F486119

General Info

Members Datasets Scaffolds Average Seq Length
934 313 1868 116

Family's Representative Sequence

Representative Sequence 3300005719|Ga0068861_100408203|Ga0068861_1004082032
Length 139
Sequence MRQWLNRLRSLHLTGQYGPVYSIGMANGEGQKADVLQGTLDLMVLQTLDTMGPQHGYAIAARLEQVSAGALQLNMGTLYPGLMRLEQRGLVKGSWGTTDTNRKARFYALTAAGRRELAKQRDAWDRMAGIMHTLLRGEG

Samples

Sample ID Description Type Environment
1 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
93 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
94 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
95 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
184 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
189 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
192 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
193 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
194 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
197 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
211 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
212 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
213 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
214 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
231 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
232 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
236 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
237 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
244 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
248 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
249 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
250 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
282 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
283 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
284 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
285 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
286 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
287 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
288 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
289 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
296 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
307 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
308 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
309 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
312 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.79
Metatranscriptomes 0.21
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.57
Nodule 0
Rhizoplane 2.36
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 30.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068861_100408203 3300005719 Bacteria 1207
2 Ga0065712_10003012 3300005290 Bacteria 6886
3 Ga0065712_10067780 3300005290 Bacteria 37076
4 Ga0065712_10117327 3300005290 Bacteria 1722
5 Ga0065715_10000224 3300005293 Bacteria 33957
6 Ga0065715_10245874 3300005293 Bacteria 1156
7 Ga0065715_10634064 3300005293 Unclassified 688
8 Ga0065707_10086010 3300005295 Bacteria 5708
9 Ga0065707_10283949 3300005295 Unclassified 1041
10 Ga0070676_10086479 3300005328 Bacteria 1912
11 Ga0070676_10203247 3300005328 Bacteria 1300
12 Ga0070676_10500059 3300005328 Unclassified 863
13 Ga0070683_100012658 3300005329 Bacteria 7336
14 Ga0070683_100542286 3300005329 Bacteria 1112
15 Ga0070690_100182326 3300005330 Bacteria 1451
16 Ga0070690_100335689 3300005330 Bacteria 1093
17 Ga0070670_100545630 3300005331 Bacteria 1034
18 Ga0070677_10006214 3300005333 Bacteria 3966
19 Ga0070677_10266452 3300005333 Bacteria 857
20 Ga0070677_10494518 3300005333 Bacteria 662
21 Ga0070677_10696658 3300005333 Bacteria 572
22 Ga0068869_101405689 3300005334 Bacteria 618
23 Ga0070666_10224249 3300005335 Unclassified 1326
24 Ga0070680_100199320 3300005336 Bacteria 1688
25 Ga0070680_101892917 3300005336 Bacteria 517
26 Ga0068868_100540113 3300005338 Bacteria 1026
27 Ga0068868_101033115 3300005338 Unclassified 753
28 Ga0068868_101564873 3300005338 Unclassified 619
29 Ga0070660_100387092 3300005339 Bacteria 1155
30 Ga0070689_100108463 3300005340 Bacteria 2206
31 Ga0070689_100259615 3300005340 Bacteria 1436
32 Ga0070691_10217556 3300005341 Bacteria 1011
33 Ga0070687_100036803 3300005343 Bacteria 2442
34 Ga0070687_101538135 3300005343 Unclassified 501
35 Ga0070661_101759853 3300005344 Unclassified 525
36 Ga0070668_100242790 3300005347 Bacteria 1493
37 Ga0070668_100295916 3300005347 Bacteria 1356
38 Ga0070668_100723984 3300005347 Unclassified 879
39 Ga0070668_100959118 3300005347 Unclassified 767
40 Ga0070669_100030799 3300005353 Bacteria 3872
41 Ga0070669_100374948 3300005353 Bacteria 1159
42 Ga0070669_100441148 3300005353 Bacteria 1071
43 Ga0070669_100486257 3300005353 Unclassified 1022
44 Ga0070669_100907933 3300005353 Bacteria 752
45 Ga0070669_101035565 3300005353 Bacteria 705
46 Ga0070675_100017607 3300005354 Bacteria 5680
47 Ga0070675_100020787 3300005354 Bacteria 5238
48 Ga0070675_100028140 3300005354 Bacteria 4523
49 Ga0070675_100062663 3300005354 Bacteria 3073
50 Ga0070675_100075777 3300005354 Bacteria 2797
51 Ga0070675_100093497 3300005354 Bacteria 2522
52 Ga0070671_100415720 3300005355 Bacteria 1151
53 Ga0070671_100817409 3300005355 Unclassified 812
54 Ga0070671_101328009 3300005355 Bacteria 634
55 Ga0070674_100009689 3300005356 Bacteria 5781
56 Ga0070674_100030127 3300005356 Unclassified 3582
57 Ga0070674_100985407 3300005356 Bacteria 739
58 Ga0070674_100989815 3300005356 Bacteria 737
59 Ga0070673_100077234 3300005364 Bacteria 2691
60 Ga0070688_100131829 3300005365 Bacteria 1687
61 Ga0070688_100280072 3300005365 Bacteria 1198
62 Ga0070688_101259641 3300005365 Bacteria 596
63 Ga0070688_101356399 3300005365 Unclassified 575
64 Ga0070659_100082853 3300005366 Bacteria 2563
65 Ga0070659_100159995 3300005366 Unclassified 1841
66 Ga0070659_100274535 3300005366 Bacteria 1401
67 Ga0070667_100096164 3300005367 Bacteria 2554
68 Ga0070667_101267059 3300005367 Unclassified 690
69 Ga0070709_10097012 3300005434 Bacteria 1956
70 Ga0070714_100299151 3300005435 Bacteria 1499
71 Ga0070713_100154660 3300005436 Unclassified 2043
72 Ga0070713_100877452 3300005436 Unclassified 862
73 Ga0070710_10240591 3300005437 Unclassified 1159
74 Ga0070710_11006889 3300005437 Unclassified 607
75 Ga0070701_10299983 3300005438 Bacteria 987
76 Ga0070701_10891833 3300005438 Unclassified 613
77 Ga0070701_11378401 3300005438 Unclassified 506
78 Ga0070701_11418245 3300005438 Bacteria 500
79 Ga0070711_100358304 3300005439 Unclassified 1174
80 Ga0070711_101461839 3300005439 Unclassified 596
81 Ga0070705_100274708 3300005440 Unclassified 1195
82 Ga0070705_100280906 3300005440 Bacteria 1184
83 Ga0070705_100959543 3300005440 Unclassified 691
84 Ga0070705_101115681 3300005440 Bacteria 646
85 Ga0070705_101179536 3300005440 Unclassified 630
86 Ga0070700_100213869 3300005441 Bacteria 1362
87 Ga0070700_100257389 3300005441 Bacteria 1255
88 Ga0070700_100270573 3300005441 Bacteria 1227
89 Ga0070700_100285314 3300005441 Unclassified 1199
90 Ga0070700_101524377 3300005441 Bacteria 569
91 Ga0070694_100034806 3300005444 Bacteria 3324
92 Ga0070694_100036098 3300005444 Bacteria 3272
93 Ga0070694_100036664 3300005444 Bacteria 3249
94 Ga0070694_100211807 3300005444 Bacteria 1450
95 Ga0070694_100553172 3300005444 Unclassified 922
96 Ga0070694_100812640 3300005444 Bacteria 767
97 Ga0070708_100029767 3300005445 Unclassified 4713
98 Ga0070708_101304503 3300005445 Unclassified 678
99 Ga0070663_100128873 3300005455 Bacteria 1919
100 Ga0070663_100290385 3300005455 Bacteria 1306
101 Ga0070678_100099830 3300005456 Bacteria 2247
102 Ga0070678_100219687 3300005456 Bacteria 1579
103 Ga0070678_100669188 3300005456 Bacteria 933
104 Ga0070678_101150683 3300005456 Bacteria 718
105 Ga0070662_100078608 3300005457 Bacteria 2451
106 Ga0070662_100145329 3300005457 Bacteria 1842
107 Ga0070662_100449063 3300005457 Unclassified 1070
108 Ga0070662_100709823 3300005457 Bacteria 851
109 Ga0070662_100861229 3300005457 Unclassified 772
110 Ga0070681_10320291 3300005458 Bacteria 1460
111 Ga0068867_100011081 3300005459 Bacteria 6361
112 Ga0070685_10076816 3300005466 Bacteria 1993
113 Ga0070685_10413894 3300005466 Bacteria 936
114 Ga0070685_10949162 3300005466 Bacteria 643
115 Ga0070706_100309752 3300005467 Bacteria 1473
116 Ga0070706_101863134 3300005467 Unclassified 546
117 Ga0070707_100056414 3300005468 Bacteria 3768
118 Ga0070707_100935265 3300005468 Unclassified 832
119 Ga0070707_102127216 3300005468 Bacteria 529
120 Ga0070698_100137168 3300005471 Bacteria 2400
121 Ga0070698_100174464 3300005471 Bacteria 2090
122 Ga0070698_101130529 3300005471 Bacteria 732
123 Ga0070699_100100453 3300005518 Unclassified 2536
124 Ga0070699_100665292 3300005518 Bacteria 951
125 Ga0070699_101576939 3300005518 Bacteria 602
126 Ga0070679_100739007 3300005530 Unclassified 927
127 Ga0070684_100002298 3300005535 Bacteria 14096
128 Ga0070684_100268877 3300005535 Bacteria 1560
129 Ga0070697_100062453 3300005536 Unclassified 3040
130 Ga0070697_100247742 3300005536 Bacteria 1523
131 Ga0070697_100579534 3300005536 Bacteria 985
132 Ga0070697_101145554 3300005536 Unclassified 693
133 Ga0070697_101204196 3300005536 Unclassified 675
134 Ga0068853_100659507 3300005539 Bacteria 996
135 Ga0068853_101874068 3300005539 Unclassified 581
136 Ga0070672_100174263 3300005543 Bacteria 1790
137 Ga0070672_100210032 3300005543 Bacteria 1630
138 Ga0070672_101163154 3300005543 Bacteria 687
139 Ga0070686_100016883 3300005544 Bacteria 4253
140 Ga0070686_100031587 3300005544 Bacteria 3239
141 Ga0070686_100138011 3300005544 Bacteria 1694
142 Ga0070686_100222751 3300005544 Bacteria 1364
143 Ga0070686_100298223 3300005544 Bacteria 1194
144 Ga0070686_101559374 3300005544 Bacteria 558
145 Ga0070695_100101410 3300005545 Bacteria 1939
146 Ga0070695_100146899 3300005545 Unclassified 1641
147 Ga0070695_101204260 3300005545 Unclassified 623
148 Ga0070695_101842038 3300005545 Unclassified 508
149 Ga0070696_100029877 3300005546 Bacteria 3728
150 Ga0070696_100817312 3300005546 Bacteria 768
151 Ga0070696_100903540 3300005546 Bacteria 733
152 Ga0070693_100204447 3300005547 Bacteria 1285
153 Ga0070665_100018067 3300005548 Bacteria 7078
154 Ga0070665_100131218 3300005548 Bacteria 2508
155 Ga0070665_100133431 3300005548 Bacteria 2485
156 Ga0070704_100793222 3300005549 Bacteria 846
157 Ga0070704_100819772 3300005549 Unclassified 833
158 Ga0070704_101681079 3300005549 Bacteria 586
159 Ga0070704_101755565 3300005549 Bacteria 574
160 Ga0068855_100607570 3300005563 Bacteria 1179
161 Ga0070664_100049641 3300005564 Unclassified 3549
162 Ga0070664_100445261 3300005564 Bacteria 1189
163 Ga0070664_100570429 3300005564 Unclassified 1048
164 Ga0070664_100671548 3300005564 Bacteria 964
165 Ga0070664_100688869 3300005564 Unclassified 951
166 Ga0070664_101258196 3300005564 Unclassified 698
167 Ga0068857_100265942 3300005577 Bacteria 1575
168 Ga0068854_100033846 3300005578 Bacteria 3564
169 Ga0068854_100211755 3300005578 Bacteria 1529
170 Ga0068854_100840006 3300005578 Bacteria 803
171 Ga0068856_100482797 3300005614 Bacteria 1260
172 Ga0068856_100535095 3300005614 Unclassified 1193
173 Ga0068856_101352378 3300005614 Bacteria 727
174 Ga0070702_100016936 3300005615 Bacteria 3751
175 Ga0070702_101274858 3300005615 Unclassified 596
176 Ga0068852_100234103 3300005616 Bacteria 1752
177 Ga0068852_100246569 3300005616 Bacteria 1709
178 Ga0068852_100305368 3300005616 Bacteria 1541
179 Ga0068859_100022688 3300005617 Bacteria 6292
180 Ga0068859_100210350 3300005617 Bacteria 2031
181 Ga0068859_100284580 3300005617 Bacteria 1746
182 Ga0068859_100471049 3300005617 Bacteria 1351
183 Ga0068859_101009175 3300005617 Bacteria 914
184 Ga0068859_101379854 3300005617 Bacteria 777
185 Ga0068864_100000641 3300005618 Bacteria 29412
186 Ga0068866_10068431 3300005718 Bacteria 1867
187 Ga0068866_10113720 3300005718 Bacteria 1514
188 Ga0068861_100082049 3300005719 Bacteria 2526
189 Ga0068861_100175122 3300005719 Bacteria 1781
190 Ga0068861_100434125 3300005719 Bacteria 1173
191 Ga0068861_101628775 3300005719 Unclassified 637
192 Ga0068861_102394200 3300005719 Bacteria 531
193 Ga0068851_10427403 3300005834 Unclassified 783
194 Ga0068870_10009489 3300005840 Unclassified 4431
195 Ga0068870_10806403 3300005840 Bacteria 656
196 Ga0068863_100024322 3300005841 Bacteria 5777
197 Ga0068863_100353094 3300005841 Unclassified 1432
198 Ga0068863_100892533 3300005841 Unclassified 889
199 Ga0068858_100104581 3300005842 Bacteria 2642
200 Ga0068858_100184235 3300005842 Bacteria 1972
201 Ga0068860_100336350 3300005843 Bacteria 1484
202 Ga0068860_100617588 3300005843 Bacteria 1090
203 Ga0068860_100776421 3300005843 Unclassified 971
204 Ga0068860_100963177 3300005843 Bacteria 871
205 Ga0068862_100006975 3300005844 Bacteria 9373
206 Ga0068862_100111626 3300005844 Bacteria 2400
207 Ga0068862_100528881 3300005844 Unclassified 1123
208 Ga0068862_100679471 3300005844 Bacteria 996
209 Ga0068862_101405685 3300005844 Bacteria 701
210 Ga0068862_102790498 3300005844 Bacteria 500
211 Ga0081539_10017195 3300005985 Bacteria 5092
212 Ga0070717_10478654 3300006028 Bacteria 1124
213 Ga0070717_10666122 3300006028 Unclassified 945
214 Ga0075363_100671926 3300006048 Bacteria 624
215 Ga0075364_10010945 3300006051 Bacteria 5499
216 Ga0075364_10762651 3300006051 Unclassified 660
217 Ga0075432_10028689 3300006058 Unclassified 1920
218 Ga0075432_10082431 3300006058 Bacteria 1168
219 Ga0070716_100304373 3300006173 Bacteria 1110
220 Ga0070712_101798774 3300006175 Bacteria 536
221 Ga0075367_10011259 3300006178 Bacteria 4725
222 Ga0075367_10026470 3300006178 Bacteria 3290
223 Ga0075369_10341549 3300006186 Bacteria 702
224 Ga0075366_10032800 3300006195 Bacteria 3057
225 Ga0075366_10458870 3300006195 Unclassified 786
226 Ga0097621_100007728 3300006237 Bacteria 7709
227 Ga0097621_100134011 3300006237 Bacteria 2111
228 Ga0097621_100151406 3300006237 Unclassified 1989
229 Ga0097621_101385651 3300006237 Unclassified 665
230 Ga0097621_101811495 3300006237 Unclassified 582
231 Ga0068871_100008586 3300006358 Bacteria 7344
232 Ga0068871_100060666 3300006358 Unclassified 3086
233 Ga0068871_100093989 3300006358 Bacteria 2502
234 Ga0068871_100956009 3300006358 Bacteria 796
235 Ga0068871_101013431 3300006358 Bacteria 774
236 Ga0075428_100045169 3300006844 Bacteria 4841
237 Ga0075428_100048357 3300006844 Bacteria 4668
238 Ga0075428_100279447 3300006844 Bacteria 1796
239 Ga0075428_100554929 3300006844 Unclassified 1228
240 Ga0075428_100740205 3300006844 Bacteria 1046
241 Ga0075428_101566296 3300006844 Unclassified 689
242 Ga0075430_100045637 3300006846 Bacteria 3701
243 Ga0075430_100208211 3300006846 Bacteria 1623
244 Ga0075430_100390122 3300006846 Bacteria 1149
245 Ga0075430_100416769 3300006846 Unclassified 1108
246 Ga0075430_100496556 3300006846 Bacteria 1007
247 Ga0075430_101068542 3300006846 Bacteria 665
248 Ga0075431_100012147 3300006847 Bacteria 8686
249 Ga0075431_100025464 3300006847 Bacteria 6064
250 Ga0075431_100049993 3300006847 Bacteria 4311
251 Ga0075431_100424537 3300006847 Unclassified 1328
252 Ga0075431_100588426 3300006847 Unclassified 1097
253 Ga0075431_100613628 3300006847 Bacteria 1071
254 Ga0075431_100629962 3300006847 Bacteria 1054
255 Ga0075431_100942138 3300006847 Bacteria 832
256 Ga0075431_101201876 3300006847 Unclassified 721
257 Ga0075431_101686009 3300006847 Bacteria 591
258 Ga0075433_10000320 3300006852 Bacteria 29341
259 Ga0075433_10005124 3300006852 Bacteria 10281
260 Ga0075433_10227184 3300006852 Unclassified 1658
261 Ga0075433_10523564 3300006852 Bacteria 1043
262 Ga0075433_10695133 3300006852 Bacteria 891
263 Ga0075433_11016909 3300006852 Bacteria 722
264 Ga0075434_100005903 3300006871 Bacteria 11195
265 Ga0075434_100008568 3300006871 Bacteria 9513
266 Ga0075434_100199148 3300006871 Bacteria 2022
267 Ga0075434_100418583 3300006871 Bacteria 1361
268 Ga0075434_100679068 3300006871 Bacteria 1048
269 Ga0075429_100241344 3300006880 Bacteria 1583
270 Ga0075429_100615611 3300006880 Bacteria 951
271 Ga0075429_100957009 3300006880 Unclassified 749
272 Ga0075429_101189098 3300006880 Unclassified 665
273 Ga0075429_101218151 3300006880 Bacteria 657
274 Ga0075429_101481121 3300006880 Unclassified 591
275 Ga0075429_101577362 3300006880 Unclassified 571
276 Ga0075429_101979143 3300006880 Unclassified 504
277 Ga0068865_100008984 3300006881 Bacteria 6183
278 Ga0068865_100173615 3300006881 Bacteria 1654
279 Ga0068865_100555647 3300006881 Unclassified 965
280 Ga0068865_100583519 3300006881 Unclassified 943
281 Ga0068865_100927536 3300006881 Unclassified 759
282 Ga0068865_100981585 3300006881 Bacteria 739
283 Ga0068865_101810100 3300006881 Bacteria 552
284 Ga0075436_100004542 3300006914 Bacteria 9511
285 Ga0075436_100022202 3300006914 Bacteria 4359
286 Ga0075436_100457884 3300006914 Bacteria 929
287 Ga0097620_100022688 3300006931 Bacteria 6292
288 Ga0097620_100210358 3300006931 Bacteria 2031
289 Ga0097620_100284581 3300006931 Bacteria 1746
290 Ga0097620_100471033 3300006931 Bacteria 1351
291 Ga0097620_101009280 3300006931 Bacteria 914
292 Ga0097620_101379214 3300006931 Bacteria 777
293 Ga0075435_100000032 3300007076 Bacteria 71881
294 Ga0075435_100095208 3300007076 Bacteria 2462
295 Ga0075435_100180396 3300007076 Bacteria 1784
296 Ga0075435_100342199 3300007076 Bacteria 1281
297 Ga0075435_100552570 3300007076 Unclassified 997
298 Ga0075435_100925528 3300007076 Unclassified 760
299 Ga0075435_101983240 3300007076 Bacteria 511
300 Ga0105240_10053284 3300009093 Bacteria 5079
301 Ga0105240_10170322 3300009093 Unclassified 2580
302 Ga0105240_10346853 3300009093 Unclassified 1685
303 Ga0105240_11552967 3300009093 Unclassified 693
304 Ga0105240_12289214 3300009093 Unclassified 560
305 Ga0111539_10000226 3300009094 Bacteria 67584
306 Ga0111539_10009944 3300009094 Bacteria 11996
307 Ga0111539_10015310 3300009094 Bacteria 9551
308 Ga0111539_10019831 3300009094 Bacteria 8286
309 Ga0111539_10071845 3300009094 Bacteria 4082
310 Ga0111539_10074935 3300009094 Bacteria 3988
311 Ga0111539_10151143 3300009094 Bacteria 2718
312 Ga0111539_10317165 3300009094 Bacteria 1814
313 Ga0111539_10439866 3300009094 Bacteria 1518
314 Ga0111539_10734655 3300009094 Bacteria 1149
315 Ga0111539_10907500 3300009094 Bacteria 1025
316 Ga0111539_10940977 3300009094 Unclassified 1005
317 Ga0111539_12209823 3300009094 Unclassified 638
318 Ga0105245_10081291 3300009098 Bacteria 2962
319 Ga0105245_10254646 3300009098 Bacteria 1707
320 Ga0105245_10809472 3300009098 Bacteria 975
321 Ga0105245_12821683 3300009098 Unclassified 538
322 Ga0114129_10005510 3300009147 Bacteria 17899
323 Ga0114129_10005675 3300009147 Bacteria 17666
324 Ga0114129_10048745 3300009147 Bacteria 5953
325 Ga0114129_10127103 3300009147 Bacteria 3504
326 Ga0114129_10203108 3300009147 Bacteria 2683
327 Ga0114129_10212550 3300009147 Bacteria 2614
328 Ga0114129_10278143 3300009147 Bacteria 2237
329 Ga0114129_10317025 3300009147 Unclassified 2074
330 Ga0114129_10456711 3300009147 Unclassified 1674
331 Ga0114129_10824686 3300009147 Bacteria 1181
332 Ga0114129_11316450 3300009147 Bacteria 895
333 Ga0114129_11753508 3300009147 Unclassified 756
334 Ga0114129_12230170 3300009147 Bacteria 658
335 Ga0114129_12675450 3300009147 Unclassified 595
336 Ga0105243_10022423 3300009148 Bacteria 4799
337 Ga0105243_10084411 3300009148 Bacteria 2601
338 Ga0105243_10409001 3300009148 Bacteria 1262
339 Ga0105243_10573188 3300009148 Unclassified 1082
340 Ga0105243_11082026 3300009148 Bacteria 809
341 Ga0105243_11083069 3300009148 Bacteria 809
342 Ga0105243_11636919 3300009148 Unclassified 671
343 Ga0105241_11173679 3300009174 Bacteria 726
344 Ga0105241_12419954 3300009174 Unclassified 524
345 Ga0105242_10001323 3300009176 Bacteria 19546
346 Ga0105242_10004655 3300009176 Bacteria 10631
347 Ga0105242_10160409 3300009176 Bacteria 1968
348 Ga0105248_10018439 3300009177 Bacteria 7712
349 Ga0105248_10073012 3300009177 Bacteria 3856
350 Ga0105248_10121676 3300009177 Unclassified 2944
351 Ga0105248_10147185 3300009177 Unclassified 2658
352 Ga0105248_10256013 3300009177 Bacteria 1970
353 Ga0105248_10406547 3300009177 Unclassified 1533
354 Ga0105248_10407182 3300009177 Bacteria 1531
355 Ga0105248_10540063 3300009177 Unclassified 1315
356 Ga0105248_10619457 3300009177 Bacteria 1221
357 Ga0105248_12148038 3300009177 Unclassified 635
358 Ga0105237_11615735 3300009545 Bacteria 655
359 Ga0105238_11687976 3300009551 Bacteria 664
360 Ga0105238_11718078 3300009551 Bacteria 659
361 Ga0105238_12405043 3300009551 Bacteria 562
362 Ga0105238_12429252 3300009551 Unclassified 560
363 Ga0105249_10041779 3300009553 Bacteria 4169
364 Ga0105249_10066443 3300009553 Bacteria 3320
365 Ga0105249_10706293 3300009553 Unclassified 1069
366 Ga0105249_10872512 3300009553 Bacteria 966
367 Ga0105249_11244039 3300009553 Bacteria 816
368 Ga0105249_13355537 3300009553 Unclassified 515
369 Ga0105239_12332006 3300010375 Bacteria 623
370 Ga0105239_12681753 3300010375 Unclassified 581
371 Ga0105246_12434501 3300011119 Bacteria 514
372 Ga0157370_10459627 3300013104 Unclassified 1170
373 Ga0157369_10892191 3300013105 Bacteria 912
374 Ga0157378_11006564 3300013297 Bacteria 868
375 Ga0157378_11200760 3300013297 Bacteria 798
376 Ga0157378_12745050 3300013297 Bacteria 545
377 Ga0163162_10245099 3300013306 Bacteria 1924
378 Ga0163162_10618538 3300013306 Unclassified 1208
379 Ga0163162_11861668 3300013306 Unclassified 688
380 Ga0163162_12556573 3300013306 Unclassified 587
381 Ga0157372_10035018 3300013307 Bacteria 5524
382 Ga0157372_10496146 3300013307 Bacteria 1424
383 Ga0157372_11023723 3300013307 Bacteria 956
384 Ga0157375_10117576 3300013308 Bacteria 2764
385 Ga0157375_10580331 3300013308 Unclassified 1281
386 Ga0157375_10893926 3300013308 Bacteria 1032
387 Ga0157375_11694521 3300013308 Bacteria 748
388 Ga0163163_10025809 3300014325 Bacteria 5604
389 Ga0163163_10093607 3300014325 Bacteria 3022
390 Ga0163163_10188513 3300014325 Bacteria 2111
391 Ga0163163_10472271 3300014325 Bacteria 1315
392 Ga0157380_10004342 3300014326 Bacteria 9829
393 Ga0157380_10056030 3300014326 Bacteria 3133
394 Ga0157380_10102069 3300014326 Bacteria 2391
395 Ga0157380_10311616 3300014326 Bacteria 1455
396 Ga0157380_10431320 3300014326 Unclassified 1260
397 Ga0157380_11599131 3300014326 Bacteria 707
398 Ga0157380_12562397 3300014326 Unclassified 576
399 Ga0157380_13077036 3300014326 Unclassified 532
400 Ga0157379_10077462 3300014968 Bacteria 2977
401 Ga0157376_10472957 3300014969 Bacteria 1227
402 Ga0157376_10605265 3300014969 Bacteria 1091
403 Ga0157376_12143135 3300014969 Unclassified 597
404 Ga0206356_10091165 3300020070 Bacteria 1533
405 Ga0206356_11626627 3300020070 Bacteria 623
406 Ga0207666_1047181 3300025271 Bacteria 679
407 Ga0207697_10176113 3300025315 Unclassified 937
408 Ga0207697_10179486 3300025315 Bacteria 928
409 Ga0207682_10075523 3300025893 Unclassified 1435
410 Ga0207682_10171267 3300025893 Bacteria 988
411 Ga0207682_10219218 3300025893 Bacteria 880
412 Ga0207682_10221697 3300025893 Bacteria 875
413 Ga0207642_10074419 3300025899 Bacteria 1628
414 Ga0207642_10151100 3300025899 Unclassified 1236
415 Ga0207688_10030405 3300025901 Unclassified 2978
416 Ga0207688_10446385 3300025901 Bacteria 806
417 Ga0207688_10451550 3300025901 Unclassified 801
418 Ga0207688_10674820 3300025901 Bacteria 653
419 Ga0207680_10024053 3300025903 Bacteria 3337
420 Ga0207680_10219725 3300025903 Bacteria 1302
421 Ga0207680_11142967 3300025903 Unclassified 556
422 Ga0207680_11206771 3300025903 Bacteria 539
423 Ga0207647_10793508 3300025904 Unclassified 510
424 Ga0207699_10015529 3300025906 Bacteria 3957
425 Ga0207645_10005161 3300025907 Bacteria 9544
426 Ga0207645_10066978 3300025907 Bacteria 2295
427 Ga0207645_10269295 3300025907 Bacteria 1129
428 Ga0207643_10100982 3300025908 Bacteria 1692
429 Ga0207643_10157681 3300025908 Bacteria 1364
430 Ga0207643_10685712 3300025908 Bacteria 662
431 Ga0207684_10109823 3300025910 Unclassified 2361
432 Ga0207684_10476057 3300025910 Bacteria 1071
433 Ga0207684_11483753 3300025910 Unclassified 552
434 Ga0207654_11404425 3300025911 Unclassified 509
435 Ga0207707_10242732 3300025912 Bacteria 1566
436 Ga0207707_10441336 3300025912 Bacteria 1114
437 Ga0207707_10768426 3300025912 Bacteria 805
438 Ga0207707_10926597 3300025912 Unclassified 719
439 Ga0207695_10225058 3300025913 Bacteria 1782
440 Ga0207695_10319497 3300025913 Bacteria 1442
441 Ga0207695_10537120 3300025913 Bacteria 1051
442 Ga0207695_10767012 3300025913 Unclassified 845
443 Ga0207671_10974030 3300025914 Bacteria 669
444 Ga0207663_10088231 3300025916 Bacteria 2051
445 Ga0207663_10466096 3300025916 Unclassified 976
446 Ga0207663_10963621 3300025916 Unclassified 684
447 Ga0207660_10168963 3300025917 Bacteria 1692
448 Ga0207660_10647513 3300025917 Unclassified 861
449 Ga0207662_10047116 3300025918 Bacteria 2553
450 Ga0207662_10983177 3300025918 Bacteria 599
451 Ga0207649_10278321 3300025920 Bacteria 1216
452 Ga0207649_10463466 3300025920 Bacteria 958
453 Ga0207646_10165094 3300025922 Bacteria 1999
454 Ga0207681_10006259 3300025923 Bacteria 7303
455 Ga0207681_10018130 3300025923 Bacteria 4432
456 Ga0207681_10155251 3300025923 Bacteria 1719
457 Ga0207681_10634329 3300025923 Unclassified 885
458 Ga0207681_10716828 3300025923 Bacteria 832
459 Ga0207694_10312658 3300025924 Bacteria 1295
460 Ga0207694_10451224 3300025924 Bacteria 1073
461 Ga0207694_11360268 3300025924 Bacteria 600
462 Ga0207650_10544684 3300025925 Bacteria 972
463 Ga0207650_11756226 3300025925 Bacteria 525
464 Ga0207659_10000571 3300025926 Bacteria 22147
465 Ga0207659_10023847 3300025926 Bacteria 4091
466 Ga0207659_10068584 3300025926 Bacteria 2580
467 Ga0207659_10099273 3300025926 Unclassified 2191
468 Ga0207659_10780692 3300025926 Bacteria 820
469 Ga0207687_10251781 3300025927 Bacteria 1404
470 Ga0207687_10259733 3300025927 Bacteria 1384
471 Ga0207687_10546021 3300025927 Bacteria 972
472 Ga0207687_10679115 3300025927 Bacteria 873
473 Ga0207687_11034766 3300025927 Unclassified 704
474 Ga0207687_11041679 3300025927 Bacteria 702
475 Ga0207700_10029284 3300025928 Unclassified 3883
476 Ga0207700_10131680 3300025928 Unclassified 2043
477 Ga0207664_10409140 3300025929 Bacteria 1207
478 Ga0207644_10004322 3300025931 Bacteria 9213
479 Ga0207644_10090437 3300025931 Bacteria 2281
480 Ga0207644_11179677 3300025931 Unclassified 644
481 Ga0207690_10053628 3300025932 Bacteria 2706
482 Ga0207690_10144230 3300025932 Unclassified 1758
483 Ga0207690_10241502 3300025932 Bacteria 1391
484 Ga0207690_10992909 3300025932 Bacteria 698
485 Ga0207690_11090003 3300025932 Bacteria 665
486 Ga0207706_10079637 3300025933 Bacteria 2881
487 Ga0207706_10178607 3300025933 Bacteria 1864
488 Ga0207706_10423891 3300025933 Bacteria 1153
489 Ga0207706_10469144 3300025933 Unclassified 1088
490 Ga0207706_11052479 3300025933 Unclassified 682
491 Ga0207686_10076451 3300025934 Unclassified 2171
492 Ga0207686_10086458 3300025934 Bacteria 2059
493 Ga0207709_10019378 3300025935 Bacteria 3824
494 Ga0207709_10666865 3300025935 Bacteria 829
495 Ga0207709_11133111 3300025935 Unclassified 643
496 Ga0207670_10187135 3300025936 Bacteria 1564
497 Ga0207670_10468214 3300025936 Bacteria 1018
498 Ga0207670_10827867 3300025936 Bacteria 772
499 Ga0207670_10918483 3300025936 Bacteria 734
500 Ga0207669_10001659 3300025937 Bacteria 9471
501 Ga0207669_10001727 3300025937 Bacteria 9273
502 Ga0207669_10394536 3300025937 Unclassified 1082
503 Ga0207669_10401315 3300025937 Bacteria 1074
504 Ga0207669_10555010 3300025937 Unclassified 927
505 Ga0207669_10581211 3300025937 Bacteria 908
506 Ga0207669_10788771 3300025937 Unclassified 787
507 Ga0207669_11177201 3300025937 Unclassified 649
508 Ga0207704_10020213 3300025938 Bacteria 3517
509 Ga0207704_10047086 3300025938 Bacteria 2575
510 Ga0207704_10054843 3300025938 Bacteria 2432
511 Ga0207704_10251353 3300025938 Bacteria 1327
512 Ga0207704_10336988 3300025938 Unclassified 1169
513 Ga0207704_10849880 3300025938 Unclassified 765
514 Ga0207665_10346682 3300025939 Bacteria 1120
515 Ga0207691_10198963 3300025940 Bacteria 1745
516 Ga0207691_10493683 3300025940 Bacteria 1040
517 Ga0207691_11017862 3300025940 Unclassified 691
518 Ga0207711_10035572 3300025941 Bacteria 4222
519 Ga0207711_10144930 3300025941 Bacteria 2139
520 Ga0207711_10153554 3300025941 Bacteria 2079
521 Ga0207711_10165253 3300025941 Bacteria 2005
522 Ga0207711_10273109 3300025941 Bacteria 1555
523 Ga0207711_10929689 3300025941 Unclassified 808
524 Ga0207711_11199767 3300025941 Unclassified 700
525 Ga0207689_10451628 3300025942 Unclassified 1074
526 Ga0207689_10738089 3300025942 Bacteria 831
527 Ga0207661_11889377 3300025944 Unclassified 543
528 Ga0207679_10614032 3300025945 Unclassified 981
529 Ga0207679_10672944 3300025945 Bacteria 937
530 Ga0207679_10680212 3300025945 Bacteria 933
531 Ga0207679_10714737 3300025945 Bacteria 910
532 Ga0207679_11147611 3300025945 Bacteria 713
533 Ga0207667_10864098 3300025949 Bacteria 898
534 Ga0207651_10108800 3300025960 Bacteria 2075
535 Ga0207651_10559962 3300025960 Bacteria 995
536 Ga0207712_10033160 3300025961 Bacteria 3490
537 Ga0207712_10152272 3300025961 Bacteria 1788
538 Ga0207712_10387076 3300025961 Bacteria 1172
539 Ga0207712_10638553 3300025961 Bacteria 924
540 Ga0207712_11296588 3300025961 Unclassified 651
541 Ga0207668_10047975 3300025972 Bacteria 2928
542 Ga0207668_10550694 3300025972 Bacteria 999
543 Ga0207668_10620136 3300025972 Unclassified 944
544 Ga0207668_12117088 3300025972 Bacteria 506
545 Ga0207640_10076817 3300025981 Bacteria 2268
546 Ga0207640_10161653 3300025981 Bacteria 1658
547 Ga0207640_10923026 3300025981 Bacteria 764
548 Ga0207677_10558196 3300026023 Bacteria 999
549 Ga0207677_10985275 3300026023 Bacteria 764
550 Ga0207703_10156859 3300026035 Bacteria 1990
551 Ga0207703_10484132 3300026035 Bacteria 1160
552 Ga0207703_10891898 3300026035 Unclassified 851
553 Ga0207703_11486767 3300026035 Unclassified 652
554 Ga0207639_11506397 3300026041 Bacteria 631
555 Ga0207678_10018458 3300026067 Bacteria 6125
556 Ga0207678_10329521 3300026067 Bacteria 1314
557 Ga0207708_10007607 3300026075 Bacteria 8020
558 Ga0207708_10030504 3300026075 Bacteria 4088
559 Ga0207708_10068496 3300026075 Bacteria 2716
560 Ga0207708_10184389 3300026075 Bacteria 1658
561 Ga0207708_10235679 3300026075 Bacteria 1471
562 Ga0207708_10389163 3300026075 Bacteria 1151
563 Ga0207702_10240370 3300026078 Bacteria 1696
564 Ga0207702_10517194 3300026078 Unclassified 1165
565 Ga0207641_10014093 3300026088 Bacteria 6553
566 Ga0207641_10192055 3300026088 Bacteria 1877
567 Ga0207641_11211684 3300026088 Bacteria 755
568 Ga0207641_11764494 3300026088 Unclassified 621
569 Ga0207648_10028810 3300026089 Bacteria 4922
570 Ga0207648_10057098 3300026089 Bacteria 3406
571 Ga0207648_10064152 3300026089 Bacteria 3201
572 Ga0207648_10134817 3300026089 Bacteria 2175
573 Ga0207648_11245213 3300026089 Bacteria 699
574 Ga0207676_10038722 3300026095 Bacteria 3641
575 Ga0207676_10158165 3300026095 Bacteria 1960
576 Ga0207674_10218526 3300026116 Unclassified 1854
577 Ga0207674_10318389 3300026116 Bacteria 1505
578 Ga0207675_100008805 3300026118 Bacteria 9472
579 Ga0207675_100010481 3300026118 Bacteria 8682
580 Ga0207675_100114454 3300026118 Bacteria 2548
581 Ga0207675_100270584 3300026118 Bacteria 1649
582 Ga0207675_100636816 3300026118 Bacteria 1071
583 Ga0207675_101427796 3300026118 Unclassified 713
584 Ga0207675_102635654 3300026118 Unclassified 512
585 Ga0207683_10018601 3300026121 Bacteria 5929
586 Ga0207683_10080000 3300026121 Bacteria 2898
587 Ga0207683_10256433 3300026121 Bacteria 1596
588 Ga0207683_10315302 3300026121 Bacteria 1432
589 Ga0207698_10148305 3300026142 Bacteria 2032
590 Ga0207698_10214584 3300026142 Bacteria 1734
591 Ga0209971_1155997 3300027682 Unclassified 563
592 Ga0209813_10151847 3300027866 Unclassified 830
593 Ga0209974_10019518 3300027876 Bacteria 2247
594 Ga0207428_10000240 3300027907 Bacteria 75186
595 Ga0207428_10000555 3300027907 Bacteria 44135
596 Ga0207428_10036331 3300027907 Bacteria 4019
597 Ga0207428_10672432 3300027907 Unclassified 742
598 Ga0268266_10029469 3300028379 Bacteria 4665
599 Ga0268266_10103901 3300028379 Bacteria 2508
600 Ga0268266_10147843 3300028379 Unclassified 2114
601 Ga0268266_10592906 3300028379 Bacteria 1064
602 Ga0268265_10319206 3300028380 Bacteria 1406
603 Ga0268265_10346449 3300028380 Bacteria 1355
604 Ga0268265_10573834 3300028380 Bacteria 1074
605 Ga0268265_10608727 3300028380 Bacteria 1045
606 Ga0268265_10914890 3300028380 Bacteria 862
607 Ga0268265_11624099 3300028380 Unclassified 652
608 Ga0268265_11748210 3300028380 Unclassified 628
609 Ga0268264_10219149 3300028381 Bacteria 1751
610 Ga0268264_10503664 3300028381 Bacteria 1181
611 Ga0268264_11322919 3300028381 Unclassified 731
612 Ga0268264_11351260 3300028381 Unclassified 723
613 Ga0268264_12370867 3300028381 Unclassified 537
614 Ga0268264_12460531 3300028381 Unclassified 526
615 Ga0307509_10780027 3300031507 Bacteria 621
616 Ga0307413_11642020 3300031824 Bacteria 572
617 Ga0307410_10658241 3300031852 Bacteria 879
618 Ga0307412_10825449 3300031911 Unclassified 807
619 Ga0307409_100399954 3300031995 Bacteria 1312
620 Ga0307409_101100208 3300031995 Bacteria 816
621 Ga0307416_100382365 3300032002 Bacteria 1438
622 Ga0307414_10206267 3300032004 Bacteria 1603
623 Ga0307411_11808587 3300032005 Bacteria 567
624 Ga0373923_0043140 3300035111 Unclassified 1866
625 Ga0373956_0461990 3300035119 Unclassified 606
626 Ga0373957_0530389 3300035120 Unclassified 514
627 Ga0373943_0127135 3300035170 Unclassified 1360
628 Ga0373955_0122823 3300035172 Unclassified 1511
629 Ga0373924_0008654 3300035410 Unclassified 3708
630 Ga0373931_0298283 3300035691 Bacteria 994
631 Ga0373931_1046455 3300035691 Unclassified 554
632 Ga0373935_0023626 3300035692 Unclassified 3779
633 Ga0373927_0325502 3300035695 Bacteria 1012
634 Ga0373937_0683876 3300036401 Unclassified 972
635 Ga0373925_0189057 3300037068 Unclassified 1633
636 Ga0373925_0245503 3300037068 Bacteria 1435
637 Ga0439453_0004701 3300041408 Bacteria 2044
638 Ga0439461_0117239 3300041410 Bacteria 662
639 Ga0451791_0907960 3300041451 Bacteria 759
640 Ga0451807_1464146 3300041486 Bacteria 1198
641 Ga0451845_0069342 3300041501 Unclassified 508
642 Ga0451845_0640654 3300041501 Bacteria 529
643 Ga0439443_092459 3300042003 Bacteria 572
644 Ga0439445_0127393 3300042004 Unclassified 733
645 Ga0439451_064306 3300042009 Unclassified 734
646 Ga0450920_045657 3300042122 Bacteria 875
647 Ga0450923_032395 3300042125 Bacteria 1071
648 Ga0439434_0112112 3300042435 Bacteria 884
649 Ga0439435_0020258 3300042436 Bacteria 1714
650 Ga0439444_0182154 3300042437 Unclassified 522
651 Ga0439459_0115204 3300042438 Bacteria 672
652 Ga0439464_0036978 3300042439 Bacteria 1383
653 Ga0439460_0048922 3300042461 Bacteria 1263
654 Ga0439460_0378506 3300042461 Unclassified 501
655 Ga0450916_035354 3300042530 Bacteria 742
656 Ga0439440_0185398 3300042993 Unclassified 611
657 Ga0466963_0765082 3300044694 Unclassified 681
658 Ga0466963_0811672 3300044694 Unclassified 660
659 Ga0466963_0919847 3300044694 Bacteria 616
660 Ga0466959_0805251 3300045049 Unclassified 628
661 Ga0451576_0702224 3300045051 Unclassified 1063
662 Ga0451576_1328890 3300045051 Bacteria 749
663 Ga0451576_2091149 3300045051 Unclassified 582
664 Ga0466958_0659023 3300045836 Unclassified 681
665 Ga0466958_0829459 3300045836 Unclassified 603
666 Ga0466967_0343188 3300045976 Unclassified 1444
667 Ga0466967_2501248 3300045976 Unclassified 511
668 Ga0495638_0243211 3300046460 Bacteria 995
669 Ga0495580_0042962 3300046472 Bacteria 3217
670 Ga0495580_0302118 3300046472 Bacteria 1090
671 Ga0495582_0079544 3300046473 Bacteria 1820
672 Ga0495582_0573196 3300046473 Bacteria 653
673 Ga0495582_0777369 3300046473 Unclassified 554
674 Ga0495662_0145084 3300046476 Bacteria 1169
675 Ga0495594_0487286 3300046499 Bacteria 700
676 Ga0495628_0836126 3300046516 Unclassified 642
677 Ga0495637_0253075 3300046520 Unclassified 634
678 Ga0495643_0002970 3300046522 Bacteria 12841
679 Ga0495666_0233828 3300046526 Bacteria 840
680 Ga0495665_0179408 3300046531 Unclassified 1101
681 Ga0495665_0232493 3300046531 Bacteria 951
682 Ga0495656_0456649 3300046615 Unclassified 673
683 Ga0495659_0437126 3300046664 Bacteria 568
684 Ga0495647_0200076 3300046681 Unclassified 876
685 Ga0495658_0334588 3300046683 Unclassified 961
686 Ga0495613_0115345 3300046689 Unclassified 1933
687 Ga0495613_0344703 3300046689 Bacteria 1024
688 Ga0495624_0318167 3300046690 Unclassified 937
689 Ga0495636_0657462 3300047318 Unclassified 515
690 Ga0495674_0516352 3300047319 Unclassified 954
691 Ga0495672_0215229 3300047320 Unclassified 952
692 Ga0495684_0715053 3300047471 Unclassified 663
693 Ga0495602_0328160 3300048088 Bacteria 1111
694 Ga0496100_0668554 3300048903 Bacteria 809
695 Ga0496102_0731353 3300048905 Bacteria 912
696 Ga0496102_1221712 3300048905 Unclassified 671
697 Ga0496104_0004618 3300048907 Bacteria 12003
698 Ga0496105_0291216 3300048908 Bacteria 1314
699 Ga0496106_0177744 3300048909 Bacteria 1689
700 Ga0496106_0434847 3300048909 Bacteria 1054
701 Ga0496107_0514675 3300048910 Bacteria 887
702 Ga0496109_0000620 3300048912 Bacteria 29596
703 Ga0496109_0150441 3300048912 Unclassified 2179
704 Ga0496109_0970059 3300048912 Bacteria 788
705 Ga0496110_0000742 3300048913 Bacteria 22522
706 Ga0496111_0508674 3300048914 Bacteria 886
707 Ga0496112_0003666 3300048915 Bacteria 12797
708 Ga0496113_0025160 3300048916 Bacteria 4240
709 Ga0496113_0190413 3300048916 Unclassified 1628
710 Ga0496113_0933872 3300048916 Unclassified 685
711 Ga0496114_0098732 3300048917 Bacteria 2490
712 Ga0496114_0376490 3300048917 Bacteria 1257
713 Ga0496115_0096310 3300048918 Bacteria 2423
714 Ga0501031_0050866 3300049568 Bacteria 2699
715 Ga0501031_0082003 3300049568 Bacteria 2103
716 Ga0501031_0163397 3300049568 Bacteria 1455
717 Ga0501031_0170620 3300049568 Unclassified 1422
718 Ga0501032_0332103 3300049569 Unclassified 980
719 Ga0501033_0497084 3300049570 Bacteria 844
720 Ga0501033_0756451 3300049570 Unclassified 659
721 Ga0501036_0045192 3300049572 Unclassified 3732
722 Ga0501036_0111651 3300049572 Bacteria 2310
723 Ga0501036_0140019 3300049572 Bacteria 2042
724 Ga0501036_0165839 3300049572 Bacteria 1862
725 Ga0501037_0351062 3300049573 Unclassified 1018
726 Ga0501038_0190961 3300049574 Unclassified 1648
727 Ga0501038_1069066 3300049574 Unclassified 590
728 Ga0501038_1241321 3300049574 Bacteria 540
729 Ga0501039_0013089 3300049575 Bacteria 6343
730 Ga0501039_0019158 3300049575 Bacteria 5251
731 Ga0501039_0037159 3300049575 Bacteria 3759
732 Ga0501039_0102820 3300049575 Bacteria 2230
733 Ga0501039_1130473 3300049575 Bacteria 607
734 Ga0501040_0010409 3300049576 Bacteria 6081
735 Ga0501040_0227660 3300049576 Bacteria 1327
736 Ga0501040_0271936 3300049576 Bacteria 1210
737 Ga0501040_0523091 3300049576 Bacteria 855
738 Ga0501040_0849550 3300049576 Bacteria 661
739 Ga0501040_1145762 3300049576 Bacteria 564
740 Ga0501041_0015859 3300049577 Bacteria 4478
741 Ga0501041_0165250 3300049577 Unclassified 1384
742 Ga0501041_0193537 3300049577 Bacteria 1274
743 Ga0501041_0208552 3300049577 Bacteria 1225
744 Ga0501041_0232660 3300049577 Unclassified 1157
745 Ga0501041_0275392 3300049577 Bacteria 1059
746 Ga0501042_0024812 3300049578 Bacteria 4208
747 Ga0501042_0030683 3300049578 Bacteria 3799
748 Ga0501042_0030800 3300049578 Bacteria 3793
749 Ga0501042_0119555 3300049578 Unclassified 1897
750 Ga0501042_0152378 3300049578 Bacteria 1667
751 Ga0501042_0322040 3300049578 Bacteria 1117
752 Ga0501042_0359751 3300049578 Bacteria 1053
753 Ga0501042_0772879 3300049578 Unclassified 699
754 Ga0501042_1101121 3300049578 Bacteria 579
755 Ga0501043_0279508 3300049579 Unclassified 1280
756 Ga0501043_0657263 3300049579 Unclassified 769
757 Ga0501046_0155514 3300049580 Bacteria 1723
758 Ga0501048_0007931 3300049582 Bacteria 8043
759 Ga0501048_0083154 3300049582 Bacteria 2257
760 Ga0501048_0886510 3300049582 Bacteria 641
761 Ga0501048_0932634 3300049582 Unclassified 624
762 Ga0501067_0130968 3300049583 Unclassified 1396
763 Ga0501068_1115982 3300049584 Unclassified 522
764 Ga0501070_0931748 3300049586 Unclassified 676
765 Ga0501070_1229646 3300049586 Unclassified 574
766 Ga0501071_0126113 3300049587 Bacteria 1900
767 Ga0501071_0437569 3300049587 Bacteria 1000
768 Ga0501071_0638192 3300049587 Bacteria 819
769 Ga0501071_0763609 3300049587 Bacteria 745
770 Ga0501072_0008891 3300049588 Bacteria 7633
771 Ga0501072_0020985 3300049588 Bacteria 5064
772 Ga0501072_0198458 3300049588 Unclassified 1600
773 Ga0501072_0199154 3300049588 Unclassified 1597
774 Ga0501072_0505212 3300049588 Unclassified 956
775 Ga0501072_0505215 3300049588 Bacteria 956
776 Ga0501072_0916493 3300049588 Unclassified 684
777 Ga0501073_0198965 3300049589 Bacteria 1386
778 Ga0501073_0508327 3300049589 Bacteria 833
779 Ga0501074_0109352 3300049590 Unclassified 1978
780 Ga0501075_0014875 3300049591 Bacteria 5581
781 Ga0501075_0104289 3300049591 Unclassified 2155
782 Ga0501075_0113684 3300049591 Unclassified 2058
783 Ga0501075_0179746 3300049591 Unclassified 1614
784 Ga0501075_0793912 3300049591 Unclassified 720
785 Ga0501075_1406006 3300049591 Unclassified 528
786 Ga0501076_0009320 3300049592 Bacteria 7244
787 Ga0501076_0009692 3300049592 Bacteria 7115
788 Ga0501076_0013963 3300049592 Bacteria 6033
789 Ga0501076_0044376 3300049592 Bacteria 3506
790 Ga0501076_0095447 3300049592 Bacteria 2395
791 Ga0501076_0096551 3300049592 Bacteria 2381
792 Ga0501076_0550669 3300049592 Bacteria 951
793 Ga0501076_0663266 3300049592 Unclassified 861
794 Ga0501076_1034553 3300049592 Bacteria 676
795 Ga0501077_0055061 3300049593 Bacteria 2526
796 Ga0501077_0277874 3300049593 Unclassified 1066
797 Ga0501077_0327358 3300049593 Bacteria 977
798 Ga0501077_0338618 3300049593 Bacteria 959
799 Ga0501253_144867 3300049683 Bacteria 595
800 Ga0501079_0021297 3300049741 Unclassified 4959
801 Ga0501079_0053587 3300049741 Unclassified 3112
802 Ga0501079_0054503 3300049741 Bacteria 3084
803 Ga0501079_0198274 3300049741 Bacteria 1567
804 Ga0501079_0206811 3300049741 Bacteria 1533
805 Ga0501079_1089351 3300049741 Bacteria 629
806 Ga0501079_1356862 3300049741 Unclassified 560
807 Ga0501080_0290815 3300049742 Bacteria 1484
808 Ga0501080_0598261 3300049742 Bacteria 979
809 Ga0501081_0194790 3300049743 Unclassified 1468
810 Ga0501081_0224381 3300049743 Unclassified 1367
811 Ga0501081_0250928 3300049743 Unclassified 1292
812 Ga0501081_0394692 3300049743 Unclassified 1024
813 Ga0501081_0612883 3300049743 Bacteria 815
814 Ga0501081_0829525 3300049743 Bacteria 696
815 Ga0501081_0834046 3300049743 Bacteria 694
816 Ga0501081_0902927 3300049743 Unclassified 666
817 Ga0501081_1492247 3300049743 Bacteria 513
818 Ga0501035_0210890 3300049822 Unclassified 1662
819 Ga0501035_0865617 3300049822 Bacteria 718
820 Ga0501035_0923047 3300049822 Unclassified 690
821 Ga0501045_0022508 3300049824 Bacteria 4514
822 Ga0501045_0040629 3300049824 Bacteria 3384
823 Ga0501045_0042649 3300049824 Unclassified 3303
824 Ga0501045_0188572 3300049824 Bacteria 1537
825 Ga0501045_0241710 3300049824 Unclassified 1344
826 Ga0501045_0521281 3300049824 Unclassified 882
827 Ga0501045_0677760 3300049824 Unclassified 761
828 nmdc:mga03n38_605897_c1 3300050490 Bacteria 624
829 nmdc:mga00v17_150059_c1 3300050491 Bacteria 1497
830 nmdc:mga00v17_26996_c1 3300050491 Bacteria 3349
831 nmdc:mga00v17_89848_c1 3300050491 Unclassified 1928
832 nmdc:mga0k408_298337_c1 3300050493 Unclassified 962
833 nmdc:mga0k408_44232_c1 3300050493 Unclassified 2567
834 nmdc:mga06z11_180720_c1 3300050494 Bacteria 1216
835 nmdc:mga06z11_24951_c1 3300050494 Bacteria 2827
836 nmdc:mga06z11_676606_c1 3300050494 Unclassified 628
837 nmdc:mga04h51_107351_c1 3300050495 Bacteria 1025
838 nmdc:mga04h51_176019_c1 3300050495 Unclassified 830
839 nmdc:mga07m45_12574_c1 3300050496 Bacteria 4476
840 nmdc:mga05p37_110698_c1 3300050507 Unclassified 3378
841 nmdc:mga05p37_1355178_c1 3300050507 Bacteria 720
842 nmdc:mga05p37_1363758_c1 3300050507 Bacteria 717
843 nmdc:mga05p37_143106_c1 3300050507 Bacteria 2929
844 nmdc:mga05p37_1552430_c1 3300050507 Bacteria 656
845 nmdc:mga05p37_216699_c1 3300050507 Bacteria 2312
846 nmdc:mga05p37_28498_c1 3300050507 Bacteria 6809
847 nmdc:mga05p37_318452_c1 3300050507 Bacteria 1842
848 nmdc:mga05p37_452891_c1 3300050507 Unclassified 1485
849 nmdc:mga05p37_454780_c1 3300050507 Bacteria 1481
850 nmdc:mga05p37_58830_c1 3300050507 Bacteria 4733
851 nmdc:mga05p37_653530_c1 3300050507 Bacteria 1177
852 nmdc:mga09592_115192_c1 3300050508 Bacteria 2307
853 nmdc:mga09592_1317098_c1 3300050508 Unclassified 593
854 nmdc:mga09592_1575949_c1 3300050508 Unclassified 532
855 nmdc:mga09592_225243_c1 3300050508 Bacteria 1625
856 nmdc:mga09592_311451_c1 3300050508 Unclassified 1364
857 nmdc:mga09592_331174_c1 3300050508 Unclassified 1318
858 nmdc:mga09592_419590_c1 3300050508 Bacteria 1156
859 nmdc:mga09592_782470_c1 3300050508 Bacteria 808
860 nmdc:mga0qj67_165525_c1 3300050509 Unclassified 1795
861 nmdc:mga0qj67_28569_c2 3300050509 Unclassified 4094
862 nmdc:mga0qj67_286208_c1 3300050509 Bacteria 1336
863 nmdc:mga0qj67_345995_c1 3300050509 Unclassified 1202
864 nmdc:mga0qj67_347530_c1 3300050509 Bacteria 1199
865 nmdc:mga0qj67_502991_c1 3300050509 Bacteria 974
866 nmdc:mga0qj67_525676_c1 3300050509 Bacteria 950
867 nmdc:mga0qj67_8903_c1 3300050509 Bacteria 7449
868 nmdc:mga06r32_22496_c1 3300050510 Bacteria 5827
869 nmdc:mga06r32_22992_c1 3300050510 Bacteria 5767
870 nmdc:mga06r32_31926_c1 3300050510 Bacteria 4950
871 nmdc:mga06r32_42351_c1 3300050510 Unclassified 4329
872 nmdc:mga06r32_497663_c1 3300050510 Unclassified 1196
873 nmdc:mga06r32_52318_c1 3300050510 Bacteria 3911
874 nmdc:mga06r32_580861_c1 3300050510 Bacteria 1093
875 nmdc:mga06r32_725736_c1 3300050510 Bacteria 958
876 nmdc:mga06r32_75762_c1 3300050510 Bacteria 3266
877 nmdc:mga06r32_917082_c1 3300050510 Bacteria 832
878 nmdc:mga08y16_1274098_c1 3300050511 Bacteria 703
879 nmdc:mga08y16_134614_c1 3300050511 Bacteria 2568
880 nmdc:mga08y16_206013_c1 3300050511 Unclassified 2038
881 nmdc:mga08y16_23828_c1 3300050511 Bacteria 6464
882 nmdc:mga08y16_302822_c1 3300050511 Bacteria 1647
883 nmdc:mga08y16_439090_c1 3300050511 Bacteria 1332
884 nmdc:mga08y16_4977_c1 3300050511 Bacteria 13889
885 nmdc:mga08y16_73_c1 3300050511 Bacteria 84090
886 nmdc:mga0n895_122843_c1 3300050512 Bacteria 2618
887 nmdc:mga0n895_2076348_c1 3300050512 Unclassified 525
888 nmdc:mga0n895_2538_c1 3300050512 Bacteria 14299
889 nmdc:mga0n895_39143_c1 3300050512 Bacteria 4598
890 nmdc:mga0n895_404123_c1 3300050512 Bacteria 1381
891 nmdc:mga0n895_47629_c1 3300050512 Bacteria 4192
892 nmdc:mga0n895_746607_c1 3300050512 Bacteria 972
893 nmdc:mga0n895_913_c1 3300050512 Bacteria 21273
894 nmdc:mga0rr50_112440_c1 3300050513 Bacteria 2157
895 nmdc:mga0rr50_150008_c1 3300050513 Bacteria 1883
896 nmdc:mga0rr50_234690_c1 3300050513 Bacteria 1519
897 nmdc:mga0rr50_30_c1 3300050513 Bacteria 105385
898 nmdc:mga0rr50_485632_c1 3300050513 Unclassified 1049
899 nmdc:mga0rr50_528908_c1 3300050513 Bacteria 1003
900 nmdc:mga0rr50_921671_c1 3300050513 Unclassified 745
901 nmdc:mga08x19_21786_c1 3300050514 Bacteria 3960
902 nmdc:mga08x19_399826_c1 3300050514 Bacteria 964
903 nmdc:mga08x19_530050_c1 3300050514 Unclassified 833
904 nmdc:mga08x19_73_c1 3300050514 Bacteria 96390
905 nmdc:mga08x19_89154_c1 3300050514 Unclassified 2034
906 nmdc:mga0a205_1250171_c1 3300050515 Unclassified 590
907 nmdc:mga0a205_125453_c1 3300050515 Unclassified 2466
908 nmdc:mga0a205_1530034_c1 3300050515 Bacteria 515
909 nmdc:mga0a205_1716_c1 3300050515 Bacteria 18910
910 nmdc:mga0a205_299870_c1 3300050515 Bacteria 1480
911 nmdc:mga0a205_35424_c1 3300050515 Bacteria 4793
912 nmdc:mga0a205_507337_c1 3300050515 Unclassified 1063
913 nmdc:mga0a205_651878_c1 3300050515 Unclassified 904
914 nmdc:mga0a205_655055_c1 3300050515 Bacteria 901
915 Ga0495655_0178203 3300053083 Bacteria 684
916 Ga0500641_0000187 3300053096 Bacteria 23355
917 Ga0500556_0007035 3300053104 Bacteria 3211
918 Ga0500645_000044 3300053730 Bacteria 109705
919 Ga0501084_0067140 3300054114 Bacteria 3002
920 Ga0501084_0118578 3300054114 Bacteria 2225
921 Ga0501084_0155336 3300054114 Bacteria 1929
922 Ga0501084_0403185 3300054114 Unclassified 1156
923 Ga0501084_1293829 3300054114 Bacteria 611
924 Ga0501084_1394480 3300054114 Bacteria 587
925 Ga0501082_0058596 3300060353 Unclassified 3318
926 Ga0501082_0279828 3300060353 Bacteria 1452
927 Ga0501082_0299992 3300060353 Unclassified 1399
928 Ga0501082_1237627 3300060353 Bacteria 652
929 Ga0501082_1534689 3300060353 Bacteria 582
930 Ga0530510_0045888 3300061734 Bacteria 3157
931 Ga0530510_0153346 3300061734 Bacteria 1702
932 Ga0530510_0172312 3300061734 Bacteria 1603
933 Ga0530510_0258182 3300061734 Unclassified 1299
934 Ga0530510_0314138 3300061734 Bacteria 1174
935 Ga0068861_100408203
936 Ga0065712_10003012
937 Ga0065712_10067780
938 Ga0065712_10117327
939 Ga0065715_10000224
940 Ga0065715_10245874
941 Ga0065715_10634064
942 Ga0065707_10086010
943 Ga0065707_10283949
944 Ga0070676_10086479
945 Ga0070676_10203247
946 Ga0070676_10500059
947 Ga0070683_100012658
948 Ga0070683_100542286
949 Ga0070690_100182326
950 Ga0070690_100335689
951 Ga0070670_100545630
952 Ga0070677_10006214
953 Ga0070677_10266452
954 Ga0070677_10494518
955 Ga0070677_10696658
956 Ga0068869_101405689
957 Ga0070666_10224249
958 Ga0070680_100199320
959 Ga0070680_101892917
960 Ga0068868_100540113
961 Ga0068868_101033115
962 Ga0068868_101564873
963 Ga0070660_100387092
964 Ga0070689_100108463
965 Ga0070689_100259615
966 Ga0070691_10217556
967 Ga0070687_100036803
968 Ga0070687_101538135
969 Ga0070661_101759853
970 Ga0070668_100242790
971 Ga0070668_100295916
972 Ga0070668_100723984
973 Ga0070668_100959118
974 Ga0070669_100030799
975 Ga0070669_100374948
976 Ga0070669_100441148
977 Ga0070669_100486257
978 Ga0070669_100907933
979 Ga0070669_101035565
980 Ga0070675_100017607
981 Ga0070675_100020787
982 Ga0070675_100028140
983 Ga0070675_100062663
984 Ga0070675_100075777
985 Ga0070675_100093497
986 Ga0070671_100415720
987 Ga0070671_100817409
988 Ga0070671_101328009
989 Ga0070674_100009689
990 Ga0070674_100030127
991 Ga0070674_100985407
992 Ga0070674_100989815
993 Ga0070673_100077234
994 Ga0070688_100131829
995 Ga0070688_100280072
996 Ga0070688_101259641
997 Ga0070688_101356399
998 Ga0070659_100082853
999 Ga0070659_100159995
1000 Ga0070659_100274535
1001 Ga0070667_100096164
1002 Ga0070667_101267059
1003 Ga0070709_10097012
1004 Ga0070714_100299151
1005 Ga0070713_100154660
1006 Ga0070713_100877452
1007 Ga0070710_10240591
1008 Ga0070710_11006889
1009 Ga0070701_10299983
1010 Ga0070701_10891833
1011 Ga0070701_11378401
1012 Ga0070701_11418245
1013 Ga0070711_100358304
1014 Ga0070711_101461839
1015 Ga0070705_100274708
1016 Ga0070705_100280906
1017 Ga0070705_100959543
1018 Ga0070705_101115681
1019 Ga0070705_101179536
1020 Ga0070700_100213869
1021 Ga0070700_100257389
1022 Ga0070700_100270573
1023 Ga0070700_100285314
1024 Ga0070700_101524377
1025 Ga0070694_100034806
1026 Ga0070694_100036098
1027 Ga0070694_100036664
1028 Ga0070694_100211807
1029 Ga0070694_100553172
1030 Ga0070694_100812640
1031 Ga0070708_100029767
1032 Ga0070708_101304503
1033 Ga0070663_100128873
1034 Ga0070663_100290385
1035 Ga0070678_100099830
1036 Ga0070678_100219687
1037 Ga0070678_100669188
1038 Ga0070678_101150683
1039 Ga0070662_100078608
1040 Ga0070662_100145329
1041 Ga0070662_100449063
1042 Ga0070662_100709823
1043 Ga0070662_100861229
1044 Ga0070681_10320291
1045 Ga0068867_100011081
1046 Ga0070685_10076816
1047 Ga0070685_10413894
1048 Ga0070685_10949162
1049 Ga0070706_100309752
1050 Ga0070706_101863134
1051 Ga0070707_100056414
1052 Ga0070707_100935265
1053 Ga0070707_102127216
1054 Ga0070698_100137168
1055 Ga0070698_100174464
1056 Ga0070698_101130529
1057 Ga0070699_100100453
1058 Ga0070699_100665292
1059 Ga0070699_101576939
1060 Ga0070679_100739007
1061 Ga0070684_100002298
1062 Ga0070684_100268877
1063 Ga0070697_100062453
1064 Ga0070697_100247742
1065 Ga0070697_100579534
1066 Ga0070697_101145554
1067 Ga0070697_101204196
1068 Ga0068853_100659507
1069 Ga0068853_101874068
1070 Ga0070672_100174263
1071 Ga0070672_100210032
1072 Ga0070672_101163154
1073 Ga0070686_100016883
1074 Ga0070686_100031587
1075 Ga0070686_100138011
1076 Ga0070686_100222751
1077 Ga0070686_100298223
1078 Ga0070686_101559374
1079 Ga0070695_100101410
1080 Ga0070695_100146899
1081 Ga0070695_101204260
1082 Ga0070695_101842038
1083 Ga0070696_100029877
1084 Ga0070696_100817312
1085 Ga0070696_100903540
1086 Ga0070693_100204447
1087 Ga0070665_100018067
1088 Ga0070665_100131218
1089 Ga0070665_100133431
1090 Ga0070704_100793222
1091 Ga0070704_100819772
1092 Ga0070704_101681079
1093 Ga0070704_101755565
1094 Ga0068855_100607570
1095 Ga0070664_100049641
1096 Ga0070664_100445261
1097 Ga0070664_100570429
1098 Ga0070664_100671548
1099 Ga0070664_100688869
1100 Ga0070664_101258196
1101 Ga0068857_100265942
1102 Ga0068854_100033846
1103 Ga0068854_100211755
1104 Ga0068854_100840006
1105 Ga0068856_100482797
1106 Ga0068856_100535095
1107 Ga0068856_101352378
1108 Ga0070702_100016936
1109 Ga0070702_101274858
1110 Ga0068852_100234103
1111 Ga0068852_100246569
1112 Ga0068852_100305368
1113 Ga0068859_100022688
1114 Ga0068859_100210350
1115 Ga0068859_100284580
1116 Ga0068859_100471049
1117 Ga0068859_101009175
1118 Ga0068859_101379854
1119 Ga0068864_100000641
1120 Ga0068866_10068431
1121 Ga0068866_10113720
1122 Ga0068861_100082049
1123 Ga0068861_100175122
1124 Ga0068861_100434125
1125 Ga0068861_101628775
1126 Ga0068861_102394200
1127 Ga0068851_10427403
1128 Ga0068870_10009489
1129 Ga0068870_10806403
1130 Ga0068863_100024322
1131 Ga0068863_100353094
1132 Ga0068863_100892533
1133 Ga0068858_100104581
1134 Ga0068858_100184235
1135 Ga0068860_100336350
1136 Ga0068860_100617588
1137 Ga0068860_100776421
1138 Ga0068860_100963177
1139 Ga0068862_100006975
1140 Ga0068862_100111626
1141 Ga0068862_100528881
1142 Ga0068862_100679471
1143 Ga0068862_101405685
1144 Ga0068862_102790498
1145 Ga0081539_10017195
1146 Ga0070717_10478654
1147 Ga0070717_10666122
1148 Ga0075363_100671926
1149 Ga0075364_10010945
1150 Ga0075364_10762651
1151 Ga0075432_10028689
1152 Ga0075432_10082431
1153 Ga0070716_100304373
1154 Ga0070712_101798774
1155 Ga0075367_10011259
1156 Ga0075367_10026470
1157 Ga0075369_10341549
1158 Ga0075366_10032800
1159 Ga0075366_10458870
1160 Ga0097621_100007728
1161 Ga0097621_100134011
1162 Ga0097621_100151406
1163 Ga0097621_101385651
1164 Ga0097621_101811495
1165 Ga0068871_100008586
1166 Ga0068871_100060666
1167 Ga0068871_100093989
1168 Ga0068871_100956009
1169 Ga0068871_101013431
1170 Ga0075428_100045169
1171 Ga0075428_100048357
1172 Ga0075428_100279447
1173 Ga0075428_100554929
1174 Ga0075428_100740205
1175 Ga0075428_101566296
1176 Ga0075430_100045637
1177 Ga0075430_100208211
1178 Ga0075430_100390122
1179 Ga0075430_100416769
1180 Ga0075430_100496556
1181 Ga0075430_101068542
1182 Ga0075431_100012147
1183 Ga0075431_100025464
1184 Ga0075431_100049993
1185 Ga0075431_100424537
1186 Ga0075431_100588426
1187 Ga0075431_100613628
1188 Ga0075431_100629962
1189 Ga0075431_100942138
1190 Ga0075431_101201876
1191 Ga0075431_101686009
1192 Ga0075433_10000320
1193 Ga0075433_10005124
1194 Ga0075433_10227184
1195 Ga0075433_10523564
1196 Ga0075433_10695133
1197 Ga0075433_11016909
1198 Ga0075434_100005903
1199 Ga0075434_100008568
1200 Ga0075434_100199148
1201 Ga0075434_100418583
1202 Ga0075434_100679068
1203 Ga0075429_100241344
1204 Ga0075429_100615611
1205 Ga0075429_100957009
1206 Ga0075429_101189098
1207 Ga0075429_101218151
1208 Ga0075429_101481121
1209 Ga0075429_101577362
1210 Ga0075429_101979143
1211 Ga0068865_100008984
1212 Ga0068865_100173615
1213 Ga0068865_100555647
1214 Ga0068865_100583519
1215 Ga0068865_100927536
1216 Ga0068865_100981585
1217 Ga0068865_101810100
1218 Ga0075436_100004542
1219 Ga0075436_100022202
1220 Ga0075436_100457884
1221 Ga0097620_100022688
1222 Ga0097620_100210358
1223 Ga0097620_100284581
1224 Ga0097620_100471033
1225 Ga0097620_101009280
1226 Ga0097620_101379214
1227 Ga0075435_100000032
1228 Ga0075435_100095208
1229 Ga0075435_100180396
1230 Ga0075435_100342199
1231 Ga0075435_100552570
1232 Ga0075435_100925528
1233 Ga0075435_101983240
1234 Ga0105240_10053284
1235 Ga0105240_10170322
1236 Ga0105240_10346853
1237 Ga0105240_11552967
1238 Ga0105240_12289214
1239 Ga0111539_10000226
1240 Ga0111539_10009944
1241 Ga0111539_10015310
1242 Ga0111539_10019831
1243 Ga0111539_10071845
1244 Ga0111539_10074935
1245 Ga0111539_10151143
1246 Ga0111539_10317165
1247 Ga0111539_10439866
1248 Ga0111539_10734655
1249 Ga0111539_10907500
1250 Ga0111539_10940977
1251 Ga0111539_12209823
1252 Ga0105245_10081291
1253 Ga0105245_10254646
1254 Ga0105245_10809472
1255 Ga0105245_12821683
1256 Ga0114129_10005510
1257 Ga0114129_10005675
1258 Ga0114129_10048745
1259 Ga0114129_10127103
1260 Ga0114129_10203108
1261 Ga0114129_10212550
1262 Ga0114129_10278143
1263 Ga0114129_10317025
1264 Ga0114129_10456711
1265 Ga0114129_10824686
1266 Ga0114129_11316450
1267 Ga0114129_11753508
1268 Ga0114129_12230170
1269 Ga0114129_12675450
1270 Ga0105243_10022423
1271 Ga0105243_10084411
1272 Ga0105243_10409001
1273 Ga0105243_10573188
1274 Ga0105243_11082026
1275 Ga0105243_11083069
1276 Ga0105243_11636919
1277 Ga0105241_11173679
1278 Ga0105241_12419954
1279 Ga0105242_10001323
1280 Ga0105242_10004655
1281 Ga0105242_10160409
1282 Ga0105248_10018439
1283 Ga0105248_10073012
1284 Ga0105248_10121676
1285 Ga0105248_10147185
1286 Ga0105248_10256013
1287 Ga0105248_10406547
1288 Ga0105248_10407182
1289 Ga0105248_10540063
1290 Ga0105248_10619457
1291 Ga0105248_12148038
1292 Ga0105237_11615735
1293 Ga0105238_11687976
1294 Ga0105238_11718078
1295 Ga0105238_12405043
1296 Ga0105238_12429252
1297 Ga0105249_10041779
1298 Ga0105249_10066443
1299 Ga0105249_10706293
1300 Ga0105249_10872512
1301 Ga0105249_11244039
1302 Ga0105249_13355537
1303 Ga0105239_12332006
1304 Ga0105239_12681753
1305 Ga0105246_12434501
1306 Ga0157370_10459627
1307 Ga0157369_10892191
1308 Ga0157378_11006564
1309 Ga0157378_11200760
1310 Ga0157378_12745050
1311 Ga0163162_10245099
1312 Ga0163162_10618538
1313 Ga0163162_11861668
1314 Ga0163162_12556573
1315 Ga0157372_10035018
1316 Ga0157372_10496146
1317 Ga0157372_11023723
1318 Ga0157375_10117576
1319 Ga0157375_10580331
1320 Ga0157375_10893926
1321 Ga0157375_11694521
1322 Ga0163163_10025809
1323 Ga0163163_10093607
1324 Ga0163163_10188513
1325 Ga0163163_10472271
1326 Ga0157380_10004342
1327 Ga0157380_10056030
1328 Ga0157380_10102069
1329 Ga0157380_10311616
1330 Ga0157380_10431320
1331 Ga0157380_11599131
1332 Ga0157380_12562397
1333 Ga0157380_13077036
1334 Ga0157379_10077462
1335 Ga0157376_10472957
1336 Ga0157376_10605265
1337 Ga0157376_12143135
1338 Ga0206356_10091165
1339 Ga0206356_11626627
1340 Ga0207666_1047181
1341 Ga0207697_10176113
1342 Ga0207697_10179486
1343 Ga0207682_10075523
1344 Ga0207682_10171267
1345 Ga0207682_10219218
1346 Ga0207682_10221697
1347 Ga0207642_10074419
1348 Ga0207642_10151100
1349 Ga0207688_10030405
1350 Ga0207688_10446385
1351 Ga0207688_10451550
1352 Ga0207688_10674820
1353 Ga0207680_10024053
1354 Ga0207680_10219725
1355 Ga0207680_11142967
1356 Ga0207680_11206771
1357 Ga0207647_10793508
1358 Ga0207699_10015529
1359 Ga0207645_10005161
1360 Ga0207645_10066978
1361 Ga0207645_10269295
1362 Ga0207643_10100982
1363 Ga0207643_10157681
1364 Ga0207643_10685712
1365 Ga0207684_10109823
1366 Ga0207684_10476057
1367 Ga0207684_11483753
1368 Ga0207654_11404425
1369 Ga0207707_10242732
1370 Ga0207707_10441336
1371 Ga0207707_10768426
1372 Ga0207707_10926597
1373 Ga0207695_10225058
1374 Ga0207695_10319497
1375 Ga0207695_10537120
1376 Ga0207695_10767012
1377 Ga0207671_10974030
1378 Ga0207663_10088231
1379 Ga0207663_10466096
1380 Ga0207663_10963621
1381 Ga0207660_10168963
1382 Ga0207660_10647513
1383 Ga0207662_10047116
1384 Ga0207662_10983177
1385 Ga0207649_10278321
1386 Ga0207649_10463466
1387 Ga0207646_10165094
1388 Ga0207681_10006259
1389 Ga0207681_10018130
1390 Ga0207681_10155251
1391 Ga0207681_10634329
1392 Ga0207681_10716828
1393 Ga0207694_10312658
1394 Ga0207694_10451224
1395 Ga0207694_11360268
1396 Ga0207650_10544684
1397 Ga0207650_11756226
1398 Ga0207659_10000571
1399 Ga0207659_10023847
1400 Ga0207659_10068584
1401 Ga0207659_10099273
1402 Ga0207659_10780692
1403 Ga0207687_10251781
1404 Ga0207687_10259733
1405 Ga0207687_10546021
1406 Ga0207687_10679115
1407 Ga0207687_11034766
1408 Ga0207687_11041679
1409 Ga0207700_10029284
1410 Ga0207700_10131680
1411 Ga0207664_10409140
1412 Ga0207644_10004322
1413 Ga0207644_10090437
1414 Ga0207644_11179677
1415 Ga0207690_10053628
1416 Ga0207690_10144230
1417 Ga0207690_10241502
1418 Ga0207690_10992909
1419 Ga0207690_11090003
1420 Ga0207706_10079637
1421 Ga0207706_10178607
1422 Ga0207706_10423891
1423 Ga0207706_10469144
1424 Ga0207706_11052479
1425 Ga0207686_10076451
1426 Ga0207686_10086458
1427 Ga0207709_10019378
1428 Ga0207709_10666865
1429 Ga0207709_11133111
1430 Ga0207670_10187135
1431 Ga0207670_10468214
1432 Ga0207670_10827867
1433 Ga0207670_10918483
1434 Ga0207669_10001659
1435 Ga0207669_10001727
1436 Ga0207669_10394536
1437 Ga0207669_10401315
1438 Ga0207669_10555010
1439 Ga0207669_10581211
1440 Ga0207669_10788771
1441 Ga0207669_11177201
1442 Ga0207704_10020213
1443 Ga0207704_10047086
1444 Ga0207704_10054843
1445 Ga0207704_10251353
1446 Ga0207704_10336988
1447 Ga0207704_10849880
1448 Ga0207665_10346682
1449 Ga0207691_10198963
1450 Ga0207691_10493683
1451 Ga0207691_11017862
1452 Ga0207711_10035572
1453 Ga0207711_10144930
1454 Ga0207711_10153554
1455 Ga0207711_10165253
1456 Ga0207711_10273109
1457 Ga0207711_10929689
1458 Ga0207711_11199767
1459 Ga0207689_10451628
1460 Ga0207689_10738089
1461 Ga0207661_11889377
1462 Ga0207679_10614032
1463 Ga0207679_10672944
1464 Ga0207679_10680212
1465 Ga0207679_10714737
1466 Ga0207679_11147611
1467 Ga0207667_10864098
1468 Ga0207651_10108800
1469 Ga0207651_10559962
1470 Ga0207712_10033160
1471 Ga0207712_10152272
1472 Ga0207712_10387076
1473 Ga0207712_10638553
1474 Ga0207712_11296588
1475 Ga0207668_10047975
1476 Ga0207668_10550694
1477 Ga0207668_10620136
1478 Ga0207668_12117088
1479 Ga0207640_10076817
1480 Ga0207640_10161653
1481 Ga0207640_10923026
1482 Ga0207677_10558196
1483 Ga0207677_10985275
1484 Ga0207703_10156859
1485 Ga0207703_10484132
1486 Ga0207703_10891898
1487 Ga0207703_11486767
1488 Ga0207639_11506397
1489 Ga0207678_10018458
1490 Ga0207678_10329521
1491 Ga0207708_10007607
1492 Ga0207708_10030504
1493 Ga0207708_10068496
1494 Ga0207708_10184389
1495 Ga0207708_10235679
1496 Ga0207708_10389163
1497 Ga0207702_10240370
1498 Ga0207702_10517194
1499 Ga0207641_10014093
1500 Ga0207641_10192055
1501 Ga0207641_11211684
1502 Ga0207641_11764494
1503 Ga0207648_10028810
1504 Ga0207648_10057098
1505 Ga0207648_10064152
1506 Ga0207648_10134817
1507 Ga0207648_11245213
1508 Ga0207676_10038722
1509 Ga0207676_10158165
1510 Ga0207674_10218526
1511 Ga0207674_10318389
1512 Ga0207675_100008805
1513 Ga0207675_100010481
1514 Ga0207675_100114454
1515 Ga0207675_100270584
1516 Ga0207675_100636816
1517 Ga0207675_101427796
1518 Ga0207675_102635654
1519 Ga0207683_10018601
1520 Ga0207683_10080000
1521 Ga0207683_10256433
1522 Ga0207683_10315302
1523 Ga0207698_10148305
1524 Ga0207698_10214584
1525 Ga0209971_1155997
1526 Ga0209813_10151847
1527 Ga0209974_10019518
1528 Ga0207428_10000240
1529 Ga0207428_10000555
1530 Ga0207428_10036331
1531 Ga0207428_10672432
1532 Ga0268266_10029469
1533 Ga0268266_10103901
1534 Ga0268266_10147843
1535 Ga0268266_10592906
1536 Ga0268265_10319206
1537 Ga0268265_10346449
1538 Ga0268265_10573834
1539 Ga0268265_10608727
1540 Ga0268265_10914890
1541 Ga0268265_11624099
1542 Ga0268265_11748210
1543 Ga0268264_10219149
1544 Ga0268264_10503664
1545 Ga0268264_11322919
1546 Ga0268264_11351260
1547 Ga0268264_12370867
1548 Ga0268264_12460531
1549 Ga0307509_10780027
1550 Ga0307413_11642020
1551 Ga0307410_10658241
1552 Ga0307412_10825449
1553 Ga0307409_100399954
1554 Ga0307409_101100208
1555 Ga0307416_100382365
1556 Ga0307414_10206267
1557 Ga0307411_11808587
1558 Ga0373923_0043140
1559 Ga0373956_0461990
1560 Ga0373957_0530389
1561 Ga0373943_0127135
1562 Ga0373955_0122823
1563 Ga0373924_0008654
1564 Ga0373931_0298283
1565 Ga0373931_1046455
1566 Ga0373935_0023626
1567 Ga0373927_0325502
1568 Ga0373937_0683876
1569 Ga0373925_0189057
1570 Ga0373925_0245503
1571 Ga0439453_0004701
1572 Ga0439461_0117239
1573 Ga0451791_0907960
1574 Ga0451807_1464146
1575 Ga0451845_0069342
1576 Ga0451845_0640654
1577 Ga0439443_092459
1578 Ga0439445_0127393
1579 Ga0439451_064306
1580 Ga0450920_045657
1581 Ga0450923_032395
1582 Ga0439434_0112112
1583 Ga0439435_0020258
1584 Ga0439444_0182154
1585 Ga0439459_0115204
1586 Ga0439464_0036978
1587 Ga0439460_0048922
1588 Ga0439460_0378506
1589 Ga0450916_035354
1590 Ga0439440_0185398
1591 Ga0466963_0765082
1592 Ga0466963_0811672
1593 Ga0466963_0919847
1594 Ga0466959_0805251
1595 Ga0451576_0702224
1596 Ga0451576_1328890
1597 Ga0451576_2091149
1598 Ga0466958_0659023
1599 Ga0466958_0829459
1600 Ga0466967_0343188
1601 Ga0466967_2501248
1602 Ga0495638_0243211
1603 Ga0495580_0042962
1604 Ga0495580_0302118
1605 Ga0495582_0079544
1606 Ga0495582_0573196
1607 Ga0495582_0777369
1608 Ga0495662_0145084
1609 Ga0495594_0487286
1610 Ga0495628_0836126
1611 Ga0495637_0253075
1612 Ga0495643_0002970
1613 Ga0495666_0233828
1614 Ga0495665_0179408
1615 Ga0495665_0232493
1616 Ga0495656_0456649
1617 Ga0495659_0437126
1618 Ga0495647_0200076
1619 Ga0495658_0334588
1620 Ga0495613_0115345
1621 Ga0495613_0344703
1622 Ga0495624_0318167
1623 Ga0495636_0657462
1624 Ga0495674_0516352
1625 Ga0495672_0215229
1626 Ga0495684_0715053
1627 Ga0495602_0328160
1628 Ga0496100_0668554
1629 Ga0496102_0731353
1630 Ga0496102_1221712
1631 Ga0496104_0004618
1632 Ga0496105_0291216
1633 Ga0496106_0177744
1634 Ga0496106_0434847
1635 Ga0496107_0514675
1636 Ga0496109_0000620
1637 Ga0496109_0150441
1638 Ga0496109_0970059
1639 Ga0496110_0000742
1640 Ga0496111_0508674
1641 Ga0496112_0003666
1642 Ga0496113_0025160
1643 Ga0496113_0190413
1644 Ga0496113_0933872
1645 Ga0496114_0098732
1646 Ga0496114_0376490
1647 Ga0496115_0096310
1648 Ga0501031_0050866
1649 Ga0501031_0082003
1650 Ga0501031_0163397
1651 Ga0501031_0170620
1652 Ga0501032_0332103
1653 Ga0501033_0497084
1654 Ga0501033_0756451
1655 Ga0501036_0045192
1656 Ga0501036_0111651
1657 Ga0501036_0140019
1658 Ga0501036_0165839
1659 Ga0501037_0351062
1660 Ga0501038_0190961
1661 Ga0501038_1069066
1662 Ga0501038_1241321
1663 Ga0501039_0013089
1664 Ga0501039_0019158
1665 Ga0501039_0037159
1666 Ga0501039_0102820
1667 Ga0501039_1130473
1668 Ga0501040_0010409
1669 Ga0501040_0227660
1670 Ga0501040_0271936
1671 Ga0501040_0523091
1672 Ga0501040_0849550
1673 Ga0501040_1145762
1674 Ga0501041_0015859
1675 Ga0501041_0165250
1676 Ga0501041_0193537
1677 Ga0501041_0208552
1678 Ga0501041_0232660
1679 Ga0501041_0275392
1680 Ga0501042_0024812
1681 Ga0501042_0030683
1682 Ga0501042_0030800
1683 Ga0501042_0119555
1684 Ga0501042_0152378
1685 Ga0501042_0322040
1686 Ga0501042_0359751
1687 Ga0501042_0772879
1688 Ga0501042_1101121
1689 Ga0501043_0279508
1690 Ga0501043_0657263
1691 Ga0501046_0155514
1692 Ga0501048_0007931
1693 Ga0501048_0083154
1694 Ga0501048_0886510
1695 Ga0501048_0932634
1696 Ga0501067_0130968
1697 Ga0501068_1115982
1698 Ga0501070_0931748
1699 Ga0501070_1229646
1700 Ga0501071_0126113
1701 Ga0501071_0437569
1702 Ga0501071_0638192
1703 Ga0501071_0763609
1704 Ga0501072_0008891
1705 Ga0501072_0020985
1706 Ga0501072_0198458
1707 Ga0501072_0199154
1708 Ga0501072_0505212
1709 Ga0501072_0505215
1710 Ga0501072_0916493
1711 Ga0501073_0198965
1712 Ga0501073_0508327
1713 Ga0501074_0109352
1714 Ga0501075_0014875
1715 Ga0501075_0104289
1716 Ga0501075_0113684
1717 Ga0501075_0179746
1718 Ga0501075_0793912
1719 Ga0501075_1406006
1720 Ga0501076_0009320
1721 Ga0501076_0009692
1722 Ga0501076_0013963
1723 Ga0501076_0044376
1724 Ga0501076_0095447
1725 Ga0501076_0096551
1726 Ga0501076_0550669
1727 Ga0501076_0663266
1728 Ga0501076_1034553
1729 Ga0501077_0055061
1730 Ga0501077_0277874
1731 Ga0501077_0327358
1732 Ga0501077_0338618
1733 Ga0501253_144867
1734 Ga0501079_0021297
1735 Ga0501079_0053587
1736 Ga0501079_0054503
1737 Ga0501079_0198274
1738 Ga0501079_0206811
1739 Ga0501079_1089351
1740 Ga0501079_1356862
1741 Ga0501080_0290815
1742 Ga0501080_0598261
1743 Ga0501081_0194790
1744 Ga0501081_0224381
1745 Ga0501081_0250928
1746 Ga0501081_0394692
1747 Ga0501081_0612883
1748 Ga0501081_0829525
1749 Ga0501081_0834046
1750 Ga0501081_0902927
1751 Ga0501081_1492247
1752 Ga0501035_0210890
1753 Ga0501035_0865617
1754 Ga0501035_0923047
1755 Ga0501045_0022508
1756 Ga0501045_0040629
1757 Ga0501045_0042649
1758 Ga0501045_0188572
1759 Ga0501045_0241710
1760 Ga0501045_0521281
1761 Ga0501045_0677760
1762 nmdc:mga03n38_605897_c1
1763 nmdc:mga00v17_150059_c1
1764 nmdc:mga00v17_26996_c1
1765 nmdc:mga00v17_89848_c1
1766 nmdc:mga0k408_298337_c1
1767 nmdc:mga0k408_44232_c1
1768 nmdc:mga06z11_180720_c1
1769 nmdc:mga06z11_24951_c1
1770 nmdc:mga06z11_676606_c1
1771 nmdc:mga04h51_107351_c1
1772 nmdc:mga04h51_176019_c1
1773 nmdc:mga07m45_12574_c1
1774 nmdc:mga05p37_110698_c1
1775 nmdc:mga05p37_1355178_c1
1776 nmdc:mga05p37_1363758_c1
1777 nmdc:mga05p37_143106_c1
1778 nmdc:mga05p37_1552430_c1
1779 nmdc:mga05p37_216699_c1
1780 nmdc:mga05p37_28498_c1
1781 nmdc:mga05p37_318452_c1
1782 nmdc:mga05p37_452891_c1
1783 nmdc:mga05p37_454780_c1
1784 nmdc:mga05p37_58830_c1
1785 nmdc:mga05p37_653530_c1
1786 nmdc:mga09592_115192_c1
1787 nmdc:mga09592_1317098_c1
1788 nmdc:mga09592_1575949_c1
1789 nmdc:mga09592_225243_c1
1790 nmdc:mga09592_311451_c1
1791 nmdc:mga09592_331174_c1
1792 nmdc:mga09592_419590_c1
1793 nmdc:mga09592_782470_c1
1794 nmdc:mga0qj67_165525_c1
1795 nmdc:mga0qj67_28569_c2
1796 nmdc:mga0qj67_286208_c1
1797 nmdc:mga0qj67_345995_c1
1798 nmdc:mga0qj67_347530_c1
1799 nmdc:mga0qj67_502991_c1
1800 nmdc:mga0qj67_525676_c1
1801 nmdc:mga0qj67_8903_c1
1802 nmdc:mga06r32_22496_c1
1803 nmdc:mga06r32_22992_c1
1804 nmdc:mga06r32_31926_c1
1805 nmdc:mga06r32_42351_c1
1806 nmdc:mga06r32_497663_c1
1807 nmdc:mga06r32_52318_c1
1808 nmdc:mga06r32_580861_c1
1809 nmdc:mga06r32_725736_c1
1810 nmdc:mga06r32_75762_c1
1811 nmdc:mga06r32_917082_c1
1812 nmdc:mga08y16_1274098_c1
1813 nmdc:mga08y16_134614_c1
1814 nmdc:mga08y16_206013_c1
1815 nmdc:mga08y16_23828_c1
1816 nmdc:mga08y16_302822_c1
1817 nmdc:mga08y16_439090_c1
1818 nmdc:mga08y16_4977_c1
1819 nmdc:mga08y16_73_c1
1820 nmdc:mga0n895_122843_c1
1821 nmdc:mga0n895_2076348_c1
1822 nmdc:mga0n895_2538_c1
1823 nmdc:mga0n895_39143_c1
1824 nmdc:mga0n895_404123_c1
1825 nmdc:mga0n895_47629_c1
1826 nmdc:mga0n895_746607_c1
1827 nmdc:mga0n895_913_c1
1828 nmdc:mga0rr50_112440_c1
1829 nmdc:mga0rr50_150008_c1
1830 nmdc:mga0rr50_234690_c1
1831 nmdc:mga0rr50_30_c1
1832 nmdc:mga0rr50_485632_c1
1833 nmdc:mga0rr50_528908_c1
1834 nmdc:mga0rr50_921671_c1
1835 nmdc:mga08x19_21786_c1
1836 nmdc:mga08x19_399826_c1
1837 nmdc:mga08x19_530050_c1
1838 nmdc:mga08x19_73_c1
1839 nmdc:mga08x19_89154_c1
1840 nmdc:mga0a205_1250171_c1
1841 nmdc:mga0a205_125453_c1
1842 nmdc:mga0a205_1530034_c1
1843 nmdc:mga0a205_1716_c1
1844 nmdc:mga0a205_299870_c1
1845 nmdc:mga0a205_35424_c1
1846 nmdc:mga0a205_507337_c1
1847 nmdc:mga0a205_651878_c1
1848 nmdc:mga0a205_655055_c1
1849 Ga0495655_0178203
1850 Ga0500641_0000187
1851 Ga0500556_0007035
1852 Ga0500645_000044
1853 Ga0501084_0067140
1854 Ga0501084_0118578
1855 Ga0501084_0155336
1856 Ga0501084_0403185
1857 Ga0501084_1293829
1858 Ga0501084_1394480
1859 Ga0501082_0058596
1860 Ga0501082_0279828
1861 Ga0501082_0299992
1862 Ga0501082_1237627
1863 Ga0501082_1534689
1864 Ga0530510_0045888
1865 Ga0530510_0153346
1866 Ga0530510_0172312
1867 Ga0530510_0258182
1868 Ga0530510_0314138

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

44

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9293 14 110
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9134 12 113
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.9044 12 110
4g9y-assembly1.cif.gz_A-2 crystal structure of the pcav transcriptional regulator from streptomyces coelicolor 0.9016 15 109
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.8983 7 113
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9472 13 110 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9415 13 103 1.10.10.10
4g9yA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9016 15 109 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8987 16 86 1.10.10.10
af_P32349_45_122_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8955 14 84 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2V8EA09-F1-model_v4 PadR family transcriptional regulator 0.9795 13 92
AF-A0A2V7J1F6-F1-model_v4 PadR family transcriptional regulator 0.9772 13 87
AF-A0A4V2G1F2-F1-model_v4 PadR family transcriptional regulator 0.9716 13 111
AF-A0A2V9QNV6-F1-model_v4 PadR family transcriptional regulator 0.9714 13 88
AF-A0A833DXI9-F1-model_v4 PadR family transcriptional regulator 0.9711 13 93

Map