F486050

General Info

Members Datasets Scaffolds Average Seq Length
931 275 1862 235

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0142022|Ga0496115_0142022_497_1321
Length 274
Sequence MRTAKTTAILREFMGCSFAQNGIAVDDRPSIFYDTIKGGIMNLTTAVALVTGGTAGIGRSIAKTLVESGARVAITGRDKARLEETAQTLGVFPIHADVSNEVDVIRSYREVLAKFGDLDILVNNAGVGVFKSLVDMDRASFDNVFATNVTGAMLMGREAARHFIKRNRGAIINIASTAGLRGAANGTAYYASKFALRGMTECWRAELRKYNIRVMLVNPSEVITNFAASAGITQKANETKLRGEEIAYAVKAILEMDDRGFTPELTIFATNPID

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
81 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
170 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
181 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
182 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
183 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
187 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
188 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
195 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
199 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
202 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
203 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
210 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
224 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
225 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
226 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
231 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
232 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
233 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
234 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
243 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
244 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
257 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
258 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
259 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.89
Metatranscriptomes 0.11
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 1.18
Rhizosphere 98.71
Stem 0
Stem Tuber 0
Unclassified 11.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0142022 3300048918 Bacteria 1981
2 Ga0065707_10150567 3300005295 Bacteria 1663
3 Ga0070658_10187959 3300005327 Bacteria 1740
4 Ga0070676_10217763 3300005328 Bacteria 1260
5 Ga0070683_100098299 3300005329 Bacteria 2754
6 Ga0070690_100032320 3300005330 Bacteria 3267
7 Ga0070670_100007834 3300005331 Bacteria 9089
8 Ga0070670_100010330 3300005331 Bacteria 7968
9 Ga0070670_100308850 3300005331 Bacteria 1384
10 Ga0070677_10059985 3300005333 Bacteria 1566
11 Ga0068869_100002089 3300005334 Bacteria 12012
12 Ga0068869_100058052 3300005334 Bacteria 2828
13 Ga0068869_100096635 3300005334 Bacteria 2230
14 Ga0068869_100408070 3300005334 Unclassified 1119
15 Ga0068869_100706225 3300005334 Unclassified 860
16 Ga0070666_10001137 3300005335 Bacteria 16197
17 Ga0070666_10039637 3300005335 Bacteria 3141
18 Ga0070666_10046062 3300005335 Bacteria 2924
19 Ga0070666_10167662 3300005335 Bacteria 1537
20 Ga0070666_10257688 3300005335 Bacteria 1236
21 Ga0070680_100013946 3300005336 Bacteria 6272
22 Ga0068868_100005508 3300005338 Bacteria 8903
23 Ga0068868_100006505 3300005338 Bacteria 8272
24 Ga0068868_100047539 3300005338 Bacteria 3364
25 Ga0068868_100145886 3300005338 Bacteria 1946
26 Ga0068868_100158663 3300005338 Bacteria 1867
27 Ga0068868_100206923 3300005338 Bacteria 1638
28 Ga0068868_100309782 3300005338 Unclassified 1343
29 Ga0068868_100443529 3300005338 Bacteria 1128
30 Ga0070660_100024608 3300005339 Bacteria 4466
31 Ga0070660_100120887 3300005339 Bacteria 2090
32 Ga0070660_100151657 3300005339 Unclassified 1864
33 Ga0070689_100043304 3300005340 Bacteria 3459
34 Ga0070689_100046856 3300005340 Bacteria 3332
35 Ga0070689_100223763 3300005340 Bacteria 1544
36 Ga0070691_10013126 3300005341 Bacteria 3795
37 Ga0070661_100110285 3300005344 Bacteria 2054
38 Ga0070661_100269976 3300005344 Bacteria 1317
39 Ga0070692_10062155 3300005345 Bacteria 1970
40 Ga0070669_100033005 3300005353 Bacteria 3742
41 Ga0070669_100162159 3300005353 Bacteria 1738
42 Ga0070675_100000819 3300005354 Bacteria 21941
43 Ga0070675_100004909 3300005354 Bacteria 10201
44 Ga0070675_100005091 3300005354 Bacteria 10027
45 Ga0070675_100129004 3300005354 Bacteria 2153
46 Ga0070675_100211505 3300005354 Unclassified 1686
47 Ga0070671_100016426 3300005355 Bacteria 5985
48 Ga0070671_100044390 3300005355 Bacteria 3694
49 Ga0070671_100046964 3300005355 Bacteria 3591
50 Ga0070671_100071980 3300005355 Bacteria 2886
51 Ga0070671_100072762 3300005355 Unclassified 2871
52 Ga0070671_100332130 3300005355 Bacteria 1296
53 Ga0070671_100351943 3300005355 Bacteria 1257
54 Ga0070674_100081645 3300005356 Bacteria 2311
55 Ga0070674_100145780 3300005356 Bacteria 1782
56 Ga0070674_100187972 3300005356 Bacteria 1587
57 Ga0070674_100763458 3300005356 Bacteria 832
58 Ga0070673_100023649 3300005364 Bacteria 4492
59 Ga0070673_100066805 3300005364 Bacteria 2874
60 Ga0070673_100201593 3300005364 Bacteria 1714
61 Ga0070673_100246687 3300005364 Bacteria 1555
62 Ga0070673_100323817 3300005364 Bacteria 1362
63 Ga0070688_100229994 3300005365 Archaea 1311
64 Ga0070688_100443521 3300005365 Bacteria 969
65 Ga0070688_100466105 3300005365 Bacteria 947
66 Ga0070659_100043757 3300005366 Unclassified 3503
67 Ga0070659_100184786 3300005366 Bacteria 1711
68 Ga0070667_100072696 3300005367 Bacteria 2931
69 Ga0070667_100082239 3300005367 Bacteria 2757
70 Ga0070667_100082948 3300005367 Bacteria 2745
71 Ga0070667_100163950 3300005367 Bacteria 1959
72 Ga0070667_100560439 3300005367 Bacteria 1051
73 Ga0070713_100011378 3300005436 Bacteria 6479
74 Ga0070713_100025278 3300005436 Bacteria 4640
75 Ga0070713_100181065 3300005436 Bacteria 1894
76 Ga0070713_100724831 3300005436 Bacteria 950
77 Ga0070713_100808371 3300005436 Bacteria 899
78 Ga0070710_10339695 3300005437 Bacteria 991
79 Ga0070701_10049956 3300005438 Bacteria 2164
80 Ga0070711_100069704 3300005439 Bacteria 2474
81 Ga0070711_100514942 3300005439 Bacteria 988
82 Ga0070705_100305830 3300005440 Bacteria 1141
83 Ga0070700_100001632 3300005441 Bacteria 11208
84 Ga0070694_100065444 3300005444 Bacteria 2490
85 Ga0070694_100083783 3300005444 Bacteria 2223
86 Ga0070694_100387784 3300005444 Bacteria 1091
87 Ga0070663_100087079 3300005455 Bacteria 2308
88 Ga0070678_100273146 3300005456 Bacteria 1426
89 Ga0070662_100022723 3300005457 Bacteria 4297
90 Ga0070662_100101600 3300005457 Bacteria 2177
91 Ga0070662_100231891 3300005457 Bacteria 1477
92 Ga0070681_10072278 3300005458 Bacteria 3412
93 Ga0070681_10093516 3300005458 Bacteria 2955
94 Ga0070681_10379789 3300005458 Bacteria 1324
95 Ga0068867_100021545 3300005459 Bacteria 4599
96 Ga0068867_100033466 3300005459 Bacteria 3722
97 Ga0068867_100085376 3300005459 Bacteria 2386
98 Ga0068867_100325983 3300005459 Bacteria 1274
99 Ga0070685_10536405 3300005466 Bacteria 833
100 Ga0070706_100004393 3300005467 Bacteria 13616
101 Ga0070706_100077523 3300005467 Bacteria 3076
102 Ga0070707_100003828 3300005468 Bacteria 14183
103 Ga0070707_100203689 3300005468 Bacteria 1929
104 Ga0070698_100014652 3300005471 Bacteria 8285
105 Ga0070698_100108751 3300005471 Bacteria 2739
106 Ga0070698_100357158 3300005471 Bacteria 1393
107 Ga0070699_100000875 3300005518 Bacteria 28029
108 Ga0070684_100007408 3300005535 Bacteria 8527
109 Ga0070684_100007644 3300005535 Bacteria 8427
110 Ga0070684_100042326 3300005535 Unclassified 3931
111 Ga0070684_100838806 3300005535 Bacteria 860
112 Ga0068853_100101024 3300005539 Unclassified 2550
113 Ga0068853_100150560 3300005539 Bacteria 2094
114 Ga0068853_100363828 3300005539 Bacteria 1348
115 Ga0068853_100738297 3300005539 Unclassified 940
116 Ga0070672_100001694 3300005543 Bacteria 13762
117 Ga0070672_100082506 3300005543 Bacteria 2579
118 Ga0070672_100126706 3300005543 Bacteria 2095
119 Ga0070686_100044340 3300005544 Bacteria 2795
120 Ga0070686_100098881 3300005544 Unclassified 1967
121 Ga0070686_100110702 3300005544 Bacteria 1870
122 Ga0070695_100081632 3300005545 Bacteria 2140
123 Ga0070696_100088620 3300005546 Bacteria 2200
124 Ga0070665_100004087 3300005548 Bacteria 15342
125 Ga0070665_100153131 3300005548 Bacteria 2308
126 Ga0070665_100499736 3300005548 Unclassified 1227
127 Ga0070665_100583453 3300005548 Bacteria 1131
128 Ga0070704_100003332 3300005549 Bacteria 9195
129 Ga0070704_100105274 3300005549 Bacteria 2135
130 Ga0070704_100511939 3300005549 Bacteria 1043
131 Ga0070704_100825013 3300005549 Bacteria 830
132 Ga0068855_100001557 3300005563 Bacteria 28824
133 Ga0068855_100009822 3300005563 Bacteria 11545
134 Ga0068855_100014867 3300005563 Bacteria 9374
135 Ga0068855_100047694 3300005563 Bacteria 5060
136 Ga0068855_100152601 3300005563 Bacteria 2626
137 Ga0068855_100213834 3300005563 Bacteria 2165
138 Ga0068855_100776972 3300005563 Bacteria 1019
139 Ga0068855_101000435 3300005563 Unclassified 878
140 Ga0070664_100007205 3300005564 Bacteria 8971
141 Ga0070664_100007317 3300005564 Bacteria 8903
142 Ga0070664_100148442 3300005564 Bacteria 2069
143 Ga0070664_100315645 3300005564 Bacteria 1415
144 Ga0070664_100644939 3300005564 Bacteria 984
145 Ga0068857_100011025 3300005577 Bacteria 7869
146 Ga0068857_100095755 3300005577 Bacteria 2660
147 Ga0068857_100140302 3300005577 Bacteria 2184
148 Ga0068857_100143645 3300005577 Bacteria 2158
149 Ga0068854_100021040 3300005578 Unclassified 4423
150 Ga0068856_100003142 3300005614 Bacteria 16839
151 Ga0068856_100006380 3300005614 Bacteria 11569
152 Ga0068856_100066042 3300005614 Unclassified 3575
153 Ga0068856_100129805 3300005614 Unclassified 2525
154 Ga0068856_100163931 3300005614 Bacteria 2234
155 Ga0068856_100405723 3300005614 Bacteria 1382
156 Ga0068856_100466278 3300005614 Eukaryota 1284
157 Ga0068852_100032351 3300005616 Unclassified 4330
158 Ga0068852_100180611 3300005616 Bacteria 1984
159 Ga0068852_100210805 3300005616 Bacteria 1843
160 Ga0068852_100903455 3300005616 Bacteria 900
161 Ga0068859_100001734 3300005617 Bacteria 22220
162 Ga0068859_100004423 3300005617 Bacteria 14339
163 Ga0068859_100431213 3300005617 Bacteria 1415
164 Ga0068859_100768319 3300005617 Bacteria 1052
165 Ga0068864_100003613 3300005618 Bacteria 12788
166 Ga0068864_100263442 3300005618 Bacteria 1604
167 Ga0068866_10010753 3300005718 Bacteria 3934
168 Ga0068866_10232944 3300005718 Bacteria 1118
169 Ga0068866_10456362 3300005718 Bacteria 837
170 Ga0068861_100025559 3300005719 Bacteria 4284
171 Ga0068861_100051526 3300005719 Bacteria 3125
172 Ga0068861_100110659 3300005719 Bacteria 2200
173 Ga0068861_100153647 3300005719 Bacteria 1891
174 Ga0068861_100204700 3300005719 Bacteria 1659
175 Ga0068861_100453585 3300005719 Bacteria 1149
176 Ga0068861_100725587 3300005719 Bacteria 926
177 Ga0068851_10332069 3300005834 Unclassified 881
178 Ga0068870_10201428 3300005840 Bacteria 1207
179 Ga0068863_100053375 3300005841 Archaea 3831
180 Ga0068863_100066682 3300005841 Unclassified 3405
181 Ga0068863_100114859 3300005841 Bacteria 2565
182 Ga0068863_100171821 3300005841 Unclassified 2079
183 Ga0068863_100198611 3300005841 Bacteria 1928
184 Ga0068863_100342225 3300005841 Bacteria 1455
185 Ga0068863_100475219 3300005841 Bacteria 1228
186 Ga0068858_100007279 3300005842 Bacteria 10723
187 Ga0068858_100012093 3300005842 Bacteria 8136
188 Ga0068858_100015353 3300005842 Bacteria 7202
189 Ga0068858_100023284 3300005842 Bacteria 5771
190 Ga0068858_100032999 3300005842 Bacteria 4808
191 Ga0068858_100170495 3300005842 Bacteria 2052
192 Ga0068860_100017221 3300005843 Bacteria 7043
193 Ga0068860_100031737 3300005843 Bacteria 5079
194 Ga0068860_100273388 3300005843 Bacteria 1649
195 Ga0068860_100282331 3300005843 Bacteria 1623
196 Ga0068860_100297603 3300005843 Bacteria 1580
197 Ga0068860_100376983 3300005843 Bacteria 1400
198 Ga0068860_100476081 3300005843 Bacteria 1244
199 Ga0068862_100154944 3300005844 Bacteria 2042
200 Ga0068862_100259555 3300005844 Bacteria 1586
201 Ga0068862_100327219 3300005844 Bacteria 1416
202 Ga0070717_10015510 3300006028 Bacteria 5888
203 Ga0070717_10321859 3300006028 Unclassified 1378
204 Ga0070712_100032433 3300006175 Bacteria 3528
205 Ga0097621_100005568 3300006237 Bacteria 8881
206 Ga0097621_100006771 3300006237 Bacteria 8138
207 Ga0097621_100007326 3300006237 Bacteria 7886
208 Ga0097621_100011511 3300006237 Bacteria 6518
209 Ga0097621_100047814 3300006237 Bacteria 3467
210 Ga0097621_100062808 3300006237 Bacteria 3050
211 Ga0097621_100118314 3300006237 Bacteria 2245
212 Ga0097621_100409269 3300006237 Bacteria 1215
213 Ga0068871_100005892 3300006358 Bacteria 8617
214 Ga0068871_100013531 3300006358 Bacteria 6056
215 Ga0068871_100016427 3300006358 Bacteria 5574
216 Ga0068871_100018946 3300006358 Bacteria 5246
217 Ga0068871_100023980 3300006358 Unclassified 4727
218 Ga0068871_100043261 3300006358 Bacteria 3618
219 Ga0068871_100054353 3300006358 Bacteria 3249
220 Ga0068871_100099886 3300006358 Unclassified 2430
221 Ga0068871_100152043 3300006358 Unclassified 1974
222 Ga0068871_100194424 3300006358 Bacteria 1749
223 Ga0068871_100231568 3300006358 Bacteria 1603
224 Ga0068871_100247047 3300006358 Bacteria 1553
225 Ga0068871_100575110 3300006358 Bacteria 1022
226 Ga0068871_100681286 3300006358 Bacteria 941
227 Ga0075428_100000019 3300006844 Bacteria 137803
228 Ga0075428_100006790 3300006844 Bacteria 12736
229 Ga0075428_100009289 3300006844 Bacteria 10901
230 Ga0075428_100023052 3300006844 Bacteria 6889
231 Ga0075428_100799367 3300006844 Bacteria 1003
232 Ga0075430_100034914 3300006846 Bacteria 4269
233 Ga0075430_100113743 3300006846 Bacteria 2256
234 Ga0075430_100173636 3300006846 Bacteria 1793
235 Ga0075431_100000914 3300006847 Bacteria 26009
236 Ga0075431_100023001 3300006847 Bacteria 6370
237 Ga0075431_100040152 3300006847 Bacteria 4822
238 Ga0075431_100088438 3300006847 Unclassified 3197
239 Ga0075431_100169520 3300006847 Bacteria 2243
240 Ga0075433_10021120 3300006852 Bacteria 5456
241 Ga0075433_10080599 3300006852 Bacteria 2870
242 Ga0075433_10311480 3300006852 Unclassified 1393
243 Ga0075434_100031003 3300006871 Bacteria 5270
244 Ga0075434_100086245 3300006871 Unclassified 3139
245 Ga0075429_100012100 3300006880 Bacteria 7478
246 Ga0075429_100076018 3300006880 Bacteria 2925
247 Ga0075429_100482109 3300006880 Bacteria 1087
248 Ga0068865_100008234 3300006881 Bacteria 6436
249 Ga0068865_100011766 3300006881 Bacteria 5482
250 Ga0068865_100060820 3300006881 Bacteria 2645
251 Ga0068865_100460680 3300006881 Bacteria 1053
252 Ga0097620_100001734 3300006931 Bacteria 22220
253 Ga0097620_100004423 3300006931 Bacteria 14339
254 Ga0097620_100431247 3300006931 Bacteria 1415
255 Ga0097620_100768304 3300006931 Bacteria 1052
256 Ga0075435_100554134 3300007076 Bacteria 996
257 Ga0099794_10030342 3300007265 Bacteria 2524
258 Ga0099795_10154082 3300007788 Bacteria 943
259 Ga0105240_10001330 3300009093 Bacteria 42531
260 Ga0105240_10005789 3300009093 Bacteria 18334
261 Ga0105240_10008052 3300009093 Bacteria 15167
262 Ga0105240_10025249 3300009093 Bacteria 7812
263 Ga0105240_10254118 3300009093 Bacteria 2031
264 Ga0105240_10454277 3300009093 Bacteria 1433
265 Ga0105240_10511859 3300009093 Bacteria 1333
266 Ga0105240_10700341 3300009093 Unclassified 1106
267 Ga0105240_10730359 3300009093 Bacteria 1078
268 Ga0111539_10000002 3300009094 Bacteria 983359
269 Ga0111539_10058550 3300009094 Bacteria 4571
270 Ga0111539_10359843 3300009094 Unclassified 1694
271 Ga0111539_10983809 3300009094 Bacteria 981
272 Ga0111539_11241595 3300009094 Bacteria 865
273 Ga0105245_10003921 3300009098 Bacteria 13224
274 Ga0105245_10004784 3300009098 Bacteria 11948
275 Ga0105245_10015086 3300009098 Bacteria 6731
276 Ga0105245_10015179 3300009098 Bacteria 6710
277 Ga0105245_10018883 3300009098 Bacteria 6033
278 Ga0105245_10019679 3300009098 Bacteria 5915
279 Ga0105245_10045083 3300009098 Bacteria 3937
280 Ga0105245_10047016 3300009098 Bacteria 3857
281 Ga0105245_10104026 3300009098 Bacteria 2632
282 Ga0105245_10119235 3300009098 Bacteria 2463
283 Ga0105245_10254073 3300009098 Bacteria 1709
284 Ga0105245_10651823 3300009098 Bacteria 1083
285 Ga0114129_10000155 3300009147 Bacteria 72923
286 Ga0114129_10011725 3300009147 Bacteria 12473
287 Ga0114129_10017965 3300009147 Bacteria 10071
288 Ga0114129_10029504 3300009147 Bacteria 7770
289 Ga0114129_10094556 3300009147 Bacteria 4139
290 Ga0114129_10173617 3300009147 Bacteria 2937
291 Ga0114129_10195313 3300009147 Unclassified 2745
292 Ga0114129_10259513 3300009147 Bacteria 2330
293 Ga0114129_10491830 3300009147 Bacteria 1603
294 Ga0114129_11074232 3300009147 Bacteria 1009
295 Ga0105243_10019430 3300009148 Bacteria 5152
296 Ga0105243_10066698 3300009148 Bacteria 2895
297 Ga0105243_10168216 3300009148 Bacteria 1896
298 Ga0105243_10199346 3300009148 Bacteria 1754
299 Ga0105243_10291081 3300009148 Bacteria 1475
300 Ga0105241_10010069 3300009174 Bacteria 6942
301 Ga0105241_10010616 3300009174 Bacteria 6754
302 Ga0105241_10168439 3300009174 Bacteria 1807
303 Ga0105241_10169075 3300009174 Bacteria 1804
304 Ga0105241_10227616 3300009174 Bacteria 1570
305 Ga0105241_10338474 3300009174 Bacteria 1303
306 Ga0105242_10003209 3300009176 Bacteria 12731
307 Ga0105242_10004802 3300009176 Bacteria 10459
308 Ga0105242_10013007 3300009176 Bacteria 6419
309 Ga0105242_10014276 3300009176 Bacteria 6153
310 Ga0105242_10049223 3300009176 Bacteria 3429
311 Ga0105242_10086644 3300009176 Bacteria 2628
312 Ga0105242_10129960 3300009176 Bacteria 2173
313 Ga0105242_10287860 3300009176 Bacteria 1495
314 Ga0105242_10335522 3300009176 Bacteria 1392
315 Ga0105248_10001841 3300009177 Bacteria 23501
316 Ga0105248_10009082 3300009177 Bacteria 10932
317 Ga0105248_10013147 3300009177 Bacteria 9113
318 Ga0105248_10019625 3300009177 Bacteria 7482
319 Ga0105248_10027712 3300009177 Bacteria 6309
320 Ga0105248_10047477 3300009177 Bacteria 4815
321 Ga0105248_10068707 3300009177 Bacteria 3978
322 Ga0105248_10116151 3300009177 Bacteria 3018
323 Ga0105248_10142009 3300009177 Bacteria 2709
324 Ga0105248_10168306 3300009177 Bacteria 2470
325 Ga0105248_10217253 3300009177 Unclassified 2153
326 Ga0105248_10450458 3300009177 Bacteria 1450
327 Ga0105248_10767645 3300009177 Bacteria 1088
328 Ga0105248_10771186 3300009177 Bacteria 1085
329 Ga0105237_10009655 3300009545 Bacteria 10326
330 Ga0105237_10025571 3300009545 Bacteria 6034
331 Ga0105237_10075686 3300009545 Bacteria 3357
332 Ga0105237_10247602 3300009545 Bacteria 1784
333 Ga0105237_10389168 3300009545 Bacteria 1399
334 Ga0105237_10408572 3300009545 Bacteria 1362
335 Ga0105238_10001988 3300009551 Bacteria 20594
336 Ga0105238_10014783 3300009551 Bacteria 7894
337 Ga0105238_10017173 3300009551 Bacteria 7349
338 Ga0105238_10032711 3300009551 Bacteria 5293
339 Ga0105238_10049845 3300009551 Bacteria 4216
340 Ga0105238_10060696 3300009551 Bacteria 3785
341 Ga0105238_10153791 3300009551 Bacteria 2275
342 Ga0105238_10348091 3300009551 Bacteria 1471
343 Ga0105238_10370196 3300009551 Bacteria 1423
344 Ga0105238_10642085 3300009551 Unclassified 1071
345 Ga0105249_10009517 3300009553 Bacteria 8514
346 Ga0105239_10010683 3300010375 Bacteria 10266
347 Ga0105239_10011071 3300010375 Bacteria 10068
348 Ga0105239_10028364 3300010375 Bacteria 6158
349 Ga0105239_10029627 3300010375 Bacteria 6017
350 Ga0105239_10529675 3300010375 Bacteria 1341
351 Ga0105246_10013333 3300011119 Bacteria 5151
352 Ga0105246_10027766 3300011119 Bacteria 3713
353 Ga0105246_10225611 3300011119 Unclassified 1472
354 Ga0105246_10285079 3300011119 Bacteria 1327
355 Ga0105246_10303823 3300011119 Bacteria 1290
356 Ga0105246_10584421 3300011119 Unclassified 962
357 Ga0157370_10001733 3300013104 Bacteria 26851
358 Ga0157370_10003270 3300013104 Bacteria 19098
359 Ga0157370_10032457 3300013104 Bacteria 5099
360 Ga0157370_10132190 3300013104 Bacteria 2327
361 Ga0157370_10239498 3300013104 Bacteria 1679
362 Ga0157369_10004743 3300013105 Bacteria 15975
363 Ga0157369_10010200 3300013105 Bacteria 10718
364 Ga0157369_10040053 3300013105 Bacteria 5118
365 Ga0157369_10085323 3300013105 Bacteria 3374
366 Ga0157374_10063327 3300013296 Bacteria 3468
367 Ga0157374_10067952 3300013296 Bacteria 3352
368 Ga0157374_10069124 3300013296 Bacteria 3325
369 Ga0157374_10072565 3300013296 Bacteria 3248
370 Ga0157374_10222409 3300013296 Bacteria 1853
371 Ga0157374_10310016 3300013296 Bacteria 1562
372 Ga0157374_10421479 3300013296 Bacteria 1334
373 Ga0157378_10001898 3300013297 Bacteria 18768
374 Ga0157378_10003929 3300013297 Bacteria 13155
375 Ga0157378_10012987 3300013297 Bacteria 7285
376 Ga0157378_10115656 3300013297 Unclassified 2465
377 Ga0157378_10179491 3300013297 Bacteria 1991
378 Ga0157378_10180595 3300013297 Bacteria 1985
379 Ga0157378_10218029 3300013297 Bacteria 1813
380 Ga0157378_10297574 3300013297 Bacteria 1561
381 Ga0157378_10578752 3300013297 Bacteria 1132
382 Ga0157378_10625605 3300013297 Bacteria 1090
383 Ga0157378_10784376 3300013297 Unclassified 978
384 Ga0163162_10003543 3300013306 Bacteria 14933
385 Ga0163162_10016295 3300013306 Bacteria 7266
386 Ga0163162_10104866 3300013306 Bacteria 2921
387 Ga0163162_10209912 3300013306 Bacteria 2077
388 Ga0163162_10243951 3300013306 Bacteria 1928
389 Ga0163162_10253751 3300013306 Bacteria 1891
390 Ga0163162_10513070 3300013306 Bacteria 1329
391 Ga0163162_10779527 3300013306 Bacteria 1074
392 Ga0163162_11351926 3300013306 Bacteria 810
393 Ga0157372_10088667 3300013307 Bacteria 3513
394 Ga0157372_10094141 3300013307 Bacteria 3410
395 Ga0157372_10144222 3300013307 Bacteria 2746
396 Ga0157372_10266572 3300013307 Unclassified 1989
397 Ga0157375_10005323 3300013308 Bacteria 11181
398 Ga0157375_10064400 3300013308 Bacteria 3650
399 Ga0157375_10081184 3300013308 Bacteria 3282
400 Ga0157375_10365727 3300013308 Unclassified 1609
401 Ga0157375_10533105 3300013308 Bacteria 1337
402 Ga0157375_10536502 3300013308 Bacteria 1332
403 Ga0157375_10623852 3300013308 Bacteria 1236
404 Ga0157375_10661389 3300013308 Unclassified 1200
405 Ga0157375_10681028 3300013308 Unclassified 1183
406 Ga0157375_10722039 3300013308 Bacteria 1149
407 Ga0157375_11344250 3300013308 Bacteria 841
408 Ga0163163_10005414 3300014325 Bacteria 11036
409 Ga0163163_10006715 3300014325 Bacteria 10085
410 Ga0163163_10015575 3300014325 Bacteria 7031
411 Ga0163163_10027228 3300014325 Bacteria 5474
412 Ga0163163_10033698 3300014325 Bacteria 4957
413 Ga0163163_10078549 3300014325 Bacteria 3297
414 Ga0163163_10102741 3300014325 Unclassified 2882
415 Ga0163163_10171701 3300014325 Bacteria 2215
416 Ga0163163_10220085 3300014325 Bacteria 1947
417 Ga0163163_10278708 3300014325 Bacteria 1723
418 Ga0163163_10413896 3300014325 Bacteria 1407
419 Ga0163163_10570566 3300014325 Bacteria 1194
420 Ga0163163_10623996 3300014325 Bacteria 1141
421 Ga0163163_10897605 3300014325 Bacteria 950
422 Ga0163163_10899258 3300014325 Bacteria 949
423 Ga0157380_10039169 3300014326 Bacteria 3685
424 Ga0157380_10089306 3300014326 Unclassified 2538
425 Ga0157380_10120262 3300014326 Bacteria 2224
426 Ga0157380_10150459 3300014326 Bacteria 2011
427 Ga0157380_10242050 3300014326 Bacteria 1627
428 Ga0157380_10268174 3300014326 Bacteria 1555
429 Ga0157380_10469449 3300014326 Bacteria 1214
430 Ga0157380_10572221 3300014326 Bacteria 1112
431 Ga0157379_10018470 3300014968 Bacteria 6149
432 Ga0157379_10063826 3300014968 Bacteria 3292
433 Ga0157379_10508449 3300014968 Bacteria 1117
434 Ga0157379_10527357 3300014968 Bacteria 1097
435 Ga0157379_10596119 3300014968 Bacteria 1031
436 Ga0157376_10010212 3300014969 Bacteria 6856
437 Ga0157376_10108109 3300014969 Bacteria 2443
438 Ga0157376_10120322 3300014969 Unclassified 2326
439 Ga0157376_10143468 3300014969 Bacteria 2145
440 Ga0157376_10201002 3300014969 Bacteria 1834
441 Ga0157376_10322746 3300014969 Bacteria 1468
442 Ga0157376_10398599 3300014969 Bacteria 1330
443 Ga0163161_10292902 3300017792 Bacteria 1280
444 Ga0207656_10230793 3300025321 Unclassified 902
445 Ga0207642_10124897 3300025899 Bacteria 1333
446 Ga0207688_10149985 3300025901 Bacteria 1377
447 Ga0207680_10034792 3300025903 Bacteria 2885
448 Ga0207680_10034916 3300025903 Unclassified 2881
449 Ga0207680_10511611 3300025903 Unclassified 856
450 Ga0207645_10001872 3300025907 Bacteria 16990
451 Ga0207645_10064264 3300025907 Bacteria 2345
452 Ga0207645_10075966 3300025907 Bacteria 2151
453 Ga0207684_10027292 3300025910 Bacteria 4867
454 Ga0207684_10071202 3300025910 Bacteria 2955
455 Ga0207654_10007504 3300025911 Bacteria 5496
456 Ga0207654_10008176 3300025911 Bacteria 5278
457 Ga0207654_10055078 3300025911 Unclassified 2301
458 Ga0207654_10231162 3300025911 Bacteria 1231
459 Ga0207707_10000684 3300025912 Bacteria 33633
460 Ga0207707_10112457 3300025912 Bacteria 2380
461 Ga0207707_10148104 3300025912 Bacteria 2052
462 Ga0207707_10293890 3300025912 Bacteria 1405
463 Ga0207695_10002411 3300025913 Bacteria 27678
464 Ga0207695_10013324 3300025913 Bacteria 9811
465 Ga0207695_10017685 3300025913 Bacteria 8282
466 Ga0207695_10019139 3300025913 Bacteria 7891
467 Ga0207695_10125494 3300025913 Bacteria 2530
468 Ga0207695_10375259 3300025913 Bacteria 1308
469 Ga0207695_10458774 3300025913 Bacteria 1157
470 Ga0207695_10501779 3300025913 Bacteria 1095
471 Ga0207671_10109280 3300025914 Unclassified 2102
472 Ga0207671_10145663 3300025914 Bacteria 1827
473 Ga0207671_10162510 3300025914 Unclassified 1730
474 Ga0207671_10228348 3300025914 Bacteria 1460
475 Ga0207671_10312852 3300025914 Bacteria 1242
476 Ga0207663_10024777 3300025916 Bacteria 3460
477 Ga0207663_10130826 3300025916 Bacteria 1734
478 Ga0207660_10009072 3300025917 Bacteria 6441
479 Ga0207660_10038258 3300025917 Bacteria 3348
480 Ga0207662_10137907 3300025918 Bacteria 1543
481 Ga0207662_10212784 3300025918 Unclassified 1255
482 Ga0207657_10012255 3300025919 Bacteria 8470
483 Ga0207657_10034860 3300025919 Bacteria 4519
484 Ga0207657_10079881 3300025919 Unclassified 2751
485 Ga0207649_10146318 3300025920 Bacteria 1622
486 Ga0207652_10031216 3300025921 Bacteria 4473
487 Ga0207652_10152293 3300025921 Bacteria 2071
488 Ga0207646_10062415 3300025922 Bacteria 3327
489 Ga0207646_10088273 3300025922 Bacteria 2774
490 Ga0207681_10027372 3300025923 Bacteria 3685
491 Ga0207681_10037039 3300025923 Bacteria 3222
492 Ga0207681_10104848 3300025923 Bacteria 2046
493 Ga0207681_10168940 3300025923 Bacteria 1656
494 Ga0207694_10003273 3300025924 Bacteria 12910
495 Ga0207694_10003730 3300025924 Bacteria 12070
496 Ga0207694_10015269 3300025924 Bacteria 5794
497 Ga0207694_10029198 3300025924 Bacteria 4206
498 Ga0207694_10087637 3300025924 Unclassified 2452
499 Ga0207694_10105887 3300025924 Bacteria 2233
500 Ga0207694_10232241 3300025924 Bacteria 1506
501 Ga0207694_10365277 3300025924 Bacteria 1196
502 Ga0207650_10022870 3300025925 Bacteria 4429
503 Ga0207650_10052007 3300025925 Bacteria 3033
504 Ga0207659_10031579 3300025926 Bacteria 3627
505 Ga0207659_10033418 3300025926 Bacteria 3540
506 Ga0207659_10085404 3300025926 Bacteria 2345
507 Ga0207659_10619435 3300025926 Bacteria 923
508 Ga0207687_10000615 3300025927 Bacteria 24045
509 Ga0207687_10002388 3300025927 Bacteria 12730
510 Ga0207687_10015132 3300025927 Bacteria 5055
511 Ga0207687_10022888 3300025927 Bacteria 4161
512 Ga0207687_10031178 3300025927 Bacteria 3601
513 Ga0207687_10032699 3300025927 Unclassified 3524
514 Ga0207687_10042953 3300025927 Unclassified 3113
515 Ga0207687_10071858 3300025927 Bacteria 2473
516 Ga0207687_10361564 3300025927 Bacteria 1185
517 Ga0207700_10007797 3300025928 Bacteria 6579
518 Ga0207700_10016437 3300025928 Bacteria 4916
519 Ga0207700_10162335 3300025928 Unclassified 1857
520 Ga0207700_10403327 3300025928 Bacteria 1198
521 Ga0207700_10788148 3300025928 Bacteria 850
522 Ga0207664_10148545 3300025929 Bacteria 1989
523 Ga0207644_10014418 3300025931 Bacteria 5288
524 Ga0207644_10096761 3300025931 Bacteria 2210
525 Ga0207644_10292988 3300025931 Unclassified 1309
526 Ga0207690_10121896 3300025932 Bacteria 1895
527 Ga0207706_10010848 3300025933 Bacteria 8313
528 Ga0207706_10265246 3300025933 Bacteria 1499
529 Ga0207686_10001799 3300025934 Bacteria 11917
530 Ga0207686_10007390 3300025934 Bacteria 5915
531 Ga0207686_10007614 3300025934 Bacteria 5835
532 Ga0207686_10058827 3300025934 Bacteria 2425
533 Ga0207686_10074536 3300025934 Bacteria 2193
534 Ga0207686_10078201 3300025934 Bacteria 2150
535 Ga0207686_10080439 3300025934 Bacteria 2124
536 Ga0207686_10112162 3300025934 Bacteria 1841
537 Ga0207686_10146652 3300025934 Bacteria 1638
538 Ga0207709_10006604 3300025935 Bacteria 6512
539 Ga0207709_10071855 3300025935 Bacteria 2199
540 Ga0207709_10258662 3300025935 Bacteria 1275
541 Ga0207670_10024442 3300025936 Bacteria 3775
542 Ga0207670_10177664 3300025936 Bacteria 1601
543 Ga0207670_10210646 3300025936 Bacteria 1482
544 Ga0207670_10457480 3300025936 Bacteria 1030
545 Ga0207669_10004816 3300025937 Bacteria 5991
546 Ga0207704_10016459 3300025938 Bacteria 3801
547 Ga0207704_10020800 3300025938 Bacteria 3480
548 Ga0207704_10047949 3300025938 Bacteria 2558
549 Ga0207691_10077819 3300025940 Bacteria 2987
550 Ga0207691_10101394 3300025940 Bacteria 2569
551 Ga0207691_10107778 3300025940 Bacteria 2480
552 Ga0207691_10110974 3300025940 Archaea 2439
553 Ga0207691_10407610 3300025940 Bacteria 1159
554 Ga0207711_10000207 3300025941 Bacteria 62922
555 Ga0207711_10001638 3300025941 Bacteria 20646
556 Ga0207711_10006493 3300025941 Bacteria 9845
557 Ga0207711_10007210 3300025941 Bacteria 9317
558 Ga0207711_10022429 3300025941 Bacteria 5279
559 Ga0207711_10041712 3300025941 Bacteria 3909
560 Ga0207711_10093431 3300025941 Bacteria 2649
561 Ga0207711_10169272 3300025941 Bacteria 1982
562 Ga0207711_10199657 3300025941 Bacteria 1825
563 Ga0207711_10285077 3300025941 Bacteria 1521
564 Ga0207711_10345190 3300025941 Bacteria 1378
565 Ga0207711_10534334 3300025941 Bacteria 1094
566 Ga0207689_10002878 3300025942 Bacteria 15867
567 Ga0207689_10017739 3300025942 Bacteria 6014
568 Ga0207689_10061818 3300025942 Bacteria 3080
569 Ga0207689_10116681 3300025942 Unclassified 2194
570 Ga0207689_10666243 3300025942 Unclassified 877
571 Ga0207661_10005447 3300025944 Bacteria 8971
572 Ga0207661_10009405 3300025944 Bacteria 7008
573 Ga0207661_10015726 3300025944 Bacteria 5574
574 Ga0207661_10062858 3300025944 Bacteria 3005
575 Ga0207661_10429628 3300025944 Bacteria 1201
576 Ga0207679_10017573 3300025945 Bacteria 4774
577 Ga0207679_10125327 3300025945 Bacteria 2051
578 Ga0207679_10146409 3300025945 Bacteria 1916
579 Ga0207679_10309879 3300025945 Bacteria 1363
580 Ga0207679_10390565 3300025945 Bacteria 1222
581 Ga0207679_10599340 3300025945 Bacteria 993
582 Ga0207667_10001255 3300025949 Bacteria 31815
583 Ga0207667_10015370 3300025949 Bacteria 8700
584 Ga0207667_10015668 3300025949 Bacteria 8599
585 Ga0207667_10019763 3300025949 Bacteria 7509
586 Ga0207667_10043664 3300025949 Bacteria 4756
587 Ga0207667_10126843 3300025949 Bacteria 2629
588 Ga0207667_10234170 3300025949 Bacteria 1880
589 Ga0207651_10001469 3300025960 Bacteria 10719
590 Ga0207651_10034021 3300025960 Bacteria 3295
591 Ga0207651_10041524 3300025960 Bacteria 3054
592 Ga0207651_10045725 3300025960 Bacteria 2938
593 Ga0207651_10094790 3300025960 Unclassified 2196
594 Ga0207651_10135196 3300025960 Bacteria 1895
595 Ga0207712_10010889 3300025961 Bacteria 5789
596 Ga0207712_10074850 3300025961 Bacteria 2446
597 Ga0207712_10473253 3300025961 Bacteria 1066
598 Ga0207668_10036119 3300025972 Bacteria 3296
599 Ga0207640_10088904 3300025981 Bacteria 2134
600 Ga0207640_10435884 3300025981 Bacteria 1076
601 Ga0207658_10039244 3300025986 Bacteria 3416
602 Ga0207658_10161180 3300025986 Bacteria 1838
603 Ga0207658_10341024 3300025986 Bacteria 1302
604 Ga0207677_10010460 3300026023 Bacteria 5249
605 Ga0207677_10050312 3300026023 Bacteria 2818
606 Ga0207677_10342878 3300026023 Bacteria 1249
607 Ga0207677_10354736 3300026023 Bacteria 1230
608 Ga0207677_10448855 3300026023 Bacteria 1105
609 Ga0207703_10042849 3300026035 Bacteria 3631
610 Ga0207703_10068429 3300026035 Bacteria 2925
611 Ga0207703_10080218 3300026035 Bacteria 2717
612 Ga0207703_10331621 3300026035 Bacteria 1396
613 Ga0207703_10522471 3300026035 Unclassified 1117
614 Ga0207639_10122814 3300026041 Bacteria 2136
615 Ga0207639_10234835 3300026041 Unclassified 1591
616 Ga0207639_10244257 3300026041 Bacteria 1563
617 Ga0207678_10085842 3300026067 Bacteria 2690
618 Ga0207678_10565836 3300026067 Bacteria 995
619 Ga0207708_10003022 3300026075 Bacteria 12403
620 Ga0207708_10144762 3300026075 Bacteria 1867
621 Ga0207708_10374943 3300026075 Bacteria 1172
622 Ga0207702_10033941 3300026078 Unclassified 4264
623 Ga0207702_10120988 3300026078 Bacteria 2343
624 Ga0207702_10347159 3300026078 Bacteria 1419
625 Ga0207641_10079572 3300026088 Bacteria 2841
626 Ga0207641_10238156 3300026088 Bacteria 1694
627 Ga0207641_10350538 3300026088 Bacteria 1407
628 Ga0207641_10564372 3300026088 Bacteria 1111
629 Ga0207641_10748789 3300026088 Bacteria 964
630 Ga0207648_10002253 3300026089 Bacteria 20851
631 Ga0207648_10082092 3300026089 Bacteria 2811
632 Ga0207648_10110615 3300026089 Bacteria 2412
633 Ga0207648_10263112 3300026089 Bacteria 1539
634 Ga0207648_10415245 3300026089 Bacteria 1221
635 Ga0207676_10004508 3300026095 Bacteria 9848
636 Ga0207676_10015043 3300026095 Bacteria 5578
637 Ga0207676_10117918 3300026095 Bacteria 2233
638 Ga0207674_10000252 3300026116 Bacteria 66798
639 Ga0207674_10002778 3300026116 Bacteria 21814
640 Ga0207674_10020948 3300026116 Bacteria 7052
641 Ga0207674_10038242 3300026116 Bacteria 4985
642 Ga0207674_10393383 3300026116 Bacteria 1340
643 Ga0207674_10768156 3300026116 Bacteria 930
644 Ga0207675_100004828 3300026118 Bacteria 12980
645 Ga0207675_100043589 3300026118 Bacteria 4190
646 Ga0207675_100069545 3300026118 Bacteria 3290
647 Ga0207675_100079920 3300026118 Bacteria 3065
648 Ga0207675_100140132 3300026118 Bacteria 2297
649 Ga0207675_100189308 3300026118 Bacteria 1973
650 Ga0207675_100733535 3300026118 Bacteria 998
651 Ga0207683_10277629 3300026121 Bacteria 1531
652 Ga0207683_10562854 3300026121 Bacteria 1054
653 Ga0207698_10087334 3300026142 Bacteria 2540
654 Ga0207698_10165103 3300026142 Bacteria 1942
655 Ga0209588_1089657 3300027671 Bacteria 991
656 Ga0207428_10000004 3300027907 Bacteria 727800
657 Ga0268266_10019226 3300028379 Bacteria 5817
658 Ga0268266_10070530 3300028379 Bacteria 3028
659 Ga0268266_10087524 3300028379 Bacteria 2725
660 Ga0268266_10398170 3300028379 Bacteria 1301
661 Ga0268265_10073994 3300028380 Bacteria 2663
662 Ga0268265_10173647 3300028380 Bacteria 1845
663 Ga0268265_10196908 3300028380 Bacteria 1744
664 Ga0268265_10272682 3300028380 Bacteria 1510
665 Ga0268264_10030492 3300028381 Bacteria 4420
666 Ga0268264_10036700 3300028381 Bacteria 4038
667 Ga0265760_10007034 3300031090 Unclassified 3223
668 Ga0265329_10028572 3300031242 Bacteria 1828
669 Ga0265331_10215362 3300031250 Bacteria 864
670 Ga0265313_10006675 3300031595 Bacteria 8090
671 Ga0265313_10009655 3300031595 Bacteria 6231
672 Ga0265314_10001386 3300031711 Bacteria 27202
673 Ga0265314_10005349 3300031711 Bacteria 11602
674 Ga0316576_10025794 3300031727 Bacteria 4118
675 Ga0316576_10077146 3300031727 Bacteria 2467
676 Ga0316578_10261088 3300031728 Bacteria 1038
677 Ga0307405_10030145 3300031731 Bacteria 3178
678 Ga0307412_10064463 3300031911 Bacteria 2476
679 Ga0307412_10355170 3300031911 Bacteria 1178
680 Ga0307409_100148400 3300031995 Bacteria 2032
681 Ga0307416_100007255 3300032002 Bacteria 7026
682 Ga0307411_10533578 3300032005 Bacteria 998
683 Ga0316583_10046053 3300032133 Bacteria 1539
684 Ga0373926_0000614 3300035083 Bacteria 9676
685 Ga0373934_0004206 3300035086 Bacteria 5309
686 Ga0373952_0031857 3300035092 Bacteria 1174
687 Ga0373923_0011426 3300035111 Bacteria 3255
688 Ga0373939_0192345 3300035114 Bacteria 767
689 Ga0373953_0035336 3300035117 Bacteria 1963
690 Ga0373954_0002133 3300035118 Bacteria 8214
691 Ga0373954_0257828 3300035118 Unclassified 859
692 Ga0373956_0042534 3300035119 Bacteria 2020
693 Ga0373956_0219625 3300035119 Bacteria 902
694 Ga0373956_0274475 3300035119 Unclassified 802
695 Ga0373957_0117090 3300035120 Bacteria 1076
696 Ga0373943_0138686 3300035170 Unclassified 1308
697 Ga0373946_0178564 3300035171 Unclassified 1006
698 Ga0373955_0006974 3300035172 Bacteria 5171
699 Ga0373955_0081164 3300035172 Bacteria 1833
700 Ga0373955_0081681 3300035172 Bacteria 1828
701 Ga0373955_0088444 3300035172 Bacteria 1762
702 Ga0373955_0295581 3300035172 Unclassified 976
703 Ga0373935_0000902 3300035692 Bacteria 16048
704 Ga0373935_0028083 3300035692 Bacteria 3477
705 Ga0373935_0037190 3300035692 Bacteria 3046
706 Ga0373935_0522022 3300035692 Bacteria 864
707 Ga0373927_0004041 3300035695 Bacteria 10373
708 Ga0373927_0005586 3300035695 Bacteria 8645
709 Ga0373927_0080942 3300035695 Bacteria 2105
710 Ga0373927_0188568 3300035695 Bacteria 1353
711 Ga0373933_0016981 3300035724 Unclassified 4080
712 Ga0373933_0044230 3300035724 Bacteria 2637
713 Ga0373933_0266037 3300035724 Bacteria 1106
714 Ga0373947_0015220 3300035725 Bacteria 4416
715 Ga0373947_0069973 3300035725 Bacteria 2149
716 Ga0373947_0070709 3300035725 Bacteria 2139
717 Ga0373947_0596161 3300035725 Bacteria 753
718 Ga0373937_0001951 3300036401 Bacteria 17278
719 Ga0373937_0004398 3300036401 Bacteria 11975
720 Ga0373937_0012599 3300036401 Bacteria 7442
721 Ga0373937_0023943 3300036401 Bacteria 5505
722 Ga0373937_0127113 3300036401 Bacteria 2379
723 Ga0373937_0210578 3300036401 Bacteria 1829
724 Ga0373937_0272259 3300036401 Unclassified 1598
725 Ga0373937_0299426 3300036401 Unclassified 1520
726 Ga0373937_0356081 3300036401 Bacteria 1387
727 Ga0373937_0359925 3300036401 Bacteria 1379
728 Ga0373937_0535302 3300036401 Unclassified 1113
729 Ga0373937_0665295 3300036401 Bacteria 987
730 Ga0373937_0715231 3300036401 Bacteria 948
731 Ga0316582_0032046 3300036647 Bacteria 3217
732 Ga0316584_0022871 3300036712 Bacteria 4562
733 Ga0316584_0371458 3300036712 Bacteria 1024
734 Ga0373925_0009351 3300037068 Bacteria 7138
735 Ga0373925_0018646 3300037068 Bacteria 5045
736 Ga0439453_0034636 3300041408 Bacteria 970
737 Ga0450896_033444 3300042133 Bacteria 784
738 Ga0451577_0131290 3300042876 Bacteria 2247
739 Ga0453684_0299781 3300044712 Bacteria 1827
740 Ga0451576_0276693 3300045051 Bacteria 1755
741 Ga0451576_0300579 3300045051 Bacteria 1679
742 Ga0451576_0397770 3300045051 Bacteria 1444
743 Ga0495592_0011052 3300046454 Bacteria 6813
744 Ga0495592_0022690 3300046454 Bacteria 4774
745 Ga0495592_0033271 3300046454 Unclassified 3889
746 Ga0495592_0063728 3300046454 Bacteria 2703
747 Ga0495592_0071647 3300046454 Bacteria 2522
748 Ga0495603_0409420 3300046455 Bacteria 777
749 Ga0495629_0063335 3300046459 Bacteria 2583
750 Ga0495651_0000126 3300046462 Bacteria 56547
751 Ga0495651_0005148 3300046462 Bacteria 9968
752 Ga0495651_0009981 3300046462 Bacteria 7300
753 Ga0495651_0417465 3300046462 Unclassified 873
754 Ga0495651_0486437 3300046462 Bacteria 792
755 Ga0495653_0010223 3300046463 Bacteria 7682
756 Ga0495653_0088967 3300046463 Unclassified 2264
757 Ga0495653_0127564 3300046463 Unclassified 1805
758 Ga0495653_0145011 3300046463 Unclassified 1665
759 Ga0495653_0460601 3300046463 Bacteria 798
760 Ga0495580_0005481 3300046472 Bacteria 10486
761 Ga0495580_0015510 3300046472 Bacteria 5745
762 Ga0495580_0018716 3300046472 Bacteria 5154
763 Ga0495580_0053551 3300046472 Unclassified 2847
764 Ga0495580_0164608 3300046472 Bacteria 1534
765 Ga0495580_0264332 3300046472 Bacteria 1176
766 Ga0495580_0283151 3300046472 Bacteria 1131
767 Ga0495582_0049359 3300046473 Bacteria 2317
768 Ga0495582_0126266 3300046473 Bacteria 1444
769 Ga0495639_0069564 3300046475 Bacteria 1624
770 Ga0495639_0117335 3300046475 Bacteria 1267
771 Ga0495639_0207836 3300046475 Bacteria 960
772 Ga0495664_0019425 3300046477 Bacteria 3907
773 Ga0495594_0106000 3300046499 Bacteria 1583
774 Ga0495594_0113942 3300046499 Unclassified 1526
775 Ga0495608_0002023 3300046511 Bacteria 14549
776 Ga0495608_0006811 3300046511 Bacteria 8103
777 Ga0495608_0010563 3300046511 Bacteria 6442
778 Ga0495608_0029614 3300046511 Unclassified 3712
779 Ga0495608_0043759 3300046511 Bacteria 2991
780 Ga0495618_0007195 3300046514 Bacteria 6738
781 Ga0495628_0001880 3300046516 Bacteria 19059
782 Ga0495628_0012049 3300046516 Bacteria 7293
783 Ga0495628_0018608 3300046516 Bacteria 5751
784 Ga0495628_0066816 3300046516 Unclassified 2810
785 Ga0495628_0232312 3300046516 Bacteria 1382
786 Ga0495628_0301316 3300046516 Bacteria 1186
787 Ga0495630_0001011 3300046517 Bacteria 19496
788 Ga0495630_0001268 3300046517 Bacteria 17403
789 Ga0495630_0003853 3300046517 Bacteria 10471
790 Ga0495630_0017821 3300046517 Bacteria 5208
791 Ga0495666_0020095 3300046526 Bacteria 3313
792 Ga0495652_0013561 3300046529 Bacteria 7335
793 Ga0495652_0016762 3300046529 Bacteria 6549
794 Ga0495652_0064347 3300046529 Unclassified 3084
795 Ga0495665_0013131 3300046531 Bacteria 4482
796 Ga0495665_0085639 3300046531 Bacteria 1656
797 Ga0495586_0000405 3300046535 Bacteria 26188
798 Ga0495586_0069027 3300046535 Bacteria 1929
799 Ga0495586_0181340 3300046535 Bacteria 1191
800 Ga0495586_0193084 3300046535 Bacteria 1153
801 Ga0495586_0205454 3300046535 Bacteria 1117
802 Ga0495586_0247271 3300046535 Bacteria 1017
803 Ga0495587_0001076 3300046536 Bacteria 17951
804 Ga0495587_0004806 3300046536 Bacteria 8868
805 Ga0495587_0128957 3300046536 Bacteria 1446
806 Ga0495621_0015319 3300046539 Bacteria 2443
807 Ga0495621_0054027 3300046539 Bacteria 1443
808 Ga0495645_0002936 3300046543 Bacteria 11555
809 Ga0495645_0024700 3300046543 Bacteria 4361
810 Ga0495645_0038923 3300046543 Unclassified 3468
811 Ga0495645_0132836 3300046543 Bacteria 1743
812 Ga0495645_0222984 3300046543 Bacteria 1267
813 Ga0495667_0001136 3300046559 Bacteria 17338
814 Ga0495667_0013664 3300046559 Bacteria 5488
815 Ga0495667_0042162 3300046559 Bacteria 3026
816 Ga0495667_0219038 3300046559 Unclassified 1215
817 Ga0495667_0274600 3300046559 Bacteria 1070
818 Ga0495634_0040074 3300046642 Bacteria 3188
819 Ga0495634_0141460 3300046642 Unclassified 1527
820 Ga0495635_0054682 3300046663 Unclassified 2749
821 Ga0495635_0130570 3300046663 Bacteria 1712
822 Ga0495635_0190783 3300046663 Bacteria 1391
823 Ga0495657_0004041 3300046675 Bacteria 11765
824 Ga0495657_0145507 3300046675 Unclassified 1474
825 Ga0495599_0003977 3300046678 Bacteria 8705
826 Ga0495599_0018901 3300046678 Unclassified 4296
827 Ga0495623_0003934 3300046679 Bacteria 9790
828 Ga0495623_0081568 3300046679 Bacteria 2000
829 Ga0495623_0260433 3300046679 Bacteria 972
830 Ga0495646_0000785 3300046680 Bacteria 17756
831 Ga0495646_0058133 3300046680 Unclassified 2312
832 Ga0495658_0045096 3300046683 Bacteria 2473
833 Ga0495658_0171042 3300046683 Bacteria 1345
834 Ga0495613_0001706 3300046689 Bacteria 16725
835 Ga0495613_0056494 3300046689 Bacteria 2882
836 Ga0495613_0168362 3300046689 Bacteria 1556
837 Ga0495613_0545359 3300046689 Unclassified 776
838 Ga0495624_0016528 3300046690 Bacteria 4965
839 Ga0495624_0393308 3300046690 Bacteria 832
840 Ga0495600_0003140 3300046809 Bacteria 9666
841 Ga0495600_0082885 3300046809 Bacteria 2093
842 Ga0495604_0005091 3300047317 Bacteria 10407
843 Ga0495604_0010297 3300047317 Bacteria 7406
844 Ga0495604_0044978 3300047317 Bacteria 3447
845 Ga0495604_0400656 3300047317 Unclassified 904
846 Ga0495674_0001401 3300047319 Bacteria 23572
847 Ga0495674_0013223 3300047319 Bacteria 7758
848 Ga0495674_0020559 3300047319 Bacteria 6110
849 Ga0495674_0024847 3300047319 Bacteria 5500
850 Ga0495674_0055836 3300047319 Unclassified 3462
851 Ga0495674_0236338 3300047319 Unclassified 1507
852 Ga0495676_0046014 3300047321 Bacteria 3547
853 Ga0495680_0000253 3300047322 Bacteria 59346
854 Ga0495680_0001258 3300047322 Bacteria 27663
855 Ga0495680_0089003 3300047322 Bacteria 2319
856 Ga0495680_0096719 3300047322 Unclassified 2205
857 Ga0495680_0186848 3300047322 Bacteria 1493
858 Ga0495675_0000165 3300047444 Bacteria 47340
859 Ga0495675_0005957 3300047444 Bacteria 7451
860 Ga0495675_0148243 3300047444 Bacteria 1451
861 Ga0495675_0178269 3300047444 Bacteria 1302
862 Ga0495684_0000125 3300047471 Bacteria 56588
863 Ga0495684_0009716 3300047471 Bacteria 7422
864 Ga0495684_0012342 3300047471 Bacteria 6590
865 Ga0495684_0013320 3300047471 Bacteria 6336
866 Ga0495684_0025018 3300047471 Bacteria 4592
867 Ga0495684_0076222 3300047471 Bacteria 2547
868 Ga0495684_0203701 3300047471 Bacteria 1458
869 Ga0495684_0311031 3300047471 Bacteria 1129
870 Ga0495602_0003164 3300048088 Bacteria 16964
871 Ga0495602_0012198 3300048088 Bacteria 8849
872 Ga0495602_0021669 3300048088 Bacteria 6316
873 Ga0495602_0081110 3300048088 Bacteria 2729
874 Ga0495602_0228155 3300048088 Unclassified 1401
875 Ga0496100_0005245 3300048903 Bacteria 6963
876 Ga0496101_0018969 3300048904 Bacteria 4687
877 Ga0496104_0170139 3300048907 Unclassified 2089
878 Ga0496104_0195870 3300048907 Bacteria 1933
879 Ga0496104_0298439 3300048907 Bacteria 1523
880 Ga0496104_0358451 3300048907 Bacteria 1371
881 Ga0496107_0062033 3300048910 Unclassified 2708
882 Ga0496112_0440891 3300048915 Bacteria 1240
883 Ga0496112_0570133 3300048915 Bacteria 1065
884 Ga0496114_0002302 3300048917 Bacteria 14547
885 Ga0501042_0443823 3300049578 Bacteria 941
886 Ga0501046_0234035 3300049580 Unclassified 1356
887 Ga0501047_0104620 3300049581 Bacteria 2711
888 Ga0501048_0135796 3300049582 Bacteria 1738
889 Ga0501074_0088039 3300049590 Unclassified 2224
890 Ga0501075_0021304 3300049591 Bacteria 4724
891 Ga0501076_0046871 3300049592 Bacteria 3416
892 Ga0501079_0042736 3300049741 Unclassified 3499
893 Ga0501080_0098430 3300049742 Unclassified 2715
894 nmdc:mga05p37_105860_c1 3300050507 Bacteria 3460
895 nmdc:mga05p37_215848_c1 3300050507 Bacteria 2317
896 nmdc:mga05p37_33_c1 3300050507 Bacteria 112965
897 nmdc:mga05p37_48567_c1 3300050507 Bacteria 5218
898 nmdc:mga05p37_7649_c1 3300050507 Bacteria 12752
899 nmdc:mga05p37_827925_c1 3300050507 Bacteria 1008
900 nmdc:mga09592_296325_c1 3300050508 Bacteria 1402
901 nmdc:mga09592_3004_c1 3300050508 Bacteria 13675
902 nmdc:mga09592_3103_c1 3300050508 Bacteria 13488
903 nmdc:mga06r32_149771_c1 3300050510 Bacteria 2311
904 nmdc:mga06r32_208333_c1 3300050510 Bacteria 1943
905 nmdc:mga06r32_29148_c1 3300050510 Bacteria 5170
906 nmdc:mga06r32_46080_c1 3300050510 Bacteria 4160
907 nmdc:mga06r32_5990_c1 3300050510 Bacteria 10937
908 nmdc:mga06r32_84513_c1 3300050510 Unclassified 3093
909 nmdc:mga08y16_249954_c1 3300050511 Bacteria 1832
910 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
911 nmdc:mga0n895_208421_c1 3300050512 Bacteria 1985
912 nmdc:mga0n895_28312_c1 3300050512 Bacteria 5329
913 nmdc:mga0n895_879410_c1 3300050512 Bacteria 882
914 nmdc:mga0rr50_280591_c1 3300050513 Bacteria 1390
915 nmdc:mga08x19_304343_c1 3300050514 Bacteria 1107
916 nmdc:mga0a205_218116_c1 3300050515 Unclassified 1794
917 nmdc:mga0a205_242635_c1 3300050515 Bacteria 1682
918 nmdc:mga0a205_30462_c1 3300050515 Bacteria 5166
919 nmdc:mga0a205_398057_c1 3300050515 Bacteria 1241
920 Ga0495601_0022203 3300053077 Unclassified 3894
921 Ga0495601_0195274 3300053077 Unclassified 1323
922 Ga0495612_0003944 3300053078 Bacteria 6161
923 Ga0495595_0103462 3300053084 Bacteria 1376
924 Ga0495619_0021501 3300053085 Unclassified 4119
925 Ga0495619_0081684 3300053085 Bacteria 2177
926 Ga0495619_0300394 3300053085 Bacteria 1112
927 Ga0495619_0551672 3300053085 Unclassified 790
928 Ga0500568_0008529 3300053139 Unclassified 4932
929 Ga0501084_0042671 3300054114 Bacteria 3794
930 Ga0501082_0129189 3300060353 Unclassified 2192
931 Ga0530510_0018388 3300061734 Bacteria 4955
932 Ga0496115_0142022
933 Ga0065707_10150567
934 Ga0070658_10187959
935 Ga0070676_10217763
936 Ga0070683_100098299
937 Ga0070690_100032320
938 Ga0070670_100007834
939 Ga0070670_100010330
940 Ga0070670_100308850
941 Ga0070677_10059985
942 Ga0068869_100002089
943 Ga0068869_100058052
944 Ga0068869_100096635
945 Ga0068869_100408070
946 Ga0068869_100706225
947 Ga0070666_10001137
948 Ga0070666_10039637
949 Ga0070666_10046062
950 Ga0070666_10167662
951 Ga0070666_10257688
952 Ga0070680_100013946
953 Ga0068868_100005508
954 Ga0068868_100006505
955 Ga0068868_100047539
956 Ga0068868_100145886
957 Ga0068868_100158663
958 Ga0068868_100206923
959 Ga0068868_100309782
960 Ga0068868_100443529
961 Ga0070660_100024608
962 Ga0070660_100120887
963 Ga0070660_100151657
964 Ga0070689_100043304
965 Ga0070689_100046856
966 Ga0070689_100223763
967 Ga0070691_10013126
968 Ga0070661_100110285
969 Ga0070661_100269976
970 Ga0070692_10062155
971 Ga0070669_100033005
972 Ga0070669_100162159
973 Ga0070675_100000819
974 Ga0070675_100004909
975 Ga0070675_100005091
976 Ga0070675_100129004
977 Ga0070675_100211505
978 Ga0070671_100016426
979 Ga0070671_100044390
980 Ga0070671_100046964
981 Ga0070671_100071980
982 Ga0070671_100072762
983 Ga0070671_100332130
984 Ga0070671_100351943
985 Ga0070674_100081645
986 Ga0070674_100145780
987 Ga0070674_100187972
988 Ga0070674_100763458
989 Ga0070673_100023649
990 Ga0070673_100066805
991 Ga0070673_100201593
992 Ga0070673_100246687
993 Ga0070673_100323817
994 Ga0070688_100229994
995 Ga0070688_100443521
996 Ga0070688_100466105
997 Ga0070659_100043757
998 Ga0070659_100184786
999 Ga0070667_100072696
1000 Ga0070667_100082239
1001 Ga0070667_100082948
1002 Ga0070667_100163950
1003 Ga0070667_100560439
1004 Ga0070713_100011378
1005 Ga0070713_100025278
1006 Ga0070713_100181065
1007 Ga0070713_100724831
1008 Ga0070713_100808371
1009 Ga0070710_10339695
1010 Ga0070701_10049956
1011 Ga0070711_100069704
1012 Ga0070711_100514942
1013 Ga0070705_100305830
1014 Ga0070700_100001632
1015 Ga0070694_100065444
1016 Ga0070694_100083783
1017 Ga0070694_100387784
1018 Ga0070663_100087079
1019 Ga0070678_100273146
1020 Ga0070662_100022723
1021 Ga0070662_100101600
1022 Ga0070662_100231891
1023 Ga0070681_10072278
1024 Ga0070681_10093516
1025 Ga0070681_10379789
1026 Ga0068867_100021545
1027 Ga0068867_100033466
1028 Ga0068867_100085376
1029 Ga0068867_100325983
1030 Ga0070685_10536405
1031 Ga0070706_100004393
1032 Ga0070706_100077523
1033 Ga0070707_100003828
1034 Ga0070707_100203689
1035 Ga0070698_100014652
1036 Ga0070698_100108751
1037 Ga0070698_100357158
1038 Ga0070699_100000875
1039 Ga0070684_100007408
1040 Ga0070684_100007644
1041 Ga0070684_100042326
1042 Ga0070684_100838806
1043 Ga0068853_100101024
1044 Ga0068853_100150560
1045 Ga0068853_100363828
1046 Ga0068853_100738297
1047 Ga0070672_100001694
1048 Ga0070672_100082506
1049 Ga0070672_100126706
1050 Ga0070686_100044340
1051 Ga0070686_100098881
1052 Ga0070686_100110702
1053 Ga0070695_100081632
1054 Ga0070696_100088620
1055 Ga0070665_100004087
1056 Ga0070665_100153131
1057 Ga0070665_100499736
1058 Ga0070665_100583453
1059 Ga0070704_100003332
1060 Ga0070704_100105274
1061 Ga0070704_100511939
1062 Ga0070704_100825013
1063 Ga0068855_100001557
1064 Ga0068855_100009822
1065 Ga0068855_100014867
1066 Ga0068855_100047694
1067 Ga0068855_100152601
1068 Ga0068855_100213834
1069 Ga0068855_100776972
1070 Ga0068855_101000435
1071 Ga0070664_100007205
1072 Ga0070664_100007317
1073 Ga0070664_100148442
1074 Ga0070664_100315645
1075 Ga0070664_100644939
1076 Ga0068857_100011025
1077 Ga0068857_100095755
1078 Ga0068857_100140302
1079 Ga0068857_100143645
1080 Ga0068854_100021040
1081 Ga0068856_100003142
1082 Ga0068856_100006380
1083 Ga0068856_100066042
1084 Ga0068856_100129805
1085 Ga0068856_100163931
1086 Ga0068856_100405723
1087 Ga0068856_100466278
1088 Ga0068852_100032351
1089 Ga0068852_100180611
1090 Ga0068852_100210805
1091 Ga0068852_100903455
1092 Ga0068859_100001734
1093 Ga0068859_100004423
1094 Ga0068859_100431213
1095 Ga0068859_100768319
1096 Ga0068864_100003613
1097 Ga0068864_100263442
1098 Ga0068866_10010753
1099 Ga0068866_10232944
1100 Ga0068866_10456362
1101 Ga0068861_100025559
1102 Ga0068861_100051526
1103 Ga0068861_100110659
1104 Ga0068861_100153647
1105 Ga0068861_100204700
1106 Ga0068861_100453585
1107 Ga0068861_100725587
1108 Ga0068851_10332069
1109 Ga0068870_10201428
1110 Ga0068863_100053375
1111 Ga0068863_100066682
1112 Ga0068863_100114859
1113 Ga0068863_100171821
1114 Ga0068863_100198611
1115 Ga0068863_100342225
1116 Ga0068863_100475219
1117 Ga0068858_100007279
1118 Ga0068858_100012093
1119 Ga0068858_100015353
1120 Ga0068858_100023284
1121 Ga0068858_100032999
1122 Ga0068858_100170495
1123 Ga0068860_100017221
1124 Ga0068860_100031737
1125 Ga0068860_100273388
1126 Ga0068860_100282331
1127 Ga0068860_100297603
1128 Ga0068860_100376983
1129 Ga0068860_100476081
1130 Ga0068862_100154944
1131 Ga0068862_100259555
1132 Ga0068862_100327219
1133 Ga0070717_10015510
1134 Ga0070717_10321859
1135 Ga0070712_100032433
1136 Ga0097621_100005568
1137 Ga0097621_100006771
1138 Ga0097621_100007326
1139 Ga0097621_100011511
1140 Ga0097621_100047814
1141 Ga0097621_100062808
1142 Ga0097621_100118314
1143 Ga0097621_100409269
1144 Ga0068871_100005892
1145 Ga0068871_100013531
1146 Ga0068871_100016427
1147 Ga0068871_100018946
1148 Ga0068871_100023980
1149 Ga0068871_100043261
1150 Ga0068871_100054353
1151 Ga0068871_100099886
1152 Ga0068871_100152043
1153 Ga0068871_100194424
1154 Ga0068871_100231568
1155 Ga0068871_100247047
1156 Ga0068871_100575110
1157 Ga0068871_100681286
1158 Ga0075428_100000019
1159 Ga0075428_100006790
1160 Ga0075428_100009289
1161 Ga0075428_100023052
1162 Ga0075428_100799367
1163 Ga0075430_100034914
1164 Ga0075430_100113743
1165 Ga0075430_100173636
1166 Ga0075431_100000914
1167 Ga0075431_100023001
1168 Ga0075431_100040152
1169 Ga0075431_100088438
1170 Ga0075431_100169520
1171 Ga0075433_10021120
1172 Ga0075433_10080599
1173 Ga0075433_10311480
1174 Ga0075434_100031003
1175 Ga0075434_100086245
1176 Ga0075429_100012100
1177 Ga0075429_100076018
1178 Ga0075429_100482109
1179 Ga0068865_100008234
1180 Ga0068865_100011766
1181 Ga0068865_100060820
1182 Ga0068865_100460680
1183 Ga0097620_100001734
1184 Ga0097620_100004423
1185 Ga0097620_100431247
1186 Ga0097620_100768304
1187 Ga0075435_100554134
1188 Ga0099794_10030342
1189 Ga0099795_10154082
1190 Ga0105240_10001330
1191 Ga0105240_10005789
1192 Ga0105240_10008052
1193 Ga0105240_10025249
1194 Ga0105240_10254118
1195 Ga0105240_10454277
1196 Ga0105240_10511859
1197 Ga0105240_10700341
1198 Ga0105240_10730359
1199 Ga0111539_10000002
1200 Ga0111539_10058550
1201 Ga0111539_10359843
1202 Ga0111539_10983809
1203 Ga0111539_11241595
1204 Ga0105245_10003921
1205 Ga0105245_10004784
1206 Ga0105245_10015086
1207 Ga0105245_10015179
1208 Ga0105245_10018883
1209 Ga0105245_10019679
1210 Ga0105245_10045083
1211 Ga0105245_10047016
1212 Ga0105245_10104026
1213 Ga0105245_10119235
1214 Ga0105245_10254073
1215 Ga0105245_10651823
1216 Ga0114129_10000155
1217 Ga0114129_10011725
1218 Ga0114129_10017965
1219 Ga0114129_10029504
1220 Ga0114129_10094556
1221 Ga0114129_10173617
1222 Ga0114129_10195313
1223 Ga0114129_10259513
1224 Ga0114129_10491830
1225 Ga0114129_11074232
1226 Ga0105243_10019430
1227 Ga0105243_10066698
1228 Ga0105243_10168216
1229 Ga0105243_10199346
1230 Ga0105243_10291081
1231 Ga0105241_10010069
1232 Ga0105241_10010616
1233 Ga0105241_10168439
1234 Ga0105241_10169075
1235 Ga0105241_10227616
1236 Ga0105241_10338474
1237 Ga0105242_10003209
1238 Ga0105242_10004802
1239 Ga0105242_10013007
1240 Ga0105242_10014276
1241 Ga0105242_10049223
1242 Ga0105242_10086644
1243 Ga0105242_10129960
1244 Ga0105242_10287860
1245 Ga0105242_10335522
1246 Ga0105248_10001841
1247 Ga0105248_10009082
1248 Ga0105248_10013147
1249 Ga0105248_10019625
1250 Ga0105248_10027712
1251 Ga0105248_10047477
1252 Ga0105248_10068707
1253 Ga0105248_10116151
1254 Ga0105248_10142009
1255 Ga0105248_10168306
1256 Ga0105248_10217253
1257 Ga0105248_10450458
1258 Ga0105248_10767645
1259 Ga0105248_10771186
1260 Ga0105237_10009655
1261 Ga0105237_10025571
1262 Ga0105237_10075686
1263 Ga0105237_10247602
1264 Ga0105237_10389168
1265 Ga0105237_10408572
1266 Ga0105238_10001988
1267 Ga0105238_10014783
1268 Ga0105238_10017173
1269 Ga0105238_10032711
1270 Ga0105238_10049845
1271 Ga0105238_10060696
1272 Ga0105238_10153791
1273 Ga0105238_10348091
1274 Ga0105238_10370196
1275 Ga0105238_10642085
1276 Ga0105249_10009517
1277 Ga0105239_10010683
1278 Ga0105239_10011071
1279 Ga0105239_10028364
1280 Ga0105239_10029627
1281 Ga0105239_10529675
1282 Ga0105246_10013333
1283 Ga0105246_10027766
1284 Ga0105246_10225611
1285 Ga0105246_10285079
1286 Ga0105246_10303823
1287 Ga0105246_10584421
1288 Ga0157370_10001733
1289 Ga0157370_10003270
1290 Ga0157370_10032457
1291 Ga0157370_10132190
1292 Ga0157370_10239498
1293 Ga0157369_10004743
1294 Ga0157369_10010200
1295 Ga0157369_10040053
1296 Ga0157369_10085323
1297 Ga0157374_10063327
1298 Ga0157374_10067952
1299 Ga0157374_10069124
1300 Ga0157374_10072565
1301 Ga0157374_10222409
1302 Ga0157374_10310016
1303 Ga0157374_10421479
1304 Ga0157378_10001898
1305 Ga0157378_10003929
1306 Ga0157378_10012987
1307 Ga0157378_10115656
1308 Ga0157378_10179491
1309 Ga0157378_10180595
1310 Ga0157378_10218029
1311 Ga0157378_10297574
1312 Ga0157378_10578752
1313 Ga0157378_10625605
1314 Ga0157378_10784376
1315 Ga0163162_10003543
1316 Ga0163162_10016295
1317 Ga0163162_10104866
1318 Ga0163162_10209912
1319 Ga0163162_10243951
1320 Ga0163162_10253751
1321 Ga0163162_10513070
1322 Ga0163162_10779527
1323 Ga0163162_11351926
1324 Ga0157372_10088667
1325 Ga0157372_10094141
1326 Ga0157372_10144222
1327 Ga0157372_10266572
1328 Ga0157375_10005323
1329 Ga0157375_10064400
1330 Ga0157375_10081184
1331 Ga0157375_10365727
1332 Ga0157375_10533105
1333 Ga0157375_10536502
1334 Ga0157375_10623852
1335 Ga0157375_10661389
1336 Ga0157375_10681028
1337 Ga0157375_10722039
1338 Ga0157375_11344250
1339 Ga0163163_10005414
1340 Ga0163163_10006715
1341 Ga0163163_10015575
1342 Ga0163163_10027228
1343 Ga0163163_10033698
1344 Ga0163163_10078549
1345 Ga0163163_10102741
1346 Ga0163163_10171701
1347 Ga0163163_10220085
1348 Ga0163163_10278708
1349 Ga0163163_10413896
1350 Ga0163163_10570566
1351 Ga0163163_10623996
1352 Ga0163163_10897605
1353 Ga0163163_10899258
1354 Ga0157380_10039169
1355 Ga0157380_10089306
1356 Ga0157380_10120262
1357 Ga0157380_10150459
1358 Ga0157380_10242050
1359 Ga0157380_10268174
1360 Ga0157380_10469449
1361 Ga0157380_10572221
1362 Ga0157379_10018470
1363 Ga0157379_10063826
1364 Ga0157379_10508449
1365 Ga0157379_10527357
1366 Ga0157379_10596119
1367 Ga0157376_10010212
1368 Ga0157376_10108109
1369 Ga0157376_10120322
1370 Ga0157376_10143468
1371 Ga0157376_10201002
1372 Ga0157376_10322746
1373 Ga0157376_10398599
1374 Ga0163161_10292902
1375 Ga0207656_10230793
1376 Ga0207642_10124897
1377 Ga0207688_10149985
1378 Ga0207680_10034792
1379 Ga0207680_10034916
1380 Ga0207680_10511611
1381 Ga0207645_10001872
1382 Ga0207645_10064264
1383 Ga0207645_10075966
1384 Ga0207684_10027292
1385 Ga0207684_10071202
1386 Ga0207654_10007504
1387 Ga0207654_10008176
1388 Ga0207654_10055078
1389 Ga0207654_10231162
1390 Ga0207707_10000684
1391 Ga0207707_10112457
1392 Ga0207707_10148104
1393 Ga0207707_10293890
1394 Ga0207695_10002411
1395 Ga0207695_10013324
1396 Ga0207695_10017685
1397 Ga0207695_10019139
1398 Ga0207695_10125494
1399 Ga0207695_10375259
1400 Ga0207695_10458774
1401 Ga0207695_10501779
1402 Ga0207671_10109280
1403 Ga0207671_10145663
1404 Ga0207671_10162510
1405 Ga0207671_10228348
1406 Ga0207671_10312852
1407 Ga0207663_10024777
1408 Ga0207663_10130826
1409 Ga0207660_10009072
1410 Ga0207660_10038258
1411 Ga0207662_10137907
1412 Ga0207662_10212784
1413 Ga0207657_10012255
1414 Ga0207657_10034860
1415 Ga0207657_10079881
1416 Ga0207649_10146318
1417 Ga0207652_10031216
1418 Ga0207652_10152293
1419 Ga0207646_10062415
1420 Ga0207646_10088273
1421 Ga0207681_10027372
1422 Ga0207681_10037039
1423 Ga0207681_10104848
1424 Ga0207681_10168940
1425 Ga0207694_10003273
1426 Ga0207694_10003730
1427 Ga0207694_10015269
1428 Ga0207694_10029198
1429 Ga0207694_10087637
1430 Ga0207694_10105887
1431 Ga0207694_10232241
1432 Ga0207694_10365277
1433 Ga0207650_10022870
1434 Ga0207650_10052007
1435 Ga0207659_10031579
1436 Ga0207659_10033418
1437 Ga0207659_10085404
1438 Ga0207659_10619435
1439 Ga0207687_10000615
1440 Ga0207687_10002388
1441 Ga0207687_10015132
1442 Ga0207687_10022888
1443 Ga0207687_10031178
1444 Ga0207687_10032699
1445 Ga0207687_10042953
1446 Ga0207687_10071858
1447 Ga0207687_10361564
1448 Ga0207700_10007797
1449 Ga0207700_10016437
1450 Ga0207700_10162335
1451 Ga0207700_10403327
1452 Ga0207700_10788148
1453 Ga0207664_10148545
1454 Ga0207644_10014418
1455 Ga0207644_10096761
1456 Ga0207644_10292988
1457 Ga0207690_10121896
1458 Ga0207706_10010848
1459 Ga0207706_10265246
1460 Ga0207686_10001799
1461 Ga0207686_10007390
1462 Ga0207686_10007614
1463 Ga0207686_10058827
1464 Ga0207686_10074536
1465 Ga0207686_10078201
1466 Ga0207686_10080439
1467 Ga0207686_10112162
1468 Ga0207686_10146652
1469 Ga0207709_10006604
1470 Ga0207709_10071855
1471 Ga0207709_10258662
1472 Ga0207670_10024442
1473 Ga0207670_10177664
1474 Ga0207670_10210646
1475 Ga0207670_10457480
1476 Ga0207669_10004816
1477 Ga0207704_10016459
1478 Ga0207704_10020800
1479 Ga0207704_10047949
1480 Ga0207691_10077819
1481 Ga0207691_10101394
1482 Ga0207691_10107778
1483 Ga0207691_10110974
1484 Ga0207691_10407610
1485 Ga0207711_10000207
1486 Ga0207711_10001638
1487 Ga0207711_10006493
1488 Ga0207711_10007210
1489 Ga0207711_10022429
1490 Ga0207711_10041712
1491 Ga0207711_10093431
1492 Ga0207711_10169272
1493 Ga0207711_10199657
1494 Ga0207711_10285077
1495 Ga0207711_10345190
1496 Ga0207711_10534334
1497 Ga0207689_10002878
1498 Ga0207689_10017739
1499 Ga0207689_10061818
1500 Ga0207689_10116681
1501 Ga0207689_10666243
1502 Ga0207661_10005447
1503 Ga0207661_10009405
1504 Ga0207661_10015726
1505 Ga0207661_10062858
1506 Ga0207661_10429628
1507 Ga0207679_10017573
1508 Ga0207679_10125327
1509 Ga0207679_10146409
1510 Ga0207679_10309879
1511 Ga0207679_10390565
1512 Ga0207679_10599340
1513 Ga0207667_10001255
1514 Ga0207667_10015370
1515 Ga0207667_10015668
1516 Ga0207667_10019763
1517 Ga0207667_10043664
1518 Ga0207667_10126843
1519 Ga0207667_10234170
1520 Ga0207651_10001469
1521 Ga0207651_10034021
1522 Ga0207651_10041524
1523 Ga0207651_10045725
1524 Ga0207651_10094790
1525 Ga0207651_10135196
1526 Ga0207712_10010889
1527 Ga0207712_10074850
1528 Ga0207712_10473253
1529 Ga0207668_10036119
1530 Ga0207640_10088904
1531 Ga0207640_10435884
1532 Ga0207658_10039244
1533 Ga0207658_10161180
1534 Ga0207658_10341024
1535 Ga0207677_10010460
1536 Ga0207677_10050312
1537 Ga0207677_10342878
1538 Ga0207677_10354736
1539 Ga0207677_10448855
1540 Ga0207703_10042849
1541 Ga0207703_10068429
1542 Ga0207703_10080218
1543 Ga0207703_10331621
1544 Ga0207703_10522471
1545 Ga0207639_10122814
1546 Ga0207639_10234835
1547 Ga0207639_10244257
1548 Ga0207678_10085842
1549 Ga0207678_10565836
1550 Ga0207708_10003022
1551 Ga0207708_10144762
1552 Ga0207708_10374943
1553 Ga0207702_10033941
1554 Ga0207702_10120988
1555 Ga0207702_10347159
1556 Ga0207641_10079572
1557 Ga0207641_10238156
1558 Ga0207641_10350538
1559 Ga0207641_10564372
1560 Ga0207641_10748789
1561 Ga0207648_10002253
1562 Ga0207648_10082092
1563 Ga0207648_10110615
1564 Ga0207648_10263112
1565 Ga0207648_10415245
1566 Ga0207676_10004508
1567 Ga0207676_10015043
1568 Ga0207676_10117918
1569 Ga0207674_10000252
1570 Ga0207674_10002778
1571 Ga0207674_10020948
1572 Ga0207674_10038242
1573 Ga0207674_10393383
1574 Ga0207674_10768156
1575 Ga0207675_100004828
1576 Ga0207675_100043589
1577 Ga0207675_100069545
1578 Ga0207675_100079920
1579 Ga0207675_100140132
1580 Ga0207675_100189308
1581 Ga0207675_100733535
1582 Ga0207683_10277629
1583 Ga0207683_10562854
1584 Ga0207698_10087334
1585 Ga0207698_10165103
1586 Ga0209588_1089657
1587 Ga0207428_10000004
1588 Ga0268266_10019226
1589 Ga0268266_10070530
1590 Ga0268266_10087524
1591 Ga0268266_10398170
1592 Ga0268265_10073994
1593 Ga0268265_10173647
1594 Ga0268265_10196908
1595 Ga0268265_10272682
1596 Ga0268264_10030492
1597 Ga0268264_10036700
1598 Ga0265760_10007034
1599 Ga0265329_10028572
1600 Ga0265331_10215362
1601 Ga0265313_10006675
1602 Ga0265313_10009655
1603 Ga0265314_10001386
1604 Ga0265314_10005349
1605 Ga0316576_10025794
1606 Ga0316576_10077146
1607 Ga0316578_10261088
1608 Ga0307405_10030145
1609 Ga0307412_10064463
1610 Ga0307412_10355170
1611 Ga0307409_100148400
1612 Ga0307416_100007255
1613 Ga0307411_10533578
1614 Ga0316583_10046053
1615 Ga0373926_0000614
1616 Ga0373934_0004206
1617 Ga0373952_0031857
1618 Ga0373923_0011426
1619 Ga0373939_0192345
1620 Ga0373953_0035336
1621 Ga0373954_0002133
1622 Ga0373954_0257828
1623 Ga0373956_0042534
1624 Ga0373956_0219625
1625 Ga0373956_0274475
1626 Ga0373957_0117090
1627 Ga0373943_0138686
1628 Ga0373946_0178564
1629 Ga0373955_0006974
1630 Ga0373955_0081164
1631 Ga0373955_0081681
1632 Ga0373955_0088444
1633 Ga0373955_0295581
1634 Ga0373935_0000902
1635 Ga0373935_0028083
1636 Ga0373935_0037190
1637 Ga0373935_0522022
1638 Ga0373927_0004041
1639 Ga0373927_0005586
1640 Ga0373927_0080942
1641 Ga0373927_0188568
1642 Ga0373933_0016981
1643 Ga0373933_0044230
1644 Ga0373933_0266037
1645 Ga0373947_0015220
1646 Ga0373947_0069973
1647 Ga0373947_0070709
1648 Ga0373947_0596161
1649 Ga0373937_0001951
1650 Ga0373937_0004398
1651 Ga0373937_0012599
1652 Ga0373937_0023943
1653 Ga0373937_0127113
1654 Ga0373937_0210578
1655 Ga0373937_0272259
1656 Ga0373937_0299426
1657 Ga0373937_0356081
1658 Ga0373937_0359925
1659 Ga0373937_0535302
1660 Ga0373937_0665295
1661 Ga0373937_0715231
1662 Ga0316582_0032046
1663 Ga0316584_0022871
1664 Ga0316584_0371458
1665 Ga0373925_0009351
1666 Ga0373925_0018646
1667 Ga0439453_0034636
1668 Ga0450896_033444
1669 Ga0451577_0131290
1670 Ga0453684_0299781
1671 Ga0451576_0276693
1672 Ga0451576_0300579
1673 Ga0451576_0397770
1674 Ga0495592_0011052
1675 Ga0495592_0022690
1676 Ga0495592_0033271
1677 Ga0495592_0063728
1678 Ga0495592_0071647
1679 Ga0495603_0409420
1680 Ga0495629_0063335
1681 Ga0495651_0000126
1682 Ga0495651_0005148
1683 Ga0495651_0009981
1684 Ga0495651_0417465
1685 Ga0495651_0486437
1686 Ga0495653_0010223
1687 Ga0495653_0088967
1688 Ga0495653_0127564
1689 Ga0495653_0145011
1690 Ga0495653_0460601
1691 Ga0495580_0005481
1692 Ga0495580_0015510
1693 Ga0495580_0018716
1694 Ga0495580_0053551
1695 Ga0495580_0164608
1696 Ga0495580_0264332
1697 Ga0495580_0283151
1698 Ga0495582_0049359
1699 Ga0495582_0126266
1700 Ga0495639_0069564
1701 Ga0495639_0117335
1702 Ga0495639_0207836
1703 Ga0495664_0019425
1704 Ga0495594_0106000
1705 Ga0495594_0113942
1706 Ga0495608_0002023
1707 Ga0495608_0006811
1708 Ga0495608_0010563
1709 Ga0495608_0029614
1710 Ga0495608_0043759
1711 Ga0495618_0007195
1712 Ga0495628_0001880
1713 Ga0495628_0012049
1714 Ga0495628_0018608
1715 Ga0495628_0066816
1716 Ga0495628_0232312
1717 Ga0495628_0301316
1718 Ga0495630_0001011
1719 Ga0495630_0001268
1720 Ga0495630_0003853
1721 Ga0495630_0017821
1722 Ga0495666_0020095
1723 Ga0495652_0013561
1724 Ga0495652_0016762
1725 Ga0495652_0064347
1726 Ga0495665_0013131
1727 Ga0495665_0085639
1728 Ga0495586_0000405
1729 Ga0495586_0069027
1730 Ga0495586_0181340
1731 Ga0495586_0193084
1732 Ga0495586_0205454
1733 Ga0495586_0247271
1734 Ga0495587_0001076
1735 Ga0495587_0004806
1736 Ga0495587_0128957
1737 Ga0495621_0015319
1738 Ga0495621_0054027
1739 Ga0495645_0002936
1740 Ga0495645_0024700
1741 Ga0495645_0038923
1742 Ga0495645_0132836
1743 Ga0495645_0222984
1744 Ga0495667_0001136
1745 Ga0495667_0013664
1746 Ga0495667_0042162
1747 Ga0495667_0219038
1748 Ga0495667_0274600
1749 Ga0495634_0040074
1750 Ga0495634_0141460
1751 Ga0495635_0054682
1752 Ga0495635_0130570
1753 Ga0495635_0190783
1754 Ga0495657_0004041
1755 Ga0495657_0145507
1756 Ga0495599_0003977
1757 Ga0495599_0018901
1758 Ga0495623_0003934
1759 Ga0495623_0081568
1760 Ga0495623_0260433
1761 Ga0495646_0000785
1762 Ga0495646_0058133
1763 Ga0495658_0045096
1764 Ga0495658_0171042
1765 Ga0495613_0001706
1766 Ga0495613_0056494
1767 Ga0495613_0168362
1768 Ga0495613_0545359
1769 Ga0495624_0016528
1770 Ga0495624_0393308
1771 Ga0495600_0003140
1772 Ga0495600_0082885
1773 Ga0495604_0005091
1774 Ga0495604_0010297
1775 Ga0495604_0044978
1776 Ga0495604_0400656
1777 Ga0495674_0001401
1778 Ga0495674_0013223
1779 Ga0495674_0020559
1780 Ga0495674_0024847
1781 Ga0495674_0055836
1782 Ga0495674_0236338
1783 Ga0495676_0046014
1784 Ga0495680_0000253
1785 Ga0495680_0001258
1786 Ga0495680_0089003
1787 Ga0495680_0096719
1788 Ga0495680_0186848
1789 Ga0495675_0000165
1790 Ga0495675_0005957
1791 Ga0495675_0148243
1792 Ga0495675_0178269
1793 Ga0495684_0000125
1794 Ga0495684_0009716
1795 Ga0495684_0012342
1796 Ga0495684_0013320
1797 Ga0495684_0025018
1798 Ga0495684_0076222
1799 Ga0495684_0203701
1800 Ga0495684_0311031
1801 Ga0495602_0003164
1802 Ga0495602_0012198
1803 Ga0495602_0021669
1804 Ga0495602_0081110
1805 Ga0495602_0228155
1806 Ga0496100_0005245
1807 Ga0496101_0018969
1808 Ga0496104_0170139
1809 Ga0496104_0195870
1810 Ga0496104_0298439
1811 Ga0496104_0358451
1812 Ga0496107_0062033
1813 Ga0496112_0440891
1814 Ga0496112_0570133
1815 Ga0496114_0002302
1816 Ga0501042_0443823
1817 Ga0501046_0234035
1818 Ga0501047_0104620
1819 Ga0501048_0135796
1820 Ga0501074_0088039
1821 Ga0501075_0021304
1822 Ga0501076_0046871
1823 Ga0501079_0042736
1824 Ga0501080_0098430
1825 nmdc:mga05p37_105860_c1
1826 nmdc:mga05p37_215848_c1
1827 nmdc:mga05p37_33_c1
1828 nmdc:mga05p37_48567_c1
1829 nmdc:mga05p37_7649_c1
1830 nmdc:mga05p37_827925_c1
1831 nmdc:mga09592_296325_c1
1832 nmdc:mga09592_3004_c1
1833 nmdc:mga09592_3103_c1
1834 nmdc:mga06r32_149771_c1
1835 nmdc:mga06r32_208333_c1
1836 nmdc:mga06r32_29148_c1
1837 nmdc:mga06r32_46080_c1
1838 nmdc:mga06r32_5990_c1
1839 nmdc:mga06r32_84513_c1
1840 nmdc:mga08y16_249954_c1
1841 nmdc:mga08y16_2_c1
1842 nmdc:mga0n895_208421_c1
1843 nmdc:mga0n895_28312_c1
1844 nmdc:mga0n895_879410_c1
1845 nmdc:mga0rr50_280591_c1
1846 nmdc:mga08x19_304343_c1
1847 nmdc:mga0a205_218116_c1
1848 nmdc:mga0a205_242635_c1
1849 nmdc:mga0a205_30462_c1
1850 nmdc:mga0a205_398057_c1
1851 Ga0495601_0022203
1852 Ga0495601_0195274
1853 Ga0495612_0003944
1854 Ga0495595_0103462
1855 Ga0495619_0021501
1856 Ga0495619_0081684
1857 Ga0495619_0300394
1858 Ga0495619_0551672
1859 Ga0500568_0008529
1860 Ga0501084_0042671
1861 Ga0501082_0129189
1862 Ga0530510_0018388

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

46

235

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

52

246

0.92

PF08659

KR

KR domain

46

217

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9539 6 234
2ehd-assembly1.cif.gz_A crystal structure analysis of oxidoreductase 0.9518 6 228
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.9454 6 234
2ehd-assembly1.cif.gz_B crystal structure analysis of oxidoreductase 0.945 6 231
3asu-assembly1.cif.gz_B-2 crystal structure of serine dehydrogenase from escherichia coli 0.9358 7 228
ID Description Score Start End Superfamily
af_A0A1D6ED38_49_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9719 3 176 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9664 85 184 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9627 2 87 3.40.50.720
af_Q0D3U8_30_207_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 3 163 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.953 3 74 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1Q7S4T9-F1-model_v4 Short-chain dehydrogenase 0.9927 1 235 GO:0016491
AF-A0A7V2AD82-F1-model_v4 SDR family oxidoreductase 0.9903 1 186 GO:0016491
AF-A0A2V8KVA2-F1-model_v4 Short-chain dehydrogenase 0.9889 27 235 GO:0016491
AF-A0A1Q7S4T9-F1-model_v4 Short-chain dehydrogenase 0.9885 1 235 GO:0016491
AF-A0A496UUZ4-F1-model_v4 Short-chain dehydrogenase 0.9849 1 234 GO:0016491

Map