F486013

General Info

Members Datasets Scaffolds Average Seq Length
930 346 924 194

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_10228142|Ga0070666_102281422
Length 212
Sequence VKARSAGRNHHPSRVLAVAPITLSDDRVRLEPLALHHEEGLRRAAADGELWQIRVTSVPEPDDTRGYIERALQGFADGHRLAFAVLDAASGEVIGSSSYHDIVPAVERLEIGYTWYAKSRQRTHVNASAKLLLMQHAFETLGARLVGWRTDNFNFASQRAIERLGARKDGVLRHHAVRRDGTIRDTVMYSMTAGEWPEAKAELQARLARPRD

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221638 Duganella sp. Root336D2 Isolate Unclassified
5 2643221684 Massilia sp. Root133 Isolate Unclassified
6 2842711865 Duganella sp. R-73148 Isolate Unclassified
7 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
8 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
179 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
180 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
183 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
184 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
185 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
196 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
197 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
198 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
209 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
210 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
211 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
225 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
226 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
227 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
228 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
229 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
230 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
231 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
232 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
233 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
234 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
235 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
241 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
247 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
248 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
249 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
263 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
264 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
269 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
270 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
271 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
272 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
277 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
278 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
285 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
286 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
287 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
288 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
289 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
290 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
291 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
303 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
304 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
305 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
306 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
307 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
327 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
328 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
329 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
330 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
331 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
332 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
334 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
335 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
336 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.25
Metatranscriptomes 0.11
Isolates 0.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.95
Nodule 0
Rhizoplane 4.62
Rhizosphere 87.2
Stem 0
Stem Tuber 0
Unclassified 3.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1020747 3300002739 Bacteria 801
2 JGI25159J45721_1001812 3300002987 Bacteria 8567
3 JGI25159J45721_1010629 3300002987 Bacteria 2326
4 rootL2_10015574 3300003322 Bacteria 1061
5 JGI25160J50197_1008378 3300003354 Bacteria 3945
6 JGI25161J50226_1003119 3300003374 Bacteria 3944
7 JGI25161J50226_1007562 3300003374 Bacteria 1802
8 Ga0055526_1002157 3300003771 Bacteria 13486
9 Ga0055537_1002292 3300003773 Bacteria 6551
10 Ga0055537_1018071 3300003773 Bacteria 1138
11 Ga0055524_1001269 3300003775 Bacteria 14790
12 Ga0055534_1002606 3300003784 Bacteria 6151
13 Ga0055530_10015821 3300003791 Bacteria 2441
14 Ga0055530_10016700 3300003791 Bacteria 2328
15 Ga0055531_10025864 3300003794 Bacteria 2115
16 Ga0055543_1001061 3300004625 Bacteria 12167
17 Ga0065165_1003149 3300005262 Bacteria 12167
18 Ga0070658_10167090 3300005327 Bacteria 1847
19 Ga0070658_10536862 3300005327 Bacteria 1012
20 Ga0070676_10006179 3300005328 Bacteria 6394
21 Ga0070676_10402641 3300005328 Bacteria 952
22 Ga0070683_100098838 3300005329 Bacteria 2746
23 Ga0070683_100333818 3300005329 Bacteria 1443
24 Ga0070683_100568363 3300005329 Bacteria 1084
25 Ga0070690_100009995 3300005330 Bacteria 5508
26 Ga0070670_100040437 3300005331 Bacteria 4009
27 Ga0070670_100041228 3300005331 Bacteria 3968
28 Ga0070670_100041810 3300005331 Bacteria 3939
29 Ga0070670_100070545 3300005331 Bacteria 2999
30 Ga0070670_100250988 3300005331 Bacteria 1541
31 Ga0070670_100289814 3300005331 Bacteria 1430
32 Ga0070670_100525976 3300005331 Bacteria 1053
33 Ga0070677_10057022 3300005333 Bacteria 1599
34 Ga0070677_10067798 3300005333 Bacteria 1492
35 Ga0070677_10244336 3300005333 Bacteria 888
36 Ga0070677_10300367 3300005333 Bacteria 815
37 Ga0068869_100023042 3300005334 Bacteria 4295
38 Ga0070666_10006509 3300005335 Bacteria 7174
39 Ga0070666_10206569 3300005335 Bacteria 1382
40 Ga0070666_10228142 3300005335 Bacteria 1315
41 Ga0070666_10240260 3300005335 Bacteria 1281
42 Ga0070680_100023635 3300005336 Bacteria 4904
43 Ga0070682_100543651 3300005337 Bacteria 908
44 Ga0068868_100139572 3300005338 Bacteria 1989
45 Ga0068868_100225914 3300005338 Bacteria 1569
46 Ga0068868_100672776 3300005338 Bacteria 923
47 Ga0068868_100797915 3300005338 Bacteria 852
48 Ga0070660_100342381 3300005339 Bacteria 1230
49 Ga0070689_100036157 3300005340 Bacteria 3777
50 Ga0070687_100049285 3300005343 Bacteria 2169
51 Ga0070687_100301400 3300005343 Bacteria 1017
52 Ga0070661_100036668 3300005344 Bacteria 3564
53 Ga0070661_100125964 3300005344 Bacteria 1922
54 Ga0070661_100134924 3300005344 Bacteria 1856
55 Ga0070661_100271965 3300005344 Bacteria 1312
56 Ga0070661_100899479 3300005344 Bacteria 731
57 Ga0070668_100091715 3300005347 Bacteria 2395
58 Ga0070668_100259897 3300005347 Bacteria 1443
59 Ga0070668_100319559 3300005347 Bacteria 1307
60 Ga0070668_100769150 3300005347 Bacteria 854
61 Ga0070669_100001130 3300005353 Bacteria 19489
62 Ga0070669_100116846 3300005353 Bacteria 2030
63 Ga0070669_100256692 3300005353 Bacteria 1393
64 Ga0070669_100343750 3300005353 Bacteria 1210
65 Ga0070675_100003213 3300005354 Bacteria 12380
66 Ga0070675_100008487 3300005354 Bacteria 7976
67 Ga0070675_100009897 3300005354 Bacteria 7432
68 Ga0070675_100156052 3300005354 Bacteria 1960
69 Ga0070675_100219464 3300005354 Bacteria 1655
70 Ga0070675_100220814 3300005354 Bacteria 1650
71 Ga0070675_100359002 3300005354 Bacteria 1293
72 Ga0070671_100011925 3300005355 Bacteria 6991
73 Ga0070671_100118865 3300005355 Bacteria 2223
74 Ga0070671_100124449 3300005355 Bacteria 2170
75 Ga0070671_100189646 3300005355 Bacteria 1742
76 Ga0070671_100233666 3300005355 Bacteria 1560
77 Ga0070671_100268030 3300005355 Bacteria 1451
78 Ga0070671_100313838 3300005355 Bacteria 1335
79 Ga0070671_100756143 3300005355 Bacteria 845
80 Ga0070674_100019990 3300005356 Bacteria 4267
81 Ga0070674_100036075 3300005356 Bacteria 3316
82 Ga0070674_100054491 3300005356 Bacteria 2766
83 Ga0070674_100061868 3300005356 Bacteria 2614
84 Ga0070674_100136079 3300005356 Bacteria 1838
85 Ga0070673_100012933 3300005364 Bacteria 5750
86 Ga0070673_100014182 3300005364 Bacteria 5539
87 Ga0070673_100049904 3300005364 Bacteria 3269
88 Ga0070673_100068785 3300005364 Bacteria 2836
89 Ga0070673_100106844 3300005364 Bacteria 2315
90 Ga0070673_100107138 3300005364 Bacteria 2311
91 Ga0070673_100466491 3300005364 Bacteria 1138
92 Ga0070688_100156585 3300005365 Bacteria 1561
93 Ga0070659_100039683 3300005366 Bacteria 3676
94 Ga0070659_100170292 3300005366 Bacteria 1783
95 Ga0070667_100005407 3300005367 Bacteria 10668
96 Ga0070667_100017232 3300005367 Bacteria 5984
97 Ga0070667_100075666 3300005367 Bacteria 2874
98 Ga0070667_100138856 3300005367 Bacteria 2126
99 Ga0070667_100227038 3300005367 Bacteria 1664
100 Ga0070667_100299990 3300005367 Bacteria 1446
101 Ga0070700_100605743 3300005441 Bacteria 859
102 Ga0070663_100096753 3300005455 Bacteria 2196
103 Ga0070663_100141142 3300005455 Bacteria 1839
104 Ga0070678_100000202 3300005456 Bacteria 26370
105 Ga0070678_100026125 3300005456 Bacteria 3942
106 Ga0070678_100144714 3300005456 Bacteria 1906
107 Ga0070678_100183127 3300005456 Bacteria 1716
108 Ga0070678_100212455 3300005456 Bacteria 1604
109 Ga0070678_100223703 3300005456 Bacteria 1565
110 Ga0070678_100229254 3300005456 Bacteria 1547
111 Ga0070678_100234822 3300005456 Bacteria 1530
112 Ga0070678_100259165 3300005456 Bacteria 1461
113 Ga0070678_100301155 3300005456 Bacteria 1362
114 Ga0070678_100334342 3300005456 Bacteria 1297
115 Ga0070662_100001238 3300005457 Bacteria 15666
116 Ga0070662_100045173 3300005457 Bacteria 3159
117 Ga0070662_100096187 3300005457 Bacteria 2234
118 Ga0070662_100157745 3300005457 Bacteria 1773
119 Ga0070662_100795813 3300005457 Bacteria 803
120 Ga0070681_10017210 3300005458 Bacteria 7227
121 Ga0068867_100000173 3300005459 Bacteria 42222
122 Ga0068867_100048156 3300005459 Bacteria 3135
123 Ga0068867_100280827 3300005459 Bacteria 1365
124 Ga0068867_100324007 3300005459 Bacteria 1277
125 Ga0068867_100491221 3300005459 Bacteria 1053
126 Ga0068867_100929104 3300005459 Bacteria 785
127 Ga0070679_100002880 3300005530 Bacteria 15636
128 Ga0070684_100225458 3300005535 Bacteria 1710
129 Ga0070684_100303343 3300005535 Bacteria 1466
130 Ga0070684_100448397 3300005535 Bacteria 1192
131 Ga0068853_100097511 3300005539 Bacteria 2595
132 Ga0068853_100183825 3300005539 Bacteria 1897
133 Ga0068853_100400553 3300005539 Bacteria 1284
134 Ga0068853_100674768 3300005539 Bacteria 985
135 Ga0068853_100736778 3300005539 Bacteria 941
136 Ga0070672_100008996 3300005543 Bacteria 6864
137 Ga0070672_100023210 3300005543 Bacteria 4569
138 Ga0070672_100035158 3300005543 Bacteria 3807
139 Ga0070672_100073201 3300005543 Bacteria 2730
140 Ga0070672_100076179 3300005543 Bacteria 2679
141 Ga0070672_100077866 3300005543 Bacteria 2652
142 Ga0070672_100155404 3300005543 Bacteria 1894
143 Ga0070672_100367461 3300005543 Bacteria 1229
144 Ga0070672_100456136 3300005543 Bacteria 1101
145 Ga0070693_100068866 3300005547 Bacteria 2078
146 Ga0070665_100220200 3300005548 Bacteria 1898
147 Ga0070665_100433462 3300005548 Bacteria 1324
148 Ga0070664_100037616 3300005564 Bacteria 4069
149 Ga0070664_100227913 3300005564 Bacteria 1669
150 Ga0070664_100297592 3300005564 Bacteria 1457
151 Ga0070664_100458131 3300005564 Bacteria 1171
152 Ga0070664_100581658 3300005564 Bacteria 1037
153 Ga0068857_100061915 3300005577 Bacteria 3325
154 Ga0068854_100099736 3300005578 Bacteria 2175
155 Ga0068854_100185117 3300005578 Bacteria 1629
156 Ga0068856_100104352 3300005614 Bacteria 2828
157 Ga0068856_100165071 3300005614 Bacteria 2225
158 Ga0068856_100802849 3300005614 Bacteria 961
159 Ga0068856_100823349 3300005614 Bacteria 948
160 Ga0070702_100201945 3300005615 Bacteria 1317
161 Ga0068852_100009055 3300005616 Bacteria 7370
162 Ga0068852_100010860 3300005616 Bacteria 6825
163 Ga0068852_100030071 3300005616 Bacteria 4467
164 Ga0068852_100031671 3300005616 Bacteria 4368
165 Ga0068852_100118587 3300005616 Bacteria 2418
166 Ga0068852_100137341 3300005616 Bacteria 2258
167 Ga0068852_100314359 3300005616 Bacteria 1519
168 Ga0068852_100339511 3300005616 Bacteria 1464
169 Ga0068852_100355595 3300005616 Bacteria 1431
170 Ga0068852_100688516 3300005616 Bacteria 1032
171 Ga0068859_100039942 3300005617 Bacteria 4709
172 Ga0068859_100136533 3300005617 Bacteria 2525
173 Ga0068859_100156913 3300005617 Bacteria 2353
174 Ga0068859_100753540 3300005617 Bacteria 1063
175 Ga0068864_100000365 3300005618 Bacteria 39562
176 Ga0068864_100002329 3300005618 Bacteria 15709
177 Ga0068864_100031123 3300005618 Bacteria 4526
178 Ga0068864_100045894 3300005618 Bacteria 3749
179 Ga0068864_100080467 3300005618 Bacteria 2854
180 Ga0068864_100283914 3300005618 Bacteria 1546
181 Ga0068864_100493069 3300005618 Bacteria 1177
182 Ga0068866_10012833 3300005718 Bacteria 3659
183 Ga0068866_10095036 3300005718 Bacteria 1632
184 Ga0068861_100416922 3300005719 Bacteria 1195
185 Ga0068851_10005284 3300005834 Bacteria 5859
186 Ga0068851_10122315 3300005834 Bacteria 1400
187 Ga0068851_10250998 3300005834 Bacteria 1003
188 Ga0068851_10259752 3300005834 Bacteria 988
189 Ga0068870_10165149 3300005840 Bacteria 1317
190 Ga0068870_10190663 3300005840 Bacteria 1237
191 Ga0068863_100025015 3300005841 Bacteria 5694
192 Ga0068863_100063605 3300005841 Bacteria 3489
193 Ga0068863_100114908 3300005841 Bacteria 2564
194 Ga0068863_100212996 3300005841 Bacteria 1860
195 Ga0068863_100236061 3300005841 Bacteria 1765
196 Ga0068863_100263291 3300005841 Bacteria 1667
197 Ga0068863_100269813 3300005841 Bacteria 1647
198 Ga0068863_100698719 3300005841 Bacteria 1008
199 Ga0068858_100001818 3300005842 Bacteria 21717
200 Ga0068858_100003428 3300005842 Bacteria 15754
201 Ga0068858_100003838 3300005842 Bacteria 14861
202 Ga0068858_100015579 3300005842 Bacteria 7151
203 Ga0068860_100004794 3300005843 Bacteria 13777
204 Ga0068860_100005517 3300005843 Bacteria 12805
205 Ga0068860_100093086 3300005843 Bacteria 2872
206 Ga0068862_100039223 3300005844 Bacteria 4021
207 Ga0068862_100093115 3300005844 Bacteria 2628
208 Ga0070717_10022058 3300006028 Bacteria 5027
209 Ga0075365_10005225 3300006038 Bacteria 6983
210 Ga0070715_10196619 3300006163 Bacteria 1022
211 Ga0075367_10029910 3300006178 Bacteria 3119
212 Ga0075366_10231906 3300006195 Bacteria 1125
213 Ga0075366_10301165 3300006195 Bacteria 981
214 Ga0097621_100016159 3300006237 Bacteria 5635
215 Ga0097621_100045361 3300006237 Bacteria 3550
216 Ga0097621_100364826 3300006237 Bacteria 1287
217 Ga0097621_100405989 3300006237 Bacteria 1220
218 Ga0097621_100739939 3300006237 Bacteria 908
219 Ga0068871_100085125 3300006358 Bacteria 2624
220 Ga0068871_100090430 3300006358 Bacteria 2549
221 Ga0068871_100261185 3300006358 Bacteria 1510
222 Ga0068871_100295490 3300006358 Bacteria 1420
223 Ga0068871_100332340 3300006358 Bacteria 1340
224 Ga0068865_100816976 3300006881 Bacteria 805
225 Ga0097620_100039942 3300006931 Bacteria 4709
226 Ga0097620_100136532 3300006931 Bacteria 2525
227 Ga0097620_100156918 3300006931 Bacteria 2353
228 Ga0097620_100753500 3300006931 Bacteria 1063
229 Ga0105240_10002543 3300009093 Bacteria 29256
230 Ga0105240_10160498 3300009093 Bacteria 2671
231 Ga0111539_10557317 3300009094 Bacteria 1335
232 Ga0111539_11910411 3300009094 Bacteria 688
233 Ga0105245_10042059 3300009098 Bacteria 4076
234 Ga0105245_10175268 3300009098 Bacteria 2045
235 Ga0105247_10520875 3300009101 Bacteria 869
236 Ga0105243_10003820 3300009148 Bacteria 12050
237 Ga0105243_10004042 3300009148 Bacteria 11682
238 Ga0105243_10916977 3300009148 Bacteria 873
239 Ga0105241_10369203 3300009174 Bacteria 1251
240 Ga0105241_10560425 3300009174 Bacteria 1027
241 Ga0105242_10073735 3300009176 Bacteria 2839
242 Ga0105242_10617790 3300009176 Bacteria 1049
243 Ga0105248_10020415 3300009177 Bacteria 7339
244 Ga0105248_10044593 3300009177 Bacteria 4973
245 Ga0105248_10109194 3300009177 Bacteria 3119
246 Ga0105248_10662727 3300009177 Bacteria 1177
247 Ga0105248_10672461 3300009177 Bacteria 1168
248 Ga0105248_11182908 3300009177 Bacteria 864
249 Ga0105237_10000518 3300009545 Bacteria 54382
250 Ga0105237_10221725 3300009545 Bacteria 1891
251 Ga0105238_10043782 3300009551 Bacteria 4528
252 Ga0105238_10175558 3300009551 Bacteria 2119
253 Ga0105238_10396108 3300009551 Bacteria 1373
254 Ga0105249_10005277 3300009553 Bacteria 11155
255 Ga0105249_10016583 3300009553 Bacteria 6537
256 Ga0105249_10213870 3300009553 Bacteria 1893
257 Ga0105249_10381685 3300009553 Bacteria 1435
258 Ga0105239_10000872 3300010375 Bacteria 42900
259 Ga0105239_10819287 3300010375 Bacteria 1067
260 Ga0105246_10717380 3300011119 Bacteria 878
261 Ga0157373_10437504 3300013100 Bacteria 940
262 Ga0157371_10057938 3300013102 Bacteria 2748
263 Ga0157370_10270238 3300013104 Bacteria 1571
264 Ga0157370_10707126 3300013104 Bacteria 920
265 Ga0157369_10032613 3300013105 Bacteria 5727
266 Ga0157374_10013203 3300013296 Bacteria 7205
267 Ga0157374_10060546 3300013296 Bacteria 3543
268 Ga0157374_10086510 3300013296 Bacteria 2982
269 Ga0157374_11141907 3300013296 Bacteria 800
270 Ga0157378_10185191 3300013297 Bacteria 1961
271 Ga0157378_10295745 3300013297 Bacteria 1565
272 Ga0163162_10020480 3300013306 Bacteria 6501
273 Ga0163162_10087946 3300013306 Bacteria 3186
274 Ga0163162_10322226 3300013306 Bacteria 1678
275 Ga0163162_10475759 3300013306 Bacteria 1380
276 Ga0163162_10677352 3300013306 Bacteria 1154
277 Ga0163162_10912745 3300013306 Bacteria 991
278 Ga0157372_10078073 3300013307 Bacteria 3741
279 Ga0157372_10253491 3300013307 Bacteria 2043
280 Ga0157372_10293460 3300013307 Bacteria 1891
281 Ga0157375_10027374 3300013308 Bacteria 5329
282 Ga0157375_10137302 3300013308 Bacteria 2570
283 Ga0157375_10149452 3300013308 Bacteria 2470
284 Ga0157375_10154362 3300013308 Bacteria 2434
285 Ga0157375_11398527 3300013308 Bacteria 824
286 Ga0163163_10007645 3300014325 Bacteria 9547
287 Ga0163163_10170102 3300014325 Bacteria 2226
288 Ga0157380_10015990 3300014326 Bacteria 5524
289 Ga0157380_10023234 3300014326 Bacteria 4675
290 Ga0157380_10030254 3300014326 Bacteria 4146
291 Ga0157380_10371249 3300014326 Bacteria 1346
292 Ga0157377_10000039 3300014745 Bacteria 112711
293 Ga0157377_10113708 3300014745 Bacteria 1630
294 Ga0157379_10047857 3300014968 Bacteria 3816
295 Ga0157379_10092877 3300014968 Bacteria 2707
296 Ga0157379_10154924 3300014968 Bacteria 2067
297 Ga0157376_10008913 3300014969 Bacteria 7263
298 Ga0157376_10009644 3300014969 Bacteria 7025
299 Ga0157376_11573919 3300014969 Bacteria 691
300 Ga0163161_10027098 3300017792 Bacteria 4064
301 Ga0163161_10350265 3300017792 Bacteria 1174
302 Ga0163161_10365361 3300017792 Bacteria 1150
303 Ga0163161_10619960 3300017792 Bacteria 894
304 Ga0207425_1000062 3300025245 Bacteria 136118
305 Ga0209677_100960 3300025253 Bacteria 14017
306 Ga0209565_1000622 3300025263 Bacteria 23367
307 Ga0209565_1000784 3300025263 Bacteria 18444
308 Ga0209565_1001080 3300025263 Bacteria 13621
309 Ga0209565_1031342 3300025263 Bacteria 1033
310 Ga0207666_1009379 3300025271 Bacteria 1322
311 Ga0209130_1001152 3300025284 Bacteria 19177
312 Ga0209130_1007249 3300025284 Bacteria 3455
313 Ga0209130_1025357 3300025284 Bacteria 1285
314 Ga0209675_1000280 3300025291 Bacteria 48644
315 Ga0209564_1001080 3300025295 Bacteria 32728
316 Ga0209050_1000064 3300025298 Bacteria 314803
317 Ga0209050_1001144 3300025298 Bacteria 31864
318 Ga0209256_1000507 3300025299 Bacteria 57359
319 Ga0209256_1001972 3300025299 Bacteria 18495
320 Ga0207426_1001027 3300025302 Bacteria 26714
321 Ga0209051_1031078 3300025303 Bacteria 2060
322 Ga0209257_1000010 3300025304 Bacteria 1158682
323 Ga0209257_1003990 3300025304 Bacteria 11915
324 Ga0207697_10042417 3300025315 Bacteria 1869
325 Ga0207656_10023503 3300025321 Bacteria 2483
326 Ga0207656_10072122 3300025321 Bacteria 1537
327 Ga0207656_10117927 3300025321 Bacteria 1233
328 Ga0207656_10150588 3300025321 Bacteria 1101
329 Ga0207656_10167946 3300025321 Bacteria 1047
330 Ga0207656_10200423 3300025321 Bacteria 964
331 Ga0207682_10007351 3300025893 Bacteria 4393
332 Ga0207682_10053057 3300025893 Bacteria 1681
333 Ga0207682_10053985 3300025893 Bacteria 1668
334 Ga0207642_10014634 3300025899 Bacteria 2900
335 Ga0207642_10130694 3300025899 Bacteria 1310
336 Ga0207688_10172200 3300025901 Bacteria 1288
337 Ga0207688_10319948 3300025901 Bacteria 952
338 Ga0207688_10436710 3300025901 Bacteria 815
339 Ga0207688_10480137 3300025901 Bacteria 777
340 Ga0207680_10019580 3300025903 Bacteria 3622
341 Ga0207680_10051951 3300025903 Bacteria 2453
342 Ga0207680_10273463 3300025903 Bacteria 1172
343 Ga0207685_10153763 3300025905 Bacteria 1044
344 Ga0207645_10016617 3300025907 Bacteria 4868
345 Ga0207645_10025026 3300025907 Bacteria 3865
346 Ga0207645_10039259 3300025907 Bacteria 3034
347 Ga0207645_10093958 3300025907 Bacteria 1930
348 Ga0207645_10118016 3300025907 Bacteria 1721
349 Ga0207643_10308284 3300025908 Bacteria 986
350 Ga0207705_10333928 3300025909 Bacteria 1166
351 Ga0207695_10006571 3300025913 Bacteria 15047
352 Ga0207695_10142141 3300025913 Bacteria 2347
353 Ga0207671_10003492 3300025914 Bacteria 15626
354 Ga0207671_10291669 3300025914 Bacteria 1288
355 Ga0207660_10185183 3300025917 Bacteria 1619
356 Ga0207662_10186112 3300025918 Bacteria 1338
357 Ga0207662_10267713 3300025918 Bacteria 1127
358 Ga0207657_10227937 3300025919 Bacteria 1491
359 Ga0207657_10333922 3300025919 Bacteria 1197
360 Ga0207649_10138295 3300025920 Bacteria 1663
361 Ga0207649_10216079 3300025920 Bacteria 1363
362 Ga0207652_10295525 3300025921 Bacteria 1462
363 Ga0207681_10032608 3300025923 Bacteria 3412
364 Ga0207681_10071671 3300025923 Bacteria 2417
365 Ga0207681_10445708 3300025923 Bacteria 1052
366 Ga0207694_10019086 3300025924 Bacteria 5182
367 Ga0207694_10278913 3300025924 Bacteria 1372
368 Ga0207650_10027735 3300025925 Bacteria 4055
369 Ga0207650_10035349 3300025925 Bacteria 3627
370 Ga0207650_10133863 3300025925 Bacteria 1942
371 Ga0207650_10153958 3300025925 Bacteria 1817
372 Ga0207650_10187506 3300025925 Bacteria 1651
373 Ga0207650_10384649 3300025925 Bacteria 1159
374 Ga0207659_10003336 3300025926 Bacteria 9629
375 Ga0207659_10010543 3300025926 Bacteria 5810
376 Ga0207659_10015331 3300025926 Bacteria 4961
377 Ga0207659_10036615 3300025926 Bacteria 3401
378 Ga0207659_10162050 3300025926 Bacteria 1757
379 Ga0207659_10310924 3300025926 Bacteria 1297
380 Ga0207659_10462700 3300025926 Bacteria 1070
381 Ga0207659_10580292 3300025926 Bacteria 955
382 Ga0207687_10034140 3300025927 Bacteria 3453
383 Ga0207687_10236079 3300025927 Bacteria 1447
384 Ga0207644_10002949 3300025931 Bacteria 10959
385 Ga0207644_10027031 3300025931 Bacteria 3961
386 Ga0207644_10193967 3300025931 Bacteria 1598
387 Ga0207644_10289150 3300025931 Bacteria 1318
388 Ga0207644_10290172 3300025931 Bacteria 1315
389 Ga0207644_10437444 3300025931 Bacteria 1073
390 Ga0207690_10122483 3300025932 Bacteria 1891
391 Ga0207706_10001684 3300025933 Bacteria 21807
392 Ga0207706_10069224 3300025933 Bacteria 3104
393 Ga0207706_10162222 3300025933 Bacteria 1965
394 Ga0207706_10762093 3300025933 Bacteria 824
395 Ga0207706_11098358 3300025933 Bacteria 665
396 Ga0207686_10068989 3300025934 Bacteria 2267
397 Ga0207686_10075378 3300025934 Bacteria 2184
398 Ga0207686_10435447 3300025934 Bacteria 1006
399 Ga0207709_10008906 3300025935 Bacteria 5541
400 Ga0207709_10020258 3300025935 Bacteria 3750
401 Ga0207709_10280442 3300025935 Bacteria 1230
402 Ga0207669_10016052 3300025937 Bacteria 3794
403 Ga0207669_10027359 3300025937 Bacteria 3120
404 Ga0207669_10389288 3300025937 Bacteria 1088
405 Ga0207704_10008539 3300025938 Bacteria 4905
406 Ga0207665_10058372 3300025939 Bacteria 2609
407 Ga0207691_10012960 3300025940 Bacteria 7984
408 Ga0207691_10024676 3300025940 Bacteria 5654
409 Ga0207691_10056925 3300025940 Bacteria 3560
410 Ga0207691_10058182 3300025940 Bacteria 3516
411 Ga0207691_10127924 3300025940 Bacteria 2246
412 Ga0207691_10372729 3300025940 Bacteria 1219
413 Ga0207691_10519804 3300025940 Bacteria 1010
414 Ga0207711_10100667 3300025941 Bacteria 2556
415 Ga0207711_10189956 3300025941 Bacteria 1871
416 Ga0207711_10290181 3300025941 Bacteria 1508
417 Ga0207711_10341131 3300025941 Bacteria 1387
418 Ga0207711_10469663 3300025941 Bacteria 1172
419 Ga0207711_11238177 3300025941 Bacteria 688
420 Ga0207689_10000716 3300025942 Bacteria 31758
421 Ga0207689_10002900 3300025942 Bacteria 15822
422 Ga0207689_10069792 3300025942 Bacteria 2887
423 Ga0207661_10026334 3300025944 Bacteria 4429
424 Ga0207679_10200857 3300025945 Bacteria 1665
425 Ga0207679_10369217 3300025945 Bacteria 1255
426 Ga0207679_10488097 3300025945 Bacteria 1098
427 Ga0207679_11275709 3300025945 Bacteria 674
428 Ga0207667_10193259 3300025949 Bacteria 2088
429 Ga0207667_10590591 3300025949 Bacteria 1120
430 Ga0207651_10007527 3300025960 Bacteria 5807
431 Ga0207651_10051280 3300025960 Bacteria 2806
432 Ga0207651_10109031 3300025960 Bacteria 2073
433 Ga0207651_10329320 3300025960 Bacteria 1279
434 Ga0207651_10475087 3300025960 Bacteria 1076
435 Ga0207712_10034313 3300025961 Bacteria 3438
436 Ga0207668_10047946 3300025972 Bacteria 2928
437 Ga0207668_10473502 3300025972 Bacteria 1073
438 Ga0207668_10573537 3300025972 Bacteria 980
439 Ga0207640_10090295 3300025981 Bacteria 2120
440 Ga0207640_10148017 3300025981 Bacteria 1721
441 Ga0207640_10328349 3300025981 Bacteria 1221
442 Ga0207658_10002511 3300025986 Bacteria 13353
443 Ga0207658_10023668 3300025986 Bacteria 4289
444 Ga0207658_10247099 3300025986 Bacteria 1514
445 Ga0207658_10435704 3300025986 Bacteria 1158
446 Ga0207658_10736009 3300025986 Bacteria 892
447 Ga0207677_10000452 3300026023 Bacteria 27626
448 Ga0207677_10020176 3300026023 Bacteria 4042
449 Ga0207677_10087762 3300026023 Bacteria 2253
450 Ga0207677_10219806 3300026023 Bacteria 1523
451 Ga0207677_10450333 3300026023 Bacteria 1103
452 Ga0207677_10950080 3300026023 Bacteria 777
453 Ga0207703_10003257 3300026035 Bacteria 13652
454 Ga0207703_10003262 3300026035 Bacteria 13624
455 Ga0207703_10089492 3300026035 Bacteria 2585
456 Ga0207639_10103265 3300026041 Bacteria 2309
457 Ga0207639_10370436 3300026041 Bacteria 1284
458 Ga0207639_10560087 3300026041 Bacteria 1050
459 Ga0207639_10623268 3300026041 Bacteria 996
460 Ga0207639_10751365 3300026041 Bacteria 907
461 Ga0207678_10008265 3300026067 Bacteria 9170
462 Ga0207678_10042827 3300026067 Bacteria 3920
463 Ga0207678_10437544 3300026067 Bacteria 1135
464 Ga0207702_10017145 3300026078 Bacteria 5991
465 Ga0207702_11202452 3300026078 Bacteria 752
466 Ga0207641_10000923 3300026088 Bacteria 30321
467 Ga0207641_10067624 3300026088 Bacteria 3061
468 Ga0207641_10557982 3300026088 Bacteria 1117
469 Ga0207641_10938236 3300026088 Bacteria 860
470 Ga0207648_10000836 3300026089 Bacteria 34689
471 Ga0207648_10063633 3300026089 Bacteria 3215
472 Ga0207648_10124501 3300026089 Bacteria 2267
473 Ga0207648_10278432 3300026089 Bacteria 1496
474 Ga0207648_10402916 3300026089 Bacteria 1240
475 Ga0207648_10928640 3300026089 Bacteria 814
476 Ga0207676_10004605 3300026095 Bacteria 9766
477 Ga0207676_10027490 3300026095 Bacteria 4237
478 Ga0207676_10028475 3300026095 Bacteria 4173
479 Ga0207676_10111006 3300026095 Bacteria 2294
480 Ga0207676_10189822 3300026095 Bacteria 1807
481 Ga0207676_10448793 3300026095 Bacteria 1215
482 Ga0207676_10620848 3300026095 Bacteria 1040
483 Ga0207674_10093330 3300026116 Bacteria 2998
484 Ga0207675_100024123 3300026118 Bacteria 5655
485 Ga0207675_100043887 3300026118 Bacteria 4176
486 Ga0207675_100772423 3300026118 Bacteria 973
487 Ga0207683_10001865 3300026121 Bacteria 18641
488 Ga0207683_10024876 3300026121 Bacteria 5160
489 Ga0207683_10028889 3300026121 Bacteria 4798
490 Ga0207683_10052952 3300026121 Bacteria 3557
491 Ga0207683_10157193 3300026121 Bacteria 2054
492 Ga0207683_10230223 3300026121 Bacteria 1690
493 Ga0207683_10238480 3300026121 Bacteria 1659
494 Ga0207683_10355924 3300026121 Bacteria 1344
495 Ga0207683_10398368 3300026121 Bacteria 1266
496 Ga0207683_10651174 3300026121 Bacteria 976
497 Ga0207683_10685541 3300026121 Bacteria 950
498 Ga0207698_10017502 3300026142 Bacteria 4865
499 Ga0207698_10047999 3300026142 Bacteria 3239
500 Ga0207698_10048420 3300026142 Bacteria 3227
501 Ga0207698_10059428 3300026142 Bacteria 2968
502 Ga0207698_10078152 3300026142 Bacteria 2656
503 Ga0207698_10152078 3300026142 Bacteria 2010
504 Ga0207698_10278503 3300026142 Bacteria 1546
505 Ga0207698_10680206 3300026142 Bacteria 1022
506 Ga0207698_10976148 3300026142 Bacteria 857
507 Ga0268266_10270974 3300028379 Bacteria 1576
508 Ga0268265_10522666 3300028380 Bacteria 1122
509 Ga0268264_10052499 3300028381 Bacteria 3399
510 Ga0268264_10071675 3300028381 Bacteria 2936
511 Ga0268264_10373113 3300028381 Bacteria 1364
512 Ga0307515_10000030 3300028794 Bacteria 364482
513 Ga0307515_10000221 3300028794 Bacteria 141099
514 Ga0307515_10000777 3300028794 Bacteria 73454
515 Ga0307515_10018037 3300028794 Bacteria 12810
516 Ga0265324_10081879 3300029957 Bacteria 1098
517 Ga0307512_10017030 3300030522 Bacteria 6686
518 Ga0307513_10023763 3300031456 Bacteria 7152
519 Ga0307408_100002803 3300031548 Bacteria 12100
520 Ga0307408_100015501 3300031548 Bacteria 5075
521 Ga0307408_100217674 3300031548 Bacteria 1556
522 Ga0307408_100345150 3300031548 Bacteria 1261
523 Ga0307408_100477666 3300031548 Bacteria 1087
524 Ga0307508_10000141 3300031616 Bacteria 85739
525 Ga0307514_10065597 3300031649 Bacteria 2749
526 Ga0307516_10004531 3300031730 Bacteria 17090
527 Ga0307405_10011385 3300031731 Bacteria 4659
528 Ga0307405_10166719 3300031731 Bacteria 1566
529 Ga0307410_10735064 3300031852 Bacteria 834
530 Ga0307406_10022936 3300031901 Bacteria 3708
531 Ga0307406_10836344 3300031901 Bacteria 779
532 Ga0307407_10120706 3300031903 Bacteria 1661
533 Ga0307412_10003513 3300031911 Bacteria 8711
534 Ga0307412_10095690 3300031911 Bacteria 2088
535 Ga0307409_100025456 3300031995 Bacteria 4151
536 Ga0307409_100869257 3300031995 Bacteria 913
537 Ga0307416_100000974 3300032002 Bacteria 15139
538 Ga0307416_100234092 3300032002 Bacteria 1773
539 Ga0307416_100309525 3300032002 Bacteria 1575
540 Ga0307414_10364022 3300032004 Bacteria 1245
541 Ga0307411_10094900 3300032005 Bacteria 2092
542 Ga0307415_100001962 3300032126 Bacteria 10127
543 Ga0307415_100551641 3300032126 Bacteria 1017
544 Ga0307510_10448412 3300033180 Bacteria 731
545 Ga0373938_0040326 3300034957 Bacteria 1035
546 Ga0373949_0035444 3300035090 Bacteria 1207
547 Ga0373936_0183358 3300035113 Bacteria 919
548 Ga0373931_0003594 3300035691 Bacteria 6996
549 Ga0373931_0262860 3300035691 Bacteria 1054
550 Ga0373927_0123237 3300035695 Bacteria 1692
551 Ga0373937_0037185 3300036401 Bacteria 4436
552 Ga0373925_0170979 3300037068 Bacteria 1716
553 Ga0373925_0253853 3300037068 Bacteria 1411
554 Ga0373925_0672663 3300037068 Bacteria 853
555 Ga0395900_0185157 3300037418 Bacteria 2114
556 Ga0395900_0746435 3300037418 Bacteria 909
557 Ga0395898_0020437 3300037466 Bacteria 6724
558 Ga0395905_0370157 3300037471 Bacteria 1326
559 Ga0395905_1185220 3300037471 Bacteria 667
560 Ga0436364_0571710 3300037853 Bacteria 4996
561 Ga0395901_0158225 3300038443 Bacteria 2379
562 Ga0395901_0381368 3300038443 Bacteria 1451
563 Ga0436365_0482375 3300039437 Bacteria 7514
564 Ga0436363_0390454 3300039450 Bacteria 2045
565 Ga0451793_1915431 3300041452 Bacteria 1668
566 Ga0451797_0142736 3300041453 Bacteria 907
567 Ga0451802_0933167 3300041460 Bacteria 995
568 Ga0451835_0346031 3300041492 Bacteria 879
569 Ga0451837_1554540 3300041494 Bacteria 953
570 Ga0451839_0874313 3300041496 Bacteria 1455
571 Ga0451841_0821959 3300041498 Bacteria 1130
572 Ga0451843_0875436 3300041509 Bacteria 1223
573 Ga0451853_0591653 3300041512 Bacteria 1143
574 Ga0451853_2839646 3300041512 Bacteria 915
575 Ga0439464_0006066 3300042439 Bacteria 3141
576 Ga0451577_0609327 3300042876 Bacteria 991
577 Ga0466972_0029464 3300044658 Bacteria 2702
578 Ga0466965_0019972 3300044683 Bacteria 3217
579 Ga0466961_0135700 3300044693 Bacteria 1542
580 Ga0466963_0253382 3300044694 Bacteria 1235
581 Ga0466964_0000831 3300044706 Bacteria 10096
582 Ga0466964_0046940 3300044706 Bacteria 1761
583 Ga0453684_0746774 3300044712 Bacteria 1059
584 Ga0466968_0005379 3300044735 Bacteria 4791
585 Ga0466970_0411913 3300044765 Bacteria 772
586 Ga0466957_0119546 3300044842 Bacteria 1678
587 Ga0466957_0246141 3300044842 Bacteria 1187
588 Ga0466957_0463066 3300044842 Unclassified 875
589 Ga0466960_0256749 3300044901 Bacteria 972
590 Ga0451576_0553615 3300045051 Bacteria 1208
591 Ga0451576_1410206 3300045051 Bacteria 725
592 Ga0466958_0391881 3300045836 Bacteria 896
593 Ga0466967_0011043 3300045976 Bacteria 6815
594 Ga0495617_000002 3300046452 Bacteria 710121
595 Ga0495627_000176 3300046453 Bacteria 72651
596 Ga0495627_005973 3300046453 Bacteria 4835
597 Ga0495603_0235314 3300046455 Bacteria 1055
598 Ga0495603_0426942 3300046455 Bacteria 759
599 Ga0495590_0025210 3300046457 Bacteria 2091
600 Ga0495591_061640 3300046458 Bacteria 995
601 Ga0495629_0021875 3300046459 Bacteria 4563
602 Ga0495629_0026938 3300046459 Bacteria 4083
603 Ga0495629_0515712 3300046459 Bacteria 805
604 Ga0495629_0548413 3300046459 Bacteria 776
605 Ga0495638_0006104 3300046460 Bacteria 8820
606 Ga0495638_0100621 3300046460 Bacteria 1729
607 Ga0495638_0280710 3300046460 Bacteria 905
608 Ga0495653_0099895 3300046463 Bacteria 2104
609 Ga0495580_0479193 3300046472 Bacteria 832
610 Ga0495582_0049455 3300046473 Bacteria 2315
611 Ga0495582_0332348 3300046473 Bacteria 875
612 Ga0495582_0346806 3300046473 Bacteria 855
613 Ga0495605_0000081 3300046474 Bacteria 125302
614 Ga0495605_0000087 3300046474 Bacteria 120256
615 Ga0495605_0014951 3300046474 Bacteria 4232
616 Ga0495605_0054408 3300046474 Bacteria 1938
617 Ga0495605_0054970 3300046474 Bacteria 1925
618 Ga0495605_0096507 3300046474 Bacteria 1363
619 Ga0495639_0119233 3300046475 Bacteria 1258
620 Ga0495664_0135482 3300046477 Bacteria 1492
621 Ga0495664_0470154 3300046477 Bacteria 752
622 Ga0495584_0003309 3300046491 Bacteria 8932
623 Ga0495584_0006863 3300046491 Bacteria 5951
624 Ga0495584_0011832 3300046491 Bacteria 4461
625 Ga0495584_0029616 3300046491 Bacteria 2775
626 Ga0495584_0136281 3300046491 Bacteria 1246
627 Ga0495584_0310848 3300046491 Bacteria 800
628 Ga0495585_0000863 3300046492 Bacteria 25902
629 Ga0495585_0008523 3300046492 Bacteria 6211
630 Ga0495585_0034137 3300046492 Bacteria 2876
631 Ga0495585_0066082 3300046492 Bacteria 1980
632 Ga0495585_0069942 3300046492 Bacteria 1915
633 Ga0495594_0000705 3300046499 Bacteria 17186
634 Ga0495594_0125810 3300046499 Bacteria 1450
635 Ga0495594_0176021 3300046499 Bacteria 1217
636 Ga0495594_0191108 3300046499 Bacteria 1166
637 Ga0495596_0001008 3300046500 Bacteria 16758
638 Ga0495596_0029285 3300046500 Bacteria 2208
639 Ga0495596_0044436 3300046500 Bacteria 1748
640 Ga0495596_0048861 3300046500 Bacteria 1659
641 Ga0495596_0061065 3300046500 Bacteria 1468
642 Ga0495596_0102603 3300046500 Bacteria 1111
643 Ga0495607_0015258 3300046501 Bacteria 4981
644 Ga0495607_0063518 3300046501 Bacteria 2088
645 Ga0495583_0000193 3300046506 Bacteria 101909
646 Ga0495583_0000430 3300046506 Bacteria 63194
647 Ga0495583_0025803 3300046506 Bacteria 2929
648 Ga0495583_0049210 3300046506 Bacteria 1931
649 Ga0495583_0053809 3300046506 Bacteria 1825
650 Ga0495583_0066555 3300046506 Bacteria 1593
651 Ga0495583_0079437 3300046506 Bacteria 1427
652 Ga0495583_0109368 3300046506 Bacteria 1172
653 Ga0495583_0149583 3300046506 Bacteria 968
654 Ga0495583_0209902 3300046506 Bacteria 789
655 Ga0495606_0000007 3300046507 Bacteria 323713
656 Ga0495606_0006338 3300046507 Bacteria 10944
657 Ga0495606_0168583 3300046507 Bacteria 1272
658 Ga0495610_0295824 3300046512 Bacteria 626
659 Ga0495616_0003775 3300046513 Bacteria 9662
660 Ga0495616_0006247 3300046513 Bacteria 7238
661 Ga0495616_0011606 3300046513 Bacteria 5040
662 Ga0495616_0026665 3300046513 Bacteria 3072
663 Ga0495616_0057859 3300046513 Bacteria 1910
664 Ga0495616_0078089 3300046513 Bacteria 1588
665 Ga0495616_0146406 3300046513 Bacteria 1071
666 Ga0495630_0408456 3300046517 Bacteria 1040
667 Ga0495631_0001768 3300046518 Bacteria 12802
668 Ga0495631_0047270 3300046518 Bacteria 1890
669 Ga0495631_0058851 3300046518 Bacteria 1670
670 Ga0495631_0078768 3300046518 Bacteria 1422
671 Ga0495631_0080287 3300046518 Bacteria 1407
672 Ga0495631_0091013 3300046518 Bacteria 1313
673 Ga0495631_0233025 3300046518 Bacteria 785
674 Ga0495632_0000114 3300046519 Bacteria 82098
675 Ga0495643_0026010 3300046522 Bacteria 3307
676 Ga0495643_0122658 3300046522 Bacteria 1311
677 Ga0495643_0162344 3300046522 Bacteria 1098
678 Ga0495644_0024432 3300046523 Bacteria 2298
679 Ga0495644_0174579 3300046523 Bacteria 825
680 Ga0495644_0199043 3300046523 Bacteria 772
681 Ga0495648_0003099 3300046524 Bacteria 14837
682 Ga0495648_0018117 3300046524 Bacteria 5005
683 Ga0495648_0104611 3300046524 Bacteria 1554
684 Ga0495663_0017699 3300046525 Bacteria 2025
685 Ga0495663_0026350 3300046525 Bacteria 1701
686 Ga0495666_0024048 3300046526 Bacteria 3012
687 Ga0495666_0051039 3300046526 Bacteria 1987
688 Ga0495666_0104105 3300046526 Bacteria 1336
689 Ga0495666_0216858 3300046526 Bacteria 877
690 Ga0495642_0000813 3300046528 Bacteria 15134
691 Ga0495642_0002336 3300046528 Bacteria 7736
692 Ga0495642_0063087 3300046528 Bacteria 1539
693 Ga0495642_0086695 3300046528 Bacteria 1322
694 Ga0495642_0092047 3300046528 Bacteria 1284
695 Ga0495642_0117604 3300046528 Bacteria 1139
696 Ga0495642_0119825 3300046528 Bacteria 1129
697 Ga0495642_0142181 3300046528 Bacteria 1036
698 Ga0495642_0146022 3300046528 Bacteria 1022
699 Ga0495642_0243901 3300046528 Bacteria 785
700 Ga0495654_0009914 3300046530 Bacteria 5207
701 Ga0495654_0027808 3300046530 Bacteria 2894
702 Ga0495654_0065381 3300046530 Bacteria 1736
703 Ga0495665_0024195 3300046531 Bacteria 3262
704 Ga0495665_0025475 3300046531 Bacteria 3177
705 Ga0495586_0130831 3300046535 Bacteria 1405
706 Ga0495587_0024560 3300046536 Bacteria 3691
707 Ga0495587_0092009 3300046536 Bacteria 1751
708 Ga0495609_0000096 3300046538 Bacteria 104135
709 Ga0495609_0005065 3300046538 Bacteria 7029
710 Ga0495609_0012026 3300046538 Bacteria 4108
711 Ga0495609_0063112 3300046538 Bacteria 1635
712 Ga0495609_0065576 3300046538 Bacteria 1600
713 Ga0495609_0074786 3300046538 Bacteria 1485
714 Ga0495609_0108656 3300046538 Bacteria 1198
715 Ga0495621_0186868 3300046539 Bacteria 829
716 Ga0495597_0000587 3300046542 Bacteria 30136
717 Ga0495597_0001219 3300046542 Bacteria 19132
718 Ga0495597_0002540 3300046542 Bacteria 11448
719 Ga0495597_0004426 3300046542 Bacteria 7720
720 Ga0495597_0039253 3300046542 Bacteria 2120
721 Ga0495597_0089115 3300046542 Bacteria 1311
722 Ga0495597_0090044 3300046542 Bacteria 1303
723 Ga0495645_0047563 3300046543 Bacteria 3125
724 Ga0495622_0005476 3300046557 Bacteria 5888
725 Ga0495622_0051667 3300046557 Bacteria 1906
726 Ga0495622_0108102 3300046557 Bacteria 1274
727 Ga0495622_0111001 3300046557 Bacteria 1255
728 Ga0495622_0229086 3300046557 Bacteria 821
729 Ga0495633_0062569 3300046558 Bacteria 1742
730 Ga0495633_0070876 3300046558 Bacteria 1626
731 Ga0495633_0123615 3300046558 Bacteria 1198
732 Ga0495633_0180395 3300046558 Bacteria 972
733 Ga0495633_0213343 3300046558 Bacteria 884
734 Ga0495667_0034780 3300046559 Bacteria 3369
735 Ga0495667_0314618 3300046559 Bacteria 991
736 Ga0495656_0064993 3300046615 Bacteria 1603
737 Ga0495656_0070245 3300046615 Bacteria 1553
738 Ga0495656_0107791 3300046615 Bacteria 1298
739 Ga0495656_0144600 3300046615 Bacteria 1143
740 Ga0495656_0493761 3300046615 Bacteria 649
741 Ga0495668_0002567 3300046616 Bacteria 14753
742 Ga0495668_0011047 3300046616 Bacteria 5429
743 Ga0495668_0013816 3300046616 Bacteria 4749
744 Ga0495668_0065700 3300046616 Bacteria 1996
745 Ga0495668_0126435 3300046616 Bacteria 1399
746 Ga0495668_0321688 3300046616 Bacteria 848
747 Ga0495634_0029421 3300046642 Bacteria 3803
748 Ga0495634_0228698 3300046642 Bacteria 1145
749 Ga0495611_0080114 3300046648 Bacteria 1500
750 Ga0495625_0002044 3300046660 Bacteria 22688
751 Ga0495625_0004537 3300046660 Bacteria 13086
752 Ga0495625_0032111 3300046660 Bacteria 3898
753 Ga0495625_0050417 3300046660 Bacteria 2987
754 Ga0495625_0053275 3300046660 Bacteria 2895
755 Ga0495625_0140040 3300046660 Bacteria 1632
756 Ga0495625_0189381 3300046660 Bacteria 1364
757 Ga0495625_0251042 3300046660 Bacteria 1148
758 Ga0495625_0254657 3300046660 Bacteria 1138
759 Ga0495661_0000164 3300046665 Bacteria 78742
760 Ga0495661_0014211 3300046665 Bacteria 5334
761 Ga0495661_0073293 3300046665 Bacteria 1995
762 Ga0495661_0104944 3300046665 Bacteria 1583
763 Ga0495661_0115739 3300046665 Bacteria 1488
764 Ga0495661_0184710 3300046665 Bacteria 1102
765 Ga0495661_0209534 3300046665 Bacteria 1015
766 Ga0495588_0083822 3300046674 Bacteria 1665
767 Ga0495588_0097659 3300046674 Bacteria 1541
768 Ga0495588_0129583 3300046674 Bacteria 1330
769 Ga0495588_0238769 3300046674 Bacteria 958
770 Ga0495588_0240112 3300046674 Bacteria 956
771 Ga0495588_0271647 3300046674 Bacteria 893
772 Ga0495588_0333912 3300046674 Bacteria 797
773 Ga0495623_0016009 3300046679 Bacteria 4846
774 Ga0495623_0142294 3300046679 Bacteria 1425
775 Ga0495623_0152455 3300046679 Bacteria 1365
776 Ga0495647_0016669 3300046681 Bacteria 2590
777 Ga0495647_0196924 3300046681 Bacteria 882
778 Ga0495647_0341001 3300046681 Bacteria 681
779 Ga0495658_0062960 3300046683 Bacteria 2133
780 Ga0495658_0274740 3300046683 Bacteria 1062
781 Ga0495669_0087744 3300046684 Bacteria 1434
782 Ga0495669_0375936 3300046684 Bacteria 687
783 Ga0495613_0138776 3300046689 Bacteria 1738
784 Ga0495613_0199300 3300046689 Bacteria 1412
785 Ga0495613_0516790 3300046689 Bacteria 802
786 Ga0495624_0045126 3300046690 Bacteria 2807
787 Ga0495670_0000604 3300046691 Bacteria 17142
788 Ga0495670_0048641 3300046691 Bacteria 2121
789 Ga0495670_0053624 3300046691 Bacteria 2019
790 Ga0495670_0182906 3300046691 Bacteria 1107
791 Ga0495670_0191468 3300046691 Bacteria 1081
792 Ga0495670_0268326 3300046691 Bacteria 911
793 Ga0495671_0000132 3300046692 Bacteria 67269
794 Ga0495671_0060264 3300046692 Bacteria 1874
795 Ga0495671_0064536 3300046692 Bacteria 1802
796 Ga0495671_0069041 3300046692 Bacteria 1737
797 Ga0495671_0079020 3300046692 Bacteria 1612
798 Ga0495671_0206591 3300046692 Bacteria 952
799 Ga0495649_0073170 3300046694 Bacteria 1836
800 Ga0495649_0098126 3300046694 Bacteria 1558
801 Ga0495649_0172010 3300046694 Bacteria 1133
802 Ga0495589_0000036 3300046794 Bacteria 153299
803 Ga0495589_0000092 3300046794 Bacteria 85372
804 Ga0495589_0001941 3300046794 Bacteria 11711
805 Ga0495589_0047793 3300046794 Bacteria 2119
806 Ga0495589_0083531 3300046794 Bacteria 1552
807 Ga0495600_0026732 3300046809 Bacteria 3726
808 Ga0495600_0550314 3300046809 Bacteria 705
809 Ga0495660_0000117 3300046810 Bacteria 85237
810 Ga0495660_0017138 3300046810 Bacteria 4172
811 Ga0495660_0020826 3300046810 Bacteria 3759
812 Ga0495660_0045575 3300046810 Bacteria 2406
813 Ga0495660_0079012 3300046810 Bacteria 1728
814 Ga0495660_0098586 3300046810 Bacteria 1507
815 Ga0495581_0024612 3300047315 Bacteria 3489
816 Ga0495581_0572309 3300047315 Bacteria 655
817 Ga0495604_0045073 3300047317 Bacteria 3442
818 Ga0495636_0015815 3300047318 Bacteria 3008
819 Ga0495674_0003022 3300047319 Bacteria 16376
820 Ga0495674_0585921 3300047319 Bacteria 885
821 Ga0495672_0000014 3300047320 Bacteria 505636
822 Ga0495672_0002183 3300047320 Bacteria 18230
823 Ga0495672_0003253 3300047320 Bacteria 14086
824 Ga0495676_0007223 3300047321 Bacteria 10188
825 Ga0495676_0009421 3300047321 Bacteria 8894
826 Ga0495676_0070247 3300047321 Bacteria 2698
827 Ga0495676_0242968 3300047321 Bacteria 1232
828 Ga0495683_0000576 3300047323 Bacteria 27760
829 Ga0495683_0007830 3300047323 Bacteria 5732
830 Ga0495683_0019300 3300047323 Bacteria 3519
831 Ga0495683_0058853 3300047323 Bacteria 1907
832 Ga0495687_000074 3300047443 Bacteria 153464
833 Ga0495687_000154 3300047443 Bacteria 104740
834 Ga0495687_002852 3300047443 Bacteria 13266
835 Ga0495687_003354 3300047443 Bacteria 11695
836 Ga0495687_167915 3300047443 Bacteria 730
837 Ga0495675_0065424 3300047444 Bacteria 2299
838 Ga0495675_0133443 3300047444 Bacteria 1542
839 Ga0495677_0000037 3300047445 Bacteria 78595
840 Ga0495677_0033630 3300047445 Bacteria 1868
841 Ga0495677_0105433 3300047445 Bacteria 1069
842 Ga0495679_038807 3300047446 Bacteria 1489
843 Ga0495685_016157 3300047447 Bacteria 2549
844 Ga0495685_039220 3300047447 Bacteria 1621
845 Ga0495681_0006668 3300047470 Bacteria 7539
846 Ga0495681_0017803 3300047470 Bacteria 3933
847 Ga0495681_0061861 3300047470 Bacteria 1723
848 Ga0495686_0001832 3300047472 Bacteria 21386
849 Ga0495686_0002933 3300047472 Bacteria 15278
850 Ga0495686_0050546 3300047472 Bacteria 2612
851 Ga0495686_0109922 3300047472 Bacteria 1654
852 Ga0495686_0178256 3300047472 Bacteria 1232
853 Ga0495593_0056294 3300047673 Bacteria 2067
854 Ga0495602_0033019 3300048088 Bacteria 4863
855 Ga0495602_0170594 3300048088 Bacteria 1689
856 Ga0495615_0027467 3300048090 Bacteria 1336
857 Ga0495626_0000006 3300048091 Bacteria 284977
858 Ga0495626_0004153 3300048091 Bacteria 8994
859 Ga0495626_0044821 3300048091 Bacteria 2067
860 Ga0495626_0069047 3300048091 Bacteria 1592
861 Ga0495626_0147140 3300048091 Bacteria 995
862 Ga0496100_0032816 3300048903 Bacteria 3242
863 Ga0496100_0074915 3300048903 Bacteria 2268
864 Ga0496102_0021103 3300048905 Bacteria 5760
865 Ga0496102_0068969 3300048905 Bacteria 3245
866 Ga0496102_0416302 3300048905 Bacteria 1262
867 Ga0496103_0004341 3300048906 Bacteria 8609
868 Ga0496104_0296569 3300048907 Bacteria 1529
869 Ga0496104_1013963 3300048907 Bacteria 734
870 Ga0496105_0182079 3300048908 Bacteria 1720
871 Ga0496105_0555668 3300048908 Bacteria 895
872 Ga0496106_0004593 3300048909 Bacteria 10241
873 Ga0496107_0608226 3300048910 Bacteria 807
874 Ga0496108_0018843 3300048911 Bacteria 5659
875 Ga0496108_0070054 3300048911 Bacteria 2959
876 Ga0496108_0275744 3300048911 Bacteria 1464
877 Ga0496108_0675345 3300048911 Bacteria 897
878 Ga0496108_0800146 3300048911 Bacteria 813
879 Ga0496108_0858628 3300048911 Bacteria 781
880 Ga0496109_0008838 3300048912 Bacteria 8578
881 Ga0496109_0220311 3300048912 Bacteria 1784
882 Ga0496109_0255942 3300048912 Bacteria 1649
883 Ga0496109_0320416 3300048912 Bacteria 1463
884 Ga0496109_0787890 3300048912 Bacteria 889
885 Ga0496110_0004486 3300048913 Bacteria 10825
886 Ga0496110_0181810 3300048913 Bacteria 1909
887 Ga0496110_0194522 3300048913 Bacteria 1841
888 Ga0496110_0570245 3300048913 Bacteria 1028
889 Ga0496110_0673692 3300048913 Bacteria 935
890 Ga0496111_0130263 3300048914 Bacteria 1861
891 Ga0496111_0212296 3300048914 Bacteria 1438
892 Ga0496111_0273343 3300048914 Bacteria 1253
893 Ga0496112_0191825 3300048915 Bacteria 2005
894 Ga0496112_0268957 3300048915 Bacteria 1653
895 Ga0496113_0087315 3300048916 Bacteria 2398
896 Ga0496113_0158354 3300048916 Bacteria 1789
897 Ga0496113_0478026 3300048916 Bacteria 1001
898 Ga0496114_0669293 3300048917 Bacteria 912
899 Ga0496115_0107553 3300048918 Bacteria 2290
900 Ga0496115_0166792 3300048918 Bacteria 1821
901 Ga0496115_0246375 3300048918 Bacteria 1472
902 Ga0496122_0001315 3300048925 Bacteria 40732
903 Ga0496123_0000851 3300048926 Bacteria 48703
904 Ga0496124_0183530 3300048927 Bacteria 1608
905 Ga0496125_0002377 3300048928 Bacteria 24572
906 Ga0501304_008260 3300049160 Bacteria 874
907 Ga0495678_002660 3300049459 Bacteria 11833
908 Ga0495678_003327 3300049459 Bacteria 10017
909 Ga0495678_003585 3300049459 Bacteria 9486
910 Ga0495682_0000726 3300049460 Bacteria 21381
911 Ga0501198_000038 3300049649 Bacteria 51689
912 Ga0501222_000037 3300049662 Bacteria 51656
913 Ga0501035_0512448 3300049822 Bacteria 986
914 nmdc:mga03683_49370_c1 3300050489 Bacteria 1751
915 nmdc:mga0yw44_380671_c1 3300050492 Bacteria 953
916 nmdc:mga0yw44_399878_c1 3300050492 Bacteria 929
917 nmdc:mga0k408_97396_c1 3300050493 Bacteria 1732
918 nmdc:mga07m45_115522_c1 3300050496 Bacteria 1548
919 nmdc:mga08y16_1054124_c1 3300050511 Bacteria 790
920 nmdc:mga08x19_167622_c1 3300050514 Bacteria 1494
921 Ga0495619_0062013 3300053085 Bacteria 2489
922 Ga0495619_0281616 3300053085 Bacteria 1152
923 Ga0500559_0033920 3300053136 Bacteria 2199
924 Ga0500564_120160 3300053138 Bacteria 1146

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046513 Ga0495616_0146406 Ga0495616_0146406_580_1053 156
2 3300046660 Ga0495625_0189381 Ga0495625_0189381_377_868 161
3 3300037853 Ga0436364_0571710 Ga0436364_0571710_3708_4241 175
4 3300049649 Ga0501198_000038 Ga0501198_000038_19436_19972 175
5 3300049662 Ga0501222_000037 Ga0501222_000037_19397_19933 175
6 3300046525 Ga0495663_0017699 Ga0495663_0017699_13_552 176
7 3300046525 Ga0495663_0026350 Ga0495663_0026350_658_1263 176
8 3300047447 Ga0495685_039220 Ga0495685_039220_251_856 176
9 3300048088 Ga0495602_0170594 Ga0495602_0170594_726_1313 176
10 3300044842 Ga0466957_0463066 Ga0466957_0463066_308_859 177
11 3300037466 Ga0395898_0020437 Ga0395898_0020437_1622_2224 179
12 3300037471 Ga0395905_1185220 Ga0395905_1185220_108_650 179
13 3300046506 Ga0495583_0149583 Ga0495583_0149583_57_644 179
14 3300047443 Ga0495687_167915 Ga0495687_167915_64_651 179
15 3300048916 Ga0496113_0478026 Ga0496113_0478026_136_681 179
16 3300031649 Ga0307514_10065597 Ga0307514_100655972 180
17 3300046506 Ga0495583_0000430 Ga0495583_0000430_8555_9142 180
18 3300046558 Ga0495633_0213343 Ga0495633_0213343_113_700 180
19 3300046691 Ga0495670_0000604 Ga0495670_0000604_4539_5126 180
20 3300006178 Ga0075367_10029910 Ga0075367_100299104 181
21 3300013306 Ga0163162_10322226 Ga0163162_103222262 181
22 3300028794 Ga0307515_10000221 Ga0307515_1000022154 181
23 3300028794 Ga0307515_10000777 Ga0307515_1000077729 181
24 3300028794 Ga0307515_10018037 Ga0307515_100180372 181
25 3300030522 Ga0307512_10017030 Ga0307512_100170304 181
26 3300031548 Ga0307408_100477666 Ga0307408_1004776662 181
27 3300031730 Ga0307516_10004531 Ga0307516_100045317 181
28 3300041452 Ga0451793_1915431 Ga0451793_1915431_333_926 181
29 3300041453 Ga0451797_0142736 Ga0451797_0142736_276_869 181
30 3300041460 Ga0451802_0933167 Ga0451802_0933167_302_895 181
31 3300041496 Ga0451839_0874313 Ga0451839_0874313_470_1063 181
32 3300041498 Ga0451841_0821959 Ga0451841_0821959_12_605 181
33 3300046452 Ga0495617_000002 Ga0495617_000002_185530_186120 181
34 3300046453 Ga0495627_000176 Ga0495627_000176_533_1123 181
35 3300046458 Ga0495591_061640 Ga0495591_061640_197_787 181
36 3300046474 Ga0495605_0000081 Ga0495605_0000081_119207_119797 181
37 3300046474 Ga0495605_0096507 Ga0495605_0096507_684_1274 181
38 3300046491 Ga0495584_0003309 Ga0495584_0003309_3959_4546 181
39 3300046492 Ga0495585_0034137 Ga0495585_0034137_1860_2450 181
40 3300046492 Ga0495585_0066082 Ga0495585_0066082_822_1409 181
41 3300046500 Ga0495596_0029285 Ga0495596_0029285_1068_1658 181
42 3300046500 Ga0495596_0044436 Ga0495596_0044436_332_919 181
43 3300046501 Ga0495607_0063518 Ga0495607_0063518_653_1243 181
44 3300046506 Ga0495583_0053809 Ga0495583_0053809_881_1471 181
45 3300046513 Ga0495616_0026665 Ga0495616_0026665_105_695 181
46 3300046513 Ga0495616_0078089 Ga0495616_0078089_805_1392 181
47 3300046518 Ga0495631_0058851 Ga0495631_0058851_688_1278 181
48 3300046518 Ga0495631_0078768 Ga0495631_0078768_105_695 181
49 3300046522 Ga0495643_0162344 Ga0495643_0162344_382_972 181
50 3300046523 Ga0495644_0024432 Ga0495644_0024432_1068_1658 181
51 3300046524 Ga0495648_0003099 Ga0495648_0003099_678_1268 181
52 3300046524 Ga0495648_0018117 Ga0495648_0018117_113_703 181
53 3300046528 Ga0495642_0000813 Ga0495642_0000813_13892_14482 181
54 3300046528 Ga0495642_0086695 Ga0495642_0086695_176_766 181
55 3300046530 Ga0495654_0009914 Ga0495654_0009914_849_1439 181
56 3300046536 Ga0495587_0092009 Ga0495587_0092009_841_1428 181
57 3300046538 Ga0495609_0005065 Ga0495609_0005065_392_982 181
58 3300046538 Ga0495609_0065576 Ga0495609_0065576_43_633 181
59 3300046538 Ga0495609_0074786 Ga0495609_0074786_149_736 181
60 3300046558 Ga0495633_0123615 Ga0495633_0123615_268_858 181
61 3300046615 Ga0495656_0070245 Ga0495656_0070245_577_1167 181
62 3300046616 Ga0495668_0002567 Ga0495668_0002567_13578_14168 181
63 3300046660 Ga0495625_0002044 Ga0495625_0002044_3574_4167 181
64 3300046660 Ga0495625_0053275 Ga0495625_0053275_1239_1829 181
65 3300046660 Ga0495625_0140040 Ga0495625_0140040_740_1330 181
66 3300046665 Ga0495661_0104944 Ga0495661_0104944_394_984 181
67 3300046691 Ga0495670_0268326 Ga0495670_0268326_300_890 181
68 3300046692 Ga0495671_0000132 Ga0495671_0000132_66152_66742 181
69 3300046794 Ga0495589_0047793 Ga0495589_0047793_653_1243 181
70 3300046810 Ga0495660_0098586 Ga0495660_0098586_369_959 181
71 3300047323 Ga0495683_0000576 Ga0495683_0000576_22547_23134 181
72 3300047443 Ga0495687_000154 Ga0495687_000154_83051_83641 181
73 3300047445 Ga0495677_0033630 Ga0495677_0033630_728_1318 181
74 3300047472 Ga0495686_0050546 Ga0495686_0050546_1589_2182 181
75 3300047472 Ga0495686_0109922 Ga0495686_0109922_259_849 181
76 3300048905 Ga0496102_0068969 Ga0496102_0068969_26_613 181
77 3300048906 Ga0496103_0004341 Ga0496103_0004341_141_731 181
78 3300050496 nmdc:mga07m45_115522_c1 nmdc:mga07m45_115522_c1_781_1374 181
79 3300050514 nmdc:mga08x19_167622_c1 nmdc:mga08x19_167622_c1_929_1480 181
80 3300005328 Ga0070676_10402641 Ga0070676_104026412 182
81 3300005331 Ga0070670_100070545 Ga0070670_1000705452 182
82 3300005333 Ga0070677_10067798 Ga0070677_100677982 182
83 3300005335 Ga0070666_10006509 Ga0070666_100065096 182
84 3300005338 Ga0068868_100672776 Ga0068868_1006727762 182
85 3300005340 Ga0070689_100036157 Ga0070689_1000361573 182
86 3300005343 Ga0070687_100049285 Ga0070687_1000492852 182
87 3300005347 Ga0070668_100769150 Ga0070668_1007691502 182
88 3300005353 Ga0070669_100256692 Ga0070669_1002566921 182
89 3300005354 Ga0070675_100003213 Ga0070675_10000321314 182
90 3300005354 Ga0070675_100156052 Ga0070675_1001560522 182
91 3300005356 Ga0070674_100136079 Ga0070674_1001360792 182
92 3300005364 Ga0070673_100012933 Ga0070673_1000129336 182
93 3300005364 Ga0070673_100014182 Ga0070673_1000141823 182
94 3300005365 Ga0070688_100156585 Ga0070688_1001565852 182
95 3300005367 Ga0070667_100017232 Ga0070667_1000172324 182
96 3300005367 Ga0070667_100227038 Ga0070667_1002270382 182
97 3300005441 Ga0070700_100605743 Ga0070700_1006057432 182
98 3300005456 Ga0070678_100000202 Ga0070678_10000020218 182
99 3300005456 Ga0070678_100183127 Ga0070678_1001831272 182
100 3300005457 Ga0070662_100795813 Ga0070662_1007958131 182
101 3300005459 Ga0068867_100280827 Ga0068867_1002808272 182
102 3300005543 Ga0070672_100077866 Ga0070672_1000778662 182
103 3300005543 Ga0070672_100456136 Ga0070672_1004561362 182
104 3300005564 Ga0070664_100227913 Ga0070664_1002279132 182
105 3300005578 Ga0068854_100099736 Ga0068854_1000997363 182
106 3300005616 Ga0068852_100688516 Ga0068852_1006885162 182
107 3300005617 Ga0068859_100156913 Ga0068859_1001569132 182
108 3300005618 Ga0068864_100000365 Ga0068864_10000036531 182
109 3300005834 Ga0068851_10122315 Ga0068851_101223152 182
110 3300005840 Ga0068870_10190663 Ga0068870_101906632 182
111 3300005841 Ga0068863_100063605 Ga0068863_1000636052 182
112 3300005842 Ga0068858_100001818 Ga0068858_10000181824 182
113 3300005843 Ga0068860_100093086 Ga0068860_1000930862 182
114 3300006237 Ga0097621_100405989 Ga0097621_1004059892 182
115 3300006358 Ga0068871_100090430 Ga0068871_1000904302 182
116 3300006931 Ga0097620_100156918 Ga0097620_1001569182 182
117 3300009101 Ga0105247_10520875 Ga0105247_105208751 182
118 3300009177 Ga0105248_10020415 Ga0105248_100204154 182
119 3300009553 Ga0105249_10016583 Ga0105249_100165832 182
120 3300013297 Ga0157378_10185191 Ga0157378_101851912 182
121 3300013306 Ga0163162_10475759 Ga0163162_104757592 182
122 3300013308 Ga0157375_10137302 Ga0157375_101373021 182
123 3300014325 Ga0163163_10007645 Ga0163163_100076458 182
124 3300014326 Ga0157380_10371249 Ga0157380_103712491 182
125 3300014968 Ga0157379_10047857 Ga0157379_100478572 182
126 3300017792 Ga0163161_10365361 Ga0163161_103653611 182
127 3300025271 Ga0207666_1009379 Ga0207666_10093792 182
128 3300025321 Ga0207656_10200423 Ga0207656_102004231 182
129 3300025903 Ga0207680_10019580 Ga0207680_100195803 182
130 3300025907 Ga0207645_10039259 Ga0207645_100392592 182
131 3300025908 Ga0207643_10308284 Ga0207643_103082842 182
132 3300025918 Ga0207662_10186112 Ga0207662_101861122 182
133 3300025920 Ga0207649_10216079 Ga0207649_102160792 182
134 3300025926 Ga0207659_10003336 Ga0207659_100033369 182
135 3300025926 Ga0207659_10580292 Ga0207659_105802922 182
136 3300025931 Ga0207644_10002949 Ga0207644_1000294911 182
137 3300025933 Ga0207706_10762093 Ga0207706_107620932 182
138 3300025933 Ga0207706_11098358 Ga0207706_110983581 182
139 3300025934 Ga0207686_10075378 Ga0207686_100753782 182
140 3300025940 Ga0207691_10519804 Ga0207691_105198042 182
141 3300025942 Ga0207689_10069792 Ga0207689_100697922 182
142 3300025945 Ga0207679_10200857 Ga0207679_102008572 182
143 3300025960 Ga0207651_10475087 Ga0207651_104750872 182
144 3300025972 Ga0207668_10473502 Ga0207668_104735022 182
145 3300025986 Ga0207658_10023668 Ga0207658_100236683 182
146 3300025986 Ga0207658_10435704 Ga0207658_104357042 182
147 3300026023 Ga0207677_10000452 Ga0207677_1000045214 182
148 3300026035 Ga0207703_10003262 Ga0207703_100032622 182
149 3300026089 Ga0207648_10402916 Ga0207648_104029162 182
150 3300026095 Ga0207676_10004605 Ga0207676_100046053 182
151 3300026121 Ga0207683_10001865 Ga0207683_1000186511 182
152 3300026121 Ga0207683_10028889 Ga0207683_100288892 182
153 3300026142 Ga0207698_10680206 Ga0207698_106802062 182
154 3300028381 Ga0268264_10052499 Ga0268264_100524992 182
155 3300046681 Ga0495647_0341001 Ga0495647_0341001_68_661 182
156 3300046691 Ga0495670_0182906 Ga0495670_0182906_338_931 182
157 3300048911 Ga0496108_0018843 Ga0496108_0018843_4747_5340 182
158 3300009174 Ga0105241_10560425 Ga0105241_105604251 183
159 3300031456 Ga0307513_10023763 Ga0307513_100237635 183
160 3300031616 Ga0307508_10000141 Ga0307508_1000014131 183
161 3300048091 Ga0495626_0044821 Ga0495626_0044821_1431_2021 183
162 3300009174 Ga0105241_10369203 Ga0105241_103692032 184
163 3300046531 Ga0495665_0024195 Ga0495665_0024195_2556_3143 184
164 3300046692 Ga0495671_0069041 Ga0495671_0069041_90_683 184
165 3300048917 Ga0496114_0669293 Ga0496114_0669293_166_756 184
166 3300005329 Ga0070683_100568363 Ga0070683_1005683632 185
167 3300005331 Ga0070670_100525976 Ga0070670_1005259762 185
168 3300005337 Ga0070682_100543651 Ga0070682_1005436511 185
169 3300005344 Ga0070661_100036668 Ga0070661_1000366683 185
170 3300005347 Ga0070668_100319559 Ga0070668_1003195592 185
171 3300005353 Ga0070669_100116846 Ga0070669_1001168463 185
172 3300005354 Ga0070675_100009897 Ga0070675_1000098976 185
173 3300005355 Ga0070671_100118865 Ga0070671_1001188652 185
174 3300005356 Ga0070674_100019990 Ga0070674_1000199901 185
175 3300005364 Ga0070673_100107138 Ga0070673_1001071382 185
176 3300005366 Ga0070659_100039683 Ga0070659_1000396833 185
177 3300005455 Ga0070663_100141142 Ga0070663_1001411422 185
178 3300005456 Ga0070678_100026125 Ga0070678_1000261252 185
179 3300005456 Ga0070678_100144714 Ga0070678_1001447142 185
180 3300005457 Ga0070662_100001238 Ga0070662_1000012389 185
181 3300005459 Ga0068867_100324007 Ga0068867_1003240071 185
182 3300005535 Ga0070684_100448397 Ga0070684_1004483972 185
183 3300005539 Ga0068853_100183825 Ga0068853_1001838251 185
184 3300005543 Ga0070672_100023210 Ga0070672_1000232102 185
185 3300005548 Ga0070665_100220200 Ga0070665_1002202002 185
186 3300005564 Ga0070664_100297592 Ga0070664_1002975922 185
187 3300005564 Ga0070664_100581658 Ga0070664_1005816582 185
188 3300005578 Ga0068854_100185117 Ga0068854_1001851172 185
189 3300005614 Ga0068856_100165071 Ga0068856_1001650713 185
190 3300005615 Ga0070702_100201945 Ga0070702_1002019452 185
191 3300005616 Ga0068852_100009055 Ga0068852_1000090552 185
192 3300005617 Ga0068859_100753540 Ga0068859_1007535402 185
193 3300005618 Ga0068864_100031123 Ga0068864_1000311234 185
194 3300005618 Ga0068864_100283914 Ga0068864_1002839142 185
195 3300005719 Ga0068861_100416922 Ga0068861_1004169222 185
196 3300005834 Ga0068851_10005284 Ga0068851_100052843 185
197 3300005840 Ga0068870_10165149 Ga0068870_101651492 185
198 3300005841 Ga0068863_100114908 Ga0068863_1001149083 185
199 3300005841 Ga0068863_100236061 Ga0068863_1002360612 185
200 3300005842 Ga0068858_100015579 Ga0068858_1000155795 185
201 3300006237 Ga0097621_100364826 Ga0097621_1003648262 185
202 3300006358 Ga0068871_100261185 Ga0068871_1002611852 185
203 3300006358 Ga0068871_100295490 Ga0068871_1002954902 185
204 3300006931 Ga0097620_100753500 Ga0097620_1007535002 185
205 3300009093 Ga0105240_10160498 Ga0105240_101604982 185
206 3300009094 Ga0111539_11910411 Ga0111539_119104111 185
207 3300009098 Ga0105245_10175268 Ga0105245_101752682 185
208 3300009177 Ga0105248_10109194 Ga0105248_101091943 185
209 3300009545 Ga0105237_10221725 Ga0105237_102217252 185
210 3300009551 Ga0105238_10175558 Ga0105238_101755583 185
211 3300009553 Ga0105249_10213870 Ga0105249_102138701 185
212 3300010375 Ga0105239_10819287 Ga0105239_108192872 185
213 3300011119 Ga0105246_10717380 Ga0105246_107173801 185
214 3300013306 Ga0163162_10020480 Ga0163162_100204804 185
215 3300013307 Ga0157372_10078073 Ga0157372_100780731 185
216 3300013308 Ga0157375_11398527 Ga0157375_113985271 185
217 3300014326 Ga0157380_10023234 Ga0157380_100232343 185
218 3300014745 Ga0157377_10113708 Ga0157377_101137082 185
219 3300014968 Ga0157379_10154924 Ga0157379_101549243 185
220 3300014969 Ga0157376_10008913 Ga0157376_100089136 185
221 3300017792 Ga0163161_10027098 Ga0163161_100270983 185
222 3300017792 Ga0163161_10619960 Ga0163161_106199602 185
223 3300025321 Ga0207656_10072122 Ga0207656_100721222 185
224 3300025321 Ga0207656_10150588 Ga0207656_101505882 185
225 3300025893 Ga0207682_10007351 Ga0207682_100073512 185
226 3300025901 Ga0207688_10319948 Ga0207688_103199482 185
227 3300025907 Ga0207645_10025026 Ga0207645_100250262 185
228 3300025907 Ga0207645_10118016 Ga0207645_101180162 185
229 3300025913 Ga0207695_10142141 Ga0207695_101421412 185
230 3300025914 Ga0207671_10291669 Ga0207671_102916692 185
231 3300025923 Ga0207681_10032608 Ga0207681_100326082 185
232 3300025924 Ga0207694_10278913 Ga0207694_102789132 185
233 3300025925 Ga0207650_10187506 Ga0207650_101875062 185
234 3300025926 Ga0207659_10010543 Ga0207659_100105434 185
235 3300025927 Ga0207687_10236079 Ga0207687_102360792 185
236 3300025931 Ga0207644_10290172 Ga0207644_102901722 185
237 3300025933 Ga0207706_10001684 Ga0207706_100016843 185
238 3300025940 Ga0207691_10024676 Ga0207691_100246762 185
239 3300025941 Ga0207711_10469663 Ga0207711_104696632 185
240 3300025942 Ga0207689_10000716 Ga0207689_1000071620 185
241 3300025949 Ga0207667_10590591 Ga0207667_105905912 185
242 3300025960 Ga0207651_10109031 Ga0207651_101090312 185
243 3300025972 Ga0207668_10573537 Ga0207668_105735371 185
244 3300025981 Ga0207640_10090295 Ga0207640_100902952 185
245 3300026023 Ga0207677_10020176 Ga0207677_100201763 185
246 3300026023 Ga0207677_10950080 Ga0207677_109500801 185
247 3300026041 Ga0207639_10560087 Ga0207639_105600872 185
248 3300026067 Ga0207678_10008265 Ga0207678_100082653 185
249 3300026089 Ga0207648_10278432 Ga0207648_102784322 185
250 3300026095 Ga0207676_10111006 Ga0207676_101110063 185
251 3300026118 Ga0207675_100024123 Ga0207675_1000241234 185
252 3300026121 Ga0207683_10024876 Ga0207683_100248764 185
253 3300026121 Ga0207683_10355924 Ga0207683_103559242 185
254 3300026142 Ga0207698_10017502 Ga0207698_100175021 185
255 3300028379 Ga0268266_10270974 Ga0268266_102709742 185
256 3300028380 Ga0268265_10522666 Ga0268265_105226662 185
257 3300028794 Ga0307515_10000030 Ga0307515_1000003083 185
258 3300034957 Ga0373938_0040326 Ga0373938_0040326_120_710 185
259 3300035090 Ga0373949_0035444 Ga0373949_0035444_461_1051 185
260 3300035691 Ga0373931_0003594 Ga0373931_0003594_1074_1664 185
261 3300039437 Ga0436365_0482375 Ga0436365_0482375_23_613 185
262 3300046615 Ga0495656_0144600 Ga0495656_0144600_394_987 185
263 3300048090 Ga0495615_0027467 Ga0495615_0027467_484_1077 185
264 3300048903 Ga0496100_0032816 Ga0496100_0032816_2626_3216 185
265 3300048905 Ga0496102_0021103 Ga0496102_0021103_2867_3460 185
266 3300048905 Ga0496102_0416302 Ga0496102_0416302_185_775 185
267 3300048907 Ga0496104_0296569 Ga0496104_0296569_684_1274 185
268 3300048908 Ga0496105_0182079 Ga0496105_0182079_304_894 185
269 3300048909 Ga0496106_0004593 Ga0496106_0004593_557_1147 185
270 3300048910 Ga0496107_0608226 Ga0496107_0608226_189_779 185
271 3300048911 Ga0496108_0070054 Ga0496108_0070054_1729_2319 185
272 3300048912 Ga0496109_0220311 Ga0496109_0220311_582_1172 185
273 3300048913 Ga0496110_0181810 Ga0496110_0181810_937_1527 185
274 3300048914 Ga0496111_0212296 Ga0496111_0212296_465_1055 185
275 3300048915 Ga0496112_0191825 Ga0496112_0191825_1368_1958 185
276 3300048918 Ga0496115_0246375 Ga0496115_0246375_491_1081 185
277 3300005331 Ga0070670_100040437 Ga0070670_1000404374 186
278 3300005356 Ga0070674_100054491 Ga0070674_1000544913 186
279 3300005718 Ga0068866_10095036 Ga0068866_100950362 186
280 3300025899 Ga0207642_10130694 Ga0207642_101306942 186
281 3300025937 Ga0207669_10016052 Ga0207669_100160524 186
282 3300031548 Ga0307408_100345150 Ga0307408_1003451502 186
283 3300031731 Ga0307405_10166719 Ga0307405_101667192 186
284 3300031901 Ga0307406_10022936 Ga0307406_100229363 186
285 3300031903 Ga0307407_10120706 Ga0307407_101207062 186
286 3300031911 Ga0307412_10003513 Ga0307412_100035136 186
287 3300031995 Ga0307409_100025456 Ga0307409_1000254566 186
288 3300032002 Ga0307416_100309525 Ga0307416_1003095252 186
289 3300032004 Ga0307414_10364022 Ga0307414_103640222 186
290 3300032005 Ga0307411_10094900 Ga0307411_100949003 186
291 3300032126 Ga0307415_100551641 Ga0307415_1005516412 186
292 3300033180 Ga0307510_10448412 Ga0307510_104484121 186
293 3300044693 Ga0466961_0135700 Ga0466961_0135700_807_1409 186
294 3300046616 Ga0495668_0065700 Ga0495668_0065700_537_1124 186
295 3300047472 Ga0495686_0002933 Ga0495686_0002933_6717_7310 186
296 3300048916 Ga0496113_0087315 Ga0496113_0087315_1056_1646 186
297 3300005335 Ga0070666_10240260 Ga0070666_102402601 187
298 3300005353 Ga0070669_100343750 Ga0070669_1003437502 187
299 3300005459 Ga0068867_100000173 Ga0068867_1000001735 187
300 3300005543 Ga0070672_100367461 Ga0070672_1003674612 187
301 3300009148 Ga0105243_10003820 Ga0105243_100038208 187
302 3300013297 Ga0157378_10295745 Ga0157378_102957452 187
303 3300014745 Ga0157377_10000039 Ga0157377_10000039102 187
304 3300025926 Ga0207659_10462700 Ga0207659_104627002 187
305 3300025935 Ga0207709_10008906 Ga0207709_100089063 187
306 3300026089 Ga0207648_10000836 Ga0207648_100008365 187
307 3300031852 Ga0307410_10735064 Ga0307410_107350642 187
308 3300035691 Ga0373931_0262860 Ga0373931_0262860_199_792 187
309 3300041494 Ga0451837_1554540 Ga0451837_1554540_286_879 187
310 3300041509 Ga0451843_0875436 Ga0451843_0875436_325_918 187
311 iso_pu_bacteria 2842711865 2842711994 187
312 3300005539 Ga0068853_100674768 Ga0068853_1006747682 188
313 3300005616 Ga0068852_100339511 Ga0068852_1003395112 188
314 3300009093 Ga0105240_10002543 Ga0105240_100025434 188
315 3300009545 Ga0105237_10000518 Ga0105237_1000051826 188
316 3300009551 Ga0105238_10043782 Ga0105238_100437822 188
317 3300010375 Ga0105239_10000872 Ga0105239_1000087226 188
318 3300025321 Ga0207656_10117927 Ga0207656_101179272 188
319 3300025913 Ga0207695_10006571 Ga0207695_100065712 188
320 3300025914 Ga0207671_10003492 Ga0207671_100034924 188
321 3300025924 Ga0207694_10019086 Ga0207694_100190864 188
322 3300025939 Ga0207665_10058372 Ga0207665_100583723 188
323 3300026041 Ga0207639_10751365 Ga0207639_107513651 188
324 3300041512 Ga0451853_2839646 Ga0451853_2839646_163_759 188
325 3300044712 Ga0453684_0746774 Ga0453684_0746774_144_752 188
326 3300045051 Ga0451576_0553615 Ga0451576_0553615_320_928 188
327 3300045051 Ga0451576_1410206 Ga0451576_1410206_120_710 188
328 3300046474 Ga0495605_0014951 Ga0495605_0014951_3391_3981 188
329 3300046507 Ga0495606_0006338 Ga0495606_0006338_1085_1666 188
330 3300046665 Ga0495661_0073293 Ga0495661_0073293_575_1162 188
331 3300048903 Ga0496100_0074915 Ga0496100_0074915_1302_1889 188
332 3300048912 Ga0496109_0008838 Ga0496109_0008838_7331_7918 188
333 3300048915 Ga0496112_0268957 Ga0496112_0268957_230_817 188
334 3300048916 Ga0496113_0158354 Ga0496113_0158354_466_1053 188
335 3300048925 Ga0496122_0001315 Ga0496122_0001315_22251_22838 188
336 3300048926 Ga0496123_0000851 Ga0496123_0000851_22991_23578 188
337 3300048928 Ga0496125_0002377 Ga0496125_0002377_1557_2144 188
338 3300046528 Ga0495642_0092047 Ga0495642_0092047_615_1226 190
339 iso_pu_bacteria 2585428062 2587754357 190
340 iso_pu_bacteria 2643221556 2643797735 190
341 iso_pu_bacteria 2643221684 2644470483 190
342 iso_pu_bacteria 2643221554 2643788735 191
343 iso_pu_bacteria 2643221638 2644213242 191
344 3300005329 Ga0070683_100333818 Ga0070683_1003338182 193
345 3300005339 Ga0070660_100342381 Ga0070660_1003423811 193
346 3300005343 Ga0070687_100301400 Ga0070687_1003014001 193
347 3300005355 Ga0070671_100313838 Ga0070671_1003138382 193
348 3300005366 Ga0070659_100170292 Ga0070659_1001702922 193
349 3300005367 Ga0070667_100075666 Ga0070667_1000756663 193
350 3300005458 Ga0070681_10017210 Ga0070681_1001721011 193
351 3300005535 Ga0070684_100225458 Ga0070684_1002254582 193
352 3300005539 Ga0068853_100097511 Ga0068853_1000975113 193
353 3300005539 Ga0068853_100400553 Ga0068853_1004005532 193
354 3300005543 Ga0070672_100008996 Ga0070672_1000089966 193
355 3300005547 Ga0070693_100068866 Ga0070693_1000688663 193
356 3300005564 Ga0070664_100037616 Ga0070664_1000376163 193
357 3300005577 Ga0068857_100061915 Ga0068857_1000619152 193
358 3300005614 Ga0068856_100104352 Ga0068856_1001043523 193
359 3300005616 Ga0068852_100030071 Ga0068852_1000300713 193
360 3300005616 Ga0068852_100137341 Ga0068852_1001373413 193
361 3300005617 Ga0068859_100136533 Ga0068859_1001365333 193
362 3300005842 Ga0068858_100003838 Ga0068858_10000383812 193
363 3300005843 Ga0068860_100005517 Ga0068860_1000055173 193
364 3300005844 Ga0068862_100093115 Ga0068862_1000931152 193
365 3300006028 Ga0070717_10022058 Ga0070717_100220587 193
366 3300006931 Ga0097620_100136532 Ga0097620_1001365323 193
367 3300009551 Ga0105238_10396108 Ga0105238_103961082 193
368 3300013100 Ga0157373_10437504 Ga0157373_104375041 193
369 3300013102 Ga0157371_10057938 Ga0157371_100579383 193
370 3300013104 Ga0157370_10707126 Ga0157370_107071262 193
371 3300013105 Ga0157369_10032613 Ga0157369_100326136 193
372 3300013296 Ga0157374_10013203 Ga0157374_100132038 193
373 3300013307 Ga0157372_10293460 Ga0157372_102934603 193
374 3300013308 Ga0157375_10149452 Ga0157375_101494523 193
375 3300014326 Ga0157380_10015990 Ga0157380_100159902 193
376 3300025253 Ga0209677_100960 Ga0209677_1009606 193
377 3300025903 Ga0207680_10273463 Ga0207680_102734632 193
378 3300025909 Ga0207705_10333928 Ga0207705_103339282 193
379 3300025918 Ga0207662_10267713 Ga0207662_102677132 193
380 3300025919 Ga0207657_10333922 Ga0207657_103339221 193
381 3300025931 Ga0207644_10437444 Ga0207644_104374442 193
382 3300025932 Ga0207690_10122483 Ga0207690_101224832 193
383 3300025940 Ga0207691_10127924 Ga0207691_101279242 193
384 3300025944 Ga0207661_10026334 Ga0207661_100263343 193
385 3300025949 Ga0207667_10193259 Ga0207667_101932592 193
386 3300025981 Ga0207640_10148017 Ga0207640_101480172 193
387 3300025986 Ga0207658_10736009 Ga0207658_107360092 193
388 3300026035 Ga0207703_10003257 Ga0207703_100032573 193
389 3300026041 Ga0207639_10103265 Ga0207639_101032652 193
390 3300026041 Ga0207639_10370436 Ga0207639_103704362 193
391 3300026078 Ga0207702_10017145 Ga0207702_100171453 193
392 3300026116 Ga0207674_10093330 Ga0207674_100933302 193
393 3300026142 Ga0207698_10047999 Ga0207698_100479992 193
394 3300026142 Ga0207698_10152078 Ga0207698_101520782 193
395 3300028381 Ga0268264_10071675 Ga0268264_100716752 193
396 3300039450 Ga0436363_0390454 Ga0436363_0390454_1294_1884 193
397 3300046507 Ga0495606_0000007 Ga0495606_0000007_301811_302395 193
398 3300047472 Ga0495686_0178256 Ga0495686_0178256_428_1012 193
399 3300048912 Ga0496109_0787890 Ga0496109_0787890_168_758 193
400 3300003322 rootL2_10015574 rootL2_100155742 194
401 3300005327 Ga0070658_10167090 Ga0070658_101670902 194
402 3300005344 Ga0070661_100899479 Ga0070661_1008994791 194
403 3300005355 Ga0070671_100756143 Ga0070671_1007561431 194
404 3300005614 Ga0068856_100802849 Ga0068856_1008028492 194
405 3300005616 Ga0068852_100010860 Ga0068852_1000108605 194
406 3300005841 Ga0068863_100698719 Ga0068863_1006987192 194
407 3300006195 Ga0075366_10231906 Ga0075366_102319062 194
408 3300006195 Ga0075366_10301165 Ga0075366_103011652 194
409 3300006881 Ga0068865_100816976 Ga0068865_1008169761 194
410 3300013104 Ga0157370_10270238 Ga0157370_102702382 194
411 3300013296 Ga0157374_11141907 Ga0157374_111419071 194
412 3300013306 Ga0163162_10912745 Ga0163162_109127451 194
413 3300014969 Ga0157376_11573919 Ga0157376_115739191 194
414 3300025901 Ga0207688_10172200 Ga0207688_101722002 194
415 3300025931 Ga0207644_10289150 Ga0207644_102891502 194
416 3300025945 Ga0207679_11275709 Ga0207679_112757091 194
417 3300026088 Ga0207641_10938236 Ga0207641_109382362 194
418 3300026121 Ga0207683_10238480 Ga0207683_102384802 194
419 3300026142 Ga0207698_10059428 Ga0207698_100594282 194
420 3300029957 Ga0265324_10081879 Ga0265324_100818792 194
421 3300032002 Ga0307416_100234092 Ga0307416_1002340922 194
422 3300037418 Ga0395900_0746435 Ga0395900_0746435_125_715 194
423 3300038443 Ga0395901_0381368 Ga0395901_0381368_376_966 194
424 3300042439 Ga0439464_0006066 Ga0439464_0006066_2405_3001 194
425 3300044658 Ga0466972_0029464 Ga0466972_0029464_2050_2637 194
426 3300044683 Ga0466965_0019972 Ga0466965_0019972_2285_2872 194
427 3300044694 Ga0466963_0253382 Ga0466963_0253382_254_850 194
428 3300044706 Ga0466964_0000831 Ga0466964_0000831_9255_9842 194
429 3300044706 Ga0466964_0046940 Ga0466964_0046940_1045_1632 194
430 3300044735 Ga0466968_0005379 Ga0466968_0005379_3876_4463 194
431 3300044765 Ga0466970_0411913 Ga0466970_0411913_22_609 194
432 3300044842 Ga0466957_0119546 Ga0466957_0119546_51_638 194
433 3300044842 Ga0466957_0246141 Ga0466957_0246141_537_1124 194
434 3300044901 Ga0466960_0256749 Ga0466960_0256749_147_734 194
435 3300045836 Ga0466958_0391881 Ga0466958_0391881_143_730 194
436 3300045976 Ga0466967_0011043 Ga0466967_0011043_604_1191 194
437 3300046453 Ga0495627_005973 Ga0495627_005973_558_1148 194
438 3300046455 Ga0495603_0235314 Ga0495603_0235314_158_748 194
439 3300046457 Ga0495590_0025210 Ga0495590_0025210_195_785 194
440 3300046459 Ga0495629_0021875 Ga0495629_0021875_3625_4215 194
441 3300046459 Ga0495629_0548413 Ga0495629_0548413_53_643 194
442 3300046460 Ga0495638_0006104 Ga0495638_0006104_402_992 194
443 3300046460 Ga0495638_0100621 Ga0495638_0100621_350_940 194
444 3300046460 Ga0495638_0280710 Ga0495638_0280710_152_742 194
445 3300046463 Ga0495653_0099895 Ga0495653_0099895_109_699 194
446 3300046472 Ga0495580_0479193 Ga0495580_0479193_218_808 194
447 3300046473 Ga0495582_0049455 Ga0495582_0049455_1115_1705 194
448 3300046474 Ga0495605_0000087 Ga0495605_0000087_100339_100926 194
449 3300046474 Ga0495605_0054408 Ga0495605_0054408_787_1377 194
450 3300046474 Ga0495605_0054970 Ga0495605_0054970_81_668 194
451 3300046475 Ga0495639_0119233 Ga0495639_0119233_419_1018 194
452 3300046477 Ga0495664_0135482 Ga0495664_0135482_349_936 194
453 3300046491 Ga0495584_0006863 Ga0495584_0006863_433_1023 194
454 3300046491 Ga0495584_0011832 Ga0495584_0011832_2163_2753 194
455 3300046491 Ga0495584_0029616 Ga0495584_0029616_114_710 194
456 3300046491 Ga0495584_0136281 Ga0495584_0136281_585_1172 194
457 3300046491 Ga0495584_0310848 Ga0495584_0310848_82_672 194
458 3300046492 Ga0495585_0000863 Ga0495585_0000863_8302_8892 194
459 3300046492 Ga0495585_0008523 Ga0495585_0008523_2311_2901 194
460 3300046492 Ga0495585_0069942 Ga0495585_0069942_11_601 194
461 3300046499 Ga0495594_0000705 Ga0495594_0000705_14614_15204 194
462 3300046499 Ga0495594_0125810 Ga0495594_0125810_487_1077 194
463 3300046499 Ga0495594_0176021 Ga0495594_0176021_255_845 194
464 3300046499 Ga0495594_0191108 Ga0495594_0191108_43_633 194
465 3300046500 Ga0495596_0001008 Ga0495596_0001008_6231_6821 194
466 3300046500 Ga0495596_0048861 Ga0495596_0048861_495_1085 194
467 3300046500 Ga0495596_0061065 Ga0495596_0061065_775_1365 194
468 3300046500 Ga0495596_0102603 Ga0495596_0102603_179_769 194
469 3300046501 Ga0495607_0015258 Ga0495607_0015258_3590_4177 194
470 3300046506 Ga0495583_0000193 Ga0495583_0000193_2459_3049 194
471 3300046506 Ga0495583_0025803 Ga0495583_0025803_377_967 194
472 3300046506 Ga0495583_0049210 Ga0495583_0049210_770_1360 194
473 3300046506 Ga0495583_0066555 Ga0495583_0066555_551_1141 194
474 3300046506 Ga0495583_0079437 Ga0495583_0079437_714_1304 194
475 3300046506 Ga0495583_0109368 Ga0495583_0109368_218_808 194
476 3300046506 Ga0495583_0209902 Ga0495583_0209902_146_736 194
477 3300046507 Ga0495606_0168583 Ga0495606_0168583_89_679 194
478 3300046512 Ga0495610_0295824 Ga0495610_0295824_15_605 194
479 3300046513 Ga0495616_0003775 Ga0495616_0003775_7740_8327 194
480 3300046513 Ga0495616_0006247 Ga0495616_0006247_574_1164 194
481 3300046513 Ga0495616_0011606 Ga0495616_0011606_1287_1877 194
482 3300046513 Ga0495616_0057859 Ga0495616_0057859_348_938 194
483 3300046517 Ga0495630_0408456 Ga0495630_0408456_110_700 194
484 3300046518 Ga0495631_0001768 Ga0495631_0001768_746_1336 194
485 3300046518 Ga0495631_0047270 Ga0495631_0047270_858_1448 194
486 3300046518 Ga0495631_0080287 Ga0495631_0080287_133_723 194
487 3300046518 Ga0495631_0091013 Ga0495631_0091013_283_873 194
488 3300046518 Ga0495631_0233025 Ga0495631_0233025_129_719 194
489 3300046519 Ga0495632_0000114 Ga0495632_0000114_547_1137 194
490 3300046522 Ga0495643_0026010 Ga0495643_0026010_934_1521 194
491 3300046522 Ga0495643_0122658 Ga0495643_0122658_373_963 194
492 3300046523 Ga0495644_0174579 Ga0495644_0174579_39_629 194
493 3300046523 Ga0495644_0199043 Ga0495644_0199043_78_668 194
494 3300046524 Ga0495648_0104611 Ga0495648_0104611_866_1456 194
495 3300046526 Ga0495666_0024048 Ga0495666_0024048_430_1020 194
496 3300046526 Ga0495666_0051039 Ga0495666_0051039_1200_1790 194
497 3300046526 Ga0495666_0104105 Ga0495666_0104105_341_931 194
498 3300046526 Ga0495666_0216858 Ga0495666_0216858_136_726 194
499 3300046528 Ga0495642_0002336 Ga0495642_0002336_6697_7284 194
500 3300046528 Ga0495642_0063087 Ga0495642_0063087_751_1341 194
501 3300046528 Ga0495642_0117604 Ga0495642_0117604_116_703 194
502 3300046528 Ga0495642_0119825 Ga0495642_0119825_74_667 194
503 3300046528 Ga0495642_0142181 Ga0495642_0142181_104_694 194
504 3300046528 Ga0495642_0146022 Ga0495642_0146022_101_691 194
505 3300046528 Ga0495642_0243901 Ga0495642_0243901_100_690 194
506 3300046530 Ga0495654_0027808 Ga0495654_0027808_2233_2823 194
507 3300046530 Ga0495654_0065381 Ga0495654_0065381_852_1442 194
508 3300046531 Ga0495665_0025475 Ga0495665_0025475_1388_1978 194
509 3300046535 Ga0495586_0130831 Ga0495586_0130831_203_793 194
510 3300046536 Ga0495587_0024560 Ga0495587_0024560_3027_3617 194
511 3300046538 Ga0495609_0000096 Ga0495609_0000096_80195_80782 194
512 3300046538 Ga0495609_0012026 Ga0495609_0012026_392_982 194
513 3300046538 Ga0495609_0063112 Ga0495609_0063112_856_1446 194
514 3300046538 Ga0495609_0108656 Ga0495609_0108656_242_832 194
515 3300046542 Ga0495597_0000587 Ga0495597_0000587_16050_16640 194
516 3300046542 Ga0495597_0002540 Ga0495597_0002540_3886_4476 194
517 3300046542 Ga0495597_0004426 Ga0495597_0004426_3597_4187 194
518 3300046542 Ga0495597_0039253 Ga0495597_0039253_89_679 194
519 3300046542 Ga0495597_0089115 Ga0495597_0089115_13_603 194
520 3300046542 Ga0495597_0090044 Ga0495597_0090044_575_1165 194
521 3300046557 Ga0495622_0005476 Ga0495622_0005476_3548_4138 194
522 3300046557 Ga0495622_0051667 Ga0495622_0051667_1143_1733 194
523 3300046557 Ga0495622_0108102 Ga0495622_0108102_630_1220 194
524 3300046557 Ga0495622_0111001 Ga0495622_0111001_431_1021 194
525 3300046557 Ga0495622_0229086 Ga0495622_0229086_203_793 194
526 3300046558 Ga0495633_0062569 Ga0495633_0062569_281_871 194
527 3300046558 Ga0495633_0070876 Ga0495633_0070876_816_1406 194
528 3300046558 Ga0495633_0180395 Ga0495633_0180395_85_678 194
529 3300046559 Ga0495667_0034780 Ga0495667_0034780_2498_3088 194
530 3300046615 Ga0495656_0064993 Ga0495656_0064993_500_1093 194
531 3300046615 Ga0495656_0107791 Ga0495656_0107791_355_942 194
532 3300046615 Ga0495656_0493761 Ga0495656_0493761_49_639 194
533 3300046616 Ga0495668_0011047 Ga0495668_0011047_3143_3733 194
534 3300046616 Ga0495668_0013816 Ga0495668_0013816_110_700 194
535 3300046616 Ga0495668_0126435 Ga0495668_0126435_39_629 194
536 3300046616 Ga0495668_0321688 Ga0495668_0321688_229_819 194
537 3300046642 Ga0495634_0029421 Ga0495634_0029421_870_1460 194
538 3300046648 Ga0495611_0080114 Ga0495611_0080114_108_695 194
539 3300046660 Ga0495625_0004537 Ga0495625_0004537_658_1248 194
540 3300046660 Ga0495625_0032111 Ga0495625_0032111_33_623 194
541 3300046660 Ga0495625_0251042 Ga0495625_0251042_244_834 194
542 3300046660 Ga0495625_0254657 Ga0495625_0254657_44_634 194
543 3300046665 Ga0495661_0000164 Ga0495661_0000164_57213_57800 194
544 3300046665 Ga0495661_0014211 Ga0495661_0014211_4334_4924 194
545 3300046665 Ga0495661_0115739 Ga0495661_0115739_530_1120 194
546 3300046665 Ga0495661_0184710 Ga0495661_0184710_190_777 194
547 3300046665 Ga0495661_0209534 Ga0495661_0209534_231_821 194
548 3300046674 Ga0495588_0083822 Ga0495588_0083822_902_1492 194
549 3300046674 Ga0495588_0097659 Ga0495588_0097659_343_933 194
550 3300046674 Ga0495588_0129583 Ga0495588_0129583_406_996 194
551 3300046674 Ga0495588_0238769 Ga0495588_0238769_191_781 194
552 3300046674 Ga0495588_0240112 Ga0495588_0240112_118_711 194
553 3300046674 Ga0495588_0271647 Ga0495588_0271647_178_768 194
554 3300046674 Ga0495588_0333912 Ga0495588_0333912_122_715 194
555 3300046679 Ga0495623_0016009 Ga0495623_0016009_4148_4738 194
556 3300046679 Ga0495623_0142294 Ga0495623_0142294_527_1117 194
557 3300046679 Ga0495623_0152455 Ga0495623_0152455_279_869 194
558 3300046684 Ga0495669_0087744 Ga0495669_0087744_126_719 194
559 3300046684 Ga0495669_0375936 Ga0495669_0375936_82_672 194
560 3300046689 Ga0495613_0138776 Ga0495613_0138776_422_1012 194
561 3300046689 Ga0495613_0516790 Ga0495613_0516790_73_663 194
562 3300046690 Ga0495624_0045126 Ga0495624_0045126_671_1261 194
563 3300046691 Ga0495670_0048641 Ga0495670_0048641_524_1114 194
564 3300046691 Ga0495670_0053624 Ga0495670_0053624_112_702 194
565 3300046691 Ga0495670_0191468 Ga0495670_0191468_308_898 194
566 3300046692 Ga0495671_0060264 Ga0495671_0060264_325_915 194
567 3300046692 Ga0495671_0064536 Ga0495671_0064536_622_1212 194
568 3300046692 Ga0495671_0079020 Ga0495671_0079020_249_836 194
569 3300046692 Ga0495671_0206591 Ga0495671_0206591_122_709 194
570 3300046694 Ga0495649_0073170 Ga0495649_0073170_829_1419 194
571 3300046694 Ga0495649_0098126 Ga0495649_0098126_646_1236 194
572 3300046694 Ga0495649_0172010 Ga0495649_0172010_19_606 194
573 3300046794 Ga0495589_0000036 Ga0495589_0000036_20853_21440 194
574 3300046794 Ga0495589_0000092 Ga0495589_0000092_49186_49773 194
575 3300046794 Ga0495589_0001941 Ga0495589_0001941_398_988 194
576 3300046794 Ga0495589_0083531 Ga0495589_0083531_649_1239 194
577 3300046809 Ga0495600_0026732 Ga0495600_0026732_110_700 194
578 3300046810 Ga0495660_0000117 Ga0495660_0000117_21533_22120 194
579 3300046810 Ga0495660_0020826 Ga0495660_0020826_935_1522 194
580 3300046810 Ga0495660_0045575 Ga0495660_0045575_1586_2176 194
581 3300046810 Ga0495660_0079012 Ga0495660_0079012_710_1300 194
582 3300047315 Ga0495581_0024612 Ga0495581_0024612_2471_3061 194
583 3300047315 Ga0495581_0572309 Ga0495581_0572309_11_601 194
584 3300047317 Ga0495604_0045073 Ga0495604_0045073_652_1242 194
585 3300047318 Ga0495636_0015815 Ga0495636_0015815_2142_2732 194
586 3300047319 Ga0495674_0003022 Ga0495674_0003022_13476_14066 194
587 3300047319 Ga0495674_0585921 Ga0495674_0585921_185_775 194
588 3300047320 Ga0495672_0002183 Ga0495672_0002183_10125_10712 194
589 3300047320 Ga0495672_0003253 Ga0495672_0003253_582_1172 194
590 3300047321 Ga0495676_0007223 Ga0495676_0007223_3769_4359 194
591 3300047321 Ga0495676_0009421 Ga0495676_0009421_4577_5179 194
592 3300047321 Ga0495676_0070247 Ga0495676_0070247_1084_1674 194
593 3300047321 Ga0495676_0242968 Ga0495676_0242968_508_1098 194
594 3300047323 Ga0495683_0007830 Ga0495683_0007830_378_968 194
595 3300047323 Ga0495683_0019300 Ga0495683_0019300_479_1066 194
596 3300047323 Ga0495683_0058853 Ga0495683_0058853_764_1354 194
597 3300047443 Ga0495687_000074 Ga0495687_000074_20992_21579 194
598 3300047443 Ga0495687_002852 Ga0495687_002852_9014_9601 194
599 3300047443 Ga0495687_003354 Ga0495687_003354_10730_11320 194
600 3300047444 Ga0495675_0065424 Ga0495675_0065424_432_1022 194
601 3300047444 Ga0495675_0133443 Ga0495675_0133443_319_909 194
602 3300047445 Ga0495677_0000037 Ga0495677_0000037_57260_57847 194
603 3300047445 Ga0495677_0105433 Ga0495677_0105433_116_706 194
604 3300047446 Ga0495679_038807 Ga0495679_038807_115_705 194
605 3300047447 Ga0495685_016157 Ga0495685_016157_1220_1810 194
606 3300047470 Ga0495681_0006668 Ga0495681_0006668_6472_7062 194
607 3300047470 Ga0495681_0017803 Ga0495681_0017803_2793_3383 194
608 3300047470 Ga0495681_0061861 Ga0495681_0061861_741_1331 194
609 3300047673 Ga0495593_0056294 Ga0495593_0056294_590_1180 194
610 3300048088 Ga0495602_0033019 Ga0495602_0033019_381_971 194
611 3300048091 Ga0495626_0000006 Ga0495626_0000006_127017_127604 194
612 3300048091 Ga0495626_0004153 Ga0495626_0004153_331_918 194
613 3300048091 Ga0495626_0069047 Ga0495626_0069047_575_1165 194
614 3300048091 Ga0495626_0147140 Ga0495626_0147140_159_749 194
615 3300048911 Ga0496108_0800146 Ga0496108_0800146_79_678 194
616 3300048913 Ga0496110_0004486 Ga0496110_0004486_9401_9991 194
617 3300048913 Ga0496110_0194522 Ga0496110_0194522_691_1278 194
618 3300048913 Ga0496110_0570245 Ga0496110_0570245_43_630 194
619 3300048914 Ga0496111_0130263 Ga0496111_0130263_817_1407 194
620 3300048914 Ga0496111_0273343 Ga0496111_0273343_497_1084 194
621 3300048918 Ga0496115_0107553 Ga0496115_0107553_575_1162 194
622 3300048918 Ga0496115_0166792 Ga0496115_0166792_696_1283 194
623 3300048927 Ga0496124_0183530 Ga0496124_0183530_503_1093 194
624 3300049160 Ga0501304_008260 Ga0501304_008260_250_837 194
625 3300049459 Ga0495678_002660 Ga0495678_002660_10792_11382 194
626 3300049459 Ga0495678_003327 Ga0495678_003327_562_1152 194
627 3300049459 Ga0495678_003585 Ga0495678_003585_5583_6173 194
628 3300049460 Ga0495682_0000726 Ga0495682_0000726_516_1106 194
629 3300049822 Ga0501035_0512448 Ga0501035_0512448_90_683 194
630 3300050493 nmdc:mga0k408_97396_c1 nmdc:mga0k408_97396_c1_109_702 194
631 3300002739 JGI25158J39367_1020747 JGI25158J39367_10207472 195
632 3300002987 JGI25159J45721_1001812 JGI25159J45721_10018124 195
633 3300002987 JGI25159J45721_1010629 JGI25159J45721_10106292 195
634 3300003354 JGI25160J50197_1008378 JGI25160J50197_10083782 195
635 3300003374 JGI25161J50226_1003119 JGI25161J50226_10031194 195
636 3300003374 JGI25161J50226_1007562 JGI25161J50226_10075622 195
637 3300003771 Ga0055526_1002157 Ga0055526_10021574 195
638 3300003773 Ga0055537_1002292 Ga0055537_10022922 195
639 3300003773 Ga0055537_1018071 Ga0055537_10180712 195
640 3300003775 Ga0055524_1001269 Ga0055524_10012695 195
641 3300003784 Ga0055534_1002606 Ga0055534_10026062 195
642 3300003791 Ga0055530_10015821 Ga0055530_100158213 195
643 3300003791 Ga0055530_10016700 Ga0055530_100167002 195
644 3300003794 Ga0055531_10025864 Ga0055531_100258642 195
645 3300004625 Ga0055543_1001061 Ga0055543_10010612 195
646 3300005262 Ga0065165_1003149 Ga0065165_100314913 195
647 3300005327 Ga0070658_10536862 Ga0070658_105368621 195
648 3300005328 Ga0070676_10006179 Ga0070676_100061792 195
649 3300005329 Ga0070683_100098838 Ga0070683_1000988382 195
650 3300005330 Ga0070690_100009995 Ga0070690_1000099953 195
651 3300005331 Ga0070670_100041228 Ga0070670_1000412284 195
652 3300005331 Ga0070670_100041810 Ga0070670_1000418106 195
653 3300005331 Ga0070670_100250988 Ga0070670_1002509882 195
654 3300005331 Ga0070670_100289814 Ga0070670_1002898142 195
655 3300005333 Ga0070677_10057022 Ga0070677_100570222 195
656 3300005333 Ga0070677_10244336 Ga0070677_102443361 195
657 3300005333 Ga0070677_10300367 Ga0070677_103003671 195
658 3300005334 Ga0068869_100023042 Ga0068869_1000230422 195
659 3300005335 Ga0070666_10206569 Ga0070666_102065692 195
660 3300005335 Ga0070666_10228142 Ga0070666_102281422 195
661 3300005336 Ga0070680_100023635 Ga0070680_1000236354 195
662 3300005338 Ga0068868_100139572 Ga0068868_1001395723 195
663 3300005338 Ga0068868_100225914 Ga0068868_1002259142 195
664 3300005338 Ga0068868_100797915 Ga0068868_1007979151 195
665 3300005344 Ga0070661_100125964 Ga0070661_1001259642 195
666 3300005344 Ga0070661_100134924 Ga0070661_1001349242 195
667 3300005344 Ga0070661_100271965 Ga0070661_1002719652 195
668 3300005347 Ga0070668_100091715 Ga0070668_1000917152 195
669 3300005347 Ga0070668_100259897 Ga0070668_1002598972 195
670 3300005353 Ga0070669_100001130 Ga0070669_10000113016 195
671 3300005354 Ga0070675_100008487 Ga0070675_1000084872 195
672 3300005354 Ga0070675_100219464 Ga0070675_1002194642 195
673 3300005354 Ga0070675_100220814 Ga0070675_1002208142 195
674 3300005354 Ga0070675_100359002 Ga0070675_1003590022 195
675 3300005355 Ga0070671_100011925 Ga0070671_1000119257 195
676 3300005355 Ga0070671_100124449 Ga0070671_1001244492 195
677 3300005355 Ga0070671_100189646 Ga0070671_1001896462 195
678 3300005355 Ga0070671_100233666 Ga0070671_1002336662 195
679 3300005355 Ga0070671_100268030 Ga0070671_1002680302 195
680 3300005356 Ga0070674_100036075 Ga0070674_1000360753 195
681 3300005356 Ga0070674_100061868 Ga0070674_1000618682 195
682 3300005364 Ga0070673_100049904 Ga0070673_1000499043 195
683 3300005364 Ga0070673_100068785 Ga0070673_1000687852 195
684 3300005364 Ga0070673_100106844 Ga0070673_1001068442 195
685 3300005364 Ga0070673_100466491 Ga0070673_1004664911 195
686 3300005367 Ga0070667_100005407 Ga0070667_1000054077 195
687 3300005367 Ga0070667_100138856 Ga0070667_1001388563 195
688 3300005367 Ga0070667_100299990 Ga0070667_1002999901 195
689 3300005455 Ga0070663_100096753 Ga0070663_1000967532 195
690 3300005456 Ga0070678_100212455 Ga0070678_1002124552 195
691 3300005456 Ga0070678_100223703 Ga0070678_1002237031 195
692 3300005456 Ga0070678_100229254 Ga0070678_1002292542 195
693 3300005456 Ga0070678_100234822 Ga0070678_1002348222 195
694 3300005456 Ga0070678_100259165 Ga0070678_1002591652 195
695 3300005456 Ga0070678_100301155 Ga0070678_1003011552 195
696 3300005456 Ga0070678_100334342 Ga0070678_1003343421 195
697 3300005457 Ga0070662_100045173 Ga0070662_1000451731 195
698 3300005457 Ga0070662_100096187 Ga0070662_1000961872 195
699 3300005457 Ga0070662_100157745 Ga0070662_1001577452 195
700 3300005459 Ga0068867_100048156 Ga0068867_1000481562 195
701 3300005459 Ga0068867_100491221 Ga0068867_1004912212 195
702 3300005459 Ga0068867_100929104 Ga0068867_1009291041 195
703 3300005530 Ga0070679_100002880 Ga0070679_1000028806 195
704 3300005535 Ga0070684_100303343 Ga0070684_1003033432 195
705 3300005539 Ga0068853_100736778 Ga0068853_1007367781 195
706 3300005543 Ga0070672_100035158 Ga0070672_1000351584 195
707 3300005543 Ga0070672_100073201 Ga0070672_1000732012 195
708 3300005543 Ga0070672_100076179 Ga0070672_1000761792 195
709 3300005543 Ga0070672_100155404 Ga0070672_1001554042 195
710 3300005548 Ga0070665_100433462 Ga0070665_1004334622 195
711 3300005564 Ga0070664_100458131 Ga0070664_1004581312 195
712 3300005614 Ga0068856_100823349 Ga0068856_1008233492 195
713 3300005616 Ga0068852_100031671 Ga0068852_1000316711 195
714 3300005616 Ga0068852_100118587 Ga0068852_1001185872 195
715 3300005616 Ga0068852_100314359 Ga0068852_1003143592 195
716 3300005616 Ga0068852_100355595 Ga0068852_1003555952 195
717 3300005617 Ga0068859_100039942 Ga0068859_1000399423 195
718 3300005618 Ga0068864_100002329 Ga0068864_10000232911 195
719 3300005618 Ga0068864_100045894 Ga0068864_1000458942 195
720 3300005618 Ga0068864_100080467 Ga0068864_1000804672 195
721 3300005618 Ga0068864_100493069 Ga0068864_1004930692 195
722 3300005718 Ga0068866_10012833 Ga0068866_100128333 195
723 3300005834 Ga0068851_10250998 Ga0068851_102509982 195
724 3300005834 Ga0068851_10259752 Ga0068851_102597522 195
725 3300005841 Ga0068863_100025015 Ga0068863_1000250153 195
726 3300005841 Ga0068863_100212996 Ga0068863_1002129962 195
727 3300005841 Ga0068863_100263291 Ga0068863_1002632912 195
728 3300005841 Ga0068863_100269813 Ga0068863_1002698133 195
729 3300005842 Ga0068858_100003428 Ga0068858_1000034283 195
730 3300005843 Ga0068860_100004794 Ga0068860_1000047942 195
731 3300005844 Ga0068862_100039223 Ga0068862_1000392233 195
732 3300006038 Ga0075365_10005225 Ga0075365_100052252 195
733 3300006163 Ga0070715_10196619 Ga0070715_101966192 195
734 3300006237 Ga0097621_100016159 Ga0097621_1000161594 195
735 3300006237 Ga0097621_100045361 Ga0097621_1000453613 195
736 3300006237 Ga0097621_100739939 Ga0097621_1007399391 195
737 3300006358 Ga0068871_100085125 Ga0068871_1000851252 195
738 3300006358 Ga0068871_100332340 Ga0068871_1003323402 195
739 3300006931 Ga0097620_100039942 Ga0097620_1000399423 195
740 3300009094 Ga0111539_10557317 Ga0111539_105573171 195
741 3300009098 Ga0105245_10042059 Ga0105245_100420592 195
742 3300009148 Ga0105243_10004042 Ga0105243_100040422 195
743 3300009148 Ga0105243_10916977 Ga0105243_109169772 195
744 3300009176 Ga0105242_10073735 Ga0105242_100737352 195
745 3300009176 Ga0105242_10617790 Ga0105242_106177902 195
746 3300009177 Ga0105248_10044593 Ga0105248_100445935 195
747 3300009177 Ga0105248_10662727 Ga0105248_106627272 195
748 3300009177 Ga0105248_10672461 Ga0105248_106724612 195
749 3300009177 Ga0105248_11182908 Ga0105248_111829081 195
750 3300009553 Ga0105249_10005277 Ga0105249_100052773 195
751 3300009553 Ga0105249_10381685 Ga0105249_103816852 195
752 3300013296 Ga0157374_10060546 Ga0157374_100605462 195
753 3300013296 Ga0157374_10086510 Ga0157374_100865104 195
754 3300013306 Ga0163162_10087946 Ga0163162_100879464 195
755 3300013306 Ga0163162_10677352 Ga0163162_106773522 195
756 3300013307 Ga0157372_10253491 Ga0157372_102534912 195
757 3300013308 Ga0157375_10027374 Ga0157375_100273744 195
758 3300013308 Ga0157375_10154362 Ga0157375_101543622 195
759 3300014325 Ga0163163_10170102 Ga0163163_101701022 195
760 3300014326 Ga0157380_10030254 Ga0157380_100302543 195
761 3300014968 Ga0157379_10092877 Ga0157379_100928773 195
762 3300014969 Ga0157376_10009644 Ga0157376_100096446 195
763 3300017792 Ga0163161_10350265 Ga0163161_103502652 195
764 3300025245 Ga0207425_1000062 Ga0207425_1000062127 195
765 3300025263 Ga0209565_1000622 Ga0209565_10006227 195
766 3300025263 Ga0209565_1000784 Ga0209565_10007845 195
767 3300025263 Ga0209565_1001080 Ga0209565_10010803 195
768 3300025263 Ga0209565_1031342 Ga0209565_10313422 195
769 3300025284 Ga0209130_1001152 Ga0209130_100115220 195
770 3300025284 Ga0209130_1007249 Ga0209130_10072492 195
771 3300025284 Ga0209130_1025357 Ga0209130_10253572 195
772 3300025291 Ga0209675_1000280 Ga0209675_100028026 195
773 3300025295 Ga0209564_1001080 Ga0209564_100108015 195
774 3300025298 Ga0209050_1000064 Ga0209050_1000064188 195
775 3300025298 Ga0209050_1001144 Ga0209050_10011443 195
776 3300025299 Ga0209256_1000507 Ga0209256_100050728 195
777 3300025299 Ga0209256_1001972 Ga0209256_100197213 195
778 3300025302 Ga0207426_1001027 Ga0207426_10010272 195
779 3300025303 Ga0209051_1031078 Ga0209051_10310782 195
780 3300025304 Ga0209257_1000010 Ga0209257_1000010548 195
781 3300025304 Ga0209257_1003990 Ga0209257_100399011 195
782 3300025315 Ga0207697_10042417 Ga0207697_100424173 195
783 3300025321 Ga0207656_10023503 Ga0207656_100235032 195
784 3300025321 Ga0207656_10167946 Ga0207656_101679462 195
785 3300025893 Ga0207682_10053057 Ga0207682_100530572 195
786 3300025893 Ga0207682_10053985 Ga0207682_100539852 195
787 3300025899 Ga0207642_10014634 Ga0207642_100146342 195
788 3300025901 Ga0207688_10436710 Ga0207688_104367101 195
789 3300025901 Ga0207688_10480137 Ga0207688_104801372 195
790 3300025903 Ga0207680_10051951 Ga0207680_100519513 195
791 3300025905 Ga0207685_10153763 Ga0207685_101537632 195
792 3300025907 Ga0207645_10016617 Ga0207645_100166172 195
793 3300025907 Ga0207645_10093958 Ga0207645_100939582 195
794 3300025917 Ga0207660_10185183 Ga0207660_101851832 195
795 3300025919 Ga0207657_10227937 Ga0207657_102279373 195
796 3300025920 Ga0207649_10138295 Ga0207649_101382952 195
797 3300025921 Ga0207652_10295525 Ga0207652_102955252 195
798 3300025923 Ga0207681_10071671 Ga0207681_100716713 195
799 3300025923 Ga0207681_10445708 Ga0207681_104457082 195
800 3300025925 Ga0207650_10027735 Ga0207650_100277352 195
801 3300025925 Ga0207650_10035349 Ga0207650_100353495 195
802 3300025925 Ga0207650_10133863 Ga0207650_101338632 195
803 3300025925 Ga0207650_10153958 Ga0207650_101539582 195
804 3300025925 Ga0207650_10384649 Ga0207650_103846492 195
805 3300025926 Ga0207659_10015331 Ga0207659_100153312 195
806 3300025926 Ga0207659_10036615 Ga0207659_100366153 195
807 3300025926 Ga0207659_10162050 Ga0207659_101620502 195
808 3300025926 Ga0207659_10310924 Ga0207659_103109242 195
809 3300025927 Ga0207687_10034140 Ga0207687_100341403 195
810 3300025931 Ga0207644_10027031 Ga0207644_100270312 195
811 3300025931 Ga0207644_10193967 Ga0207644_101939672 195
812 3300025933 Ga0207706_10069224 Ga0207706_100692243 195
813 3300025933 Ga0207706_10162222 Ga0207706_101622223 195
814 3300025934 Ga0207686_10068989 Ga0207686_100689891 195
815 3300025934 Ga0207686_10435447 Ga0207686_104354472 195
816 3300025935 Ga0207709_10020258 Ga0207709_100202583 195
817 3300025935 Ga0207709_10280442 Ga0207709_102804422 195
818 3300025937 Ga0207669_10027359 Ga0207669_100273593 195
819 3300025937 Ga0207669_10389288 Ga0207669_103892882 195
820 3300025938 Ga0207704_10008539 Ga0207704_100085393 195
821 3300025940 Ga0207691_10012960 Ga0207691_100129602 195
822 3300025940 Ga0207691_10056925 Ga0207691_100569252 195
823 3300025940 Ga0207691_10058182 Ga0207691_100581824 195
824 3300025940 Ga0207691_10372729 Ga0207691_103727292 195
825 3300025941 Ga0207711_10100667 Ga0207711_101006672 195
826 3300025941 Ga0207711_10189956 Ga0207711_101899562 195
827 3300025941 Ga0207711_10290181 Ga0207711_102901813 195
828 3300025941 Ga0207711_10341131 Ga0207711_103411312 195
829 3300025941 Ga0207711_11238177 Ga0207711_112381771 195
830 3300025942 Ga0207689_10002900 Ga0207689_100029004 195
831 3300025945 Ga0207679_10369217 Ga0207679_103692172 195
832 3300025945 Ga0207679_10488097 Ga0207679_104880972 195
833 3300025960 Ga0207651_10007527 Ga0207651_100075273 195
834 3300025960 Ga0207651_10051280 Ga0207651_100512802 195
835 3300025960 Ga0207651_10329320 Ga0207651_103293202 195
836 3300025961 Ga0207712_10034313 Ga0207712_100343132 195
837 3300025972 Ga0207668_10047946 Ga0207668_100479462 195
838 3300025981 Ga0207640_10328349 Ga0207640_103283492 195
839 3300025986 Ga0207658_10002511 Ga0207658_100025113 195
840 3300025986 Ga0207658_10247099 Ga0207658_102470992 195
841 3300026023 Ga0207677_10087762 Ga0207677_100877623 195
842 3300026023 Ga0207677_10219806 Ga0207677_102198062 195
843 3300026023 Ga0207677_10450333 Ga0207677_104503332 195
844 3300026035 Ga0207703_10089492 Ga0207703_100894922 195
845 3300026041 Ga0207639_10623268 Ga0207639_106232683 195
846 3300026067 Ga0207678_10042827 Ga0207678_100428273 195
847 3300026067 Ga0207678_10437544 Ga0207678_104375442 195
848 3300026078 Ga0207702_11202452 Ga0207702_112024521 195
849 3300026088 Ga0207641_10000923 Ga0207641_1000092318 195
850 3300026088 Ga0207641_10067624 Ga0207641_100676242 195
851 3300026088 Ga0207641_10557982 Ga0207641_105579822 195
852 3300026089 Ga0207648_10063633 Ga0207648_100636333 195
853 3300026089 Ga0207648_10124501 Ga0207648_101245012 195
854 3300026089 Ga0207648_10928640 Ga0207648_109286401 195
855 3300026095 Ga0207676_10027490 Ga0207676_100274904 195
856 3300026095 Ga0207676_10028475 Ga0207676_100284752 195
857 3300026095 Ga0207676_10189822 Ga0207676_101898222 195
858 3300026095 Ga0207676_10448793 Ga0207676_104487931 195
859 3300026095 Ga0207676_10620848 Ga0207676_106208482 195
860 3300026118 Ga0207675_100043887 Ga0207675_1000438874 195
861 3300026118 Ga0207675_100772423 Ga0207675_1007724232 195
862 3300026121 Ga0207683_10052952 Ga0207683_100529522 195
863 3300026121 Ga0207683_10157193 Ga0207683_101571932 195
864 3300026121 Ga0207683_10230223 Ga0207683_102302232 195
865 3300026121 Ga0207683_10398368 Ga0207683_103983682 195
866 3300026121 Ga0207683_10651174 Ga0207683_106511742 195
867 3300026121 Ga0207683_10685541 Ga0207683_106855412 195
868 3300026142 Ga0207698_10048420 Ga0207698_100484201 195
869 3300026142 Ga0207698_10078152 Ga0207698_100781522 195
870 3300026142 Ga0207698_10278503 Ga0207698_102785032 195
871 3300026142 Ga0207698_10976148 Ga0207698_109761482 195
872 3300028381 Ga0268264_10373113 Ga0268264_103731132 195
873 3300031548 Ga0307408_100002803 Ga0307408_10000280311 195
874 3300031548 Ga0307408_100015501 Ga0307408_1000155013 195
875 3300031548 Ga0307408_100217674 Ga0307408_1002176742 195
876 3300031731 Ga0307405_10011385 Ga0307405_100113853 195
877 3300031901 Ga0307406_10836344 Ga0307406_108363441 195
878 3300031911 Ga0307412_10095690 Ga0307412_100956902 195
879 3300031995 Ga0307409_100869257 Ga0307409_1008692572 195
880 3300032002 Ga0307416_100000974 Ga0307416_10000097414 195
881 3300032126 Ga0307415_100001962 Ga0307415_1000019623 195
882 3300035113 Ga0373936_0183358 Ga0373936_0183358_222_818 195
883 3300035695 Ga0373927_0123237 Ga0373927_0123237_202_807 195
884 3300036401 Ga0373937_0037185 Ga0373937_0037185_3037_3633 195
885 3300037068 Ga0373925_0170979 Ga0373925_0170979_456_1052 195
886 3300037068 Ga0373925_0253853 Ga0373925_0253853_720_1325 195
887 3300037068 Ga0373925_0672663 Ga0373925_0672663_90_686 195
888 3300037418 Ga0395900_0185157 Ga0395900_0185157_695_1291 195
889 3300037471 Ga0395905_0370157 Ga0395905_0370157_601_1221 195
890 3300038443 Ga0395901_0158225 Ga0395901_0158225_550_1146 195
891 3300041492 Ga0451835_0346031 Ga0451835_0346031_24_620 195
892 3300041512 Ga0451853_0591653 Ga0451853_0591653_341_937 195
893 3300042876 Ga0451577_0609327 Ga0451577_0609327_323_922 195
894 3300046455 Ga0495603_0426942 Ga0495603_0426942_140_736 195
895 3300046459 Ga0495629_0026938 Ga0495629_0026938_2062_2658 195
896 3300046459 Ga0495629_0515712 Ga0495629_0515712_128_733 195
897 3300046473 Ga0495582_0332348 Ga0495582_0332348_134_730 195
898 3300046473 Ga0495582_0346806 Ga0495582_0346806_93_689 195
899 3300046477 Ga0495664_0470154 Ga0495664_0470154_14_610 195
900 3300046539 Ga0495621_0186868 Ga0495621_0186868_17_613 195
901 3300046542 Ga0495597_0001219 Ga0495597_0001219_1814_2407 195
902 3300046543 Ga0495645_0047563 Ga0495645_0047563_2141_2737 195
903 3300046559 Ga0495667_0314618 Ga0495667_0314618_383_979 195
904 3300046642 Ga0495634_0228698 Ga0495634_0228698_71_667 195
905 3300046660 Ga0495625_0050417 Ga0495625_0050417_564_1157 195
906 3300046681 Ga0495647_0016669 Ga0495647_0016669_762_1358 195
907 3300046681 Ga0495647_0196924 Ga0495647_0196924_99_695 195
908 3300046683 Ga0495658_0062960 Ga0495658_0062960_975_1571 195
909 3300046683 Ga0495658_0274740 Ga0495658_0274740_390_986 195
910 3300046689 Ga0495613_0199300 Ga0495613_0199300_175_771 195
911 3300046809 Ga0495600_0550314 Ga0495600_0550314_37_633 195
912 3300046810 Ga0495660_0017138 Ga0495660_0017138_1515_2123 195
913 3300047320 Ga0495672_0000014 Ga0495672_0000014_502007_502615 195
914 3300047472 Ga0495686_0001832 Ga0495686_0001832_3881_4489 195
915 3300048907 Ga0496104_1013963 Ga0496104_1013963_70_666 195
916 3300048908 Ga0496105_0555668 Ga0496105_0555668_68_664 195
917 3300048911 Ga0496108_0275744 Ga0496108_0275744_17_613 195
918 3300048911 Ga0496108_0675345 Ga0496108_0675345_212_808 195
919 3300048911 Ga0496108_0858628 Ga0496108_0858628_146_742 195
920 3300048912 Ga0496109_0255942 Ga0496109_0255942_852_1448 195
921 3300048912 Ga0496109_0320416 Ga0496109_0320416_172_774 195
922 3300048913 Ga0496110_0673692 Ga0496110_0673692_195_791 195
923 3300050489 nmdc:mga03683_49370_c1 nmdc:mga03683_49370_c1_185_784 195
924 3300050492 nmdc:mga0yw44_380671_c1 nmdc:mga0yw44_380671_c1_133_732 195
925 3300050492 nmdc:mga0yw44_399878_c1 nmdc:mga0yw44_399878_c1_53_658 195
926 3300050511 nmdc:mga08y16_1054124_c1 nmdc:mga08y16_1054124_c1_85_681 195
927 3300053085 Ga0495619_0062013 Ga0495619_0062013_1406_2002 195
928 3300053085 Ga0495619_0281616 Ga0495619_0281616_117_713 195
929 3300053136 Ga0500559_0033920 Ga0500559_0033920_291_890 195
930 3300053138 Ga0500564_120160 Ga0500564_120160_494_1093 195

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

27

167

0.93

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

48

166

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.9118 4 191
8gxf-assembly2.cif.gz_C pseudomonas flexibilis gcn5 family acetyltransferase 0.8935 4 191
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.8915 3 191
8gxj-assembly1.cif.gz_A pseudomonas aeruginosa n-acetyltransferase domain-containing protein pa3270 0.8881 1 189
8gxk-assembly2.cif.gz_C pseudomonas jinjuensis n-acetyltransferase 0.8876 4 189
ID Description Score Start End Superfamily
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9702 3 191 3.40.630.30
af_Q869N8_82_281_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9362 3 191 3.40.630.30
1yreD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9069 4 189 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8995 3 191 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8915 3 191 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Y9SWL4-F1-model_v4 N-acetyltransferase 0.9866 1 194 GO:0016747
AF-A0A430HGL1-F1-model_v4 N-acetyltransferase 0.9854 1 194 GO:0016747
AF-A0A833KNB9-F1-model_v4 deleted 0.9827 5 134
AF-A0A1Q7Q2C2-F1-model_v4 GNAT family N-acetyltransferase 0.9783 1 181 GO:0016747
AF-A0A4Y9SWL4-F1-model_v4 N-acetyltransferase 0.9766 1 194 GO:0016747

Feature Viewer

pLDDT pTM Quality
94.91 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map