F486050
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 931 | 275 | 1862 | 235 |
Family's Representative Sequence
| Representative Sequence | 3300048918|Ga0496115_0142022|Ga0496115_0142022_497_1321 |
| Length | 274 |
| Sequence | MRTAKTTAILREFMGCSFAQNGIAVDDRPSIFYDTIKGGIMNLTTAVALVTGGTAGIGRSIAKTLVESGARVAITGRDKARLEETAQTLGVFPIHADVSNEVDVIRSYREVLAKFGDLDILVNNAGVGVFKSLVDMDRASFDNVFATNVTGAMLMGREAARHFIKRNRGAIINIASTAGLRGAANGTAYYASKFALRGMTECWRAELRKYNIRVMLVNPSEVITNFAASAGITQKANETKLRGEEIAYAVKAILEMDDRGFTPELTIFATNPID |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 81 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 171 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 178 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 181 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 182 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 188 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 194 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 195 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 199 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 202 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 203 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 204 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 205 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 206 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.89 |
| Metatranscriptomes | 0.11 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 98.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.71 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496115_0142022 | 3300048918 | Bacteria | 1981 |
| 2 | Ga0065707_10150567 | 3300005295 | Bacteria | 1663 |
| 3 | Ga0070658_10187959 | 3300005327 | Bacteria | 1740 |
| 4 | Ga0070676_10217763 | 3300005328 | Bacteria | 1260 |
| 5 | Ga0070683_100098299 | 3300005329 | Bacteria | 2754 |
| 6 | Ga0070690_100032320 | 3300005330 | Bacteria | 3267 |
| 7 | Ga0070670_100007834 | 3300005331 | Bacteria | 9089 |
| 8 | Ga0070670_100010330 | 3300005331 | Bacteria | 7968 |
| 9 | Ga0070670_100308850 | 3300005331 | Bacteria | 1384 |
| 10 | Ga0070677_10059985 | 3300005333 | Bacteria | 1566 |
| 11 | Ga0068869_100002089 | 3300005334 | Bacteria | 12012 |
| 12 | Ga0068869_100058052 | 3300005334 | Bacteria | 2828 |
| 13 | Ga0068869_100096635 | 3300005334 | Bacteria | 2230 |
| 14 | Ga0068869_100408070 | 3300005334 | Unclassified | 1119 |
| 15 | Ga0068869_100706225 | 3300005334 | Unclassified | 860 |
| 16 | Ga0070666_10001137 | 3300005335 | Bacteria | 16197 |
| 17 | Ga0070666_10039637 | 3300005335 | Bacteria | 3141 |
| 18 | Ga0070666_10046062 | 3300005335 | Bacteria | 2924 |
| 19 | Ga0070666_10167662 | 3300005335 | Bacteria | 1537 |
| 20 | Ga0070666_10257688 | 3300005335 | Bacteria | 1236 |
| 21 | Ga0070680_100013946 | 3300005336 | Bacteria | 6272 |
| 22 | Ga0068868_100005508 | 3300005338 | Bacteria | 8903 |
| 23 | Ga0068868_100006505 | 3300005338 | Bacteria | 8272 |
| 24 | Ga0068868_100047539 | 3300005338 | Bacteria | 3364 |
| 25 | Ga0068868_100145886 | 3300005338 | Bacteria | 1946 |
| 26 | Ga0068868_100158663 | 3300005338 | Bacteria | 1867 |
| 27 | Ga0068868_100206923 | 3300005338 | Bacteria | 1638 |
| 28 | Ga0068868_100309782 | 3300005338 | Unclassified | 1343 |
| 29 | Ga0068868_100443529 | 3300005338 | Bacteria | 1128 |
| 30 | Ga0070660_100024608 | 3300005339 | Bacteria | 4466 |
| 31 | Ga0070660_100120887 | 3300005339 | Bacteria | 2090 |
| 32 | Ga0070660_100151657 | 3300005339 | Unclassified | 1864 |
| 33 | Ga0070689_100043304 | 3300005340 | Bacteria | 3459 |
| 34 | Ga0070689_100046856 | 3300005340 | Bacteria | 3332 |
| 35 | Ga0070689_100223763 | 3300005340 | Bacteria | 1544 |
| 36 | Ga0070691_10013126 | 3300005341 | Bacteria | 3795 |
| 37 | Ga0070661_100110285 | 3300005344 | Bacteria | 2054 |
| 38 | Ga0070661_100269976 | 3300005344 | Bacteria | 1317 |
| 39 | Ga0070692_10062155 | 3300005345 | Bacteria | 1970 |
| 40 | Ga0070669_100033005 | 3300005353 | Bacteria | 3742 |
| 41 | Ga0070669_100162159 | 3300005353 | Bacteria | 1738 |
| 42 | Ga0070675_100000819 | 3300005354 | Bacteria | 21941 |
| 43 | Ga0070675_100004909 | 3300005354 | Bacteria | 10201 |
| 44 | Ga0070675_100005091 | 3300005354 | Bacteria | 10027 |
| 45 | Ga0070675_100129004 | 3300005354 | Bacteria | 2153 |
| 46 | Ga0070675_100211505 | 3300005354 | Unclassified | 1686 |
| 47 | Ga0070671_100016426 | 3300005355 | Bacteria | 5985 |
| 48 | Ga0070671_100044390 | 3300005355 | Bacteria | 3694 |
| 49 | Ga0070671_100046964 | 3300005355 | Bacteria | 3591 |
| 50 | Ga0070671_100071980 | 3300005355 | Bacteria | 2886 |
| 51 | Ga0070671_100072762 | 3300005355 | Unclassified | 2871 |
| 52 | Ga0070671_100332130 | 3300005355 | Bacteria | 1296 |
| 53 | Ga0070671_100351943 | 3300005355 | Bacteria | 1257 |
| 54 | Ga0070674_100081645 | 3300005356 | Bacteria | 2311 |
| 55 | Ga0070674_100145780 | 3300005356 | Bacteria | 1782 |
| 56 | Ga0070674_100187972 | 3300005356 | Bacteria | 1587 |
| 57 | Ga0070674_100763458 | 3300005356 | Bacteria | 832 |
| 58 | Ga0070673_100023649 | 3300005364 | Bacteria | 4492 |
| 59 | Ga0070673_100066805 | 3300005364 | Bacteria | 2874 |
| 60 | Ga0070673_100201593 | 3300005364 | Bacteria | 1714 |
| 61 | Ga0070673_100246687 | 3300005364 | Bacteria | 1555 |
| 62 | Ga0070673_100323817 | 3300005364 | Bacteria | 1362 |
| 63 | Ga0070688_100229994 | 3300005365 | Archaea | 1311 |
| 64 | Ga0070688_100443521 | 3300005365 | Bacteria | 969 |
| 65 | Ga0070688_100466105 | 3300005365 | Bacteria | 947 |
| 66 | Ga0070659_100043757 | 3300005366 | Unclassified | 3503 |
| 67 | Ga0070659_100184786 | 3300005366 | Bacteria | 1711 |
| 68 | Ga0070667_100072696 | 3300005367 | Bacteria | 2931 |
| 69 | Ga0070667_100082239 | 3300005367 | Bacteria | 2757 |
| 70 | Ga0070667_100082948 | 3300005367 | Bacteria | 2745 |
| 71 | Ga0070667_100163950 | 3300005367 | Bacteria | 1959 |
| 72 | Ga0070667_100560439 | 3300005367 | Bacteria | 1051 |
| 73 | Ga0070713_100011378 | 3300005436 | Bacteria | 6479 |
| 74 | Ga0070713_100025278 | 3300005436 | Bacteria | 4640 |
| 75 | Ga0070713_100181065 | 3300005436 | Bacteria | 1894 |
| 76 | Ga0070713_100724831 | 3300005436 | Bacteria | 950 |
| 77 | Ga0070713_100808371 | 3300005436 | Bacteria | 899 |
| 78 | Ga0070710_10339695 | 3300005437 | Bacteria | 991 |
| 79 | Ga0070701_10049956 | 3300005438 | Bacteria | 2164 |
| 80 | Ga0070711_100069704 | 3300005439 | Bacteria | 2474 |
| 81 | Ga0070711_100514942 | 3300005439 | Bacteria | 988 |
| 82 | Ga0070705_100305830 | 3300005440 | Bacteria | 1141 |
| 83 | Ga0070700_100001632 | 3300005441 | Bacteria | 11208 |
| 84 | Ga0070694_100065444 | 3300005444 | Bacteria | 2490 |
| 85 | Ga0070694_100083783 | 3300005444 | Bacteria | 2223 |
| 86 | Ga0070694_100387784 | 3300005444 | Bacteria | 1091 |
| 87 | Ga0070663_100087079 | 3300005455 | Bacteria | 2308 |
| 88 | Ga0070678_100273146 | 3300005456 | Bacteria | 1426 |
| 89 | Ga0070662_100022723 | 3300005457 | Bacteria | 4297 |
| 90 | Ga0070662_100101600 | 3300005457 | Bacteria | 2177 |
| 91 | Ga0070662_100231891 | 3300005457 | Bacteria | 1477 |
| 92 | Ga0070681_10072278 | 3300005458 | Bacteria | 3412 |
| 93 | Ga0070681_10093516 | 3300005458 | Bacteria | 2955 |
| 94 | Ga0070681_10379789 | 3300005458 | Bacteria | 1324 |
| 95 | Ga0068867_100021545 | 3300005459 | Bacteria | 4599 |
| 96 | Ga0068867_100033466 | 3300005459 | Bacteria | 3722 |
| 97 | Ga0068867_100085376 | 3300005459 | Bacteria | 2386 |
| 98 | Ga0068867_100325983 | 3300005459 | Bacteria | 1274 |
| 99 | Ga0070685_10536405 | 3300005466 | Bacteria | 833 |
| 100 | Ga0070706_100004393 | 3300005467 | Bacteria | 13616 |
| 101 | Ga0070706_100077523 | 3300005467 | Bacteria | 3076 |
| 102 | Ga0070707_100003828 | 3300005468 | Bacteria | 14183 |
| 103 | Ga0070707_100203689 | 3300005468 | Bacteria | 1929 |
| 104 | Ga0070698_100014652 | 3300005471 | Bacteria | 8285 |
| 105 | Ga0070698_100108751 | 3300005471 | Bacteria | 2739 |
| 106 | Ga0070698_100357158 | 3300005471 | Bacteria | 1393 |
| 107 | Ga0070699_100000875 | 3300005518 | Bacteria | 28029 |
| 108 | Ga0070684_100007408 | 3300005535 | Bacteria | 8527 |
| 109 | Ga0070684_100007644 | 3300005535 | Bacteria | 8427 |
| 110 | Ga0070684_100042326 | 3300005535 | Unclassified | 3931 |
| 111 | Ga0070684_100838806 | 3300005535 | Bacteria | 860 |
| 112 | Ga0068853_100101024 | 3300005539 | Unclassified | 2550 |
| 113 | Ga0068853_100150560 | 3300005539 | Bacteria | 2094 |
| 114 | Ga0068853_100363828 | 3300005539 | Bacteria | 1348 |
| 115 | Ga0068853_100738297 | 3300005539 | Unclassified | 940 |
| 116 | Ga0070672_100001694 | 3300005543 | Bacteria | 13762 |
| 117 | Ga0070672_100082506 | 3300005543 | Bacteria | 2579 |
| 118 | Ga0070672_100126706 | 3300005543 | Bacteria | 2095 |
| 119 | Ga0070686_100044340 | 3300005544 | Bacteria | 2795 |
| 120 | Ga0070686_100098881 | 3300005544 | Unclassified | 1967 |
| 121 | Ga0070686_100110702 | 3300005544 | Bacteria | 1870 |
| 122 | Ga0070695_100081632 | 3300005545 | Bacteria | 2140 |
| 123 | Ga0070696_100088620 | 3300005546 | Bacteria | 2200 |
| 124 | Ga0070665_100004087 | 3300005548 | Bacteria | 15342 |
| 125 | Ga0070665_100153131 | 3300005548 | Bacteria | 2308 |
| 126 | Ga0070665_100499736 | 3300005548 | Unclassified | 1227 |
| 127 | Ga0070665_100583453 | 3300005548 | Bacteria | 1131 |
| 128 | Ga0070704_100003332 | 3300005549 | Bacteria | 9195 |
| 129 | Ga0070704_100105274 | 3300005549 | Bacteria | 2135 |
| 130 | Ga0070704_100511939 | 3300005549 | Bacteria | 1043 |
| 131 | Ga0070704_100825013 | 3300005549 | Bacteria | 830 |
| 132 | Ga0068855_100001557 | 3300005563 | Bacteria | 28824 |
| 133 | Ga0068855_100009822 | 3300005563 | Bacteria | 11545 |
| 134 | Ga0068855_100014867 | 3300005563 | Bacteria | 9374 |
| 135 | Ga0068855_100047694 | 3300005563 | Bacteria | 5060 |
| 136 | Ga0068855_100152601 | 3300005563 | Bacteria | 2626 |
| 137 | Ga0068855_100213834 | 3300005563 | Bacteria | 2165 |
| 138 | Ga0068855_100776972 | 3300005563 | Bacteria | 1019 |
| 139 | Ga0068855_101000435 | 3300005563 | Unclassified | 878 |
| 140 | Ga0070664_100007205 | 3300005564 | Bacteria | 8971 |
| 141 | Ga0070664_100007317 | 3300005564 | Bacteria | 8903 |
| 142 | Ga0070664_100148442 | 3300005564 | Bacteria | 2069 |
| 143 | Ga0070664_100315645 | 3300005564 | Bacteria | 1415 |
| 144 | Ga0070664_100644939 | 3300005564 | Bacteria | 984 |
| 145 | Ga0068857_100011025 | 3300005577 | Bacteria | 7869 |
| 146 | Ga0068857_100095755 | 3300005577 | Bacteria | 2660 |
| 147 | Ga0068857_100140302 | 3300005577 | Bacteria | 2184 |
| 148 | Ga0068857_100143645 | 3300005577 | Bacteria | 2158 |
| 149 | Ga0068854_100021040 | 3300005578 | Unclassified | 4423 |
| 150 | Ga0068856_100003142 | 3300005614 | Bacteria | 16839 |
| 151 | Ga0068856_100006380 | 3300005614 | Bacteria | 11569 |
| 152 | Ga0068856_100066042 | 3300005614 | Unclassified | 3575 |
| 153 | Ga0068856_100129805 | 3300005614 | Unclassified | 2525 |
| 154 | Ga0068856_100163931 | 3300005614 | Bacteria | 2234 |
| 155 | Ga0068856_100405723 | 3300005614 | Bacteria | 1382 |
| 156 | Ga0068856_100466278 | 3300005614 | Eukaryota | 1284 |
| 157 | Ga0068852_100032351 | 3300005616 | Unclassified | 4330 |
| 158 | Ga0068852_100180611 | 3300005616 | Bacteria | 1984 |
| 159 | Ga0068852_100210805 | 3300005616 | Bacteria | 1843 |
| 160 | Ga0068852_100903455 | 3300005616 | Bacteria | 900 |
| 161 | Ga0068859_100001734 | 3300005617 | Bacteria | 22220 |
| 162 | Ga0068859_100004423 | 3300005617 | Bacteria | 14339 |
| 163 | Ga0068859_100431213 | 3300005617 | Bacteria | 1415 |
| 164 | Ga0068859_100768319 | 3300005617 | Bacteria | 1052 |
| 165 | Ga0068864_100003613 | 3300005618 | Bacteria | 12788 |
| 166 | Ga0068864_100263442 | 3300005618 | Bacteria | 1604 |
| 167 | Ga0068866_10010753 | 3300005718 | Bacteria | 3934 |
| 168 | Ga0068866_10232944 | 3300005718 | Bacteria | 1118 |
| 169 | Ga0068866_10456362 | 3300005718 | Bacteria | 837 |
| 170 | Ga0068861_100025559 | 3300005719 | Bacteria | 4284 |
| 171 | Ga0068861_100051526 | 3300005719 | Bacteria | 3125 |
| 172 | Ga0068861_100110659 | 3300005719 | Bacteria | 2200 |
| 173 | Ga0068861_100153647 | 3300005719 | Bacteria | 1891 |
| 174 | Ga0068861_100204700 | 3300005719 | Bacteria | 1659 |
| 175 | Ga0068861_100453585 | 3300005719 | Bacteria | 1149 |
| 176 | Ga0068861_100725587 | 3300005719 | Bacteria | 926 |
| 177 | Ga0068851_10332069 | 3300005834 | Unclassified | 881 |
| 178 | Ga0068870_10201428 | 3300005840 | Bacteria | 1207 |
| 179 | Ga0068863_100053375 | 3300005841 | Archaea | 3831 |
| 180 | Ga0068863_100066682 | 3300005841 | Unclassified | 3405 |
| 181 | Ga0068863_100114859 | 3300005841 | Bacteria | 2565 |
| 182 | Ga0068863_100171821 | 3300005841 | Unclassified | 2079 |
| 183 | Ga0068863_100198611 | 3300005841 | Bacteria | 1928 |
| 184 | Ga0068863_100342225 | 3300005841 | Bacteria | 1455 |
| 185 | Ga0068863_100475219 | 3300005841 | Bacteria | 1228 |
| 186 | Ga0068858_100007279 | 3300005842 | Bacteria | 10723 |
| 187 | Ga0068858_100012093 | 3300005842 | Bacteria | 8136 |
| 188 | Ga0068858_100015353 | 3300005842 | Bacteria | 7202 |
| 189 | Ga0068858_100023284 | 3300005842 | Bacteria | 5771 |
| 190 | Ga0068858_100032999 | 3300005842 | Bacteria | 4808 |
| 191 | Ga0068858_100170495 | 3300005842 | Bacteria | 2052 |
| 192 | Ga0068860_100017221 | 3300005843 | Bacteria | 7043 |
| 193 | Ga0068860_100031737 | 3300005843 | Bacteria | 5079 |
| 194 | Ga0068860_100273388 | 3300005843 | Bacteria | 1649 |
| 195 | Ga0068860_100282331 | 3300005843 | Bacteria | 1623 |
| 196 | Ga0068860_100297603 | 3300005843 | Bacteria | 1580 |
| 197 | Ga0068860_100376983 | 3300005843 | Bacteria | 1400 |
| 198 | Ga0068860_100476081 | 3300005843 | Bacteria | 1244 |
| 199 | Ga0068862_100154944 | 3300005844 | Bacteria | 2042 |
| 200 | Ga0068862_100259555 | 3300005844 | Bacteria | 1586 |
| 201 | Ga0068862_100327219 | 3300005844 | Bacteria | 1416 |
| 202 | Ga0070717_10015510 | 3300006028 | Bacteria | 5888 |
| 203 | Ga0070717_10321859 | 3300006028 | Unclassified | 1378 |
| 204 | Ga0070712_100032433 | 3300006175 | Bacteria | 3528 |
| 205 | Ga0097621_100005568 | 3300006237 | Bacteria | 8881 |
| 206 | Ga0097621_100006771 | 3300006237 | Bacteria | 8138 |
| 207 | Ga0097621_100007326 | 3300006237 | Bacteria | 7886 |
| 208 | Ga0097621_100011511 | 3300006237 | Bacteria | 6518 |
| 209 | Ga0097621_100047814 | 3300006237 | Bacteria | 3467 |
| 210 | Ga0097621_100062808 | 3300006237 | Bacteria | 3050 |
| 211 | Ga0097621_100118314 | 3300006237 | Bacteria | 2245 |
| 212 | Ga0097621_100409269 | 3300006237 | Bacteria | 1215 |
| 213 | Ga0068871_100005892 | 3300006358 | Bacteria | 8617 |
| 214 | Ga0068871_100013531 | 3300006358 | Bacteria | 6056 |
| 215 | Ga0068871_100016427 | 3300006358 | Bacteria | 5574 |
| 216 | Ga0068871_100018946 | 3300006358 | Bacteria | 5246 |
| 217 | Ga0068871_100023980 | 3300006358 | Unclassified | 4727 |
| 218 | Ga0068871_100043261 | 3300006358 | Bacteria | 3618 |
| 219 | Ga0068871_100054353 | 3300006358 | Bacteria | 3249 |
| 220 | Ga0068871_100099886 | 3300006358 | Unclassified | 2430 |
| 221 | Ga0068871_100152043 | 3300006358 | Unclassified | 1974 |
| 222 | Ga0068871_100194424 | 3300006358 | Bacteria | 1749 |
| 223 | Ga0068871_100231568 | 3300006358 | Bacteria | 1603 |
| 224 | Ga0068871_100247047 | 3300006358 | Bacteria | 1553 |
| 225 | Ga0068871_100575110 | 3300006358 | Bacteria | 1022 |
| 226 | Ga0068871_100681286 | 3300006358 | Bacteria | 941 |
| 227 | Ga0075428_100000019 | 3300006844 | Bacteria | 137803 |
| 228 | Ga0075428_100006790 | 3300006844 | Bacteria | 12736 |
| 229 | Ga0075428_100009289 | 3300006844 | Bacteria | 10901 |
| 230 | Ga0075428_100023052 | 3300006844 | Bacteria | 6889 |
| 231 | Ga0075428_100799367 | 3300006844 | Bacteria | 1003 |
| 232 | Ga0075430_100034914 | 3300006846 | Bacteria | 4269 |
| 233 | Ga0075430_100113743 | 3300006846 | Bacteria | 2256 |
| 234 | Ga0075430_100173636 | 3300006846 | Bacteria | 1793 |
| 235 | Ga0075431_100000914 | 3300006847 | Bacteria | 26009 |
| 236 | Ga0075431_100023001 | 3300006847 | Bacteria | 6370 |
| 237 | Ga0075431_100040152 | 3300006847 | Bacteria | 4822 |
| 238 | Ga0075431_100088438 | 3300006847 | Unclassified | 3197 |
| 239 | Ga0075431_100169520 | 3300006847 | Bacteria | 2243 |
| 240 | Ga0075433_10021120 | 3300006852 | Bacteria | 5456 |
| 241 | Ga0075433_10080599 | 3300006852 | Bacteria | 2870 |
| 242 | Ga0075433_10311480 | 3300006852 | Unclassified | 1393 |
| 243 | Ga0075434_100031003 | 3300006871 | Bacteria | 5270 |
| 244 | Ga0075434_100086245 | 3300006871 | Unclassified | 3139 |
| 245 | Ga0075429_100012100 | 3300006880 | Bacteria | 7478 |
| 246 | Ga0075429_100076018 | 3300006880 | Bacteria | 2925 |
| 247 | Ga0075429_100482109 | 3300006880 | Bacteria | 1087 |
| 248 | Ga0068865_100008234 | 3300006881 | Bacteria | 6436 |
| 249 | Ga0068865_100011766 | 3300006881 | Bacteria | 5482 |
| 250 | Ga0068865_100060820 | 3300006881 | Bacteria | 2645 |
| 251 | Ga0068865_100460680 | 3300006881 | Bacteria | 1053 |
| 252 | Ga0097620_100001734 | 3300006931 | Bacteria | 22220 |
| 253 | Ga0097620_100004423 | 3300006931 | Bacteria | 14339 |
| 254 | Ga0097620_100431247 | 3300006931 | Bacteria | 1415 |
| 255 | Ga0097620_100768304 | 3300006931 | Bacteria | 1052 |
| 256 | Ga0075435_100554134 | 3300007076 | Bacteria | 996 |
| 257 | Ga0099794_10030342 | 3300007265 | Bacteria | 2524 |
| 258 | Ga0099795_10154082 | 3300007788 | Bacteria | 943 |
| 259 | Ga0105240_10001330 | 3300009093 | Bacteria | 42531 |
| 260 | Ga0105240_10005789 | 3300009093 | Bacteria | 18334 |
| 261 | Ga0105240_10008052 | 3300009093 | Bacteria | 15167 |
| 262 | Ga0105240_10025249 | 3300009093 | Bacteria | 7812 |
| 263 | Ga0105240_10254118 | 3300009093 | Bacteria | 2031 |
| 264 | Ga0105240_10454277 | 3300009093 | Bacteria | 1433 |
| 265 | Ga0105240_10511859 | 3300009093 | Bacteria | 1333 |
| 266 | Ga0105240_10700341 | 3300009093 | Unclassified | 1106 |
| 267 | Ga0105240_10730359 | 3300009093 | Bacteria | 1078 |
| 268 | Ga0111539_10000002 | 3300009094 | Bacteria | 983359 |
| 269 | Ga0111539_10058550 | 3300009094 | Bacteria | 4571 |
| 270 | Ga0111539_10359843 | 3300009094 | Unclassified | 1694 |
| 271 | Ga0111539_10983809 | 3300009094 | Bacteria | 981 |
| 272 | Ga0111539_11241595 | 3300009094 | Bacteria | 865 |
| 273 | Ga0105245_10003921 | 3300009098 | Bacteria | 13224 |
| 274 | Ga0105245_10004784 | 3300009098 | Bacteria | 11948 |
| 275 | Ga0105245_10015086 | 3300009098 | Bacteria | 6731 |
| 276 | Ga0105245_10015179 | 3300009098 | Bacteria | 6710 |
| 277 | Ga0105245_10018883 | 3300009098 | Bacteria | 6033 |
| 278 | Ga0105245_10019679 | 3300009098 | Bacteria | 5915 |
| 279 | Ga0105245_10045083 | 3300009098 | Bacteria | 3937 |
| 280 | Ga0105245_10047016 | 3300009098 | Bacteria | 3857 |
| 281 | Ga0105245_10104026 | 3300009098 | Bacteria | 2632 |
| 282 | Ga0105245_10119235 | 3300009098 | Bacteria | 2463 |
| 283 | Ga0105245_10254073 | 3300009098 | Bacteria | 1709 |
| 284 | Ga0105245_10651823 | 3300009098 | Bacteria | 1083 |
| 285 | Ga0114129_10000155 | 3300009147 | Bacteria | 72923 |
| 286 | Ga0114129_10011725 | 3300009147 | Bacteria | 12473 |
| 287 | Ga0114129_10017965 | 3300009147 | Bacteria | 10071 |
| 288 | Ga0114129_10029504 | 3300009147 | Bacteria | 7770 |
| 289 | Ga0114129_10094556 | 3300009147 | Bacteria | 4139 |
| 290 | Ga0114129_10173617 | 3300009147 | Bacteria | 2937 |
| 291 | Ga0114129_10195313 | 3300009147 | Unclassified | 2745 |
| 292 | Ga0114129_10259513 | 3300009147 | Bacteria | 2330 |
| 293 | Ga0114129_10491830 | 3300009147 | Bacteria | 1603 |
| 294 | Ga0114129_11074232 | 3300009147 | Bacteria | 1009 |
| 295 | Ga0105243_10019430 | 3300009148 | Bacteria | 5152 |
| 296 | Ga0105243_10066698 | 3300009148 | Bacteria | 2895 |
| 297 | Ga0105243_10168216 | 3300009148 | Bacteria | 1896 |
| 298 | Ga0105243_10199346 | 3300009148 | Bacteria | 1754 |
| 299 | Ga0105243_10291081 | 3300009148 | Bacteria | 1475 |
| 300 | Ga0105241_10010069 | 3300009174 | Bacteria | 6942 |
| 301 | Ga0105241_10010616 | 3300009174 | Bacteria | 6754 |
| 302 | Ga0105241_10168439 | 3300009174 | Bacteria | 1807 |
| 303 | Ga0105241_10169075 | 3300009174 | Bacteria | 1804 |
| 304 | Ga0105241_10227616 | 3300009174 | Bacteria | 1570 |
| 305 | Ga0105241_10338474 | 3300009174 | Bacteria | 1303 |
| 306 | Ga0105242_10003209 | 3300009176 | Bacteria | 12731 |
| 307 | Ga0105242_10004802 | 3300009176 | Bacteria | 10459 |
| 308 | Ga0105242_10013007 | 3300009176 | Bacteria | 6419 |
| 309 | Ga0105242_10014276 | 3300009176 | Bacteria | 6153 |
| 310 | Ga0105242_10049223 | 3300009176 | Bacteria | 3429 |
| 311 | Ga0105242_10086644 | 3300009176 | Bacteria | 2628 |
| 312 | Ga0105242_10129960 | 3300009176 | Bacteria | 2173 |
| 313 | Ga0105242_10287860 | 3300009176 | Bacteria | 1495 |
| 314 | Ga0105242_10335522 | 3300009176 | Bacteria | 1392 |
| 315 | Ga0105248_10001841 | 3300009177 | Bacteria | 23501 |
| 316 | Ga0105248_10009082 | 3300009177 | Bacteria | 10932 |
| 317 | Ga0105248_10013147 | 3300009177 | Bacteria | 9113 |
| 318 | Ga0105248_10019625 | 3300009177 | Bacteria | 7482 |
| 319 | Ga0105248_10027712 | 3300009177 | Bacteria | 6309 |
| 320 | Ga0105248_10047477 | 3300009177 | Bacteria | 4815 |
| 321 | Ga0105248_10068707 | 3300009177 | Bacteria | 3978 |
| 322 | Ga0105248_10116151 | 3300009177 | Bacteria | 3018 |
| 323 | Ga0105248_10142009 | 3300009177 | Bacteria | 2709 |
| 324 | Ga0105248_10168306 | 3300009177 | Bacteria | 2470 |
| 325 | Ga0105248_10217253 | 3300009177 | Unclassified | 2153 |
| 326 | Ga0105248_10450458 | 3300009177 | Bacteria | 1450 |
| 327 | Ga0105248_10767645 | 3300009177 | Bacteria | 1088 |
| 328 | Ga0105248_10771186 | 3300009177 | Bacteria | 1085 |
| 329 | Ga0105237_10009655 | 3300009545 | Bacteria | 10326 |
| 330 | Ga0105237_10025571 | 3300009545 | Bacteria | 6034 |
| 331 | Ga0105237_10075686 | 3300009545 | Bacteria | 3357 |
| 332 | Ga0105237_10247602 | 3300009545 | Bacteria | 1784 |
| 333 | Ga0105237_10389168 | 3300009545 | Bacteria | 1399 |
| 334 | Ga0105237_10408572 | 3300009545 | Bacteria | 1362 |
| 335 | Ga0105238_10001988 | 3300009551 | Bacteria | 20594 |
| 336 | Ga0105238_10014783 | 3300009551 | Bacteria | 7894 |
| 337 | Ga0105238_10017173 | 3300009551 | Bacteria | 7349 |
| 338 | Ga0105238_10032711 | 3300009551 | Bacteria | 5293 |
| 339 | Ga0105238_10049845 | 3300009551 | Bacteria | 4216 |
| 340 | Ga0105238_10060696 | 3300009551 | Bacteria | 3785 |
| 341 | Ga0105238_10153791 | 3300009551 | Bacteria | 2275 |
| 342 | Ga0105238_10348091 | 3300009551 | Bacteria | 1471 |
| 343 | Ga0105238_10370196 | 3300009551 | Bacteria | 1423 |
| 344 | Ga0105238_10642085 | 3300009551 | Unclassified | 1071 |
| 345 | Ga0105249_10009517 | 3300009553 | Bacteria | 8514 |
| 346 | Ga0105239_10010683 | 3300010375 | Bacteria | 10266 |
| 347 | Ga0105239_10011071 | 3300010375 | Bacteria | 10068 |
| 348 | Ga0105239_10028364 | 3300010375 | Bacteria | 6158 |
| 349 | Ga0105239_10029627 | 3300010375 | Bacteria | 6017 |
| 350 | Ga0105239_10529675 | 3300010375 | Bacteria | 1341 |
| 351 | Ga0105246_10013333 | 3300011119 | Bacteria | 5151 |
| 352 | Ga0105246_10027766 | 3300011119 | Bacteria | 3713 |
| 353 | Ga0105246_10225611 | 3300011119 | Unclassified | 1472 |
| 354 | Ga0105246_10285079 | 3300011119 | Bacteria | 1327 |
| 355 | Ga0105246_10303823 | 3300011119 | Bacteria | 1290 |
| 356 | Ga0105246_10584421 | 3300011119 | Unclassified | 962 |
| 357 | Ga0157370_10001733 | 3300013104 | Bacteria | 26851 |
| 358 | Ga0157370_10003270 | 3300013104 | Bacteria | 19098 |
| 359 | Ga0157370_10032457 | 3300013104 | Bacteria | 5099 |
| 360 | Ga0157370_10132190 | 3300013104 | Bacteria | 2327 |
| 361 | Ga0157370_10239498 | 3300013104 | Bacteria | 1679 |
| 362 | Ga0157369_10004743 | 3300013105 | Bacteria | 15975 |
| 363 | Ga0157369_10010200 | 3300013105 | Bacteria | 10718 |
| 364 | Ga0157369_10040053 | 3300013105 | Bacteria | 5118 |
| 365 | Ga0157369_10085323 | 3300013105 | Bacteria | 3374 |
| 366 | Ga0157374_10063327 | 3300013296 | Bacteria | 3468 |
| 367 | Ga0157374_10067952 | 3300013296 | Bacteria | 3352 |
| 368 | Ga0157374_10069124 | 3300013296 | Bacteria | 3325 |
| 369 | Ga0157374_10072565 | 3300013296 | Bacteria | 3248 |
| 370 | Ga0157374_10222409 | 3300013296 | Bacteria | 1853 |
| 371 | Ga0157374_10310016 | 3300013296 | Bacteria | 1562 |
| 372 | Ga0157374_10421479 | 3300013296 | Bacteria | 1334 |
| 373 | Ga0157378_10001898 | 3300013297 | Bacteria | 18768 |
| 374 | Ga0157378_10003929 | 3300013297 | Bacteria | 13155 |
| 375 | Ga0157378_10012987 | 3300013297 | Bacteria | 7285 |
| 376 | Ga0157378_10115656 | 3300013297 | Unclassified | 2465 |
| 377 | Ga0157378_10179491 | 3300013297 | Bacteria | 1991 |
| 378 | Ga0157378_10180595 | 3300013297 | Bacteria | 1985 |
| 379 | Ga0157378_10218029 | 3300013297 | Bacteria | 1813 |
| 380 | Ga0157378_10297574 | 3300013297 | Bacteria | 1561 |
| 381 | Ga0157378_10578752 | 3300013297 | Bacteria | 1132 |
| 382 | Ga0157378_10625605 | 3300013297 | Bacteria | 1090 |
| 383 | Ga0157378_10784376 | 3300013297 | Unclassified | 978 |
| 384 | Ga0163162_10003543 | 3300013306 | Bacteria | 14933 |
| 385 | Ga0163162_10016295 | 3300013306 | Bacteria | 7266 |
| 386 | Ga0163162_10104866 | 3300013306 | Bacteria | 2921 |
| 387 | Ga0163162_10209912 | 3300013306 | Bacteria | 2077 |
| 388 | Ga0163162_10243951 | 3300013306 | Bacteria | 1928 |
| 389 | Ga0163162_10253751 | 3300013306 | Bacteria | 1891 |
| 390 | Ga0163162_10513070 | 3300013306 | Bacteria | 1329 |
| 391 | Ga0163162_10779527 | 3300013306 | Bacteria | 1074 |
| 392 | Ga0163162_11351926 | 3300013306 | Bacteria | 810 |
| 393 | Ga0157372_10088667 | 3300013307 | Bacteria | 3513 |
| 394 | Ga0157372_10094141 | 3300013307 | Bacteria | 3410 |
| 395 | Ga0157372_10144222 | 3300013307 | Bacteria | 2746 |
| 396 | Ga0157372_10266572 | 3300013307 | Unclassified | 1989 |
| 397 | Ga0157375_10005323 | 3300013308 | Bacteria | 11181 |
| 398 | Ga0157375_10064400 | 3300013308 | Bacteria | 3650 |
| 399 | Ga0157375_10081184 | 3300013308 | Bacteria | 3282 |
| 400 | Ga0157375_10365727 | 3300013308 | Unclassified | 1609 |
| 401 | Ga0157375_10533105 | 3300013308 | Bacteria | 1337 |
| 402 | Ga0157375_10536502 | 3300013308 | Bacteria | 1332 |
| 403 | Ga0157375_10623852 | 3300013308 | Bacteria | 1236 |
| 404 | Ga0157375_10661389 | 3300013308 | Unclassified | 1200 |
| 405 | Ga0157375_10681028 | 3300013308 | Unclassified | 1183 |
| 406 | Ga0157375_10722039 | 3300013308 | Bacteria | 1149 |
| 407 | Ga0157375_11344250 | 3300013308 | Bacteria | 841 |
| 408 | Ga0163163_10005414 | 3300014325 | Bacteria | 11036 |
| 409 | Ga0163163_10006715 | 3300014325 | Bacteria | 10085 |
| 410 | Ga0163163_10015575 | 3300014325 | Bacteria | 7031 |
| 411 | Ga0163163_10027228 | 3300014325 | Bacteria | 5474 |
| 412 | Ga0163163_10033698 | 3300014325 | Bacteria | 4957 |
| 413 | Ga0163163_10078549 | 3300014325 | Bacteria | 3297 |
| 414 | Ga0163163_10102741 | 3300014325 | Unclassified | 2882 |
| 415 | Ga0163163_10171701 | 3300014325 | Bacteria | 2215 |
| 416 | Ga0163163_10220085 | 3300014325 | Bacteria | 1947 |
| 417 | Ga0163163_10278708 | 3300014325 | Bacteria | 1723 |
| 418 | Ga0163163_10413896 | 3300014325 | Bacteria | 1407 |
| 419 | Ga0163163_10570566 | 3300014325 | Bacteria | 1194 |
| 420 | Ga0163163_10623996 | 3300014325 | Bacteria | 1141 |
| 421 | Ga0163163_10897605 | 3300014325 | Bacteria | 950 |
| 422 | Ga0163163_10899258 | 3300014325 | Bacteria | 949 |
| 423 | Ga0157380_10039169 | 3300014326 | Bacteria | 3685 |
| 424 | Ga0157380_10089306 | 3300014326 | Unclassified | 2538 |
| 425 | Ga0157380_10120262 | 3300014326 | Bacteria | 2224 |
| 426 | Ga0157380_10150459 | 3300014326 | Bacteria | 2011 |
| 427 | Ga0157380_10242050 | 3300014326 | Bacteria | 1627 |
| 428 | Ga0157380_10268174 | 3300014326 | Bacteria | 1555 |
| 429 | Ga0157380_10469449 | 3300014326 | Bacteria | 1214 |
| 430 | Ga0157380_10572221 | 3300014326 | Bacteria | 1112 |
| 431 | Ga0157379_10018470 | 3300014968 | Bacteria | 6149 |
| 432 | Ga0157379_10063826 | 3300014968 | Bacteria | 3292 |
| 433 | Ga0157379_10508449 | 3300014968 | Bacteria | 1117 |
| 434 | Ga0157379_10527357 | 3300014968 | Bacteria | 1097 |
| 435 | Ga0157379_10596119 | 3300014968 | Bacteria | 1031 |
| 436 | Ga0157376_10010212 | 3300014969 | Bacteria | 6856 |
| 437 | Ga0157376_10108109 | 3300014969 | Bacteria | 2443 |
| 438 | Ga0157376_10120322 | 3300014969 | Unclassified | 2326 |
| 439 | Ga0157376_10143468 | 3300014969 | Bacteria | 2145 |
| 440 | Ga0157376_10201002 | 3300014969 | Bacteria | 1834 |
| 441 | Ga0157376_10322746 | 3300014969 | Bacteria | 1468 |
| 442 | Ga0157376_10398599 | 3300014969 | Bacteria | 1330 |
| 443 | Ga0163161_10292902 | 3300017792 | Bacteria | 1280 |
| 444 | Ga0207656_10230793 | 3300025321 | Unclassified | 902 |
| 445 | Ga0207642_10124897 | 3300025899 | Bacteria | 1333 |
| 446 | Ga0207688_10149985 | 3300025901 | Bacteria | 1377 |
| 447 | Ga0207680_10034792 | 3300025903 | Bacteria | 2885 |
| 448 | Ga0207680_10034916 | 3300025903 | Unclassified | 2881 |
| 449 | Ga0207680_10511611 | 3300025903 | Unclassified | 856 |
| 450 | Ga0207645_10001872 | 3300025907 | Bacteria | 16990 |
| 451 | Ga0207645_10064264 | 3300025907 | Bacteria | 2345 |
| 452 | Ga0207645_10075966 | 3300025907 | Bacteria | 2151 |
| 453 | Ga0207684_10027292 | 3300025910 | Bacteria | 4867 |
| 454 | Ga0207684_10071202 | 3300025910 | Bacteria | 2955 |
| 455 | Ga0207654_10007504 | 3300025911 | Bacteria | 5496 |
| 456 | Ga0207654_10008176 | 3300025911 | Bacteria | 5278 |
| 457 | Ga0207654_10055078 | 3300025911 | Unclassified | 2301 |
| 458 | Ga0207654_10231162 | 3300025911 | Bacteria | 1231 |
| 459 | Ga0207707_10000684 | 3300025912 | Bacteria | 33633 |
| 460 | Ga0207707_10112457 | 3300025912 | Bacteria | 2380 |
| 461 | Ga0207707_10148104 | 3300025912 | Bacteria | 2052 |
| 462 | Ga0207707_10293890 | 3300025912 | Bacteria | 1405 |
| 463 | Ga0207695_10002411 | 3300025913 | Bacteria | 27678 |
| 464 | Ga0207695_10013324 | 3300025913 | Bacteria | 9811 |
| 465 | Ga0207695_10017685 | 3300025913 | Bacteria | 8282 |
| 466 | Ga0207695_10019139 | 3300025913 | Bacteria | 7891 |
| 467 | Ga0207695_10125494 | 3300025913 | Bacteria | 2530 |
| 468 | Ga0207695_10375259 | 3300025913 | Bacteria | 1308 |
| 469 | Ga0207695_10458774 | 3300025913 | Bacteria | 1157 |
| 470 | Ga0207695_10501779 | 3300025913 | Bacteria | 1095 |
| 471 | Ga0207671_10109280 | 3300025914 | Unclassified | 2102 |
| 472 | Ga0207671_10145663 | 3300025914 | Bacteria | 1827 |
| 473 | Ga0207671_10162510 | 3300025914 | Unclassified | 1730 |
| 474 | Ga0207671_10228348 | 3300025914 | Bacteria | 1460 |
| 475 | Ga0207671_10312852 | 3300025914 | Bacteria | 1242 |
| 476 | Ga0207663_10024777 | 3300025916 | Bacteria | 3460 |
| 477 | Ga0207663_10130826 | 3300025916 | Bacteria | 1734 |
| 478 | Ga0207660_10009072 | 3300025917 | Bacteria | 6441 |
| 479 | Ga0207660_10038258 | 3300025917 | Bacteria | 3348 |
| 480 | Ga0207662_10137907 | 3300025918 | Bacteria | 1543 |
| 481 | Ga0207662_10212784 | 3300025918 | Unclassified | 1255 |
| 482 | Ga0207657_10012255 | 3300025919 | Bacteria | 8470 |
| 483 | Ga0207657_10034860 | 3300025919 | Bacteria | 4519 |
| 484 | Ga0207657_10079881 | 3300025919 | Unclassified | 2751 |
| 485 | Ga0207649_10146318 | 3300025920 | Bacteria | 1622 |
| 486 | Ga0207652_10031216 | 3300025921 | Bacteria | 4473 |
| 487 | Ga0207652_10152293 | 3300025921 | Bacteria | 2071 |
| 488 | Ga0207646_10062415 | 3300025922 | Bacteria | 3327 |
| 489 | Ga0207646_10088273 | 3300025922 | Bacteria | 2774 |
| 490 | Ga0207681_10027372 | 3300025923 | Bacteria | 3685 |
| 491 | Ga0207681_10037039 | 3300025923 | Bacteria | 3222 |
| 492 | Ga0207681_10104848 | 3300025923 | Bacteria | 2046 |
| 493 | Ga0207681_10168940 | 3300025923 | Bacteria | 1656 |
| 494 | Ga0207694_10003273 | 3300025924 | Bacteria | 12910 |
| 495 | Ga0207694_10003730 | 3300025924 | Bacteria | 12070 |
| 496 | Ga0207694_10015269 | 3300025924 | Bacteria | 5794 |
| 497 | Ga0207694_10029198 | 3300025924 | Bacteria | 4206 |
| 498 | Ga0207694_10087637 | 3300025924 | Unclassified | 2452 |
| 499 | Ga0207694_10105887 | 3300025924 | Bacteria | 2233 |
| 500 | Ga0207694_10232241 | 3300025924 | Bacteria | 1506 |
| 501 | Ga0207694_10365277 | 3300025924 | Bacteria | 1196 |
| 502 | Ga0207650_10022870 | 3300025925 | Bacteria | 4429 |
| 503 | Ga0207650_10052007 | 3300025925 | Bacteria | 3033 |
| 504 | Ga0207659_10031579 | 3300025926 | Bacteria | 3627 |
| 505 | Ga0207659_10033418 | 3300025926 | Bacteria | 3540 |
| 506 | Ga0207659_10085404 | 3300025926 | Bacteria | 2345 |
| 507 | Ga0207659_10619435 | 3300025926 | Bacteria | 923 |
| 508 | Ga0207687_10000615 | 3300025927 | Bacteria | 24045 |
| 509 | Ga0207687_10002388 | 3300025927 | Bacteria | 12730 |
| 510 | Ga0207687_10015132 | 3300025927 | Bacteria | 5055 |
| 511 | Ga0207687_10022888 | 3300025927 | Bacteria | 4161 |
| 512 | Ga0207687_10031178 | 3300025927 | Bacteria | 3601 |
| 513 | Ga0207687_10032699 | 3300025927 | Unclassified | 3524 |
| 514 | Ga0207687_10042953 | 3300025927 | Unclassified | 3113 |
| 515 | Ga0207687_10071858 | 3300025927 | Bacteria | 2473 |
| 516 | Ga0207687_10361564 | 3300025927 | Bacteria | 1185 |
| 517 | Ga0207700_10007797 | 3300025928 | Bacteria | 6579 |
| 518 | Ga0207700_10016437 | 3300025928 | Bacteria | 4916 |
| 519 | Ga0207700_10162335 | 3300025928 | Unclassified | 1857 |
| 520 | Ga0207700_10403327 | 3300025928 | Bacteria | 1198 |
| 521 | Ga0207700_10788148 | 3300025928 | Bacteria | 850 |
| 522 | Ga0207664_10148545 | 3300025929 | Bacteria | 1989 |
| 523 | Ga0207644_10014418 | 3300025931 | Bacteria | 5288 |
| 524 | Ga0207644_10096761 | 3300025931 | Bacteria | 2210 |
| 525 | Ga0207644_10292988 | 3300025931 | Unclassified | 1309 |
| 526 | Ga0207690_10121896 | 3300025932 | Bacteria | 1895 |
| 527 | Ga0207706_10010848 | 3300025933 | Bacteria | 8313 |
| 528 | Ga0207706_10265246 | 3300025933 | Bacteria | 1499 |
| 529 | Ga0207686_10001799 | 3300025934 | Bacteria | 11917 |
| 530 | Ga0207686_10007390 | 3300025934 | Bacteria | 5915 |
| 531 | Ga0207686_10007614 | 3300025934 | Bacteria | 5835 |
| 532 | Ga0207686_10058827 | 3300025934 | Bacteria | 2425 |
| 533 | Ga0207686_10074536 | 3300025934 | Bacteria | 2193 |
| 534 | Ga0207686_10078201 | 3300025934 | Bacteria | 2150 |
| 535 | Ga0207686_10080439 | 3300025934 | Bacteria | 2124 |
| 536 | Ga0207686_10112162 | 3300025934 | Bacteria | 1841 |
| 537 | Ga0207686_10146652 | 3300025934 | Bacteria | 1638 |
| 538 | Ga0207709_10006604 | 3300025935 | Bacteria | 6512 |
| 539 | Ga0207709_10071855 | 3300025935 | Bacteria | 2199 |
| 540 | Ga0207709_10258662 | 3300025935 | Bacteria | 1275 |
| 541 | Ga0207670_10024442 | 3300025936 | Bacteria | 3775 |
| 542 | Ga0207670_10177664 | 3300025936 | Bacteria | 1601 |
| 543 | Ga0207670_10210646 | 3300025936 | Bacteria | 1482 |
| 544 | Ga0207670_10457480 | 3300025936 | Bacteria | 1030 |
| 545 | Ga0207669_10004816 | 3300025937 | Bacteria | 5991 |
| 546 | Ga0207704_10016459 | 3300025938 | Bacteria | 3801 |
| 547 | Ga0207704_10020800 | 3300025938 | Bacteria | 3480 |
| 548 | Ga0207704_10047949 | 3300025938 | Bacteria | 2558 |
| 549 | Ga0207691_10077819 | 3300025940 | Bacteria | 2987 |
| 550 | Ga0207691_10101394 | 3300025940 | Bacteria | 2569 |
| 551 | Ga0207691_10107778 | 3300025940 | Bacteria | 2480 |
| 552 | Ga0207691_10110974 | 3300025940 | Archaea | 2439 |
| 553 | Ga0207691_10407610 | 3300025940 | Bacteria | 1159 |
| 554 | Ga0207711_10000207 | 3300025941 | Bacteria | 62922 |
| 555 | Ga0207711_10001638 | 3300025941 | Bacteria | 20646 |
| 556 | Ga0207711_10006493 | 3300025941 | Bacteria | 9845 |
| 557 | Ga0207711_10007210 | 3300025941 | Bacteria | 9317 |
| 558 | Ga0207711_10022429 | 3300025941 | Bacteria | 5279 |
| 559 | Ga0207711_10041712 | 3300025941 | Bacteria | 3909 |
| 560 | Ga0207711_10093431 | 3300025941 | Bacteria | 2649 |
| 561 | Ga0207711_10169272 | 3300025941 | Bacteria | 1982 |
| 562 | Ga0207711_10199657 | 3300025941 | Bacteria | 1825 |
| 563 | Ga0207711_10285077 | 3300025941 | Bacteria | 1521 |
| 564 | Ga0207711_10345190 | 3300025941 | Bacteria | 1378 |
| 565 | Ga0207711_10534334 | 3300025941 | Bacteria | 1094 |
| 566 | Ga0207689_10002878 | 3300025942 | Bacteria | 15867 |
| 567 | Ga0207689_10017739 | 3300025942 | Bacteria | 6014 |
| 568 | Ga0207689_10061818 | 3300025942 | Bacteria | 3080 |
| 569 | Ga0207689_10116681 | 3300025942 | Unclassified | 2194 |
| 570 | Ga0207689_10666243 | 3300025942 | Unclassified | 877 |
| 571 | Ga0207661_10005447 | 3300025944 | Bacteria | 8971 |
| 572 | Ga0207661_10009405 | 3300025944 | Bacteria | 7008 |
| 573 | Ga0207661_10015726 | 3300025944 | Bacteria | 5574 |
| 574 | Ga0207661_10062858 | 3300025944 | Bacteria | 3005 |
| 575 | Ga0207661_10429628 | 3300025944 | Bacteria | 1201 |
| 576 | Ga0207679_10017573 | 3300025945 | Bacteria | 4774 |
| 577 | Ga0207679_10125327 | 3300025945 | Bacteria | 2051 |
| 578 | Ga0207679_10146409 | 3300025945 | Bacteria | 1916 |
| 579 | Ga0207679_10309879 | 3300025945 | Bacteria | 1363 |
| 580 | Ga0207679_10390565 | 3300025945 | Bacteria | 1222 |
| 581 | Ga0207679_10599340 | 3300025945 | Bacteria | 993 |
| 582 | Ga0207667_10001255 | 3300025949 | Bacteria | 31815 |
| 583 | Ga0207667_10015370 | 3300025949 | Bacteria | 8700 |
| 584 | Ga0207667_10015668 | 3300025949 | Bacteria | 8599 |
| 585 | Ga0207667_10019763 | 3300025949 | Bacteria | 7509 |
| 586 | Ga0207667_10043664 | 3300025949 | Bacteria | 4756 |
| 587 | Ga0207667_10126843 | 3300025949 | Bacteria | 2629 |
| 588 | Ga0207667_10234170 | 3300025949 | Bacteria | 1880 |
| 589 | Ga0207651_10001469 | 3300025960 | Bacteria | 10719 |
| 590 | Ga0207651_10034021 | 3300025960 | Bacteria | 3295 |
| 591 | Ga0207651_10041524 | 3300025960 | Bacteria | 3054 |
| 592 | Ga0207651_10045725 | 3300025960 | Bacteria | 2938 |
| 593 | Ga0207651_10094790 | 3300025960 | Unclassified | 2196 |
| 594 | Ga0207651_10135196 | 3300025960 | Bacteria | 1895 |
| 595 | Ga0207712_10010889 | 3300025961 | Bacteria | 5789 |
| 596 | Ga0207712_10074850 | 3300025961 | Bacteria | 2446 |
| 597 | Ga0207712_10473253 | 3300025961 | Bacteria | 1066 |
| 598 | Ga0207668_10036119 | 3300025972 | Bacteria | 3296 |
| 599 | Ga0207640_10088904 | 3300025981 | Bacteria | 2134 |
| 600 | Ga0207640_10435884 | 3300025981 | Bacteria | 1076 |
| 601 | Ga0207658_10039244 | 3300025986 | Bacteria | 3416 |
| 602 | Ga0207658_10161180 | 3300025986 | Bacteria | 1838 |
| 603 | Ga0207658_10341024 | 3300025986 | Bacteria | 1302 |
| 604 | Ga0207677_10010460 | 3300026023 | Bacteria | 5249 |
| 605 | Ga0207677_10050312 | 3300026023 | Bacteria | 2818 |
| 606 | Ga0207677_10342878 | 3300026023 | Bacteria | 1249 |
| 607 | Ga0207677_10354736 | 3300026023 | Bacteria | 1230 |
| 608 | Ga0207677_10448855 | 3300026023 | Bacteria | 1105 |
| 609 | Ga0207703_10042849 | 3300026035 | Bacteria | 3631 |
| 610 | Ga0207703_10068429 | 3300026035 | Bacteria | 2925 |
| 611 | Ga0207703_10080218 | 3300026035 | Bacteria | 2717 |
| 612 | Ga0207703_10331621 | 3300026035 | Bacteria | 1396 |
| 613 | Ga0207703_10522471 | 3300026035 | Unclassified | 1117 |
| 614 | Ga0207639_10122814 | 3300026041 | Bacteria | 2136 |
| 615 | Ga0207639_10234835 | 3300026041 | Unclassified | 1591 |
| 616 | Ga0207639_10244257 | 3300026041 | Bacteria | 1563 |
| 617 | Ga0207678_10085842 | 3300026067 | Bacteria | 2690 |
| 618 | Ga0207678_10565836 | 3300026067 | Bacteria | 995 |
| 619 | Ga0207708_10003022 | 3300026075 | Bacteria | 12403 |
| 620 | Ga0207708_10144762 | 3300026075 | Bacteria | 1867 |
| 621 | Ga0207708_10374943 | 3300026075 | Bacteria | 1172 |
| 622 | Ga0207702_10033941 | 3300026078 | Unclassified | 4264 |
| 623 | Ga0207702_10120988 | 3300026078 | Bacteria | 2343 |
| 624 | Ga0207702_10347159 | 3300026078 | Bacteria | 1419 |
| 625 | Ga0207641_10079572 | 3300026088 | Bacteria | 2841 |
| 626 | Ga0207641_10238156 | 3300026088 | Bacteria | 1694 |
| 627 | Ga0207641_10350538 | 3300026088 | Bacteria | 1407 |
| 628 | Ga0207641_10564372 | 3300026088 | Bacteria | 1111 |
| 629 | Ga0207641_10748789 | 3300026088 | Bacteria | 964 |
| 630 | Ga0207648_10002253 | 3300026089 | Bacteria | 20851 |
| 631 | Ga0207648_10082092 | 3300026089 | Bacteria | 2811 |
| 632 | Ga0207648_10110615 | 3300026089 | Bacteria | 2412 |
| 633 | Ga0207648_10263112 | 3300026089 | Bacteria | 1539 |
| 634 | Ga0207648_10415245 | 3300026089 | Bacteria | 1221 |
| 635 | Ga0207676_10004508 | 3300026095 | Bacteria | 9848 |
| 636 | Ga0207676_10015043 | 3300026095 | Bacteria | 5578 |
| 637 | Ga0207676_10117918 | 3300026095 | Bacteria | 2233 |
| 638 | Ga0207674_10000252 | 3300026116 | Bacteria | 66798 |
| 639 | Ga0207674_10002778 | 3300026116 | Bacteria | 21814 |
| 640 | Ga0207674_10020948 | 3300026116 | Bacteria | 7052 |
| 641 | Ga0207674_10038242 | 3300026116 | Bacteria | 4985 |
| 642 | Ga0207674_10393383 | 3300026116 | Bacteria | 1340 |
| 643 | Ga0207674_10768156 | 3300026116 | Bacteria | 930 |
| 644 | Ga0207675_100004828 | 3300026118 | Bacteria | 12980 |
| 645 | Ga0207675_100043589 | 3300026118 | Bacteria | 4190 |
| 646 | Ga0207675_100069545 | 3300026118 | Bacteria | 3290 |
| 647 | Ga0207675_100079920 | 3300026118 | Bacteria | 3065 |
| 648 | Ga0207675_100140132 | 3300026118 | Bacteria | 2297 |
| 649 | Ga0207675_100189308 | 3300026118 | Bacteria | 1973 |
| 650 | Ga0207675_100733535 | 3300026118 | Bacteria | 998 |
| 651 | Ga0207683_10277629 | 3300026121 | Bacteria | 1531 |
| 652 | Ga0207683_10562854 | 3300026121 | Bacteria | 1054 |
| 653 | Ga0207698_10087334 | 3300026142 | Bacteria | 2540 |
| 654 | Ga0207698_10165103 | 3300026142 | Bacteria | 1942 |
| 655 | Ga0209588_1089657 | 3300027671 | Bacteria | 991 |
| 656 | Ga0207428_10000004 | 3300027907 | Bacteria | 727800 |
| 657 | Ga0268266_10019226 | 3300028379 | Bacteria | 5817 |
| 658 | Ga0268266_10070530 | 3300028379 | Bacteria | 3028 |
| 659 | Ga0268266_10087524 | 3300028379 | Bacteria | 2725 |
| 660 | Ga0268266_10398170 | 3300028379 | Bacteria | 1301 |
| 661 | Ga0268265_10073994 | 3300028380 | Bacteria | 2663 |
| 662 | Ga0268265_10173647 | 3300028380 | Bacteria | 1845 |
| 663 | Ga0268265_10196908 | 3300028380 | Bacteria | 1744 |
| 664 | Ga0268265_10272682 | 3300028380 | Bacteria | 1510 |
| 665 | Ga0268264_10030492 | 3300028381 | Bacteria | 4420 |
| 666 | Ga0268264_10036700 | 3300028381 | Bacteria | 4038 |
| 667 | Ga0265760_10007034 | 3300031090 | Unclassified | 3223 |
| 668 | Ga0265329_10028572 | 3300031242 | Bacteria | 1828 |
| 669 | Ga0265331_10215362 | 3300031250 | Bacteria | 864 |
| 670 | Ga0265313_10006675 | 3300031595 | Bacteria | 8090 |
| 671 | Ga0265313_10009655 | 3300031595 | Bacteria | 6231 |
| 672 | Ga0265314_10001386 | 3300031711 | Bacteria | 27202 |
| 673 | Ga0265314_10005349 | 3300031711 | Bacteria | 11602 |
| 674 | Ga0316576_10025794 | 3300031727 | Bacteria | 4118 |
| 675 | Ga0316576_10077146 | 3300031727 | Bacteria | 2467 |
| 676 | Ga0316578_10261088 | 3300031728 | Bacteria | 1038 |
| 677 | Ga0307405_10030145 | 3300031731 | Bacteria | 3178 |
| 678 | Ga0307412_10064463 | 3300031911 | Bacteria | 2476 |
| 679 | Ga0307412_10355170 | 3300031911 | Bacteria | 1178 |
| 680 | Ga0307409_100148400 | 3300031995 | Bacteria | 2032 |
| 681 | Ga0307416_100007255 | 3300032002 | Bacteria | 7026 |
| 682 | Ga0307411_10533578 | 3300032005 | Bacteria | 998 |
| 683 | Ga0316583_10046053 | 3300032133 | Bacteria | 1539 |
| 684 | Ga0373926_0000614 | 3300035083 | Bacteria | 9676 |
| 685 | Ga0373934_0004206 | 3300035086 | Bacteria | 5309 |
| 686 | Ga0373952_0031857 | 3300035092 | Bacteria | 1174 |
| 687 | Ga0373923_0011426 | 3300035111 | Bacteria | 3255 |
| 688 | Ga0373939_0192345 | 3300035114 | Bacteria | 767 |
| 689 | Ga0373953_0035336 | 3300035117 | Bacteria | 1963 |
| 690 | Ga0373954_0002133 | 3300035118 | Bacteria | 8214 |
| 691 | Ga0373954_0257828 | 3300035118 | Unclassified | 859 |
| 692 | Ga0373956_0042534 | 3300035119 | Bacteria | 2020 |
| 693 | Ga0373956_0219625 | 3300035119 | Bacteria | 902 |
| 694 | Ga0373956_0274475 | 3300035119 | Unclassified | 802 |
| 695 | Ga0373957_0117090 | 3300035120 | Bacteria | 1076 |
| 696 | Ga0373943_0138686 | 3300035170 | Unclassified | 1308 |
| 697 | Ga0373946_0178564 | 3300035171 | Unclassified | 1006 |
| 698 | Ga0373955_0006974 | 3300035172 | Bacteria | 5171 |
| 699 | Ga0373955_0081164 | 3300035172 | Bacteria | 1833 |
| 700 | Ga0373955_0081681 | 3300035172 | Bacteria | 1828 |
| 701 | Ga0373955_0088444 | 3300035172 | Bacteria | 1762 |
| 702 | Ga0373955_0295581 | 3300035172 | Unclassified | 976 |
| 703 | Ga0373935_0000902 | 3300035692 | Bacteria | 16048 |
| 704 | Ga0373935_0028083 | 3300035692 | Bacteria | 3477 |
| 705 | Ga0373935_0037190 | 3300035692 | Bacteria | 3046 |
| 706 | Ga0373935_0522022 | 3300035692 | Bacteria | 864 |
| 707 | Ga0373927_0004041 | 3300035695 | Bacteria | 10373 |
| 708 | Ga0373927_0005586 | 3300035695 | Bacteria | 8645 |
| 709 | Ga0373927_0080942 | 3300035695 | Bacteria | 2105 |
| 710 | Ga0373927_0188568 | 3300035695 | Bacteria | 1353 |
| 711 | Ga0373933_0016981 | 3300035724 | Unclassified | 4080 |
| 712 | Ga0373933_0044230 | 3300035724 | Bacteria | 2637 |
| 713 | Ga0373933_0266037 | 3300035724 | Bacteria | 1106 |
| 714 | Ga0373947_0015220 | 3300035725 | Bacteria | 4416 |
| 715 | Ga0373947_0069973 | 3300035725 | Bacteria | 2149 |
| 716 | Ga0373947_0070709 | 3300035725 | Bacteria | 2139 |
| 717 | Ga0373947_0596161 | 3300035725 | Bacteria | 753 |
| 718 | Ga0373937_0001951 | 3300036401 | Bacteria | 17278 |
| 719 | Ga0373937_0004398 | 3300036401 | Bacteria | 11975 |
| 720 | Ga0373937_0012599 | 3300036401 | Bacteria | 7442 |
| 721 | Ga0373937_0023943 | 3300036401 | Bacteria | 5505 |
| 722 | Ga0373937_0127113 | 3300036401 | Bacteria | 2379 |
| 723 | Ga0373937_0210578 | 3300036401 | Bacteria | 1829 |
| 724 | Ga0373937_0272259 | 3300036401 | Unclassified | 1598 |
| 725 | Ga0373937_0299426 | 3300036401 | Unclassified | 1520 |
| 726 | Ga0373937_0356081 | 3300036401 | Bacteria | 1387 |
| 727 | Ga0373937_0359925 | 3300036401 | Bacteria | 1379 |
| 728 | Ga0373937_0535302 | 3300036401 | Unclassified | 1113 |
| 729 | Ga0373937_0665295 | 3300036401 | Bacteria | 987 |
| 730 | Ga0373937_0715231 | 3300036401 | Bacteria | 948 |
| 731 | Ga0316582_0032046 | 3300036647 | Bacteria | 3217 |
| 732 | Ga0316584_0022871 | 3300036712 | Bacteria | 4562 |
| 733 | Ga0316584_0371458 | 3300036712 | Bacteria | 1024 |
| 734 | Ga0373925_0009351 | 3300037068 | Bacteria | 7138 |
| 735 | Ga0373925_0018646 | 3300037068 | Bacteria | 5045 |
| 736 | Ga0439453_0034636 | 3300041408 | Bacteria | 970 |
| 737 | Ga0450896_033444 | 3300042133 | Bacteria | 784 |
| 738 | Ga0451577_0131290 | 3300042876 | Bacteria | 2247 |
| 739 | Ga0453684_0299781 | 3300044712 | Bacteria | 1827 |
| 740 | Ga0451576_0276693 | 3300045051 | Bacteria | 1755 |
| 741 | Ga0451576_0300579 | 3300045051 | Bacteria | 1679 |
| 742 | Ga0451576_0397770 | 3300045051 | Bacteria | 1444 |
| 743 | Ga0495592_0011052 | 3300046454 | Bacteria | 6813 |
| 744 | Ga0495592_0022690 | 3300046454 | Bacteria | 4774 |
| 745 | Ga0495592_0033271 | 3300046454 | Unclassified | 3889 |
| 746 | Ga0495592_0063728 | 3300046454 | Bacteria | 2703 |
| 747 | Ga0495592_0071647 | 3300046454 | Bacteria | 2522 |
| 748 | Ga0495603_0409420 | 3300046455 | Bacteria | 777 |
| 749 | Ga0495629_0063335 | 3300046459 | Bacteria | 2583 |
| 750 | Ga0495651_0000126 | 3300046462 | Bacteria | 56547 |
| 751 | Ga0495651_0005148 | 3300046462 | Bacteria | 9968 |
| 752 | Ga0495651_0009981 | 3300046462 | Bacteria | 7300 |
| 753 | Ga0495651_0417465 | 3300046462 | Unclassified | 873 |
| 754 | Ga0495651_0486437 | 3300046462 | Bacteria | 792 |
| 755 | Ga0495653_0010223 | 3300046463 | Bacteria | 7682 |
| 756 | Ga0495653_0088967 | 3300046463 | Unclassified | 2264 |
| 757 | Ga0495653_0127564 | 3300046463 | Unclassified | 1805 |
| 758 | Ga0495653_0145011 | 3300046463 | Unclassified | 1665 |
| 759 | Ga0495653_0460601 | 3300046463 | Bacteria | 798 |
| 760 | Ga0495580_0005481 | 3300046472 | Bacteria | 10486 |
| 761 | Ga0495580_0015510 | 3300046472 | Bacteria | 5745 |
| 762 | Ga0495580_0018716 | 3300046472 | Bacteria | 5154 |
| 763 | Ga0495580_0053551 | 3300046472 | Unclassified | 2847 |
| 764 | Ga0495580_0164608 | 3300046472 | Bacteria | 1534 |
| 765 | Ga0495580_0264332 | 3300046472 | Bacteria | 1176 |
| 766 | Ga0495580_0283151 | 3300046472 | Bacteria | 1131 |
| 767 | Ga0495582_0049359 | 3300046473 | Bacteria | 2317 |
| 768 | Ga0495582_0126266 | 3300046473 | Bacteria | 1444 |
| 769 | Ga0495639_0069564 | 3300046475 | Bacteria | 1624 |
| 770 | Ga0495639_0117335 | 3300046475 | Bacteria | 1267 |
| 771 | Ga0495639_0207836 | 3300046475 | Bacteria | 960 |
| 772 | Ga0495664_0019425 | 3300046477 | Bacteria | 3907 |
| 773 | Ga0495594_0106000 | 3300046499 | Bacteria | 1583 |
| 774 | Ga0495594_0113942 | 3300046499 | Unclassified | 1526 |
| 775 | Ga0495608_0002023 | 3300046511 | Bacteria | 14549 |
| 776 | Ga0495608_0006811 | 3300046511 | Bacteria | 8103 |
| 777 | Ga0495608_0010563 | 3300046511 | Bacteria | 6442 |
| 778 | Ga0495608_0029614 | 3300046511 | Unclassified | 3712 |
| 779 | Ga0495608_0043759 | 3300046511 | Bacteria | 2991 |
| 780 | Ga0495618_0007195 | 3300046514 | Bacteria | 6738 |
| 781 | Ga0495628_0001880 | 3300046516 | Bacteria | 19059 |
| 782 | Ga0495628_0012049 | 3300046516 | Bacteria | 7293 |
| 783 | Ga0495628_0018608 | 3300046516 | Bacteria | 5751 |
| 784 | Ga0495628_0066816 | 3300046516 | Unclassified | 2810 |
| 785 | Ga0495628_0232312 | 3300046516 | Bacteria | 1382 |
| 786 | Ga0495628_0301316 | 3300046516 | Bacteria | 1186 |
| 787 | Ga0495630_0001011 | 3300046517 | Bacteria | 19496 |
| 788 | Ga0495630_0001268 | 3300046517 | Bacteria | 17403 |
| 789 | Ga0495630_0003853 | 3300046517 | Bacteria | 10471 |
| 790 | Ga0495630_0017821 | 3300046517 | Bacteria | 5208 |
| 791 | Ga0495666_0020095 | 3300046526 | Bacteria | 3313 |
| 792 | Ga0495652_0013561 | 3300046529 | Bacteria | 7335 |
| 793 | Ga0495652_0016762 | 3300046529 | Bacteria | 6549 |
| 794 | Ga0495652_0064347 | 3300046529 | Unclassified | 3084 |
| 795 | Ga0495665_0013131 | 3300046531 | Bacteria | 4482 |
| 796 | Ga0495665_0085639 | 3300046531 | Bacteria | 1656 |
| 797 | Ga0495586_0000405 | 3300046535 | Bacteria | 26188 |
| 798 | Ga0495586_0069027 | 3300046535 | Bacteria | 1929 |
| 799 | Ga0495586_0181340 | 3300046535 | Bacteria | 1191 |
| 800 | Ga0495586_0193084 | 3300046535 | Bacteria | 1153 |
| 801 | Ga0495586_0205454 | 3300046535 | Bacteria | 1117 |
| 802 | Ga0495586_0247271 | 3300046535 | Bacteria | 1017 |
| 803 | Ga0495587_0001076 | 3300046536 | Bacteria | 17951 |
| 804 | Ga0495587_0004806 | 3300046536 | Bacteria | 8868 |
| 805 | Ga0495587_0128957 | 3300046536 | Bacteria | 1446 |
| 806 | Ga0495621_0015319 | 3300046539 | Bacteria | 2443 |
| 807 | Ga0495621_0054027 | 3300046539 | Bacteria | 1443 |
| 808 | Ga0495645_0002936 | 3300046543 | Bacteria | 11555 |
| 809 | Ga0495645_0024700 | 3300046543 | Bacteria | 4361 |
| 810 | Ga0495645_0038923 | 3300046543 | Unclassified | 3468 |
| 811 | Ga0495645_0132836 | 3300046543 | Bacteria | 1743 |
| 812 | Ga0495645_0222984 | 3300046543 | Bacteria | 1267 |
| 813 | Ga0495667_0001136 | 3300046559 | Bacteria | 17338 |
| 814 | Ga0495667_0013664 | 3300046559 | Bacteria | 5488 |
| 815 | Ga0495667_0042162 | 3300046559 | Bacteria | 3026 |
| 816 | Ga0495667_0219038 | 3300046559 | Unclassified | 1215 |
| 817 | Ga0495667_0274600 | 3300046559 | Bacteria | 1070 |
| 818 | Ga0495634_0040074 | 3300046642 | Bacteria | 3188 |
| 819 | Ga0495634_0141460 | 3300046642 | Unclassified | 1527 |
| 820 | Ga0495635_0054682 | 3300046663 | Unclassified | 2749 |
| 821 | Ga0495635_0130570 | 3300046663 | Bacteria | 1712 |
| 822 | Ga0495635_0190783 | 3300046663 | Bacteria | 1391 |
| 823 | Ga0495657_0004041 | 3300046675 | Bacteria | 11765 |
| 824 | Ga0495657_0145507 | 3300046675 | Unclassified | 1474 |
| 825 | Ga0495599_0003977 | 3300046678 | Bacteria | 8705 |
| 826 | Ga0495599_0018901 | 3300046678 | Unclassified | 4296 |
| 827 | Ga0495623_0003934 | 3300046679 | Bacteria | 9790 |
| 828 | Ga0495623_0081568 | 3300046679 | Bacteria | 2000 |
| 829 | Ga0495623_0260433 | 3300046679 | Bacteria | 972 |
| 830 | Ga0495646_0000785 | 3300046680 | Bacteria | 17756 |
| 831 | Ga0495646_0058133 | 3300046680 | Unclassified | 2312 |
| 832 | Ga0495658_0045096 | 3300046683 | Bacteria | 2473 |
| 833 | Ga0495658_0171042 | 3300046683 | Bacteria | 1345 |
| 834 | Ga0495613_0001706 | 3300046689 | Bacteria | 16725 |
| 835 | Ga0495613_0056494 | 3300046689 | Bacteria | 2882 |
| 836 | Ga0495613_0168362 | 3300046689 | Bacteria | 1556 |
| 837 | Ga0495613_0545359 | 3300046689 | Unclassified | 776 |
| 838 | Ga0495624_0016528 | 3300046690 | Bacteria | 4965 |
| 839 | Ga0495624_0393308 | 3300046690 | Bacteria | 832 |
| 840 | Ga0495600_0003140 | 3300046809 | Bacteria | 9666 |
| 841 | Ga0495600_0082885 | 3300046809 | Bacteria | 2093 |
| 842 | Ga0495604_0005091 | 3300047317 | Bacteria | 10407 |
| 843 | Ga0495604_0010297 | 3300047317 | Bacteria | 7406 |
| 844 | Ga0495604_0044978 | 3300047317 | Bacteria | 3447 |
| 845 | Ga0495604_0400656 | 3300047317 | Unclassified | 904 |
| 846 | Ga0495674_0001401 | 3300047319 | Bacteria | 23572 |
| 847 | Ga0495674_0013223 | 3300047319 | Bacteria | 7758 |
| 848 | Ga0495674_0020559 | 3300047319 | Bacteria | 6110 |
| 849 | Ga0495674_0024847 | 3300047319 | Bacteria | 5500 |
| 850 | Ga0495674_0055836 | 3300047319 | Unclassified | 3462 |
| 851 | Ga0495674_0236338 | 3300047319 | Unclassified | 1507 |
| 852 | Ga0495676_0046014 | 3300047321 | Bacteria | 3547 |
| 853 | Ga0495680_0000253 | 3300047322 | Bacteria | 59346 |
| 854 | Ga0495680_0001258 | 3300047322 | Bacteria | 27663 |
| 855 | Ga0495680_0089003 | 3300047322 | Bacteria | 2319 |
| 856 | Ga0495680_0096719 | 3300047322 | Unclassified | 2205 |
| 857 | Ga0495680_0186848 | 3300047322 | Bacteria | 1493 |
| 858 | Ga0495675_0000165 | 3300047444 | Bacteria | 47340 |
| 859 | Ga0495675_0005957 | 3300047444 | Bacteria | 7451 |
| 860 | Ga0495675_0148243 | 3300047444 | Bacteria | 1451 |
| 861 | Ga0495675_0178269 | 3300047444 | Bacteria | 1302 |
| 862 | Ga0495684_0000125 | 3300047471 | Bacteria | 56588 |
| 863 | Ga0495684_0009716 | 3300047471 | Bacteria | 7422 |
| 864 | Ga0495684_0012342 | 3300047471 | Bacteria | 6590 |
| 865 | Ga0495684_0013320 | 3300047471 | Bacteria | 6336 |
| 866 | Ga0495684_0025018 | 3300047471 | Bacteria | 4592 |
| 867 | Ga0495684_0076222 | 3300047471 | Bacteria | 2547 |
| 868 | Ga0495684_0203701 | 3300047471 | Bacteria | 1458 |
| 869 | Ga0495684_0311031 | 3300047471 | Bacteria | 1129 |
| 870 | Ga0495602_0003164 | 3300048088 | Bacteria | 16964 |
| 871 | Ga0495602_0012198 | 3300048088 | Bacteria | 8849 |
| 872 | Ga0495602_0021669 | 3300048088 | Bacteria | 6316 |
| 873 | Ga0495602_0081110 | 3300048088 | Bacteria | 2729 |
| 874 | Ga0495602_0228155 | 3300048088 | Unclassified | 1401 |
| 875 | Ga0496100_0005245 | 3300048903 | Bacteria | 6963 |
| 876 | Ga0496101_0018969 | 3300048904 | Bacteria | 4687 |
| 877 | Ga0496104_0170139 | 3300048907 | Unclassified | 2089 |
| 878 | Ga0496104_0195870 | 3300048907 | Bacteria | 1933 |
| 879 | Ga0496104_0298439 | 3300048907 | Bacteria | 1523 |
| 880 | Ga0496104_0358451 | 3300048907 | Bacteria | 1371 |
| 881 | Ga0496107_0062033 | 3300048910 | Unclassified | 2708 |
| 882 | Ga0496112_0440891 | 3300048915 | Bacteria | 1240 |
| 883 | Ga0496112_0570133 | 3300048915 | Bacteria | 1065 |
| 884 | Ga0496114_0002302 | 3300048917 | Bacteria | 14547 |
| 885 | Ga0501042_0443823 | 3300049578 | Bacteria | 941 |
| 886 | Ga0501046_0234035 | 3300049580 | Unclassified | 1356 |
| 887 | Ga0501047_0104620 | 3300049581 | Bacteria | 2711 |
| 888 | Ga0501048_0135796 | 3300049582 | Bacteria | 1738 |
| 889 | Ga0501074_0088039 | 3300049590 | Unclassified | 2224 |
| 890 | Ga0501075_0021304 | 3300049591 | Bacteria | 4724 |
| 891 | Ga0501076_0046871 | 3300049592 | Bacteria | 3416 |
| 892 | Ga0501079_0042736 | 3300049741 | Unclassified | 3499 |
| 893 | Ga0501080_0098430 | 3300049742 | Unclassified | 2715 |
| 894 | nmdc:mga05p37_105860_c1 | 3300050507 | Bacteria | 3460 |
| 895 | nmdc:mga05p37_215848_c1 | 3300050507 | Bacteria | 2317 |
| 896 | nmdc:mga05p37_33_c1 | 3300050507 | Bacteria | 112965 |
| 897 | nmdc:mga05p37_48567_c1 | 3300050507 | Bacteria | 5218 |
| 898 | nmdc:mga05p37_7649_c1 | 3300050507 | Bacteria | 12752 |
| 899 | nmdc:mga05p37_827925_c1 | 3300050507 | Bacteria | 1008 |
| 900 | nmdc:mga09592_296325_c1 | 3300050508 | Bacteria | 1402 |
| 901 | nmdc:mga09592_3004_c1 | 3300050508 | Bacteria | 13675 |
| 902 | nmdc:mga09592_3103_c1 | 3300050508 | Bacteria | 13488 |
| 903 | nmdc:mga06r32_149771_c1 | 3300050510 | Bacteria | 2311 |
| 904 | nmdc:mga06r32_208333_c1 | 3300050510 | Bacteria | 1943 |
| 905 | nmdc:mga06r32_29148_c1 | 3300050510 | Bacteria | 5170 |
| 906 | nmdc:mga06r32_46080_c1 | 3300050510 | Bacteria | 4160 |
| 907 | nmdc:mga06r32_5990_c1 | 3300050510 | Bacteria | 10937 |
| 908 | nmdc:mga06r32_84513_c1 | 3300050510 | Unclassified | 3093 |
| 909 | nmdc:mga08y16_249954_c1 | 3300050511 | Bacteria | 1832 |
| 910 | nmdc:mga08y16_2_c1 | 3300050511 | Bacteria | 983367 |
| 911 | nmdc:mga0n895_208421_c1 | 3300050512 | Bacteria | 1985 |
| 912 | nmdc:mga0n895_28312_c1 | 3300050512 | Bacteria | 5329 |
| 913 | nmdc:mga0n895_879410_c1 | 3300050512 | Bacteria | 882 |
| 914 | nmdc:mga0rr50_280591_c1 | 3300050513 | Bacteria | 1390 |
| 915 | nmdc:mga08x19_304343_c1 | 3300050514 | Bacteria | 1107 |
| 916 | nmdc:mga0a205_218116_c1 | 3300050515 | Unclassified | 1794 |
| 917 | nmdc:mga0a205_242635_c1 | 3300050515 | Bacteria | 1682 |
| 918 | nmdc:mga0a205_30462_c1 | 3300050515 | Bacteria | 5166 |
| 919 | nmdc:mga0a205_398057_c1 | 3300050515 | Bacteria | 1241 |
| 920 | Ga0495601_0022203 | 3300053077 | Unclassified | 3894 |
| 921 | Ga0495601_0195274 | 3300053077 | Unclassified | 1323 |
| 922 | Ga0495612_0003944 | 3300053078 | Bacteria | 6161 |
| 923 | Ga0495595_0103462 | 3300053084 | Bacteria | 1376 |
| 924 | Ga0495619_0021501 | 3300053085 | Unclassified | 4119 |
| 925 | Ga0495619_0081684 | 3300053085 | Bacteria | 2177 |
| 926 | Ga0495619_0300394 | 3300053085 | Bacteria | 1112 |
| 927 | Ga0495619_0551672 | 3300053085 | Unclassified | 790 |
| 928 | Ga0500568_0008529 | 3300053139 | Unclassified | 4932 |
| 929 | Ga0501084_0042671 | 3300054114 | Bacteria | 3794 |
| 930 | Ga0501082_0129189 | 3300060353 | Unclassified | 2192 |
| 931 | Ga0530510_0018388 | 3300061734 | Bacteria | 4955 |
| 932 | Ga0496115_0142022 | |||
| 933 | Ga0065707_10150567 | |||
| 934 | Ga0070658_10187959 | |||
| 935 | Ga0070676_10217763 | |||
| 936 | Ga0070683_100098299 | |||
| 937 | Ga0070690_100032320 | |||
| 938 | Ga0070670_100007834 | |||
| 939 | Ga0070670_100010330 | |||
| 940 | Ga0070670_100308850 | |||
| 941 | Ga0070677_10059985 | |||
| 942 | Ga0068869_100002089 | |||
| 943 | Ga0068869_100058052 | |||
| 944 | Ga0068869_100096635 | |||
| 945 | Ga0068869_100408070 | |||
| 946 | Ga0068869_100706225 | |||
| 947 | Ga0070666_10001137 | |||
| 948 | Ga0070666_10039637 | |||
| 949 | Ga0070666_10046062 | |||
| 950 | Ga0070666_10167662 | |||
| 951 | Ga0070666_10257688 | |||
| 952 | Ga0070680_100013946 | |||
| 953 | Ga0068868_100005508 | |||
| 954 | Ga0068868_100006505 | |||
| 955 | Ga0068868_100047539 | |||
| 956 | Ga0068868_100145886 | |||
| 957 | Ga0068868_100158663 | |||
| 958 | Ga0068868_100206923 | |||
| 959 | Ga0068868_100309782 | |||
| 960 | Ga0068868_100443529 | |||
| 961 | Ga0070660_100024608 | |||
| 962 | Ga0070660_100120887 | |||
| 963 | Ga0070660_100151657 | |||
| 964 | Ga0070689_100043304 | |||
| 965 | Ga0070689_100046856 | |||
| 966 | Ga0070689_100223763 | |||
| 967 | Ga0070691_10013126 | |||
| 968 | Ga0070661_100110285 | |||
| 969 | Ga0070661_100269976 | |||
| 970 | Ga0070692_10062155 | |||
| 971 | Ga0070669_100033005 | |||
| 972 | Ga0070669_100162159 | |||
| 973 | Ga0070675_100000819 | |||
| 974 | Ga0070675_100004909 | |||
| 975 | Ga0070675_100005091 | |||
| 976 | Ga0070675_100129004 | |||
| 977 | Ga0070675_100211505 | |||
| 978 | Ga0070671_100016426 | |||
| 979 | Ga0070671_100044390 | |||
| 980 | Ga0070671_100046964 | |||
| 981 | Ga0070671_100071980 | |||
| 982 | Ga0070671_100072762 | |||
| 983 | Ga0070671_100332130 | |||
| 984 | Ga0070671_100351943 | |||
| 985 | Ga0070674_100081645 | |||
| 986 | Ga0070674_100145780 | |||
| 987 | Ga0070674_100187972 | |||
| 988 | Ga0070674_100763458 | |||
| 989 | Ga0070673_100023649 | |||
| 990 | Ga0070673_100066805 | |||
| 991 | Ga0070673_100201593 | |||
| 992 | Ga0070673_100246687 | |||
| 993 | Ga0070673_100323817 | |||
| 994 | Ga0070688_100229994 | |||
| 995 | Ga0070688_100443521 | |||
| 996 | Ga0070688_100466105 | |||
| 997 | Ga0070659_100043757 | |||
| 998 | Ga0070659_100184786 | |||
| 999 | Ga0070667_100072696 | |||
| 1000 | Ga0070667_100082239 | |||
| 1001 | Ga0070667_100082948 | |||
| 1002 | Ga0070667_100163950 | |||
| 1003 | Ga0070667_100560439 | |||
| 1004 | Ga0070713_100011378 | |||
| 1005 | Ga0070713_100025278 | |||
| 1006 | Ga0070713_100181065 | |||
| 1007 | Ga0070713_100724831 | |||
| 1008 | Ga0070713_100808371 | |||
| 1009 | Ga0070710_10339695 | |||
| 1010 | Ga0070701_10049956 | |||
| 1011 | Ga0070711_100069704 | |||
| 1012 | Ga0070711_100514942 | |||
| 1013 | Ga0070705_100305830 | |||
| 1014 | Ga0070700_100001632 | |||
| 1015 | Ga0070694_100065444 | |||
| 1016 | Ga0070694_100083783 | |||
| 1017 | Ga0070694_100387784 | |||
| 1018 | Ga0070663_100087079 | |||
| 1019 | Ga0070678_100273146 | |||
| 1020 | Ga0070662_100022723 | |||
| 1021 | Ga0070662_100101600 | |||
| 1022 | Ga0070662_100231891 | |||
| 1023 | Ga0070681_10072278 | |||
| 1024 | Ga0070681_10093516 | |||
| 1025 | Ga0070681_10379789 | |||
| 1026 | Ga0068867_100021545 | |||
| 1027 | Ga0068867_100033466 | |||
| 1028 | Ga0068867_100085376 | |||
| 1029 | Ga0068867_100325983 | |||
| 1030 | Ga0070685_10536405 | |||
| 1031 | Ga0070706_100004393 | |||
| 1032 | Ga0070706_100077523 | |||
| 1033 | Ga0070707_100003828 | |||
| 1034 | Ga0070707_100203689 | |||
| 1035 | Ga0070698_100014652 | |||
| 1036 | Ga0070698_100108751 | |||
| 1037 | Ga0070698_100357158 | |||
| 1038 | Ga0070699_100000875 | |||
| 1039 | Ga0070684_100007408 | |||
| 1040 | Ga0070684_100007644 | |||
| 1041 | Ga0070684_100042326 | |||
| 1042 | Ga0070684_100838806 | |||
| 1043 | Ga0068853_100101024 | |||
| 1044 | Ga0068853_100150560 | |||
| 1045 | Ga0068853_100363828 | |||
| 1046 | Ga0068853_100738297 | |||
| 1047 | Ga0070672_100001694 | |||
| 1048 | Ga0070672_100082506 | |||
| 1049 | Ga0070672_100126706 | |||
| 1050 | Ga0070686_100044340 | |||
| 1051 | Ga0070686_100098881 | |||
| 1052 | Ga0070686_100110702 | |||
| 1053 | Ga0070695_100081632 | |||
| 1054 | Ga0070696_100088620 | |||
| 1055 | Ga0070665_100004087 | |||
| 1056 | Ga0070665_100153131 | |||
| 1057 | Ga0070665_100499736 | |||
| 1058 | Ga0070665_100583453 | |||
| 1059 | Ga0070704_100003332 | |||
| 1060 | Ga0070704_100105274 | |||
| 1061 | Ga0070704_100511939 | |||
| 1062 | Ga0070704_100825013 | |||
| 1063 | Ga0068855_100001557 | |||
| 1064 | Ga0068855_100009822 | |||
| 1065 | Ga0068855_100014867 | |||
| 1066 | Ga0068855_100047694 | |||
| 1067 | Ga0068855_100152601 | |||
| 1068 | Ga0068855_100213834 | |||
| 1069 | Ga0068855_100776972 | |||
| 1070 | Ga0068855_101000435 | |||
| 1071 | Ga0070664_100007205 | |||
| 1072 | Ga0070664_100007317 | |||
| 1073 | Ga0070664_100148442 | |||
| 1074 | Ga0070664_100315645 | |||
| 1075 | Ga0070664_100644939 | |||
| 1076 | Ga0068857_100011025 | |||
| 1077 | Ga0068857_100095755 | |||
| 1078 | Ga0068857_100140302 | |||
| 1079 | Ga0068857_100143645 | |||
| 1080 | Ga0068854_100021040 | |||
| 1081 | Ga0068856_100003142 | |||
| 1082 | Ga0068856_100006380 | |||
| 1083 | Ga0068856_100066042 | |||
| 1084 | Ga0068856_100129805 | |||
| 1085 | Ga0068856_100163931 | |||
| 1086 | Ga0068856_100405723 | |||
| 1087 | Ga0068856_100466278 | |||
| 1088 | Ga0068852_100032351 | |||
| 1089 | Ga0068852_100180611 | |||
| 1090 | Ga0068852_100210805 | |||
| 1091 | Ga0068852_100903455 | |||
| 1092 | Ga0068859_100001734 | |||
| 1093 | Ga0068859_100004423 | |||
| 1094 | Ga0068859_100431213 | |||
| 1095 | Ga0068859_100768319 | |||
| 1096 | Ga0068864_100003613 | |||
| 1097 | Ga0068864_100263442 | |||
| 1098 | Ga0068866_10010753 | |||
| 1099 | Ga0068866_10232944 | |||
| 1100 | Ga0068866_10456362 | |||
| 1101 | Ga0068861_100025559 | |||
| 1102 | Ga0068861_100051526 | |||
| 1103 | Ga0068861_100110659 | |||
| 1104 | Ga0068861_100153647 | |||
| 1105 | Ga0068861_100204700 | |||
| 1106 | Ga0068861_100453585 | |||
| 1107 | Ga0068861_100725587 | |||
| 1108 | Ga0068851_10332069 | |||
| 1109 | Ga0068870_10201428 | |||
| 1110 | Ga0068863_100053375 | |||
| 1111 | Ga0068863_100066682 | |||
| 1112 | Ga0068863_100114859 | |||
| 1113 | Ga0068863_100171821 | |||
| 1114 | Ga0068863_100198611 | |||
| 1115 | Ga0068863_100342225 | |||
| 1116 | Ga0068863_100475219 | |||
| 1117 | Ga0068858_100007279 | |||
| 1118 | Ga0068858_100012093 | |||
| 1119 | Ga0068858_100015353 | |||
| 1120 | Ga0068858_100023284 | |||
| 1121 | Ga0068858_100032999 | |||
| 1122 | Ga0068858_100170495 | |||
| 1123 | Ga0068860_100017221 | |||
| 1124 | Ga0068860_100031737 | |||
| 1125 | Ga0068860_100273388 | |||
| 1126 | Ga0068860_100282331 | |||
| 1127 | Ga0068860_100297603 | |||
| 1128 | Ga0068860_100376983 | |||
| 1129 | Ga0068860_100476081 | |||
| 1130 | Ga0068862_100154944 | |||
| 1131 | Ga0068862_100259555 | |||
| 1132 | Ga0068862_100327219 | |||
| 1133 | Ga0070717_10015510 | |||
| 1134 | Ga0070717_10321859 | |||
| 1135 | Ga0070712_100032433 | |||
| 1136 | Ga0097621_100005568 | |||
| 1137 | Ga0097621_100006771 | |||
| 1138 | Ga0097621_100007326 | |||
| 1139 | Ga0097621_100011511 | |||
| 1140 | Ga0097621_100047814 | |||
| 1141 | Ga0097621_100062808 | |||
| 1142 | Ga0097621_100118314 | |||
| 1143 | Ga0097621_100409269 | |||
| 1144 | Ga0068871_100005892 | |||
| 1145 | Ga0068871_100013531 | |||
| 1146 | Ga0068871_100016427 | |||
| 1147 | Ga0068871_100018946 | |||
| 1148 | Ga0068871_100023980 | |||
| 1149 | Ga0068871_100043261 | |||
| 1150 | Ga0068871_100054353 | |||
| 1151 | Ga0068871_100099886 | |||
| 1152 | Ga0068871_100152043 | |||
| 1153 | Ga0068871_100194424 | |||
| 1154 | Ga0068871_100231568 | |||
| 1155 | Ga0068871_100247047 | |||
| 1156 | Ga0068871_100575110 | |||
| 1157 | Ga0068871_100681286 | |||
| 1158 | Ga0075428_100000019 | |||
| 1159 | Ga0075428_100006790 | |||
| 1160 | Ga0075428_100009289 | |||
| 1161 | Ga0075428_100023052 | |||
| 1162 | Ga0075428_100799367 | |||
| 1163 | Ga0075430_100034914 | |||
| 1164 | Ga0075430_100113743 | |||
| 1165 | Ga0075430_100173636 | |||
| 1166 | Ga0075431_100000914 | |||
| 1167 | Ga0075431_100023001 | |||
| 1168 | Ga0075431_100040152 | |||
| 1169 | Ga0075431_100088438 | |||
| 1170 | Ga0075431_100169520 | |||
| 1171 | Ga0075433_10021120 | |||
| 1172 | Ga0075433_10080599 | |||
| 1173 | Ga0075433_10311480 | |||
| 1174 | Ga0075434_100031003 | |||
| 1175 | Ga0075434_100086245 | |||
| 1176 | Ga0075429_100012100 | |||
| 1177 | Ga0075429_100076018 | |||
| 1178 | Ga0075429_100482109 | |||
| 1179 | Ga0068865_100008234 | |||
| 1180 | Ga0068865_100011766 | |||
| 1181 | Ga0068865_100060820 | |||
| 1182 | Ga0068865_100460680 | |||
| 1183 | Ga0097620_100001734 | |||
| 1184 | Ga0097620_100004423 | |||
| 1185 | Ga0097620_100431247 | |||
| 1186 | Ga0097620_100768304 | |||
| 1187 | Ga0075435_100554134 | |||
| 1188 | Ga0099794_10030342 | |||
| 1189 | Ga0099795_10154082 | |||
| 1190 | Ga0105240_10001330 | |||
| 1191 | Ga0105240_10005789 | |||
| 1192 | Ga0105240_10008052 | |||
| 1193 | Ga0105240_10025249 | |||
| 1194 | Ga0105240_10254118 | |||
| 1195 | Ga0105240_10454277 | |||
| 1196 | Ga0105240_10511859 | |||
| 1197 | Ga0105240_10700341 | |||
| 1198 | Ga0105240_10730359 | |||
| 1199 | Ga0111539_10000002 | |||
| 1200 | Ga0111539_10058550 | |||
| 1201 | Ga0111539_10359843 | |||
| 1202 | Ga0111539_10983809 | |||
| 1203 | Ga0111539_11241595 | |||
| 1204 | Ga0105245_10003921 | |||
| 1205 | Ga0105245_10004784 | |||
| 1206 | Ga0105245_10015086 | |||
| 1207 | Ga0105245_10015179 | |||
| 1208 | Ga0105245_10018883 | |||
| 1209 | Ga0105245_10019679 | |||
| 1210 | Ga0105245_10045083 | |||
| 1211 | Ga0105245_10047016 | |||
| 1212 | Ga0105245_10104026 | |||
| 1213 | Ga0105245_10119235 | |||
| 1214 | Ga0105245_10254073 | |||
| 1215 | Ga0105245_10651823 | |||
| 1216 | Ga0114129_10000155 | |||
| 1217 | Ga0114129_10011725 | |||
| 1218 | Ga0114129_10017965 | |||
| 1219 | Ga0114129_10029504 | |||
| 1220 | Ga0114129_10094556 | |||
| 1221 | Ga0114129_10173617 | |||
| 1222 | Ga0114129_10195313 | |||
| 1223 | Ga0114129_10259513 | |||
| 1224 | Ga0114129_10491830 | |||
| 1225 | Ga0114129_11074232 | |||
| 1226 | Ga0105243_10019430 | |||
| 1227 | Ga0105243_10066698 | |||
| 1228 | Ga0105243_10168216 | |||
| 1229 | Ga0105243_10199346 | |||
| 1230 | Ga0105243_10291081 | |||
| 1231 | Ga0105241_10010069 | |||
| 1232 | Ga0105241_10010616 | |||
| 1233 | Ga0105241_10168439 | |||
| 1234 | Ga0105241_10169075 | |||
| 1235 | Ga0105241_10227616 | |||
| 1236 | Ga0105241_10338474 | |||
| 1237 | Ga0105242_10003209 | |||
| 1238 | Ga0105242_10004802 | |||
| 1239 | Ga0105242_10013007 | |||
| 1240 | Ga0105242_10014276 | |||
| 1241 | Ga0105242_10049223 | |||
| 1242 | Ga0105242_10086644 | |||
| 1243 | Ga0105242_10129960 | |||
| 1244 | Ga0105242_10287860 | |||
| 1245 | Ga0105242_10335522 | |||
| 1246 | Ga0105248_10001841 | |||
| 1247 | Ga0105248_10009082 | |||
| 1248 | Ga0105248_10013147 | |||
| 1249 | Ga0105248_10019625 | |||
| 1250 | Ga0105248_10027712 | |||
| 1251 | Ga0105248_10047477 | |||
| 1252 | Ga0105248_10068707 | |||
| 1253 | Ga0105248_10116151 | |||
| 1254 | Ga0105248_10142009 | |||
| 1255 | Ga0105248_10168306 | |||
| 1256 | Ga0105248_10217253 | |||
| 1257 | Ga0105248_10450458 | |||
| 1258 | Ga0105248_10767645 | |||
| 1259 | Ga0105248_10771186 | |||
| 1260 | Ga0105237_10009655 | |||
| 1261 | Ga0105237_10025571 | |||
| 1262 | Ga0105237_10075686 | |||
| 1263 | Ga0105237_10247602 | |||
| 1264 | Ga0105237_10389168 | |||
| 1265 | Ga0105237_10408572 | |||
| 1266 | Ga0105238_10001988 | |||
| 1267 | Ga0105238_10014783 | |||
| 1268 | Ga0105238_10017173 | |||
| 1269 | Ga0105238_10032711 | |||
| 1270 | Ga0105238_10049845 | |||
| 1271 | Ga0105238_10060696 | |||
| 1272 | Ga0105238_10153791 | |||
| 1273 | Ga0105238_10348091 | |||
| 1274 | Ga0105238_10370196 | |||
| 1275 | Ga0105238_10642085 | |||
| 1276 | Ga0105249_10009517 | |||
| 1277 | Ga0105239_10010683 | |||
| 1278 | Ga0105239_10011071 | |||
| 1279 | Ga0105239_10028364 | |||
| 1280 | Ga0105239_10029627 | |||
| 1281 | Ga0105239_10529675 | |||
| 1282 | Ga0105246_10013333 | |||
| 1283 | Ga0105246_10027766 | |||
| 1284 | Ga0105246_10225611 | |||
| 1285 | Ga0105246_10285079 | |||
| 1286 | Ga0105246_10303823 | |||
| 1287 | Ga0105246_10584421 | |||
| 1288 | Ga0157370_10001733 | |||
| 1289 | Ga0157370_10003270 | |||
| 1290 | Ga0157370_10032457 | |||
| 1291 | Ga0157370_10132190 | |||
| 1292 | Ga0157370_10239498 | |||
| 1293 | Ga0157369_10004743 | |||
| 1294 | Ga0157369_10010200 | |||
| 1295 | Ga0157369_10040053 | |||
| 1296 | Ga0157369_10085323 | |||
| 1297 | Ga0157374_10063327 | |||
| 1298 | Ga0157374_10067952 | |||
| 1299 | Ga0157374_10069124 | |||
| 1300 | Ga0157374_10072565 | |||
| 1301 | Ga0157374_10222409 | |||
| 1302 | Ga0157374_10310016 | |||
| 1303 | Ga0157374_10421479 | |||
| 1304 | Ga0157378_10001898 | |||
| 1305 | Ga0157378_10003929 | |||
| 1306 | Ga0157378_10012987 | |||
| 1307 | Ga0157378_10115656 | |||
| 1308 | Ga0157378_10179491 | |||
| 1309 | Ga0157378_10180595 | |||
| 1310 | Ga0157378_10218029 | |||
| 1311 | Ga0157378_10297574 | |||
| 1312 | Ga0157378_10578752 | |||
| 1313 | Ga0157378_10625605 | |||
| 1314 | Ga0157378_10784376 | |||
| 1315 | Ga0163162_10003543 | |||
| 1316 | Ga0163162_10016295 | |||
| 1317 | Ga0163162_10104866 | |||
| 1318 | Ga0163162_10209912 | |||
| 1319 | Ga0163162_10243951 | |||
| 1320 | Ga0163162_10253751 | |||
| 1321 | Ga0163162_10513070 | |||
| 1322 | Ga0163162_10779527 | |||
| 1323 | Ga0163162_11351926 | |||
| 1324 | Ga0157372_10088667 | |||
| 1325 | Ga0157372_10094141 | |||
| 1326 | Ga0157372_10144222 | |||
| 1327 | Ga0157372_10266572 | |||
| 1328 | Ga0157375_10005323 | |||
| 1329 | Ga0157375_10064400 | |||
| 1330 | Ga0157375_10081184 | |||
| 1331 | Ga0157375_10365727 | |||
| 1332 | Ga0157375_10533105 | |||
| 1333 | Ga0157375_10536502 | |||
| 1334 | Ga0157375_10623852 | |||
| 1335 | Ga0157375_10661389 | |||
| 1336 | Ga0157375_10681028 | |||
| 1337 | Ga0157375_10722039 | |||
| 1338 | Ga0157375_11344250 | |||
| 1339 | Ga0163163_10005414 | |||
| 1340 | Ga0163163_10006715 | |||
| 1341 | Ga0163163_10015575 | |||
| 1342 | Ga0163163_10027228 | |||
| 1343 | Ga0163163_10033698 | |||
| 1344 | Ga0163163_10078549 | |||
| 1345 | Ga0163163_10102741 | |||
| 1346 | Ga0163163_10171701 | |||
| 1347 | Ga0163163_10220085 | |||
| 1348 | Ga0163163_10278708 | |||
| 1349 | Ga0163163_10413896 | |||
| 1350 | Ga0163163_10570566 | |||
| 1351 | Ga0163163_10623996 | |||
| 1352 | Ga0163163_10897605 | |||
| 1353 | Ga0163163_10899258 | |||
| 1354 | Ga0157380_10039169 | |||
| 1355 | Ga0157380_10089306 | |||
| 1356 | Ga0157380_10120262 | |||
| 1357 | Ga0157380_10150459 | |||
| 1358 | Ga0157380_10242050 | |||
| 1359 | Ga0157380_10268174 | |||
| 1360 | Ga0157380_10469449 | |||
| 1361 | Ga0157380_10572221 | |||
| 1362 | Ga0157379_10018470 | |||
| 1363 | Ga0157379_10063826 | |||
| 1364 | Ga0157379_10508449 | |||
| 1365 | Ga0157379_10527357 | |||
| 1366 | Ga0157379_10596119 | |||
| 1367 | Ga0157376_10010212 | |||
| 1368 | Ga0157376_10108109 | |||
| 1369 | Ga0157376_10120322 | |||
| 1370 | Ga0157376_10143468 | |||
| 1371 | Ga0157376_10201002 | |||
| 1372 | Ga0157376_10322746 | |||
| 1373 | Ga0157376_10398599 | |||
| 1374 | Ga0163161_10292902 | |||
| 1375 | Ga0207656_10230793 | |||
| 1376 | Ga0207642_10124897 | |||
| 1377 | Ga0207688_10149985 | |||
| 1378 | Ga0207680_10034792 | |||
| 1379 | Ga0207680_10034916 | |||
| 1380 | Ga0207680_10511611 | |||
| 1381 | Ga0207645_10001872 | |||
| 1382 | Ga0207645_10064264 | |||
| 1383 | Ga0207645_10075966 | |||
| 1384 | Ga0207684_10027292 | |||
| 1385 | Ga0207684_10071202 | |||
| 1386 | Ga0207654_10007504 | |||
| 1387 | Ga0207654_10008176 | |||
| 1388 | Ga0207654_10055078 | |||
| 1389 | Ga0207654_10231162 | |||
| 1390 | Ga0207707_10000684 | |||
| 1391 | Ga0207707_10112457 | |||
| 1392 | Ga0207707_10148104 | |||
| 1393 | Ga0207707_10293890 | |||
| 1394 | Ga0207695_10002411 | |||
| 1395 | Ga0207695_10013324 | |||
| 1396 | Ga0207695_10017685 | |||
| 1397 | Ga0207695_10019139 | |||
| 1398 | Ga0207695_10125494 | |||
| 1399 | Ga0207695_10375259 | |||
| 1400 | Ga0207695_10458774 | |||
| 1401 | Ga0207695_10501779 | |||
| 1402 | Ga0207671_10109280 | |||
| 1403 | Ga0207671_10145663 | |||
| 1404 | Ga0207671_10162510 | |||
| 1405 | Ga0207671_10228348 | |||
| 1406 | Ga0207671_10312852 | |||
| 1407 | Ga0207663_10024777 | |||
| 1408 | Ga0207663_10130826 | |||
| 1409 | Ga0207660_10009072 | |||
| 1410 | Ga0207660_10038258 | |||
| 1411 | Ga0207662_10137907 | |||
| 1412 | Ga0207662_10212784 | |||
| 1413 | Ga0207657_10012255 | |||
| 1414 | Ga0207657_10034860 | |||
| 1415 | Ga0207657_10079881 | |||
| 1416 | Ga0207649_10146318 | |||
| 1417 | Ga0207652_10031216 | |||
| 1418 | Ga0207652_10152293 | |||
| 1419 | Ga0207646_10062415 | |||
| 1420 | Ga0207646_10088273 | |||
| 1421 | Ga0207681_10027372 | |||
| 1422 | Ga0207681_10037039 | |||
| 1423 | Ga0207681_10104848 | |||
| 1424 | Ga0207681_10168940 | |||
| 1425 | Ga0207694_10003273 | |||
| 1426 | Ga0207694_10003730 | |||
| 1427 | Ga0207694_10015269 | |||
| 1428 | Ga0207694_10029198 | |||
| 1429 | Ga0207694_10087637 | |||
| 1430 | Ga0207694_10105887 | |||
| 1431 | Ga0207694_10232241 | |||
| 1432 | Ga0207694_10365277 | |||
| 1433 | Ga0207650_10022870 | |||
| 1434 | Ga0207650_10052007 | |||
| 1435 | Ga0207659_10031579 | |||
| 1436 | Ga0207659_10033418 | |||
| 1437 | Ga0207659_10085404 | |||
| 1438 | Ga0207659_10619435 | |||
| 1439 | Ga0207687_10000615 | |||
| 1440 | Ga0207687_10002388 | |||
| 1441 | Ga0207687_10015132 | |||
| 1442 | Ga0207687_10022888 | |||
| 1443 | Ga0207687_10031178 | |||
| 1444 | Ga0207687_10032699 | |||
| 1445 | Ga0207687_10042953 | |||
| 1446 | Ga0207687_10071858 | |||
| 1447 | Ga0207687_10361564 | |||
| 1448 | Ga0207700_10007797 | |||
| 1449 | Ga0207700_10016437 | |||
| 1450 | Ga0207700_10162335 | |||
| 1451 | Ga0207700_10403327 | |||
| 1452 | Ga0207700_10788148 | |||
| 1453 | Ga0207664_10148545 | |||
| 1454 | Ga0207644_10014418 | |||
| 1455 | Ga0207644_10096761 | |||
| 1456 | Ga0207644_10292988 | |||
| 1457 | Ga0207690_10121896 | |||
| 1458 | Ga0207706_10010848 | |||
| 1459 | Ga0207706_10265246 | |||
| 1460 | Ga0207686_10001799 | |||
| 1461 | Ga0207686_10007390 | |||
| 1462 | Ga0207686_10007614 | |||
| 1463 | Ga0207686_10058827 | |||
| 1464 | Ga0207686_10074536 | |||
| 1465 | Ga0207686_10078201 | |||
| 1466 | Ga0207686_10080439 | |||
| 1467 | Ga0207686_10112162 | |||
| 1468 | Ga0207686_10146652 | |||
| 1469 | Ga0207709_10006604 | |||
| 1470 | Ga0207709_10071855 | |||
| 1471 | Ga0207709_10258662 | |||
| 1472 | Ga0207670_10024442 | |||
| 1473 | Ga0207670_10177664 | |||
| 1474 | Ga0207670_10210646 | |||
| 1475 | Ga0207670_10457480 | |||
| 1476 | Ga0207669_10004816 | |||
| 1477 | Ga0207704_10016459 | |||
| 1478 | Ga0207704_10020800 | |||
| 1479 | Ga0207704_10047949 | |||
| 1480 | Ga0207691_10077819 | |||
| 1481 | Ga0207691_10101394 | |||
| 1482 | Ga0207691_10107778 | |||
| 1483 | Ga0207691_10110974 | |||
| 1484 | Ga0207691_10407610 | |||
| 1485 | Ga0207711_10000207 | |||
| 1486 | Ga0207711_10001638 | |||
| 1487 | Ga0207711_10006493 | |||
| 1488 | Ga0207711_10007210 | |||
| 1489 | Ga0207711_10022429 | |||
| 1490 | Ga0207711_10041712 | |||
| 1491 | Ga0207711_10093431 | |||
| 1492 | Ga0207711_10169272 | |||
| 1493 | Ga0207711_10199657 | |||
| 1494 | Ga0207711_10285077 | |||
| 1495 | Ga0207711_10345190 | |||
| 1496 | Ga0207711_10534334 | |||
| 1497 | Ga0207689_10002878 | |||
| 1498 | Ga0207689_10017739 | |||
| 1499 | Ga0207689_10061818 | |||
| 1500 | Ga0207689_10116681 | |||
| 1501 | Ga0207689_10666243 | |||
| 1502 | Ga0207661_10005447 | |||
| 1503 | Ga0207661_10009405 | |||
| 1504 | Ga0207661_10015726 | |||
| 1505 | Ga0207661_10062858 | |||
| 1506 | Ga0207661_10429628 | |||
| 1507 | Ga0207679_10017573 | |||
| 1508 | Ga0207679_10125327 | |||
| 1509 | Ga0207679_10146409 | |||
| 1510 | Ga0207679_10309879 | |||
| 1511 | Ga0207679_10390565 | |||
| 1512 | Ga0207679_10599340 | |||
| 1513 | Ga0207667_10001255 | |||
| 1514 | Ga0207667_10015370 | |||
| 1515 | Ga0207667_10015668 | |||
| 1516 | Ga0207667_10019763 | |||
| 1517 | Ga0207667_10043664 | |||
| 1518 | Ga0207667_10126843 | |||
| 1519 | Ga0207667_10234170 | |||
| 1520 | Ga0207651_10001469 | |||
| 1521 | Ga0207651_10034021 | |||
| 1522 | Ga0207651_10041524 | |||
| 1523 | Ga0207651_10045725 | |||
| 1524 | Ga0207651_10094790 | |||
| 1525 | Ga0207651_10135196 | |||
| 1526 | Ga0207712_10010889 | |||
| 1527 | Ga0207712_10074850 | |||
| 1528 | Ga0207712_10473253 | |||
| 1529 | Ga0207668_10036119 | |||
| 1530 | Ga0207640_10088904 | |||
| 1531 | Ga0207640_10435884 | |||
| 1532 | Ga0207658_10039244 | |||
| 1533 | Ga0207658_10161180 | |||
| 1534 | Ga0207658_10341024 | |||
| 1535 | Ga0207677_10010460 | |||
| 1536 | Ga0207677_10050312 | |||
| 1537 | Ga0207677_10342878 | |||
| 1538 | Ga0207677_10354736 | |||
| 1539 | Ga0207677_10448855 | |||
| 1540 | Ga0207703_10042849 | |||
| 1541 | Ga0207703_10068429 | |||
| 1542 | Ga0207703_10080218 | |||
| 1543 | Ga0207703_10331621 | |||
| 1544 | Ga0207703_10522471 | |||
| 1545 | Ga0207639_10122814 | |||
| 1546 | Ga0207639_10234835 | |||
| 1547 | Ga0207639_10244257 | |||
| 1548 | Ga0207678_10085842 | |||
| 1549 | Ga0207678_10565836 | |||
| 1550 | Ga0207708_10003022 | |||
| 1551 | Ga0207708_10144762 | |||
| 1552 | Ga0207708_10374943 | |||
| 1553 | Ga0207702_10033941 | |||
| 1554 | Ga0207702_10120988 | |||
| 1555 | Ga0207702_10347159 | |||
| 1556 | Ga0207641_10079572 | |||
| 1557 | Ga0207641_10238156 | |||
| 1558 | Ga0207641_10350538 | |||
| 1559 | Ga0207641_10564372 | |||
| 1560 | Ga0207641_10748789 | |||
| 1561 | Ga0207648_10002253 | |||
| 1562 | Ga0207648_10082092 | |||
| 1563 | Ga0207648_10110615 | |||
| 1564 | Ga0207648_10263112 | |||
| 1565 | Ga0207648_10415245 | |||
| 1566 | Ga0207676_10004508 | |||
| 1567 | Ga0207676_10015043 | |||
| 1568 | Ga0207676_10117918 | |||
| 1569 | Ga0207674_10000252 | |||
| 1570 | Ga0207674_10002778 | |||
| 1571 | Ga0207674_10020948 | |||
| 1572 | Ga0207674_10038242 | |||
| 1573 | Ga0207674_10393383 | |||
| 1574 | Ga0207674_10768156 | |||
| 1575 | Ga0207675_100004828 | |||
| 1576 | Ga0207675_100043589 | |||
| 1577 | Ga0207675_100069545 | |||
| 1578 | Ga0207675_100079920 | |||
| 1579 | Ga0207675_100140132 | |||
| 1580 | Ga0207675_100189308 | |||
| 1581 | Ga0207675_100733535 | |||
| 1582 | Ga0207683_10277629 | |||
| 1583 | Ga0207683_10562854 | |||
| 1584 | Ga0207698_10087334 | |||
| 1585 | Ga0207698_10165103 | |||
| 1586 | Ga0209588_1089657 | |||
| 1587 | Ga0207428_10000004 | |||
| 1588 | Ga0268266_10019226 | |||
| 1589 | Ga0268266_10070530 | |||
| 1590 | Ga0268266_10087524 | |||
| 1591 | Ga0268266_10398170 | |||
| 1592 | Ga0268265_10073994 | |||
| 1593 | Ga0268265_10173647 | |||
| 1594 | Ga0268265_10196908 | |||
| 1595 | Ga0268265_10272682 | |||
| 1596 | Ga0268264_10030492 | |||
| 1597 | Ga0268264_10036700 | |||
| 1598 | Ga0265760_10007034 | |||
| 1599 | Ga0265329_10028572 | |||
| 1600 | Ga0265331_10215362 | |||
| 1601 | Ga0265313_10006675 | |||
| 1602 | Ga0265313_10009655 | |||
| 1603 | Ga0265314_10001386 | |||
| 1604 | Ga0265314_10005349 | |||
| 1605 | Ga0316576_10025794 | |||
| 1606 | Ga0316576_10077146 | |||
| 1607 | Ga0316578_10261088 | |||
| 1608 | Ga0307405_10030145 | |||
| 1609 | Ga0307412_10064463 | |||
| 1610 | Ga0307412_10355170 | |||
| 1611 | Ga0307409_100148400 | |||
| 1612 | Ga0307416_100007255 | |||
| 1613 | Ga0307411_10533578 | |||
| 1614 | Ga0316583_10046053 | |||
| 1615 | Ga0373926_0000614 | |||
| 1616 | Ga0373934_0004206 | |||
| 1617 | Ga0373952_0031857 | |||
| 1618 | Ga0373923_0011426 | |||
| 1619 | Ga0373939_0192345 | |||
| 1620 | Ga0373953_0035336 | |||
| 1621 | Ga0373954_0002133 | |||
| 1622 | Ga0373954_0257828 | |||
| 1623 | Ga0373956_0042534 | |||
| 1624 | Ga0373956_0219625 | |||
| 1625 | Ga0373956_0274475 | |||
| 1626 | Ga0373957_0117090 | |||
| 1627 | Ga0373943_0138686 | |||
| 1628 | Ga0373946_0178564 | |||
| 1629 | Ga0373955_0006974 | |||
| 1630 | Ga0373955_0081164 | |||
| 1631 | Ga0373955_0081681 | |||
| 1632 | Ga0373955_0088444 | |||
| 1633 | Ga0373955_0295581 | |||
| 1634 | Ga0373935_0000902 | |||
| 1635 | Ga0373935_0028083 | |||
| 1636 | Ga0373935_0037190 | |||
| 1637 | Ga0373935_0522022 | |||
| 1638 | Ga0373927_0004041 | |||
| 1639 | Ga0373927_0005586 | |||
| 1640 | Ga0373927_0080942 | |||
| 1641 | Ga0373927_0188568 | |||
| 1642 | Ga0373933_0016981 | |||
| 1643 | Ga0373933_0044230 | |||
| 1644 | Ga0373933_0266037 | |||
| 1645 | Ga0373947_0015220 | |||
| 1646 | Ga0373947_0069973 | |||
| 1647 | Ga0373947_0070709 | |||
| 1648 | Ga0373947_0596161 | |||
| 1649 | Ga0373937_0001951 | |||
| 1650 | Ga0373937_0004398 | |||
| 1651 | Ga0373937_0012599 | |||
| 1652 | Ga0373937_0023943 | |||
| 1653 | Ga0373937_0127113 | |||
| 1654 | Ga0373937_0210578 | |||
| 1655 | Ga0373937_0272259 | |||
| 1656 | Ga0373937_0299426 | |||
| 1657 | Ga0373937_0356081 | |||
| 1658 | Ga0373937_0359925 | |||
| 1659 | Ga0373937_0535302 | |||
| 1660 | Ga0373937_0665295 | |||
| 1661 | Ga0373937_0715231 | |||
| 1662 | Ga0316582_0032046 | |||
| 1663 | Ga0316584_0022871 | |||
| 1664 | Ga0316584_0371458 | |||
| 1665 | Ga0373925_0009351 | |||
| 1666 | Ga0373925_0018646 | |||
| 1667 | Ga0439453_0034636 | |||
| 1668 | Ga0450896_033444 | |||
| 1669 | Ga0451577_0131290 | |||
| 1670 | Ga0453684_0299781 | |||
| 1671 | Ga0451576_0276693 | |||
| 1672 | Ga0451576_0300579 | |||
| 1673 | Ga0451576_0397770 | |||
| 1674 | Ga0495592_0011052 | |||
| 1675 | Ga0495592_0022690 | |||
| 1676 | Ga0495592_0033271 | |||
| 1677 | Ga0495592_0063728 | |||
| 1678 | Ga0495592_0071647 | |||
| 1679 | Ga0495603_0409420 | |||
| 1680 | Ga0495629_0063335 | |||
| 1681 | Ga0495651_0000126 | |||
| 1682 | Ga0495651_0005148 | |||
| 1683 | Ga0495651_0009981 | |||
| 1684 | Ga0495651_0417465 | |||
| 1685 | Ga0495651_0486437 | |||
| 1686 | Ga0495653_0010223 | |||
| 1687 | Ga0495653_0088967 | |||
| 1688 | Ga0495653_0127564 | |||
| 1689 | Ga0495653_0145011 | |||
| 1690 | Ga0495653_0460601 | |||
| 1691 | Ga0495580_0005481 | |||
| 1692 | Ga0495580_0015510 | |||
| 1693 | Ga0495580_0018716 | |||
| 1694 | Ga0495580_0053551 | |||
| 1695 | Ga0495580_0164608 | |||
| 1696 | Ga0495580_0264332 | |||
| 1697 | Ga0495580_0283151 | |||
| 1698 | Ga0495582_0049359 | |||
| 1699 | Ga0495582_0126266 | |||
| 1700 | Ga0495639_0069564 | |||
| 1701 | Ga0495639_0117335 | |||
| 1702 | Ga0495639_0207836 | |||
| 1703 | Ga0495664_0019425 | |||
| 1704 | Ga0495594_0106000 | |||
| 1705 | Ga0495594_0113942 | |||
| 1706 | Ga0495608_0002023 | |||
| 1707 | Ga0495608_0006811 | |||
| 1708 | Ga0495608_0010563 | |||
| 1709 | Ga0495608_0029614 | |||
| 1710 | Ga0495608_0043759 | |||
| 1711 | Ga0495618_0007195 | |||
| 1712 | Ga0495628_0001880 | |||
| 1713 | Ga0495628_0012049 | |||
| 1714 | Ga0495628_0018608 | |||
| 1715 | Ga0495628_0066816 | |||
| 1716 | Ga0495628_0232312 | |||
| 1717 | Ga0495628_0301316 | |||
| 1718 | Ga0495630_0001011 | |||
| 1719 | Ga0495630_0001268 | |||
| 1720 | Ga0495630_0003853 | |||
| 1721 | Ga0495630_0017821 | |||
| 1722 | Ga0495666_0020095 | |||
| 1723 | Ga0495652_0013561 | |||
| 1724 | Ga0495652_0016762 | |||
| 1725 | Ga0495652_0064347 | |||
| 1726 | Ga0495665_0013131 | |||
| 1727 | Ga0495665_0085639 | |||
| 1728 | Ga0495586_0000405 | |||
| 1729 | Ga0495586_0069027 | |||
| 1730 | Ga0495586_0181340 | |||
| 1731 | Ga0495586_0193084 | |||
| 1732 | Ga0495586_0205454 | |||
| 1733 | Ga0495586_0247271 | |||
| 1734 | Ga0495587_0001076 | |||
| 1735 | Ga0495587_0004806 | |||
| 1736 | Ga0495587_0128957 | |||
| 1737 | Ga0495621_0015319 | |||
| 1738 | Ga0495621_0054027 | |||
| 1739 | Ga0495645_0002936 | |||
| 1740 | Ga0495645_0024700 | |||
| 1741 | Ga0495645_0038923 | |||
| 1742 | Ga0495645_0132836 | |||
| 1743 | Ga0495645_0222984 | |||
| 1744 | Ga0495667_0001136 | |||
| 1745 | Ga0495667_0013664 | |||
| 1746 | Ga0495667_0042162 | |||
| 1747 | Ga0495667_0219038 | |||
| 1748 | Ga0495667_0274600 | |||
| 1749 | Ga0495634_0040074 | |||
| 1750 | Ga0495634_0141460 | |||
| 1751 | Ga0495635_0054682 | |||
| 1752 | Ga0495635_0130570 | |||
| 1753 | Ga0495635_0190783 | |||
| 1754 | Ga0495657_0004041 | |||
| 1755 | Ga0495657_0145507 | |||
| 1756 | Ga0495599_0003977 | |||
| 1757 | Ga0495599_0018901 | |||
| 1758 | Ga0495623_0003934 | |||
| 1759 | Ga0495623_0081568 | |||
| 1760 | Ga0495623_0260433 | |||
| 1761 | Ga0495646_0000785 | |||
| 1762 | Ga0495646_0058133 | |||
| 1763 | Ga0495658_0045096 | |||
| 1764 | Ga0495658_0171042 | |||
| 1765 | Ga0495613_0001706 | |||
| 1766 | Ga0495613_0056494 | |||
| 1767 | Ga0495613_0168362 | |||
| 1768 | Ga0495613_0545359 | |||
| 1769 | Ga0495624_0016528 | |||
| 1770 | Ga0495624_0393308 | |||
| 1771 | Ga0495600_0003140 | |||
| 1772 | Ga0495600_0082885 | |||
| 1773 | Ga0495604_0005091 | |||
| 1774 | Ga0495604_0010297 | |||
| 1775 | Ga0495604_0044978 | |||
| 1776 | Ga0495604_0400656 | |||
| 1777 | Ga0495674_0001401 | |||
| 1778 | Ga0495674_0013223 | |||
| 1779 | Ga0495674_0020559 | |||
| 1780 | Ga0495674_0024847 | |||
| 1781 | Ga0495674_0055836 | |||
| 1782 | Ga0495674_0236338 | |||
| 1783 | Ga0495676_0046014 | |||
| 1784 | Ga0495680_0000253 | |||
| 1785 | Ga0495680_0001258 | |||
| 1786 | Ga0495680_0089003 | |||
| 1787 | Ga0495680_0096719 | |||
| 1788 | Ga0495680_0186848 | |||
| 1789 | Ga0495675_0000165 | |||
| 1790 | Ga0495675_0005957 | |||
| 1791 | Ga0495675_0148243 | |||
| 1792 | Ga0495675_0178269 | |||
| 1793 | Ga0495684_0000125 | |||
| 1794 | Ga0495684_0009716 | |||
| 1795 | Ga0495684_0012342 | |||
| 1796 | Ga0495684_0013320 | |||
| 1797 | Ga0495684_0025018 | |||
| 1798 | Ga0495684_0076222 | |||
| 1799 | Ga0495684_0203701 | |||
| 1800 | Ga0495684_0311031 | |||
| 1801 | Ga0495602_0003164 | |||
| 1802 | Ga0495602_0012198 | |||
| 1803 | Ga0495602_0021669 | |||
| 1804 | Ga0495602_0081110 | |||
| 1805 | Ga0495602_0228155 | |||
| 1806 | Ga0496100_0005245 | |||
| 1807 | Ga0496101_0018969 | |||
| 1808 | Ga0496104_0170139 | |||
| 1809 | Ga0496104_0195870 | |||
| 1810 | Ga0496104_0298439 | |||
| 1811 | Ga0496104_0358451 | |||
| 1812 | Ga0496107_0062033 | |||
| 1813 | Ga0496112_0440891 | |||
| 1814 | Ga0496112_0570133 | |||
| 1815 | Ga0496114_0002302 | |||
| 1816 | Ga0501042_0443823 | |||
| 1817 | Ga0501046_0234035 | |||
| 1818 | Ga0501047_0104620 | |||
| 1819 | Ga0501048_0135796 | |||
| 1820 | Ga0501074_0088039 | |||
| 1821 | Ga0501075_0021304 | |||
| 1822 | Ga0501076_0046871 | |||
| 1823 | Ga0501079_0042736 | |||
| 1824 | Ga0501080_0098430 | |||
| 1825 | nmdc:mga05p37_105860_c1 | |||
| 1826 | nmdc:mga05p37_215848_c1 | |||
| 1827 | nmdc:mga05p37_33_c1 | |||
| 1828 | nmdc:mga05p37_48567_c1 | |||
| 1829 | nmdc:mga05p37_7649_c1 | |||
| 1830 | nmdc:mga05p37_827925_c1 | |||
| 1831 | nmdc:mga09592_296325_c1 | |||
| 1832 | nmdc:mga09592_3004_c1 | |||
| 1833 | nmdc:mga09592_3103_c1 | |||
| 1834 | nmdc:mga06r32_149771_c1 | |||
| 1835 | nmdc:mga06r32_208333_c1 | |||
| 1836 | nmdc:mga06r32_29148_c1 | |||
| 1837 | nmdc:mga06r32_46080_c1 | |||
| 1838 | nmdc:mga06r32_5990_c1 | |||
| 1839 | nmdc:mga06r32_84513_c1 | |||
| 1840 | nmdc:mga08y16_249954_c1 | |||
| 1841 | nmdc:mga08y16_2_c1 | |||
| 1842 | nmdc:mga0n895_208421_c1 | |||
| 1843 | nmdc:mga0n895_28312_c1 | |||
| 1844 | nmdc:mga0n895_879410_c1 | |||
| 1845 | nmdc:mga0rr50_280591_c1 | |||
| 1846 | nmdc:mga08x19_304343_c1 | |||
| 1847 | nmdc:mga0a205_218116_c1 | |||
| 1848 | nmdc:mga0a205_242635_c1 | |||
| 1849 | nmdc:mga0a205_30462_c1 | |||
| 1850 | nmdc:mga0a205_398057_c1 | |||
| 1851 | Ga0495601_0022203 | |||
| 1852 | Ga0495601_0195274 | |||
| 1853 | Ga0495612_0003944 | |||
| 1854 | Ga0495595_0103462 | |||
| 1855 | Ga0495619_0021501 | |||
| 1856 | Ga0495619_0081684 | |||
| 1857 | Ga0495619_0300394 | |||
| 1858 | Ga0495619_0551672 | |||
| 1859 | Ga0500568_0008529 | |||
| 1860 | Ga0501084_0042671 | |||
| 1861 | Ga0501082_0129189 | |||
| 1862 | Ga0530510_0018388 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3p19-assembly1.cif.gz_B | improved nadph-dependent blue fluorescent protein | 0.9539 | 6 | 234 |
| 2ehd-assembly1.cif.gz_A | crystal structure analysis of oxidoreductase | 0.9518 | 6 | 228 |
| 3p19-assembly1.cif.gz_B | improved nadph-dependent blue fluorescent protein | 0.9454 | 6 | 234 |
| 2ehd-assembly1.cif.gz_B | crystal structure analysis of oxidoreductase | 0.945 | 6 | 231 |
| 3asu-assembly1.cif.gz_B-2 | crystal structure of serine dehydrogenase from escherichia coli | 0.9358 | 7 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6ED38_49_231_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9719 | 3 | 176 | 3.40.50.720 |
| af_F4J128_251_373_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9664 | 85 | 184 | 3.40.50.720 |
| af_A0A0P0X9U1_21_128_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9627 | 2 | 87 | 3.40.50.720 |
| af_Q0D3U8_30_207_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9589 | 3 | 163 | 3.40.50.720 |
| af_C6T421_12_106_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.953 | 3 | 74 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q7S4T9-F1-model_v4 | Short-chain dehydrogenase | 0.9927 | 1 | 235 |
GO:0016491
|
| AF-A0A7V2AD82-F1-model_v4 | SDR family oxidoreductase | 0.9903 | 1 | 186 |
GO:0016491
|
| AF-A0A2V8KVA2-F1-model_v4 | Short-chain dehydrogenase | 0.9889 | 27 | 235 |
GO:0016491
|
| AF-A0A1Q7S4T9-F1-model_v4 | Short-chain dehydrogenase | 0.9885 | 1 | 235 |
GO:0016491
|
| AF-A0A496UUZ4-F1-model_v4 | Short-chain dehydrogenase | 0.9849 | 1 | 234 |
GO:0016491
|