ga0070683_100286227
962 Ga0070683_100366160
963 Ga0070683_100418645
964 Ga0070670_100002219
965 Ga0070670_100219085
966 Ga0070670_100240335
967 Ga0068869_100033425
968 Ga0070666_10018134
969 Ga0070666_10203719
970 Ga0070680_100024372
971 Ga0070680_100035320
972 Ga0070680_100203560
973 Ga0070680_100390111
974 Ga0068868_100028922
975 Ga0068868_100077548
976 Ga0068868_100274002
977 Ga0070660_100008310
978 Ga0070660_100068432
979 Ga0070660_100218581
980 Ga0070660_100358250
981 Ga0070661_100009496
982 Ga0070661_100012609
983 Ga0070661_100013673
984 Ga0070668_100310919
985 Ga0070669_100316061
986 Ga0070675_100023019
987 Ga0070671_100010048
988 Ga0070671_100014408
989 Ga0070671_100255009
990 Ga0070673_100011090
991 Ga0070659_100000543
992 Ga0070659_100035327
993 Ga0070659_100057835
994 Ga0070659_100305228
995 Ga0070667_100012156
996 Ga0070667_100121784
997 Ga0070667_100241161
998 Ga0070709_10030959
999 Ga0070714_100031767
1000 Ga0070714_100110219
1001 Ga0070714_100292635
1002 Ga0070713_100003297
1003 Ga0070713_100067778
1004 Ga0070713_100104847
1005 Ga0070713_100150844
1006 Ga0070713_100431299
1007 Ga0070713_100459287
1008 Ga0070713_100743432
1009 Ga0070710_10001087
1010 Ga0070710_10025739
1011 Ga0070710_10351578
1012 Ga0070711_100012475
1013 Ga0070711_100207321
1014 Ga0070708_100019770
1015 Ga0070708_100047654
1016 Ga0070708_100087170
1017 Ga0070663_100020176
1018 Ga0070663_100031510
1019 Ga0070663_100526784
1020 Ga0070663_100786076
1021 Ga0070678_100010783
1022 Ga0070678_100654327
1023 Ga0070662_100037880
1024 Ga0070662_100075543
1025 Ga0070681_10003504
1026 Ga0070681_10009038
1027 Ga0070681_10089820
1028 Ga0070681_10101063
1029 Ga0070681_10129621
1030 Ga0070681_10167896
1031 Ga0070681_10171172
1032 Ga0070681_10259050
1033 Ga0070681_10261677
1034 Ga0070681_10317772
1035 Ga0070681_10366738
1036 Ga0070681_10430514
1037 Ga0070681_10789321
1038 Ga0070706_100182487
1039 Ga0070707_100397264
1040 Ga0070699_100012791
1041 Ga0070679_100000142
1042 Ga0070679_100016723
1043 Ga0070679_100056106
1044 Ga0070679_100064308
1045 Ga0070679_100110681
1046 Ga0070679_100208872
1047 Ga0070679_100240901
1048 Ga0070679_100247945
1049 Ga0070679_100250736
1050 Ga0070684_100002371
1051 Ga0070684_100047389
1052 Ga0070684_100066748
1053 Ga0070684_100240322
1054 Ga0070684_100303732
1055 Ga0070684_100368000
1056 Ga0070684_100561323
1057 Ga0070684_100677841
1058 Ga0070697_100083263
1059 Ga0068853_100000049
1060 Ga0068853_100010059
1061 Ga0068853_100018922
1062 Ga0068853_100080816
1063 Ga0068853_100088219
1064 Ga0068853_100092171
1065 Ga0068853_100142180
1066 Ga0068853_100157505
1067 Ga0068853_100241265
1068 Ga0068853_100462788
1069 Ga0070672_100013876
1070 Ga0070696_100412958
1071 Ga0070693_100049914
1072 Ga0070693_100230371
1073 Ga0070693_100537021
1074 Ga0070693_100707817
1075 Ga0070665_100056890
1076 Ga0070665_100067885
1077 Ga0070665_100117300
1078 Ga0070665_100153535
1079 Ga0070665_100171343
1080 Ga0070665_100303658
1081 Ga0070665_100636490
1082 Ga0068855_100022355
1083 Ga0068855_100023539
1084 Ga0068855_100035182
1085 Ga0068855_100037164
1086 Ga0068855_100055757
1087 Ga0068855_100078538
1088 Ga0068855_100080052
1089 Ga0068855_100084975
1090 Ga0068855_100106836
1091 Ga0068855_100311221
1092 Ga0068855_100364912
1093 Ga0070664_100057431
1094 Ga0070664_100184694
1095 Ga0070664_100273595
1096 Ga0070664_100541751
1097 Ga0068857_100000158
1098 Ga0068857_100004818
1099 Ga0068857_100082502
1100 Ga0068857_100162791
1101 Ga0068857_100228357
1102 Ga0068857_100232001
1103 Ga0068854_100000055
1104 Ga0068854_100007803
1105 Ga0068854_100064011
1106 Ga0068854_100503875
1107 Ga0068856_100013601
1108 Ga0068856_100014141
1109 Ga0068856_100019029
1110 Ga0068856_100041249
1111 Ga0068856_100058066
1112 Ga0068856_100068915
1113 Ga0068856_100109057
1114 Ga0068856_100148226
1115 Ga0068856_100181827
1116 Ga0068856_100246876
1117 Ga0068856_100641779
1118 Ga0068852_100000023
1119 Ga0068852_100000650
1120 Ga0068852_100008476
1121 Ga0068852_100009589
1122 Ga0068852_100035040
1123 Ga0068852_100061504
1124 Ga0068852_100072000
1125 Ga0068859_100065862
1126 Ga0068864_100014372
1127 Ga0068864_100135149
1128 Ga0068864_100142631
1129 Ga0068861_100378888
1130 Ga0068851_10018899
1131 Ga0068851_10032688
1132 Ga0068851_10063947
1133 Ga0068851_10076541
1134 Ga0068851_10113056
1135 Ga0068851_10249383
1136 Ga0068863_100008200
1137 Ga0068863_100030571
1138 Ga0068863_100069588
1139 Ga0068863_100413225
1140 Ga0068863_100633869
1141 Ga0068858_100073258
1142 Ga0068858_100388765
1143 Ga0068860_100007235
1144 Ga0068860_100215561
1145 Ga0070717_10014729
1146 Ga0070717_10031517
1147 Ga0070717_10176321
1148 Ga0070717_10432299
1149 Ga0070717_10506575
1150 Ga0070717_10946406
1151 Ga0070717_11088233
1152 Ga0070716_100026183
1153 Ga0070716_100060077
1154 Ga0070716_100069691
1155 Ga0070716_100253970
1156 Ga0070712_100033762
1157 Ga0070712_100424603
1158 Ga0097621_100009531
1159 Ga0097621_100034492
1160 Ga0097621_100087283
1161 Ga0068871_100028980
1162 Ga0068871_100037410
1163 Ga0068871_100714500
1164 Ga0075430_100301558
1165 Ga0075434_100050253
1166 Ga0068865_100194829
1167 Ga0075436_100040657
1168 Ga0075436_100108968
1169 Ga0075436_100335447
1170 Ga0075436_100487932
1171 Ga0097620_100065860
1172 Ga0099794_10080636
1173 Ga0105240_10000001
1174 Ga0105240_10000203
1175 Ga0105240_10002494
1176 Ga0105240_10003537
1177 Ga0105240_10003873
1178 Ga0105240_10013349
1179 Ga0105240_10017631
1180 Ga0105240_10022791
1181 Ga0105240_10025072
1182 Ga0105240_10053947
1183 Ga0105240_10071210
1184 Ga0105240_10125952
1185 Ga0105240_10127164
1186 Ga0105240_10228961
1187 Ga0105240_10267247
1188 Ga0105240_10550702
1189 Ga0105240_10835884
1190 Ga0105240_11085003
1191 Ga0105245_10003445
1192 Ga0105245_10014904
1193 Ga0105245_10016260
1194 Ga0105245_10051868
1195 Ga0105245_10197349
1196 Ga0105247_10034937
1197 Ga0105243_10245779
1198 Ga0105241_10001348
1199 Ga0105241_10022157
1200 Ga0105241_10050444
1201 Ga0105241_10074452
1202 Ga0105241_10098700
1203 Ga0105241_10710099
1204 Ga0105242_10032800
1205 Ga0105248_10000003
1206 Ga0105248_10003035
1207 Ga0105248_10012616
1208 Ga0105248_10019898
1209 Ga0105248_10082685
1210 Ga0105237_10013833
1211 Ga0105237_10055993
1212 Ga0105237_10095413
1213 Ga0105237_10120869
1214 Ga0105237_10197854
1215 Ga0105237_10252397
1216 Ga0105237_10338597
1217 Ga0105237_10760196
1218 Ga0105238_10004199
1219 Ga0105238_10009838
1220 Ga0105238_10011748
1221 Ga0105238_10016124
1222 Ga0105238_10017544
1223 Ga0105238_10033244
1224 Ga0105238_10051566
1225 Ga0105238_10058807
1226 Ga0105238_10067744
1227 Ga0105238_10095478
1228 Ga0105238_10120932
1229 Ga0105238_10159775
1230 Ga0105238_10162974
1231 Ga0105238_10195748
1232 Ga0105238_10199759
1233 Ga0105238_10440891
1234 Ga0105249_10132004
1235 Ga0105249_10272198
1236 Ga0105249_10413466
1237 Ga0105239_10002793
1238 Ga0105239_10044315
1239 Ga0105239_10077477
1240 Ga0105239_10151970
1241 Ga0105239_10292429
1242 Ga0105239_10330250
1243 Ga0105239_10353290
1244 Ga0105239_10372854
1245 Ga0105239_10873417
1246 Ga0105246_10046125
1247 Ga0157373_10010582
1248 Ga0157373_10043823
1249 Ga0157371_10040562
1250 Ga0157371_10210629
1251 Ga0157370_10000082
1252 Ga0157370_10051902
1253 Ga0157370_10052517
1254 Ga0157370_10054612
1255 Ga0157370_10067409
1256 Ga0157370_10118953
1257 Ga0157370_10161932
1258 Ga0157370_10317155
1259 Ga0157370_10321274
1260 Ga0157370_10326642
1261 Ga0157370_10525410
1262 Ga0157370_10793616
1263 Ga0157369_10000095
1264 Ga0157369_10004782
1265 Ga0157369_10016017
1266 Ga0157369_10022800
1267 Ga0157369_10024425
1268 Ga0157369_10025865
1269 Ga0157369_10035004
1270 Ga0157369_10040476
1271 Ga0157369_10042663
1272 Ga0157369_10053162
1273 Ga0157369_10137346
1274 Ga0157369_10141715
1275 Ga0157369_10155800
1276 Ga0157369_10215274
1277 Ga0157369_10385349
1278 Ga0157369_10464371
1279 Ga0157369_10547272
1280 Ga0157369_11302650
1281 Ga0157374_10006654
1282 Ga0157374_10013447
1283 Ga0157374_10013966
1284 Ga0157374_10022035
1285 Ga0157374_10024468
1286 Ga0157374_10111890
1287 Ga0157374_10120998
1288 Ga0157374_10137656
1289 Ga0157374_10155817
1290 Ga0157374_10577733
1291 Ga0157374_10658316
1292 Ga0157374_11111129
1293 Ga0157378_10005859
1294 Ga0157378_10016744
1295 Ga0157378_10026752
1296 Ga0157378_10031303
1297 Ga0157378_10145631
1298 Ga0157378_10167630
1299 Ga0157378_10975965
1300 Ga0163162_10063135
1301 Ga0163162_10123812
1302 Ga0157372_10000102
1303 Ga0157372_10010094
1304 Ga0157372_10012351
1305 Ga0157372_10018972
1306 Ga0157372_10026765
1307 Ga0157372_10034189
1308 Ga0157372_10035115
1309 Ga0157372_10045727
1310 Ga0157372_10047146
1311 Ga0157372_10143199
1312 Ga0157372_10221366
1313 Ga0157372_10225927
1314 Ga0157375_10013132
1315 Ga0157375_10304072
1316 Ga0163163_10061970
1317 Ga0163163_10070842
1318 Ga0163163_10216767
1319 Ga0182008_10021755
1320 Ga0157379_10012396
1321 Ga0157379_10031712
1322 Ga0157379_10199972
1323 Ga0157379_10216580
1324 Ga0157379_10218832
1325 Ga0157379_10238668
1326 Ga0157376_10002799
1327 Ga0157376_10024145
1328 Ga0157376_10057025
1329 Ga0157376_10068438
1330 Ga0157376_10161132
1331 Ga0157376_10271962
1332 Ga0157376_10411348
1333 Ga0157376_10525593
1334 Ga0182005_1011918
1335 Ga0163161_10047930
1336 Ga0206353_10589488
1337 Ga0154015_1253388
1338 Ga0154015_1618321
1339 Ga0213872_10009480
1340 Ga0213872_10016554
1341 Ga0213872_10038364
1342 Ga0224712_10044926
1343 Ga0224571_100070
1344 Ga0228598_1000318
1345 Ga0228598_1000456
1346 Ga0207697_10048954
1347 Ga0207656_10024994
1348 Ga0207656_10030677
1349 Ga0207656_10035109
1350 Ga0207656_10069013
1351 Ga0207656_10089766
1352 Ga0207692_10000544
1353 Ga0207710_10011929
1354 Ga0207680_10190439
1355 Ga0207647_10007872
1356 Ga0207647_10033850
1357 Ga0207647_10169747
1358 Ga0207685_10040565
1359 Ga0207699_10047674
1360 Ga0207699_10166402
1361 Ga0207699_10429368
1362 Ga0207699_10589477
1363 Ga0207645_10019509
1364 Ga0207705_10000020
1365 Ga0207705_10000562
1366 Ga0207705_10020122
1367 Ga0207705_10033166
1368 Ga0207705_10070610
1369 Ga0207705_10108027
1370 Ga0207705_10140847
1371 Ga0207705_10167041
1372 Ga0207705_10178395
1373 Ga0207705_10285699
1374 Ga0207705_10533811
1375 Ga0207684_10244547
1376 Ga0207654_10000154
1377 Ga0207654_10008218
1378 Ga0207654_10074069
1379 Ga0207654_10086042
1380 Ga0207654_10086545
1381 Ga0207707_10053907
1382 Ga0207707_10075858
1383 Ga0207707_10092577
1384 Ga0207707_10122448
1385 Ga0207707_10125768
1386 Ga0207707_10129161
1387 Ga0207707_10296707
1388 Ga0207707_10341735
1389 Ga0207707_10489598
1390 Ga0207695_10000001
1391 Ga0207695_10000080
1392 Ga0207695_10000303
1393 Ga0207695_10001162
1394 Ga0207695_10010711
1395 Ga0207695_10016845
1396 Ga0207695_10036140
1397 Ga0207695_10039924
1398 Ga0207695_10046202
1399 Ga0207695_10061989
1400 Ga0207695_10092962
1401 Ga0207695_10119326
1402 Ga0207695_10125766
1403 Ga0207695_10222845
1404 Ga0207695_10323636
1405 Ga0207671_10001283
1406 Ga0207671_10051157
1407 Ga0207671_10106061
1408 Ga0207671_10171809
1409 Ga0207671_10184214
1410 Ga0207671_10342543
1411 Ga0207693_10034660
1412 Ga0207693_10089471
1413 Ga0207663_10097909
1414 Ga0207663_10103697
1415 Ga0207663_10577885
1416 Ga0207660_10017684
1417 Ga0207660_10024884
1418 Ga0207660_10373925
1419 Ga0207660_10391181
1420 Ga0207660_10477750
1421 Ga0207660_10544054
1422 Ga0207657_10001167
1423 Ga0207657_10011054
1424 Ga0207657_10012789
1425 Ga0207657_10015325
1426 Ga0207657_10057971
1427 Ga0207657_10177074
1428 Ga0207657_10384094
1429 Ga0207649_10008630
1430 Ga0207649_10023724
1431 Ga0207649_10060461
1432 Ga0207649_10073936
1433 Ga0207652_10003733
1434 Ga0207652_10012797
1435 Ga0207652_10064756
1436 Ga0207652_10074748
1437 Ga0207652_10107374
1438 Ga0207652_10122528
1439 Ga0207652_10214561
1440 Ga0207652_10262021
1441 Ga0207646_10027006
1442 Ga0207646_10061824
1443 Ga0207646_10381060
1444 Ga0207681_10372494
1445 Ga0207694_10000184
1446 Ga0207694_10000520
1447 Ga0207694_10002242
1448 Ga0207694_10005906
1449 Ga0207694_10015919
1450 Ga0207694_10105638
1451 Ga0207694_10264021
1452 Ga0207650_10007412
1453 Ga0207650_10142958
1454 Ga0207650_10245297
1455 Ga0207659_10055096
1456 Ga0207687_10017710
1457 Ga0207687_10021523
1458 Ga0207687_10024117
1459 Ga0207687_10024146
1460 Ga0207687_10227668
1461 Ga0207700_10029316
1462 Ga0207700_10050881
1463 Ga0207700_10104341
1464 Ga0207700_10190703
1465 Ga0207700_10619160
1466 Ga0207664_10044693
1467 Ga0207664_10055740
1468 Ga0207664_10098498
1469 Ga0207664_10139131
1470 Ga0207664_10142063
1471 Ga0207664_10258537
1472 Ga0207644_10003660
1473 Ga0207644_10022921
1474 Ga0207644_10755678
1475 Ga0207690_10000553
1476 Ga0207690_10072618
1477 Ga0207690_10137372
1478 Ga0207706_10002843
1479 Ga0207706_10026562
1480 Ga0207704_10070618
1481 Ga0207665_10067620
1482 Ga0207665_10069495
1483 Ga0207665_10104766
1484 Ga0207665_10200314
1485 Ga0207691_10002212
1486 Ga0207711_10000013
1487 Ga0207711_10003932
1488 Ga0207711_10027419
1489 Ga0207711_10105990
1490 Ga0207711_10170679
1491 Ga0207689_10000659
1492 Ga0207689_10005877
1493 Ga0207661_10086886
1494 Ga0207661_10152072
1495 Ga0207661_10152983
1496 Ga0207661_10169361
1497 Ga0207661_10365526
1498 Ga0207661_10376274
1499 Ga0207661_10435648
1500 Ga0207679_10131132
1501 Ga0207679_10187229
1502 Ga0207667_10000259
1503 Ga0207667_10000360
1504 Ga0207667_10000385
1505 Ga0207667_10003193
1506 Ga0207667_10004195
1507 Ga0207667_10020451
1508 Ga0207667_10021092
1509 Ga0207667_10022273
1510 Ga0207667_10025199
1511 Ga0207667_10061196
1512 Ga0207667_10070190
1513 Ga0207667_10132051
1514 Ga0207667_10138412
1515 Ga0207667_10442289
1516 Ga0207651_10135544
1517 Ga0207712_10426277
1518 Ga0207640_10000011
1519 Ga0207640_10077604
1520 Ga0207640_10191626
1521 Ga0207640_10337966
1522 Ga0207640_10460605
1523 Ga0207658_10081057
1524 Ga0207658_10195626
1525 Ga0207677_10002003
1526 Ga0207677_10345121
1527 Ga0207703_10027827
1528 Ga0207703_10049953
1529 Ga0207703_10384030
1530 Ga0207639_10000085
1531 Ga0207639_10000586
1532 Ga0207639_10037593
1533 Ga0207639_10048283
1534 Ga0207639_10054517
1535 Ga0207639_10065523
1536 Ga0207639_10147871
1537 Ga0207639_10350913
1538 Ga0207678_10005665
1539 Ga0207678_10012647
1540 Ga0207678_10015323
1541 Ga0207678_10200822
1542 Ga0207702_10016202
1543 Ga0207702_10038053
1544 Ga0207702_10038590
1545 Ga0207702_10076053
1546 Ga0207702_10138403
1547 Ga0207702_10160710
1548 Ga0207702_10286429
1549 Ga0207702_10412719
1550 Ga0207702_10474556
1551 Ga0207702_10504342
1552 Ga0207702_10579262
1553 Ga0207641_10006263
1554 Ga0207641_10010079
1555 Ga0207641_10025399
1556 Ga0207641_11194350
1557 Ga0207648_10449632
1558 Ga0207676_10071649
1559 Ga0207676_10081144
1560 Ga0207674_10000122
1561 Ga0207674_10005786
1562 Ga0207674_10005961
1563 Ga0207674_10112128
1564 Ga0207674_10134956
1565 Ga0207674_10158701
1566 Ga0207674_10239523
1567 Ga0207674_10289017
1568 Ga0207674_10348495
1569 Ga0207675_100469683
1570 Ga0207683_10000896
1571 Ga0207698_10000026
1572 Ga0207698_10000221
1573 Ga0207698_10012069
1574 Ga0207698_10036728
1575 Ga0207698_10040613
1576 Ga0207698_10097128
1577 Ga0207698_10105379
1578 Ga0207698_10116654
1579 Ga0207698_10140845
1580 Ga0265356_1001810
1581 Ga0268266_10030012
1582 Ga0268266_10075026
1583 Ga0268266_10122131
1584 Ga0268266_10443874
1585 Ga0268266_10508422
1586 Ga0268264_10000653
1587 Ga0265319_1093749
1588 Ga0265338_10001900
1589 Ga0265338_10013731
1590 Ga0265338_10088176
1591 Ga0265338_10117288
1592 Ga0265338_10194152
1593 Ga0265324_10134710
1594 Ga0265762_1000914
1595 Ga0265770_1003967
1596 Ga0265765_1014627
1597 Ga0265771_1001456
1598 Ga0265760_10066695
1599 Ga0265330_10000548
1600 Ga0265330_10000631
1601 Ga0265330_10008852
1602 Ga0265330_10028232
1603 Ga0265330_10055915
1604 Ga0265332_10007138
1605 Ga0265332_10080339
1606 Ga0265328_10008795
1607 Ga0265328_10031821
1608 Ga0265328_10113805
1609 Ga0265320_10061946
1610 Ga0265325_10000614
1611 Ga0265325_10000899
1612 Ga0265325_10009867
1613 Ga0265325_10026762
1614 Ga0265325_10027726
1615 Ga0265325_10041139
1616 Ga0265325_10150599
1617 Ga0265340_10002990
1618 Ga0265340_10048843
1619 Ga0265339_10000011
1620 Ga0265339_10004485
1621 Ga0265339_10021534
1622 Ga0265339_10028416
1623 Ga0265339_10039397
1624 Ga0265339_10046078
1625 Ga0265339_10074604
1626 Ga0265331_10034295
1627 Ga0265331_10056221
1628 Ga0265316_10002386
1629 Ga0265316_10006508
1630 Ga0265316_10013155
1631 Ga0265316_10018468
1632 Ga0265316_10174177
1633 Ga0265316_10369902
1634 Ga0265316_10407827
1635 Ga0265313_10001746
1636 Ga0265313_10004925
1637 Ga0265313_10014026
1638 Ga0265314_10000151
1639 Ga0265314_10066976
1640 Ga0265314_10067265
1641 Ga0265342_10000977
1642 Ga0265342_10009076
1643 Ga0265342_10012334
1644 Ga0265342_10013306
1645 Ga0265342_10014774
1646 Ga0265342_10020074
1647 Ga0265342_10037153
1648 Ga0265342_10040434
1649 Ga0265342_10045754
1650 Ga0265342_10066928
1651 Ga0307510_10050521
1652 Ga0307510_10086828
1653 Ga0373926_0005964
1654 Ga0373936_0008999
1655 Ga0373954_0356053
1656 Ga0373956_0007313
1657 Ga0373957_0054835
1658 Ga0373946_0019743
1659 Ga0373955_0019606
1660 Ga0373955_0046902
1661 Ga0373955_0386896
1662 Ga0373924_0000594
1663 Ga0373924_0070292
1664 Ga0373935_0114292
1665 Ga0373933_0144338
1666 Ga0373933_0190558
1667 Ga0373947_0031202
1668 Ga0373937_0000188
1669 Ga0373937_0004446
1670 Ga0373937_0375316
1671 Ga0373937_1288031
1672 Ga0373925_0018342
1673 Ga0373925_0038621
1674 Ga0395900_0405899
1675 Ga0395900_0777166
1676 Ga0395898_0076695
1677 Ga0395898_0379897
1678 Ga0395905_0012025
1679 Ga0395905_0068453
1680 Ga0395905_0358324
1681 Ga0395905_0523149
1682 Ga0395901_0592451
1683 Ga0395901_0900573
1684 Ga0436360_0569272
1685 Ga0436360_1128119
1686 Ga0436361_0010391
1687 Ga0436361_0061101
1688 Ga0436361_0448534
1689 Ga0436361_0639567
1690 Ga0436361_0879866
1691 Ga0436361_1162467
1692 Ga0436363_0162138
1693 Ga0436363_0461399
1694 Ga0436362_0240647
1695 Ga0466963_0000107
1696 Ga0466963_0058277
1697 Ga0466963_0113690
1698 Ga0466963_0150175
1699 Ga0466963_0243937
1700 Ga0466957_0001754
1701 Ga0466957_0447897
1702 Ga0466959_0159680
1703 Ga0451576_1315184
1704 Ga0466958_0047770
1705 Ga0466958_0105353
1706 Ga0466967_0010311
1707 Ga0466967_0012589
1708 Ga0466967_0422045
1709 Ga0495603_0000592
1710 Ga0495629_0061900
1711 Ga0495638_0158466
1712 Ga0495651_0034112
1713 Ga0495650_0000006
1714 Ga0495650_0002472
1715 Ga0495650_0049622
1716 Ga0495580_0004410
1717 Ga0495580_0020638
1718 Ga0495580_0053999
1719 Ga0495580_0083777
1720 Ga0495662_0099947
1721 Ga0495664_0034919
1722 Ga0495585_0004907
1723 Ga0495585_0170442
1724 Ga0495594_0001118
1725 Ga0495596_0004138
1726 Ga0495583_0023158
1727 Ga0495583_0046599
1728 Ga0495606_0255215
1729 Ga0495628_0038045
1730 Ga0495628_0133928
1731 Ga0495631_0017357
1732 Ga0495631_0031194
1733 Ga0495644_0000058
1734 Ga0495648_0024978
1735 Ga0495648_0078985
1736 Ga0495666_0124858
1737 Ga0495642_0003827
1738 Ga0495652_0059042
1739 Ga0495665_0021330
1740 Ga0495640_0048324
1741 Ga0495586_0087692
1742 Ga0495587_0122827
1743 Ga0495609_0008526
1744 Ga0495645_0003905
1745 Ga0495645_0079147
1746 Ga0495633_0002138
1747 Ga0495633_0275420
1748 Ga0495667_0069997
1749 Ga0495656_0059638
1750 Ga0495668_0015581
1751 Ga0495611_0004999
1752 Ga0495625_0002024
1753 Ga0495625_0018272
1754 Ga0495625_0021565
1755 Ga0495625_0070054
1756 Ga0495625_0073319
1757 Ga0495635_0064750
1758 Ga0495661_0004329
1759 Ga0495657_0077042
1760 Ga0495599_0164359
1761 Ga0495623_0046920
1762 Ga0495623_0054069
1763 Ga0495646_0045291
1764 Ga0495658_0078626
1765 Ga0495669_0009608
1766 Ga0495613_0046863
1767 Ga0495670_0309273
1768 Ga0495589_0141531
1769 Ga0495581_0039648
1770 Ga0495604_0060709
1771 Ga0495674_0020527
1772 Ga0495672_0078796
1773 Ga0495683_0090570
1774 Ga0495679_055291
1775 Ga0495673_0112129
1776 Ga0495686_0010491
1777 Ga0495593_0065122
1778 Ga0495602_0158783
1779 Ga0496100_0185172
1780 Ga0496100_0316737
1781 Ga0496100_0614737
1782 Ga0496101_0069925
1783 Ga0496101_0091782
1784 Ga0496102_0038515
1785 Ga0496102_0066719
1786 Ga0496102_0133453
1787 Ga0496104_0024706
1788 Ga0496104_0079480
1789 Ga0496104_0135632
1790 Ga0496104_0146642
1791 Ga0496104_0162627
1792 Ga0496104_0252763
1793 Ga0496105_0002471
1794 Ga0496105_0033996
1795 Ga0496105_0282821
1796 Ga0496105_0373092
1797 Ga0496105_0775943
1798 Ga0496107_0192996
1799 Ga0496107_0496479
1800 Ga0496108_0040547
1801 Ga0496109_0128025
1802 Ga0496109_0279182
1803 Ga0496110_0101070
1804 Ga0496110_0113142
1805 Ga0496110_0163040
1806 Ga0496110_0394608
1807 Ga0496111_0003574
1808 Ga0496111_0092455
1809 Ga0496112_0070886
1810 Ga0496112_0136322
1811 Ga0496112_0148272
1812 Ga0496112_0351270
1813 Ga0496113_0019388
1814 Ga0496113_0529772
1815 Ga0496114_0021864
1816 Ga0496114_0026119
1817 Ga0496115_0113220
1818 Ga0496115_0289712
1819 Ga0496115_0412706
1820 Ga0496124_0178480
1821 Ga0496126_0000018
1822 Ga0496126_0000303
1823 Ga0496126_0001484
1824 Ga0496126_0116213
1825 Ga0496126_0119238
1826 Ga0496126_0189150
1827 Ga0495682_0023485
1828 Ga0501290_023513
1829 Ga0501296_002897
1830 Ga0501031_0064110
1831 Ga0501032_0003645
1832 Ga0501033_0002402
1833 Ga0501034_0002515
1834 Ga0501036_0006243
1835 Ga0501037_0021635
1836 Ga0501038_0010117
1837 Ga0501038_0082627
1838 Ga0501039_0069808
1839 Ga0501043_0000343
1840 Ga0501046_0000199
1841 Ga0501047_0000766
1842 Ga0501047_0109652
1843 Ga0501070_0082836
1844 Ga0501070_0407599
1845 Ga0501073_0000437
1846 Ga0501074_0262336
1847 Ga0501257_026850
1848 Ga0501080_0017271
1849 Ga0501080_0365704
1850 Ga0501283_011542
1851 Ga0501035_0062126
1852 Ga0501044_0069580
1853 Ga0501044_0166125
1854 nmdc:mga08x19_32893_c1
1855 nmdc:mga08x19_456197_c1
1856 nmdc:mga08x19_65233_c1
1857 Ga0495601_0010753
1858 Ga0495601_0034655
1859 Ga0500644_0056545
1860 Ga0500651_0000016
1861 Ga0500595_010150
1862 Ga0500595_040244
1863 Ga0587066_015538
1864 Ga0587073_0008457
1865 Ga0587083_0008183
1866 Ga0587088_017561
1867 Ga0587090_005110
1868 Ga0587067_007178
1869 Ga0587075_010825
1870 Ga0587107_009325
1871 Ga0587114_005199
1872 2884218668

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01066

CDP-OH_P_transf

CDP-alcohol phosphatidyltransferase

26

194

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
4q7c-assembly1.cif.gz_B structure of af2299, a cdp-alcohol phosphotransferase 0.819 14 196
4o6m-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase (cmp-bound) 0.8144 14 196
4q7c-assembly1.cif.gz_A structure of af2299, a cdp-alcohol phosphotransferase 0.8141 14 196
6wmv-assembly1.cif.gz_A structure of a phosphatidylinositol-phosphate synthase (pips) from mycobacterium kansasii with evidence of substrate binding 0.8107 14 199
5d92-assembly1.cif.gz_A structure of a phosphatidylinositolphosphate (pip) synthase from renibacterium salmoninarum 0.8107 7 205
ID Description Score Start End Superfamily
af_P76090_8_197_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8282 13 199 1.20.120.1760
4o6mB02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8237 14 196 1.20.120.1760
5d92A02 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8105 7 205 1.20.120.1760
af_P76226_9_202_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8045 14 202 1.20.120.1760
af_P76090_8_197_1.20.120.1760 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);CDP-alcohol phosphotransferase transmembrane (TM) domain 0.8042 13 199 1.20.120.1760
ID Description Score Start End GO Terms
AF-A0A6N8YT58-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9544 17 137 GO:0008654
GO:0016020
GO:0016780
AF-A0A521XXT1-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9392 13 145 GO:0008654
GO:0016020
GO:0016780
AF-A0A7W0LCC3-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9276 1 137 GO:0008654
GO:0016020
GO:0016780
AF-X0WQ27-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9213 6 145 GO:0008654
GO:0016020
GO:0016780
AF-A0A7W0LCC3-F1-model_v4 CDP-alcohol phosphatidyltransferase family protein 0.9143 1 137 GO:0008654
GO:0016020
GO:0016780

Map