F485971

General Info

Members Datasets Scaffolds Average Seq Length
928 295 1856 134

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10091225|Ga0105240_100912253
Length 164
Sequence VAVSLAERSDPADEFRAGERSYEQTPDKEAQMSTAASTLNVTQVGRVCITVADTDRAIDFYVGKLGFEKVVDVPMGPDMRWVEVQVAGTPTTIALAPPPSGKQAGGTDTGICLDTSDIDADHAALQAAGVDVDAEIARWGAPVPPMFWFRDPDGNSLIVVEPLP

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
138 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
139 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
149 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
160 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
178 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
179 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
209 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
210 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
223 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
224 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
225 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
234 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
235 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
239 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
240 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
241 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
242 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
243 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
244 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
245 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
252 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
253 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
254 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
255 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
256 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
257 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
266 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
267 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
268 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
269 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
270 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
271 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
272 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
273 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
279 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
287 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
290 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.12
Metatranscriptomes 3.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 13.15
Rhizosphere 86.64
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10091225 3300009093 Bacteria 3723
2 Ga0070658_10011268 3300005327 Bacteria 7167
3 Ga0070683_100000320 3300005329 Bacteria 33119
4 Ga0070683_100016774 3300005329 Bacteria 6461
5 Ga0070683_100023619 3300005329 Bacteria 5500
6 Ga0070683_100270987 3300005329 Bacteria 1615
7 Ga0070683_100440773 3300005329 Bacteria 1243
8 Ga0070680_100027859 3300005336 Bacteria 4527
9 Ga0070680_100031401 3300005336 Bacteria 4270
10 Ga0070680_100080186 3300005336 Bacteria 2692
11 Ga0070680_100240578 3300005336 Bacteria 1530
12 Ga0070680_100399361 3300005336 Bacteria 1172
13 Ga0070680_101322199 3300005336 Bacteria 624
14 Ga0070682_100159254 3300005337 Bacteria 1557
15 Ga0068868_100037222 3300005338 Bacteria 3771
16 Ga0068868_100634520 3300005338 Bacteria 950
17 Ga0070660_100002588 3300005339 Bacteria 12413
18 Ga0070660_100046649 3300005339 Bacteria 3321
19 Ga0070660_100069624 3300005339 Bacteria 2744
20 Ga0070660_101180188 3300005339 Bacteria 649
21 Ga0070691_10041326 3300005341 Bacteria 2180
22 Ga0070661_100112139 3300005344 Bacteria 2037
23 Ga0070661_100126942 3300005344 Bacteria 1914
24 Ga0070661_100969948 3300005344 Unclassified 704
25 Ga0070675_100475032 3300005354 Bacteria 1124
26 Ga0070675_101319678 3300005354 Bacteria 665
27 Ga0070671_100254010 3300005355 Bacteria 1493
28 Ga0070671_100634187 3300005355 Bacteria 925
29 Ga0070671_101007797 3300005355 Bacteria 730
30 Ga0070674_100306495 3300005356 Bacteria 1268
31 Ga0070659_100062863 3300005366 Bacteria 2935
32 Ga0070703_10203563 3300005406 Bacteria 778
33 Ga0070709_10004535 3300005434 Bacteria 7495
34 Ga0070714_100009674 3300005435 Bacteria 7591
35 Ga0070714_100026376 3300005435 Bacteria 4802
36 Ga0070714_100105772 3300005435 Bacteria 2485
37 Ga0070714_100134500 3300005435 Bacteria 2212
38 Ga0070714_100209421 3300005435 Bacteria 1786
39 Ga0070714_101359375 3300005435 Bacteria 693
40 Ga0070713_100001075 3300005436 Bacteria 17478
41 Ga0070713_100003268 3300005436 Bacteria 10694
42 Ga0070713_100456590 3300005436 Bacteria 1201
43 Ga0070713_100697621 3300005436 Bacteria 969
44 Ga0070710_10033542 3300005437 Bacteria 2788
45 Ga0070710_10071838 3300005437 Bacteria 1997
46 Ga0070710_10395798 3300005437 Unclassified 925
47 Ga0070710_10460151 3300005437 Bacteria 864
48 Ga0070701_11028706 3300005438 Bacteria 576
49 Ga0070711_100038865 3300005439 Bacteria 3202
50 Ga0070711_100565495 3300005439 Bacteria 945
51 Ga0070705_100317068 3300005440 Bacteria 1124
52 Ga0070705_100475659 3300005440 Bacteria 943
53 Ga0070708_100014377 3300005445 Bacteria 6511
54 Ga0070708_100176260 3300005445 Bacteria 1998
55 Ga0070708_100809103 3300005445 Bacteria 881
56 Ga0070663_101486132 3300005455 Unclassified 602
57 Ga0070678_100026384 3300005456 Bacteria 3927
58 Ga0070678_100576557 3300005456 Unclassified 1002
59 Ga0070678_101467200 3300005456 Unclassified 638
60 Ga0070681_10001517 3300005458 Bacteria 20575
61 Ga0070681_10021893 3300005458 Bacteria 6411
62 Ga0070681_10027815 3300005458 Bacteria 5686
63 Ga0070681_10033059 3300005458 Bacteria 5192
64 Ga0070681_10256237 3300005458 Bacteria 1662
65 Ga0070681_10543920 3300005458 Unclassified 1075
66 Ga0070681_10773278 3300005458 Bacteria 877
67 Ga0068867_100453799 3300005459 Bacteria 1093
68 Ga0070706_100021256 3300005467 Bacteria 5977
69 Ga0070706_100359949 3300005467 Unclassified 1356
70 Ga0070707_100001869 3300005468 Bacteria 20252
71 Ga0070707_100029672 3300005468 Bacteria 5206
72 Ga0070707_100364594 3300005468 Bacteria 1404
73 Ga0070707_100507490 3300005468 Bacteria 1168
74 Ga0070707_101334382 3300005468 Bacteria 684
75 Ga0070698_100429085 3300005471 Unclassified 1256
76 Ga0070698_100632042 3300005471 Unclassified 1011
77 Ga0070699_100049873 3300005518 Bacteria 3623
78 Ga0070699_100481307 3300005518 Bacteria 1127
79 Ga0070699_100654442 3300005518 Bacteria 959
80 Ga0070679_100011048 3300005530 Bacteria 8589
81 Ga0070679_100028886 3300005530 Bacteria 5470
82 Ga0070679_100031716 3300005530 Bacteria 5223
83 Ga0070679_100063108 3300005530 Bacteria 3693
84 Ga0070679_100066373 3300005530 Bacteria 3597
85 Ga0070679_100376282 3300005530 Unclassified 1367
86 Ga0070679_101260174 3300005530 Unclassified 685
87 Ga0070684_100000431 3300005535 Bacteria 28771
88 Ga0070684_100096345 3300005535 Bacteria 2637
89 Ga0070684_100099255 3300005535 Bacteria 2598
90 Ga0070684_100158129 3300005535 Bacteria 2055
91 Ga0070684_100244645 3300005535 Unclassified 1639
92 Ga0070684_100640454 3300005535 Bacteria 989
93 Ga0070684_100794958 3300005535 Bacteria 884
94 Ga0070684_101436989 3300005535 Bacteria 650
95 Ga0070697_100334005 3300005536 Bacteria 1307
96 Ga0070697_100365298 3300005536 Unclassified 1248
97 Ga0070697_100532938 3300005536 Bacteria 1029
98 Ga0070697_100944025 3300005536 Unclassified 766
99 Ga0070686_100091418 3300005544 Bacteria 2036
100 Ga0070695_100000003 3300005545 Bacteria 111545
101 Ga0070695_100197941 3300005545 Bacteria 1434
102 Ga0070696_100255123 3300005546 Bacteria 1328
103 Ga0070696_100331914 3300005546 Bacteria 1173
104 Ga0070696_101801681 3300005546 Bacteria 529
105 Ga0070693_100001852 3300005547 Bacteria 9664
106 Ga0070704_101147233 3300005549 Bacteria 707
107 Ga0068855_100015594 3300005563 Bacteria 9143
108 Ga0068855_100044514 3300005563 Bacteria 5251
109 Ga0068855_100239117 3300005563 Bacteria 2030
110 Ga0068857_100350010 3300005577 Bacteria 1368
111 Ga0068857_100364512 3300005577 Bacteria 1340
112 Ga0068857_101760455 3300005577 Bacteria 606
113 Ga0068854_101012864 3300005578 Bacteria 736
114 Ga0068856_100023327 3300005614 Bacteria 6016
115 Ga0068856_100230631 3300005614 Bacteria 1867
116 Ga0068856_100330551 3300005614 Bacteria 1542
117 Ga0068856_100429430 3300005614 Bacteria 1341
118 Ga0068856_101240227 3300005614 Bacteria 762
119 Ga0070702_100246759 3300005615 Bacteria 1208
120 Ga0068852_101470636 3300005616 Bacteria 703
121 Ga0068866_10938474 3300005718 Unclassified 611
122 Ga0068870_10121360 3300005840 Bacteria 1506
123 Ga0068863_100169003 3300005841 Bacteria 2097
124 Ga0068863_101842486 3300005841 Bacteria 615
125 Ga0070717_10006950 3300006028 Bacteria 8362
126 Ga0070717_10017759 3300006028 Bacteria 5541
127 Ga0070717_10021347 3300006028 Bacteria 5102
128 Ga0070717_10027430 3300006028 Bacteria 4552
129 Ga0070717_10030201 3300006028 Bacteria 4354
130 Ga0070717_10772105 3300006028 Bacteria 874
131 Ga0070717_11517073 3300006028 Bacteria 608
132 Ga0070715_10002011 3300006163 Bacteria 6131
133 Ga0070716_100004105 3300006173 Bacteria 6909
134 Ga0070716_100031456 3300006173 Bacteria 2886
135 Ga0070712_100024588 3300006175 Bacteria 3994
136 Ga0070712_100277498 3300006175 Bacteria 1349
137 Ga0070712_100751833 3300006175 Bacteria 834
138 Ga0070712_100796032 3300006175 Unclassified 811
139 Ga0070712_100874555 3300006175 Unclassified 774
140 Ga0070712_100988340 3300006175 Bacteria 728
141 Ga0097621_100164799 3300006237 Bacteria 1908
142 Ga0097621_100206263 3300006237 Bacteria 1708
143 Ga0097621_100582801 3300006237 Bacteria 1021
144 Ga0068871_100028151 3300006358 Bacteria 4403
145 Ga0068871_100209122 3300006358 Bacteria 1687
146 Ga0068871_100266399 3300006358 Bacteria 1496
147 Ga0068871_100902970 3300006358 Unclassified 819
148 Ga0075433_10357602 3300006852 Bacteria 1290
149 Ga0075433_10417106 3300006852 Bacteria 1184
150 Ga0075433_11315633 3300006852 Bacteria 626
151 Ga0075433_11560194 3300006852 Unclassified 570
152 Ga0075434_100053570 3300006871 Bacteria 4008
153 Ga0075434_100150987 3300006871 Bacteria 2343
154 Ga0075434_100163639 3300006871 Bacteria 2245
155 Ga0075434_100346944 3300006871 Bacteria 1505
156 Ga0075434_100695158 3300006871 Unclassified 1035
157 Ga0068865_100700967 3300006881 Bacteria 865
158 Ga0075435_100034410 3300007076 Bacteria 4014
159 Ga0075435_100230618 3300007076 Bacteria 1573
160 Ga0075435_100413035 3300007076 Bacteria 1162
161 Ga0105240_10053723 3300009093 Bacteria 5054
162 Ga0105240_10244655 3300009093 Bacteria 2078
163 Ga0105240_10266310 3300009093 Bacteria 1975
164 Ga0105240_10412394 3300009093 Bacteria 1519
165 Ga0105245_10144131 3300009098 Bacteria 2246
166 Ga0105245_10248959 3300009098 Bacteria 1725
167 Ga0105245_11395512 3300009098 Bacteria 750
168 Ga0105247_11104883 3300009101 Bacteria 626
169 Ga0114129_10954462 3300009147 Bacteria 1083
170 Ga0105243_10075126 3300009148 Bacteria 2742
171 Ga0105243_10101554 3300009148 Bacteria 2388
172 Ga0105243_10341224 3300009148 Bacteria 1372
173 Ga0105241_10109855 3300009174 Bacteria 2206
174 Ga0105242_10043710 3300009176 Bacteria 3625
175 Ga0105242_10084950 3300009176 Bacteria 2653
176 Ga0105242_10163927 3300009176 Bacteria 1948
177 Ga0105242_12137556 3300009176 Bacteria 604
178 Ga0105242_12592182 3300009176 Unclassified 556
179 Ga0105248_10168095 3300009177 Bacteria 2472
180 Ga0105248_10331001 3300009177 Bacteria 1715
181 Ga0105248_10397209 3300009177 Unclassified 1552
182 Ga0105237_10476229 3300009545 Bacteria 1255
183 Ga0105237_12191029 3300009545 Bacteria 562
184 Ga0105238_10304633 3300009551 Bacteria 1577
185 Ga0105238_10662535 3300009551 Bacteria 1054
186 Ga0105239_10659976 3300010375 Unclassified 1195
187 Ga0105239_12861348 3300010375 Bacteria 563
188 Ga0105246_10032406 3300011119 Bacteria 3465
189 Ga0105246_11373586 3300011119 Bacteria 658
190 Ga0157373_11242153 3300013100 Bacteria 562
191 Ga0157370_10005691 3300013104 Bacteria 13930
192 Ga0157369_10032553 3300013105 Bacteria 5733
193 Ga0157369_10139012 3300013105 Bacteria 2571
194 Ga0157369_10491344 3300013105 Unclassified 1270
195 Ga0157369_10592755 3300013105 Bacteria 1144
196 Ga0157369_11398126 3300013105 Bacteria 712
197 Ga0157374_10192731 3300013296 Bacteria 1994
198 Ga0157374_11326527 3300013296 Bacteria 742
199 Ga0157378_10185952 3300013297 Unclassified 1957
200 Ga0157378_10584486 3300013297 Bacteria 1126
201 Ga0163162_10520728 3300013306 Unclassified 1319
202 Ga0163162_10693529 3300013306 Bacteria 1140
203 Ga0163162_12019709 3300013306 Bacteria 661
204 Ga0157372_10327048 3300013307 Bacteria 1785
205 Ga0157372_10407554 3300013307 Bacteria 1584
206 Ga0157372_10898072 3300013307 Bacteria 1028
207 Ga0157375_10082222 3300013308 Bacteria 3262
208 Ga0157375_10407173 3300013308 Bacteria 1527
209 Ga0157375_10498899 3300013308 Bacteria 1381
210 Ga0163163_11129674 3300014325 Bacteria 846
211 Ga0163163_11512249 3300014325 Bacteria 733
212 Ga0157380_11481919 3300014326 Bacteria 731
213 Ga0182008_10005743 3300014497 Bacteria 7025
214 Ga0157379_10253928 3300014968 Bacteria 1597
215 Ga0157376_10007490 3300014969 Bacteria 7799
216 Ga0157376_10152755 3300014969 Bacteria 2084
217 Ga0182006_1036896 3300015261 Bacteria 1941
218 Ga0182007_10027794 3300015262 Bacteria 1948
219 Ga0182007_10036157 3300015262 Bacteria 1662
220 Ga0197907_10589986 3300020069 Bacteria 3146
221 Ga0197907_10777264 3300020069 Bacteria 1176
222 Ga0197907_11035475 3300020069 Bacteria 1382
223 Ga0197907_11238147 3300020069 Bacteria 1653
224 Ga0206356_10418925 3300020070 Bacteria 5905
225 Ga0206356_10822865 3300020070 Bacteria 1085
226 Ga0206356_11230150 3300020070 Bacteria 2988
227 Ga0206356_11855689 3300020070 Bacteria 1909
228 Ga0206349_1009309 3300020075 Bacteria 1749
229 Ga0206349_1109861 3300020075 Bacteria 559
230 Ga0206351_10930327 3300020077 Unclassified 545
231 Ga0206352_10295053 3300020078 Unclassified 1185
232 Ga0206352_10468852 3300020078 Bacteria 1127
233 Ga0206352_10674228 3300020078 Unclassified 1161
234 Ga0206350_10604927 3300020080 Unclassified 705
235 Ga0206350_10822870 3300020080 Unclassified 795
236 Ga0206350_11487435 3300020080 Bacteria 593
237 Ga0206354_10111255 3300020081 Bacteria 3340
238 Ga0206354_10660180 3300020081 Bacteria 562
239 Ga0206354_10928650 3300020081 Bacteria 3337
240 Ga0206354_11113594 3300020081 Bacteria 5230
241 Ga0206354_11356773 3300020081 Bacteria 653
242 Ga0206354_11530171 3300020081 Bacteria 544
243 Ga0206353_10854756 3300020082 Bacteria 9578
244 Ga0206353_10918167 3300020082 Bacteria 4663
245 Ga0206353_11349432 3300020082 Bacteria 4280
246 Ga0224712_10049988 3300022467 Bacteria 1622
247 Ga0224712_10076579 3300022467 Bacteria 1371
248 Ga0224712_10087425 3300022467 Bacteria 1299
249 Ga0224712_10631060 3300022467 Bacteria 524
250 Ga0224712_10682337 3300022467 Bacteria 505
251 Ga0207692_10462419 3300025898 Bacteria 800
252 Ga0207642_10255626 3300025899 Bacteria 996
253 Ga0207642_10336915 3300025899 Bacteria 886
254 Ga0207699_10007356 3300025906 Bacteria 5384
255 Ga0207699_11162077 3300025906 Bacteria 572
256 Ga0207643_10388001 3300025908 Bacteria 881
257 Ga0207705_10014632 3300025909 Bacteria 5645
258 Ga0207705_10120284 3300025909 Bacteria 1948
259 Ga0207684_10428542 3300025910 Unclassified 1136
260 Ga0207684_10472720 3300025910 Unclassified 1075
261 Ga0207707_10025403 3300025912 Bacteria 5182
262 Ga0207707_10106756 3300025912 Bacteria 2448
263 Ga0207707_10107397 3300025912 Bacteria 2440
264 Ga0207707_10138297 3300025912 Bacteria 2129
265 Ga0207707_10199680 3300025912 Bacteria 1744
266 Ga0207707_10229390 3300025912 Bacteria 1616
267 Ga0207707_10362876 3300025912 Unclassified 1247
268 Ga0207707_10386256 3300025912 Bacteria 1203
269 Ga0207695_10099287 3300025913 Unclassified 2909
270 Ga0207695_10270833 3300025913 Bacteria 1594
271 Ga0207695_10373182 3300025913 Unclassified 1313
272 Ga0207695_10486889 3300025913 Bacteria 1116
273 Ga0207695_10498230 3300025913 Bacteria 1100
274 Ga0207671_10227672 3300025914 Bacteria 1462
275 Ga0207671_11404558 3300025914 Bacteria 541
276 Ga0207693_10013795 3300025915 Bacteria 6505
277 Ga0207693_10062148 3300025915 Bacteria 2926
278 Ga0207693_10149242 3300025915 Bacteria 1838
279 Ga0207693_10154333 3300025915 Bacteria 1806
280 Ga0207693_10159884 3300025915 Bacteria 1772
281 Ga0207693_10181970 3300025915 Bacteria 1654
282 Ga0207693_10264668 3300025915 Unclassified 1348
283 Ga0207693_10629982 3300025915 Bacteria 834
284 Ga0207693_11347001 3300025915 Unclassified 532
285 Ga0207663_10121719 3300025916 Bacteria 1788
286 Ga0207663_10477949 3300025916 Bacteria 965
287 Ga0207663_11612336 3300025916 Bacteria 522
288 Ga0207660_10007441 3300025917 Bacteria 7086
289 Ga0207660_10054159 3300025917 Bacteria 2862
290 Ga0207660_10067098 3300025917 Bacteria 2597
291 Ga0207660_10416856 3300025917 Bacteria 1083
292 Ga0207660_10513825 3300025917 Bacteria 972
293 Ga0207660_11019608 3300025917 Bacteria 675
294 Ga0207657_10000331 3300025919 Bacteria 50115
295 Ga0207657_10051361 3300025919 Bacteria 3583
296 Ga0207657_10061155 3300025919 Bacteria 3231
297 Ga0207657_10350420 3300025919 Bacteria 1164
298 Ga0207649_10087175 3300025920 Bacteria 2036
299 Ga0207649_10088948 3300025920 Bacteria 2018
300 Ga0207649_10872583 3300025920 Unclassified 705
301 Ga0207652_10007747 3300025921 Bacteria 8625
302 Ga0207652_10097191 3300025921 Bacteria 2595
303 Ga0207652_10133898 3300025921 Bacteria 2212
304 Ga0207652_10165856 3300025921 Bacteria 1981
305 Ga0207652_10183337 3300025921 Unclassified 1882
306 Ga0207652_11035037 3300025921 Unclassified 720
307 Ga0207652_11138739 3300025921 Bacteria 681
308 Ga0207646_10000129 3300025922 Bacteria 102411
309 Ga0207646_10026256 3300025922 Bacteria 5317
310 Ga0207646_10735773 3300025922 Bacteria 881
311 Ga0207659_10451447 3300025926 Bacteria 1083
312 Ga0207659_10880250 3300025926 Bacteria 770
313 Ga0207687_10002002 3300025927 Bacteria 14006
314 Ga0207687_10156053 3300025927 Bacteria 1746
315 Ga0207687_11939162 3300025927 Unclassified 503
316 Ga0207700_10000036 3300025928 Bacteria 119429
317 Ga0207700_10018638 3300025928 Bacteria 4671
318 Ga0207700_10037237 3300025928 Bacteria 3521
319 Ga0207700_10070616 3300025928 Bacteria 2685
320 Ga0207700_10183054 3300025928 Unclassified 1756
321 Ga0207700_11211493 3300025928 Bacteria 674
322 Ga0207664_10005201 3300025929 Bacteria 8871
323 Ga0207664_10112603 3300025929 Bacteria 2265
324 Ga0207664_10139948 3300025929 Bacteria 2046
325 Ga0207664_10150738 3300025929 Bacteria 1975
326 Ga0207664_10174776 3300025929 Bacteria 1840
327 Ga0207664_11580503 3300025929 Unclassified 578
328 Ga0207644_10140113 3300025931 Bacteria 1862
329 Ga0207644_11465445 3300025931 Bacteria 573
330 Ga0207690_10016151 3300025932 Bacteria 4539
331 Ga0207686_10002712 3300025934 Bacteria 9609
332 Ga0207709_10126658 3300025935 Bacteria 1733
333 Ga0207670_11720586 3300025936 Unclassified 533
334 Ga0207665_10000716 3300025939 Bacteria 22500
335 Ga0207665_10006441 3300025939 Bacteria 7790
336 Ga0207665_10742948 3300025939 Bacteria 773
337 Ga0207665_10932085 3300025939 Bacteria 689
338 Ga0207665_11207019 3300025939 Unclassified 603
339 Ga0207711_10163950 3300025941 Bacteria 2014
340 Ga0207661_10000153 3300025944 Bacteria 44357
341 Ga0207661_10009928 3300025944 Bacteria 6836
342 Ga0207661_10038853 3300025944 Bacteria 3733
343 Ga0207661_10117614 3300025944 Bacteria 2258
344 Ga0207661_10123709 3300025944 Bacteria 2206
345 Ga0207661_10167664 3300025944 Bacteria 1910
346 Ga0207661_10890369 3300025944 Unclassified 820
347 Ga0207679_10034583 3300025945 Bacteria 3567
348 Ga0207679_10285951 3300025945 Bacteria 1416
349 Ga0207667_10020985 3300025949 Bacteria 7245
350 Ga0207667_10193880 3300025949 Bacteria 2084
351 Ga0207667_10267163 3300025949 Bacteria 1749
352 Ga0207667_11036521 3300025949 Bacteria 806
353 Ga0207640_10314717 3300025981 Bacteria 1244
354 Ga0207677_10007839 3300026023 Bacteria 5932
355 Ga0207677_10350257 3300026023 Bacteria 1237
356 Ga0207703_11557779 3300026035 Bacteria 636
357 Ga0207639_10333782 3300026041 Bacteria 1350
358 Ga0207678_10877289 3300026067 Bacteria 793
359 Ga0207708_10696911 3300026075 Bacteria 868
360 Ga0207702_10002831 3300026078 Bacteria 16231
361 Ga0207702_10086354 3300026078 Bacteria 2736
362 Ga0207702_10180699 3300026078 Bacteria 1943
363 Ga0207702_10354177 3300026078 Bacteria 1405
364 Ga0207641_10274558 3300026088 Bacteria 1583
365 Ga0207641_12078639 3300026088 Unclassified 569
366 Ga0207648_11099597 3300026089 Bacteria 745
367 Ga0207674_10266240 3300026116 Bacteria 1661
368 Ga0207674_10387798 3300026116 Bacteria 1350
369 Ga0207675_100301235 3300026118 Bacteria 1561
370 Ga0207683_10115722 3300026121 Bacteria 2404
371 Ga0207683_10160367 3300026121 Bacteria 2033
372 Ga0207698_10333122 3300026142 Unclassified 1426
373 Ga0207698_10423826 3300026142 Bacteria 1278
374 Ga0207698_12579660 3300026142 Unclassified 518
375 Ga0268266_10300172 3300028379 Bacteria 1498
376 Ga0265319_1004366 3300028563 Bacteria 7009
377 Ga0265319_1056041 3300028563 Bacteria 1288
378 Ga0265334_10060663 3300028573 Bacteria 1427
379 Ga0265318_10013117 3300028577 Bacteria 3512
380 Ga0265322_10032236 3300028654 Bacteria 1495
381 Ga0265338_10044681 3300028800 Bacteria 4085
382 Ga0265330_10032228 3300031235 Bacteria 2348
383 Ga0265320_10038423 3300031240 Bacteria 2401
384 Ga0265325_10312552 3300031241 Unclassified 699
385 Ga0265329_10065229 3300031242 Bacteria 1152
386 Ga0265339_10052859 3300031249 Bacteria 2211
387 Ga0265331_10024994 3300031250 Bacteria 3017
388 Ga0265327_10024417 3300031251 Bacteria 3553
389 Ga0265327_10426389 3300031251 Bacteria 574
390 Ga0265316_10050466 3300031344 Bacteria 3271
391 Ga0265314_10047958 3300031711 Bacteria 3002
392 Ga0265314_10345149 3300031711 Bacteria 821
393 Ga0373959_0152494 3300034820 Bacteria 585
394 Ga0373926_0010144 3300035083 Bacteria 3153
395 Ga0373934_0185184 3300035086 Bacteria 856
396 Ga0373944_0189419 3300035089 Unclassified 741
397 Ga0373951_0013573 3300035091 Bacteria 1831
398 Ga0373923_0261462 3300035111 Bacteria 812
399 Ga0373936_0064043 3300035113 Bacteria 1506
400 Ga0373936_0136139 3300035113 Bacteria 1058
401 Ga0373945_0008136 3300035116 Bacteria 3409
402 Ga0373945_0015496 3300035116 Bacteria 2566
403 Ga0373945_0021885 3300035116 Bacteria 2200
404 Ga0373945_0405744 3300035116 Bacteria 598
405 Ga0373954_0414069 3300035118 Bacteria 667
406 Ga0373956_0505953 3300035119 Bacteria 576
407 Ga0373943_0000048 3300035170 Bacteria 41033
408 Ga0373943_0000685 3300035170 Bacteria 14788
409 Ga0373943_0745213 3300035170 Bacteria 582
410 Ga0373946_0009234 3300035171 Bacteria 3628
411 Ga0373955_0264570 3300035172 Bacteria 1033
412 Ga0373924_0156056 3300035410 Unclassified 1000
413 Ga0373935_0021359 3300035692 Bacteria 3964
414 Ga0373935_0065680 3300035692 Bacteria 2329
415 Ga0373927_0012161 3300035695 Bacteria 5725
416 Ga0373927_0042475 3300035695 Bacteria 2945
417 Ga0373927_0058785 3300035695 Bacteria 2487
418 Ga0373933_0240788 3300035724 Bacteria 1164
419 Ga0373933_0472663 3300035724 Bacteria 821
420 Ga0373947_0002244 3300035725 Bacteria 11689
421 Ga0373947_0002751 3300035725 Bacteria 10526
422 Ga0373947_0473517 3300035725 Bacteria 849
423 Ga0373947_1020353 3300035725 Bacteria 564
424 Ga0373937_0460508 3300036401 Bacteria 1208
425 Ga0373937_0472354 3300036401 Bacteria 1191
426 Ga0373937_0664447 3300036401 Unclassified 988
427 Ga0373937_0837873 3300036401 Bacteria 868
428 Ga0373925_0004043 3300037068 Bacteria 11141
429 Ga0373925_0014494 3300037068 Bacteria 5697
430 Ga0373925_0026473 3300037068 Bacteria 4243
431 Ga0395899_0344313 3300037312 Bacteria 999
432 Ga0395900_0125204 3300037418 Bacteria 2636
433 Ga0395900_0463473 3300037418 Bacteria 1222
434 Ga0395900_0504989 3300037418 Bacteria 1159
435 Ga0395900_1042242 3300037418 Bacteria 737
436 Ga0395898_0471895 3300037466 Bacteria 1194
437 Ga0395898_0505219 3300037466 Bacteria 1150
438 Ga0395898_0563672 3300037466 Bacteria 1081
439 Ga0395898_1625040 3300037466 Bacteria 570
440 Ga0395905_1359942 3300037471 Bacteria 614
441 Ga0395901_0129091 3300038443 Bacteria 2657
442 Ga0395901_0162696 3300038443 Bacteria 2344
443 Ga0395901_0181546 3300038443 Bacteria 2207
444 Ga0395901_1433605 3300038443 Unclassified 648
445 Ga0436360_0951907 3300039438 Bacteria 1541
446 Ga0436362_0108004 3300039453 Bacteria 717
447 Ga0451795_0066248 3300041456 Bacteria 684
448 Ga0451839_0426424 3300041496 Bacteria 859
449 Ga0466969_0000842 3300044656 Bacteria 16661
450 Ga0466969_0004072 3300044656 Bacteria 7750
451 Ga0466969_0075746 3300044656 Bacteria 1612
452 Ga0466969_0515156 3300044656 Bacteria 546
453 Ga0453683_0863321 3300044673 Bacteria 597
454 Ga0466965_0017811 3300044683 Bacteria 3397
455 Ga0466965_0137224 3300044683 Bacteria 1271
456 Ga0466965_0374188 3300044683 Bacteria 783
457 Ga0466966_0019638 3300044684 Bacteria 4446
458 Ga0466966_0025858 3300044684 Bacteria 3834
459 Ga0466966_0072370 3300044684 Bacteria 2158
460 Ga0466966_0110869 3300044684 Bacteria 1691
461 Ga0466966_0121364 3300044684 Bacteria 1605
462 Ga0466966_0172808 3300044684 Bacteria 1312
463 Ga0466966_0265844 3300044684 Bacteria 1032
464 Ga0466961_0006416 3300044693 Bacteria 7469
465 Ga0466961_0016296 3300044693 Bacteria 4773
466 Ga0466961_0041683 3300044693 Bacteria 2943
467 Ga0466961_0078398 3300044693 Bacteria 2092
468 Ga0466963_0000768 3300044694 Bacteria 15875
469 Ga0466963_0001745 3300044694 Bacteria 11840
470 Ga0466963_0001777 3300044694 Bacteria 11736
471 Ga0466963_0002439 3300044694 Bacteria 10401
472 Ga0466963_0003819 3300044694 Bacteria 8685
473 Ga0466963_0007553 3300044694 Bacteria 6488
474 Ga0466963_0024908 3300044694 Bacteria 3811
475 Ga0466963_0027782 3300044694 Bacteria 3627
476 Ga0466963_0037939 3300044694 Bacteria 3149
477 Ga0466963_0071413 3300044694 Bacteria 2336
478 Ga0466963_0088170 3300044694 Bacteria 2111
479 Ga0466963_0091552 3300044694 Bacteria 2071
480 Ga0466963_0121532 3300044694 Unclassified 1798
481 Ga0466963_0210761 3300044694 Bacteria 1359
482 Ga0466963_0518397 3300044694 Bacteria 842
483 Ga0466963_1137526 3300044694 Bacteria 549
484 Ga0466963_1301669 3300044694 Bacteria 510
485 Ga0466964_0001896 3300044706 Bacteria 7302
486 Ga0466964_0002170 3300044706 Bacteria 6937
487 Ga0466964_0013934 3300044706 Bacteria 3053
488 Ga0466964_0029103 3300044706 Bacteria 2179
489 Ga0466964_0064074 3300044706 Bacteria 1537
490 Ga0466964_0385655 3300044706 Unclassified 728
491 Ga0466964_0421196 3300044706 Bacteria 702
492 Ga0466964_0671534 3300044706 Bacteria 575
493 Ga0466971_0001398 3300044719 Bacteria 10130
494 Ga0466971_0006829 3300044719 Bacteria 4966
495 Ga0466971_0028646 3300044719 Bacteria 2491
496 Ga0466971_0077393 3300044719 Bacteria 1514
497 Ga0466971_0098841 3300044719 Bacteria 1340
498 Ga0466971_0661718 3300044719 Bacteria 523
499 Ga0466968_0031264 3300044735 Bacteria 2208
500 Ga0466968_0032205 3300044735 Bacteria 2179
501 Ga0466968_0036509 3300044735 Bacteria 2060
502 Ga0466968_0052237 3300044735 Bacteria 1748
503 Ga0466968_0064943 3300044735 Bacteria 1579
504 Ga0466968_0096907 3300044735 Bacteria 1313
505 Ga0466968_0124879 3300044735 Bacteria 1167
506 Ga0466968_0178214 3300044735 Bacteria 987
507 Ga0466970_0098231 3300044765 Bacteria 1593
508 Ga0466970_0148286 3300044765 Bacteria 1295
509 Ga0466970_0580063 3300044765 Bacteria 649
510 Ga0466957_0000936 3300044842 Bacteria 14934
511 Ga0466957_0020308 3300044842 Bacteria 3908
512 Ga0466957_0022022 3300044842 Bacteria 3757
513 Ga0466957_0024494 3300044842 Bacteria 3571
514 Ga0466957_0042911 3300044842 Bacteria 2737
515 Ga0466957_0097137 3300044842 Bacteria 1852
516 Ga0466957_0114251 3300044842 Bacteria 1715
517 Ga0466957_0133885 3300044842 Bacteria 1591
518 Ga0466957_0147819 3300044842 Bacteria 1518
519 Ga0466957_0221069 3300044842 Bacteria 1251
520 Ga0466960_0044545 3300044901 Bacteria 2116
521 Ga0466960_0054487 3300044901 Bacteria 1942
522 Ga0466960_0743900 3300044901 Unclassified 591
523 Ga0466959_0004897 3300045049 Bacteria 9067
524 Ga0466959_0012854 3300045049 Bacteria 6057
525 Ga0466959_0020896 3300045049 Bacteria 4825
526 Ga0466959_0026355 3300045049 Bacteria 4308
527 Ga0466959_0033913 3300045049 Bacteria 3776
528 Ga0466959_1121566 3300045049 Bacteria 523
529 Ga0451576_1694029 3300045051 Bacteria 655
530 Ga0466958_0002388 3300045836 Bacteria 9400
531 Ga0466958_0002635 3300045836 Bacteria 9070
532 Ga0466958_0003001 3300045836 Bacteria 8647
533 Ga0466958_0004176 3300045836 Bacteria 7587
534 Ga0466958_0021359 3300045836 Bacteria 3781
535 Ga0466958_0043813 3300045836 Bacteria 2696
536 Ga0466958_0056855 3300045836 Bacteria 2377
537 Ga0466958_0067910 3300045836 Bacteria 2178
538 Ga0466958_0208862 3300045836 Bacteria 1243
539 Ga0466958_0224364 3300045836 Bacteria 1199
540 Ga0466958_0239138 3300045836 Unclassified 1160
541 Ga0466958_0268988 3300045836 Bacteria 1091
542 Ga0466967_0001386 3300045976 Bacteria 13990
543 Ga0466967_0006433 3300045976 Bacteria 8310
544 Ga0466967_0008724 3300045976 Bacteria 7464
545 Ga0466967_0021581 3300045976 Bacteria 5235
546 Ga0466967_0022089 3300045976 Bacteria 5184
547 Ga0466967_0046731 3300045976 Bacteria 3770
548 Ga0466967_0055137 3300045976 Bacteria 3501
549 Ga0466967_0086288 3300045976 Bacteria 2843
550 Ga0466967_0093421 3300045976 Bacteria 2737
551 Ga0466967_0111020 3300045976 Bacteria 2519
552 Ga0466967_0117893 3300045976 Bacteria 2448
553 Ga0466967_0278196 3300045976 Bacteria 1605
554 Ga0466967_0319298 3300045976 Bacteria 1497
555 Ga0466967_0343144 3300045976 Bacteria 1444
556 Ga0466967_0453499 3300045976 Bacteria 1253
557 Ga0466967_0585853 3300045976 Unclassified 1100
558 Ga0466967_0876124 3300045976 Bacteria 892
559 Ga0466967_1250787 3300045976 Bacteria 739
560 Ga0466967_2043506 3300045976 Bacteria 569
561 Ga0466967_2501360 3300045976 Bacteria 511
562 Ga0495592_0056902 3300046454 Bacteria 2888
563 Ga0495592_0071165 3300046454 Bacteria 2532
564 Ga0495592_0309658 3300046454 Unclassified 1024
565 Ga0495592_0317017 3300046454 Bacteria 1009
566 Ga0495603_0016728 3300046455 Bacteria 4436
567 Ga0495603_0028893 3300046455 Bacteria 3345
568 Ga0495629_0000159 3300046459 Bacteria 59616
569 Ga0495629_0010159 3300046459 Bacteria 6862
570 Ga0495629_0030459 3300046459 Bacteria 3825
571 Ga0495629_0137646 3300046459 Bacteria 1700
572 Ga0495629_0147555 3300046459 Bacteria 1635
573 Ga0495629_0229927 3300046459 Bacteria 1278
574 Ga0495629_0441701 3300046459 Bacteria 881
575 Ga0495641_0002695 3300046461 Bacteria 13801
576 Ga0495641_0009222 3300046461 Bacteria 5892
577 Ga0495641_0520777 3300046461 Unclassified 542
578 Ga0495651_0035829 3300046462 Bacteria 3863
579 Ga0495651_0105648 3300046462 Bacteria 2088
580 Ga0495651_0112045 3300046462 Bacteria 2016
581 Ga0495651_0147514 3300046462 Unclassified 1699
582 Ga0495651_0244697 3300046462 Bacteria 1228
583 Ga0495651_0448389 3300046462 Bacteria 834
584 Ga0495651_0846652 3300046462 Unclassified 562
585 Ga0495653_0016911 3300046463 Bacteria 5933
586 Ga0495653_0057407 3300046463 Bacteria 2962
587 Ga0495653_0069160 3300046463 Bacteria 2646
588 Ga0495653_0109752 3300046463 Bacteria 1985
589 Ga0495653_0314202 3300046463 Bacteria 1018
590 Ga0495580_0022526 3300046472 Bacteria 4635
591 Ga0495582_0000036 3300046473 Bacteria 71283
592 Ga0495582_0042097 3300046473 Bacteria 2516
593 Ga0495582_0059376 3300046473 Unclassified 2110
594 Ga0495582_0078245 3300046473 Bacteria 1834
595 Ga0495582_0118557 3300046473 Bacteria 1490
596 Ga0495605_0092480 3300046474 Bacteria 1400
597 Ga0495639_0001197 3300046475 Bacteria 11707
598 Ga0495639_0029376 3300046475 Bacteria 2440
599 Ga0495639_0171242 3300046475 Bacteria 1054
600 Ga0495662_0003844 3300046476 Bacteria 7571
601 Ga0495664_0018479 3300046477 Bacteria 3995
602 Ga0495664_0136521 3300046477 Bacteria 1486
603 Ga0495664_0177344 3300046477 Unclassified 1292
604 Ga0495664_0466565 3300046477 Bacteria 755
605 Ga0495585_0041719 3300046492 Bacteria 2573
606 Ga0495594_0049960 3300046499 Unclassified 2300
607 Ga0495594_0310944 3300046499 Unclassified 898
608 Ga0495594_0402442 3300046499 Bacteria 779
609 Ga0495594_0503303 3300046499 Unclassified 688
610 Ga0495594_0673902 3300046499 Bacteria 585
611 Ga0495596_0130879 3300046500 Bacteria 974
612 Ga0495607_0282902 3300046501 Bacteria 786
613 Ga0495608_0198905 3300046511 Bacteria 1263
614 Ga0495608_0226250 3300046511 Bacteria 1172
615 Ga0495608_0256957 3300046511 Bacteria 1088
616 Ga0495608_0346922 3300046511 Bacteria 914
617 Ga0495618_0098067 3300046514 Bacteria 1875
618 Ga0495618_0476620 3300046514 Unclassified 755
619 Ga0495618_0594951 3300046514 Unclassified 659
620 Ga0495628_0154580 3300046516 Bacteria 1746
621 Ga0495628_0882640 3300046516 Bacteria 621
622 Ga0495628_1197341 3300046516 Bacteria 515
623 Ga0495630_0004782 3300046517 Bacteria 9498
624 Ga0495630_0018175 3300046517 Bacteria 5162
625 Ga0495630_0095762 3300046517 Bacteria 2244
626 Ga0495630_0346132 3300046517 Bacteria 1137
627 Ga0495630_0803836 3300046517 Unclassified 718
628 Ga0495631_0049048 3300046518 Bacteria 1850
629 Ga0495637_0135657 3300046520 Bacteria 937
630 Ga0495644_0001492 3300046523 Bacteria 9540
631 Ga0495663_0227259 3300046525 Bacteria 657
632 Ga0495666_0002137 3300046526 Bacteria 9819
633 Ga0495666_0529734 3300046526 Unclassified 526
634 Ga0495652_0088127 3300046529 Bacteria 2544
635 Ga0495652_0105994 3300046529 Bacteria 2270
636 Ga0495652_0235158 3300046529 Bacteria 1367
637 Ga0495652_0803946 3300046529 Unclassified 626
638 Ga0495652_0867497 3300046529 Bacteria 597
639 Ga0495665_0455393 3300046531 Bacteria 646
640 Ga0495665_0645141 3300046531 Unclassified 527
641 Ga0495640_0032678 3300046533 Bacteria 3704
642 Ga0495640_0110004 3300046533 Bacteria 1801
643 Ga0495586_0016243 3300046535 Bacteria 3959
644 Ga0495586_0136460 3300046535 Bacteria 1375
645 Ga0495586_0452715 3300046535 Bacteria 740
646 Ga0495586_0581845 3300046535 Bacteria 647
647 Ga0495587_0216494 3300046536 Bacteria 1081
648 Ga0495587_0259394 3300046536 Bacteria 976
649 Ga0495587_0323471 3300046536 Unclassified 861
650 Ga0495587_0657815 3300046536 Bacteria 575
651 Ga0495587_0690007 3300046536 Bacteria 560
652 Ga0495598_0128874 3300046537 Unclassified 865
653 Ga0495645_0081206 3300046543 Bacteria 2326
654 Ga0495645_0110078 3300046543 Bacteria 1950
655 Ga0495645_0597771 3300046543 Bacteria 679
656 Ga0495645_0750593 3300046543 Bacteria 589
657 Ga0495667_0084220 3300046559 Bacteria 2064
658 Ga0495667_0093000 3300046559 Bacteria 1952
659 Ga0495667_0108861 3300046559 Unclassified 1790
660 Ga0495667_0306109 3300046559 Bacteria 1006
661 Ga0495667_0384729 3300046559 Bacteria 884
662 Ga0495667_0457616 3300046559 Bacteria 801
663 Ga0495656_0000672 3300046615 Bacteria 10975
664 Ga0495634_0018092 3300046642 Bacteria 5020
665 Ga0495634_0040709 3300046642 Bacteria 3158
666 Ga0495634_0065359 3300046642 Bacteria 2411
667 Ga0495611_0022727 3300046648 Bacteria 2715
668 Ga0495635_0038756 3300046663 Bacteria 3298
669 Ga0495635_0272923 3300046663 Bacteria 1137
670 Ga0495635_0742033 3300046663 Bacteria 635
671 Ga0495659_0451116 3300046664 Bacteria 560
672 Ga0495661_0050966 3300046665 Bacteria 2502
673 Ga0495588_0167292 3300046674 Bacteria 1163
674 Ga0495588_0182258 3300046674 Bacteria 1110
675 Ga0495588_0697703 3300046674 Bacteria 531
676 Ga0495657_0034744 3300046675 Bacteria 3499
677 Ga0495657_0037950 3300046675 Bacteria 3317
678 Ga0495657_0055931 3300046675 Bacteria 2631
679 Ga0495657_0719482 3300046675 Unclassified 573
680 Ga0495599_0371656 3300046678 Unclassified 855
681 Ga0495599_0448368 3300046678 Bacteria 764
682 Ga0495599_0595524 3300046678 Bacteria 644
683 Ga0495646_0025809 3300046680 Bacteria 3694
684 Ga0495646_0094551 3300046680 Bacteria 1721
685 Ga0495646_0259731 3300046680 Bacteria 928
686 Ga0495646_0505782 3300046680 Bacteria 620
687 Ga0495647_0001238 3300046681 Bacteria 7877
688 Ga0495647_0004455 3300046681 Bacteria 4551
689 Ga0495647_0020964 3300046681 Bacteria 2350
690 Ga0495658_0029366 3300046683 Bacteria 2976
691 Ga0495658_0091185 3300046683 Bacteria 1805
692 Ga0495658_0108637 3300046683 Bacteria 1665
693 Ga0495658_0406005 3300046683 Unclassified 869
694 Ga0495658_0434581 3300046683 Bacteria 838
695 Ga0495613_0001777 3300046689 Bacteria 16372
696 Ga0495613_0027163 3300046689 Bacteria 4259
697 Ga0495613_0431518 3300046689 Unclassified 895
698 Ga0495613_0631434 3300046689 Bacteria 710
699 Ga0495613_1006931 3300046689 Bacteria 535
700 Ga0495613_1107328 3300046689 Bacteria 505
701 Ga0495624_0002893 3300046690 Bacteria 12849
702 Ga0495624_0003155 3300046690 Bacteria 12286
703 Ga0495624_0035813 3300046690 Bacteria 3203
704 Ga0495624_0744529 3300046690 Bacteria 581
705 Ga0495670_0414714 3300046691 Bacteria 728
706 Ga0495589_0542491 3300046794 Bacteria 530
707 Ga0495600_0016740 3300046809 Bacteria 4659
708 Ga0495600_0029027 3300046809 Bacteria 3581
709 Ga0495600_0654272 3300046809 Bacteria 635
710 Ga0495581_0000587 3300047315 Bacteria 19001
711 Ga0495581_0593883 3300047315 Unclassified 641
712 Ga0495604_0478700 3300047317 Bacteria 810
713 Ga0495604_0580953 3300047317 Bacteria 720
714 Ga0495674_0018004 3300047319 Bacteria 6575
715 Ga0495674_0025174 3300047319 Bacteria 5462
716 Ga0495674_0043646 3300047319 Bacteria 3990
717 Ga0495674_0043942 3300047319 Bacteria 3973
718 Ga0495674_0077334 3300047319 Bacteria 2861
719 Ga0495674_0335701 3300047319 Bacteria 1229
720 Ga0495674_0452822 3300047319 Bacteria 1031
721 Ga0495674_0701146 3300047319 Bacteria 794
722 Ga0495674_1484384 3300047319 Bacteria 502
723 Ga0495676_0000361 3300047321 Bacteria 37295
724 Ga0495676_0283901 3300047321 Bacteria 1120
725 Ga0495676_0330210 3300047321 Bacteria 1023
726 Ga0495680_0002866 3300047322 Bacteria 17323
727 Ga0495680_0025668 3300047322 Bacteria 4873
728 Ga0495680_0030352 3300047322 Bacteria 4413
729 Ga0495680_0057909 3300047322 Bacteria 2995
730 Ga0495680_0134465 3300047322 Bacteria 1814
731 Ga0495680_0170936 3300047322 Bacteria 1573
732 Ga0495680_0172337 3300047322 Bacteria 1566
733 Ga0495680_0661118 3300047322 Bacteria 693
734 Ga0495680_0664010 3300047322 Bacteria 692
735 Ga0495683_0084980 3300047323 Bacteria 1539
736 Ga0495675_0115303 3300047444 Bacteria 1675
737 Ga0495675_0185388 3300047444 Bacteria 1272
738 Ga0495675_0653039 3300047444 Bacteria 592
739 Ga0495685_107384 3300047447 Bacteria 920
740 Ga0495684_0017217 3300047471 Bacteria 5563
741 Ga0495684_0071627 3300047471 Bacteria 2633
742 Ga0495684_0105928 3300047471 Bacteria 2124
743 Ga0495684_0117953 3300047471 Bacteria 2000
744 Ga0495684_0143072 3300047471 Bacteria 1792
745 Ga0495593_0043996 3300047673 Bacteria 2390
746 Ga0495593_0103176 3300047673 Bacteria 1461
747 Ga0495602_0274683 3300048088 Bacteria 1244
748 Ga0495602_0362157 3300048088 Bacteria 1044
749 Ga0495602_0371249 3300048088 Bacteria 1027
750 Ga0495602_0931945 3300048088 Bacteria 576
751 Ga0495614_0000877 3300048089 Bacteria 12748
752 Ga0495614_0071446 3300048089 Bacteria 1496
753 Ga0496100_0030073 3300048903 Bacteria 3365
754 Ga0496100_0100222 3300048903 Bacteria 1995
755 Ga0496100_0147364 3300048903 Unclassified 1675
756 Ga0496100_0297075 3300048903 Bacteria 1208
757 Ga0496100_0634741 3300048903 Bacteria 831
758 Ga0496100_0714923 3300048903 Unclassified 782
759 Ga0496100_1086725 3300048903 Bacteria 630
760 Ga0496100_1180556 3300048903 Bacteria 604
761 Ga0496101_0000947 3300048904 Bacteria 17119
762 Ga0496101_0002071 3300048904 Bacteria 12211
763 Ga0496101_0008977 3300048904 Bacteria 6553
764 Ga0496101_0041668 3300048904 Bacteria 3275
765 Ga0496101_0125412 3300048904 Unclassified 1945
766 Ga0496101_0242271 3300048904 Bacteria 1403
767 Ga0496102_0000889 3300048905 Bacteria 28364
768 Ga0496102_0039679 3300048905 Bacteria 4255
769 Ga0496102_0046909 3300048905 Bacteria 3925
770 Ga0496102_0054082 3300048905 Bacteria 3660
771 Ga0496102_0119891 3300048905 Bacteria 2456
772 Ga0496102_0297779 3300048905 Bacteria 1520
773 Ga0496102_0456677 3300048905 Bacteria 1198
774 Ga0496102_1240672 3300048905 Unclassified 665
775 Ga0496103_0017841 3300048906 Bacteria 4252
776 Ga0496103_0026685 3300048906 Bacteria 3496
777 Ga0496103_0062063 3300048906 Bacteria 2326
778 Ga0496103_0140689 3300048906 Bacteria 1543
779 Ga0496103_0163078 3300048906 Bacteria 1430
780 Ga0496103_0189745 3300048906 Bacteria 1321
781 Ga0496104_0002177 3300048907 Bacteria 17000
782 Ga0496104_0002279 3300048907 Bacteria 16544
783 Ga0496104_0044575 3300048907 Bacteria 4167
784 Ga0496104_0098521 3300048907 Bacteria 2798
785 Ga0496104_0129103 3300048907 Bacteria 2427
786 Ga0496104_0451861 3300048907 Unclassified 1197
787 Ga0496104_0652172 3300048907 Bacteria 961
788 Ga0496105_0000123 3300048908 Bacteria 52367
789 Ga0496105_0002447 3300048908 Bacteria 13431
790 Ga0496105_0014622 3300048908 Bacteria 6250
791 Ga0496105_0119218 3300048908 Bacteria 2177
792 Ga0496105_0135449 3300048908 Bacteria 2029
793 Ga0496105_0151699 3300048908 Unclassified 1905
794 Ga0496105_0212469 3300048908 Bacteria 1576
795 Ga0496105_0724261 3300048908 Bacteria 762
796 Ga0496105_0795687 3300048908 Bacteria 719
797 Ga0496105_1219770 3300048908 Bacteria 553
798 Ga0496105_1307270 3300048908 Unclassified 529
799 Ga0496106_0014987 3300048909 Bacteria 5735
800 Ga0496106_0027485 3300048909 Bacteria 4237
801 Ga0496106_0031374 3300048909 Bacteria 3959
802 Ga0496106_0146112 3300048909 Bacteria 1863
803 Ga0496106_0328245 3300048909 Bacteria 1228
804 Ga0496106_0577215 3300048909 Bacteria 901
805 Ga0496107_0008144 3300048910 Bacteria 7249
806 Ga0496107_0033250 3300048910 Bacteria 3689
807 Ga0496107_0038792 3300048910 Bacteria 3416
808 Ga0496107_0116613 3300048910 Bacteria 1966
809 Ga0496107_0119064 3300048910 Bacteria 1944
810 Ga0496107_0251066 3300048910 Bacteria 1316
811 Ga0496107_0258660 3300048910 Bacteria 1295
812 Ga0496107_0262572 3300048910 Unclassified 1285
813 Ga0496107_0938164 3300048910 Bacteria 630
814 Ga0496108_0056221 3300048911 Bacteria 3305
815 Ga0496108_0063357 3300048911 Bacteria 3113
816 Ga0496108_0083533 3300048911 Bacteria 2709
817 Ga0496108_0085296 3300048911 Bacteria 2680
818 Ga0496108_0352822 3300048911 Bacteria 1284
819 Ga0496108_1625922 3300048911 Bacteria 534
820 Ga0496109_0002406 3300048912 Bacteria 15672
821 Ga0496109_0003079 3300048912 Bacteria 13905
822 Ga0496109_0005647 3300048912 Bacteria 10464
823 Ga0496109_0026855 3300048912 Bacteria 5135
824 Ga0496109_0076164 3300048912 Bacteria 3085
825 Ga0496109_0244240 3300048912 Bacteria 1690
826 Ga0496109_0775548 3300048912 Bacteria 897
827 Ga0496109_1061443 3300048912 Bacteria 747
828 Ga0496110_0004567 3300048913 Bacteria 10753
829 Ga0496110_0040976 3300048913 Bacteria 4038
830 Ga0496110_1830876 3300048913 Bacteria 517
831 Ga0496111_0000659 3300048914 Bacteria 18153
832 Ga0496111_0019831 3300048914 Bacteria 4675
833 Ga0496111_0041148 3300048914 Bacteria 3316
834 Ga0496111_0096552 3300048914 Bacteria 2169
835 Ga0496111_0107903 3300048914 Bacteria 2050
836 Ga0496111_0122931 3300048914 Bacteria 1917
837 Ga0496111_0164832 3300048914 Bacteria 1646
838 Ga0496111_0381465 3300048914 Unclassified 1042
839 Ga0496111_0422061 3300048914 Bacteria 985
840 Ga0496112_0033021 3300048915 Bacteria 5026
841 Ga0496112_0057379 3300048915 Bacteria 3833
842 Ga0496112_0096176 3300048915 Bacteria 2932
843 Ga0496112_0118840 3300048915 Bacteria 2613
844 Ga0496112_0290932 3300048915 Bacteria 1579
845 Ga0496112_0887264 3300048915 Bacteria 814
846 Ga0496112_1496381 3300048915 Bacteria 589
847 Ga0496112_1686297 3300048915 Unclassified 546
848 Ga0496113_0088332 3300048916 Bacteria 2384
849 Ga0496113_0109686 3300048916 Bacteria 2146
850 Ga0496113_0408772 3300048916 Bacteria 1090
851 Ga0496113_0776817 3300048916 Unclassified 762
852 Ga0496113_1057759 3300048916 Bacteria 638
853 Ga0496114_0000202 3300048917 Bacteria 43512
854 Ga0496114_0001405 3300048917 Bacteria 18264
855 Ga0496114_0050982 3300048917 Bacteria 3445
856 Ga0496114_0056019 3300048917 Bacteria 3288
857 Ga0496114_0063253 3300048917 Bacteria 3098
858 Ga0496114_0107881 3300048917 Unclassified 2383
859 Ga0496114_0141639 3300048917 Bacteria 2082
860 Ga0496114_0149313 3300048917 Unclassified 2027
861 Ga0496114_0322547 3300048917 Bacteria 1365
862 Ga0496115_0001304 3300048918 Bacteria 17770
863 Ga0496115_0007949 3300048918 Bacteria 7828
864 Ga0496115_0018339 3300048918 Bacteria 5371
865 Ga0496115_0085259 3300048918 Bacteria 2576
866 Ga0496115_0166760 3300048918 Bacteria 1821
867 Ga0496115_0237326 3300048918 Unclassified 1503
868 Ga0496115_0327650 3300048918 Unclassified 1252
869 Ga0496115_0437336 3300048918 Bacteria 1058
870 Ga0496115_0442663 3300048918 Bacteria 1050
871 Ga0496115_0466748 3300048918 Bacteria 1018
872 Ga0496115_0466771 3300048918 Bacteria 1018
873 Ga0496115_0684939 3300048918 Bacteria 807
874 Ga0501038_0906107 3300049574 Bacteria 651
875 Ga0501067_0020799 3300049583 Bacteria 3630
876 Ga0501067_0417937 3300049583 Bacteria 748
877 Ga0501068_0085197 3300049584 Bacteria 1945
878 Ga0501068_0234356 3300049584 Bacteria 1168
879 Ga0501068_0390531 3300049584 Bacteria 897
880 Ga0501069_0016467 3300049585 Bacteria 3973
881 Ga0501069_0019903 3300049585 Bacteria 3631
882 Ga0501069_0040917 3300049585 Bacteria 2561
883 Ga0501071_0088195 3300049587 Bacteria 2276
884 Ga0501076_0463074 3300049592 Bacteria 1044
885 nmdc:mga05p37_1400006_c1 3300050507 Unclassified 704
886 nmdc:mga0n895_125532_c1 3300050512 Bacteria 2590
887 nmdc:mga0n895_327670_c1 3300050512 Bacteria 1552
888 nmdc:mga0n895_579537_c1 3300050512 Bacteria 1126
889 nmdc:mga0n895_595820_c1 3300050512 Bacteria 1108
890 nmdc:mga0rr50_294547_c1 3300050513 Bacteria 1356
891 nmdc:mga0rr50_550607_c1 3300050513 Bacteria 982
892 nmdc:mga0rr50_710640_c1 3300050513 Bacteria 858
893 nmdc:mga08x19_232209_c1 3300050514 Bacteria 1270
894 nmdc:mga0a205_11791_c2 3300050515 Bacteria 6229
895 nmdc:mga0a205_1274121_c1 3300050515 Unclassified 583
896 nmdc:mga0a205_349004_c1 3300050515 Bacteria 1347
897 nmdc:mga0a205_462571_c1 3300050515 Bacteria 1128
898 Ga0495601_0029860 3300053077 Bacteria 3384
899 Ga0495601_0048421 3300053077 Bacteria 2677
900 Ga0495601_0150242 3300053077 Bacteria 1520
901 Ga0495601_0166095 3300053077 Bacteria 1442
902 Ga0495601_0206733 3300053077 Bacteria 1282
903 Ga0495601_0894252 3300053077 Bacteria 561
904 Ga0495601_1020642 3300053077 Unclassified 520
905 Ga0495612_0003796 3300053078 Bacteria 6280
906 Ga0495612_0119383 3300053078 Bacteria 1133
907 Ga0495612_0413618 3300053078 Unclassified 614
908 Ga0495595_0047752 3300053084 Bacteria 1975
909 Ga0495595_0093362 3300053084 Bacteria 1446
910 Ga0495619_0001672 3300053085 Bacteria 14668
911 Ga0495619_0009375 3300053085 Bacteria 6176
912 Ga0495619_0049593 3300053085 Bacteria 2769
913 Ga0495619_0181059 3300053085 Bacteria 1458
914 Ga0495619_0299704 3300053085 Bacteria 1113
915 Ga0495619_0355037 3300053085 Bacteria 1014
916 Ga0495619_0813709 3300053085 Bacteria 631
917 Ga0500566_0012003 3300053094 Bacteria 5101
918 Ga0587070_064177 3300059491 Unclassified 767
919 Ga0587073_0168726 3300059492 Bacteria 633
920 Ga0587106_073502 3300059605 Unclassified 652
921 Ga0587067_169181 3300059640 Bacteria 562
922 Ga0587079_098818 3300059647 Bacteria 694
923 Ga0466962_0000760 3300061719 Bacteria 14449
924 Ga0466962_0003085 3300061719 Bacteria 7928
925 Ga0466962_0006014 3300061719 Bacteria 5835
926 Ga0466962_0066438 3300061719 Bacteria 1721
927 Ga0466962_0067064 3300061719 Bacteria 1713
928 Ga0466962_0090873 3300061719 Bacteria 1462
929 Ga0105240_10091225
930 Ga0070658_10011268
931 Ga0070683_100000320
932 Ga0070683_100016774
933 Ga0070683_100023619
934 Ga0070683_100270987
935 Ga0070683_100440773
936 Ga0070680_100027859
937 Ga0070680_100031401
938 Ga0070680_100080186
939 Ga0070680_100240578
940 Ga0070680_100399361
941 Ga0070680_101322199
942 Ga0070682_100159254
943 Ga0068868_100037222
944 Ga0068868_100634520
945 Ga0070660_100002588
946 Ga0070660_100046649
947 Ga0070660_100069624
948 Ga0070660_101180188
949 Ga0070691_10041326
950 Ga0070661_100112139
951 Ga0070661_100126942
952 Ga0070661_100969948
953 Ga0070675_100475032
954 Ga0070675_101319678
955 Ga0070671_100254010
956 Ga0070671_100634187
957 Ga0070671_101007797
958 Ga0070674_100306495
959 Ga0070659_100062863
960 Ga0070703_10203563
961 Ga0070709_10004535
962 Ga0070714_100009674
963 Ga0070714_100026376
964 Ga0070714_100105772
965 Ga0070714_100134500
966 Ga0070714_100209421
967 Ga0070714_101359375
968 Ga0070713_100001075
969 Ga0070713_100003268
970 Ga0070713_100456590
971 Ga0070713_100697621
972 Ga0070710_10033542
973 Ga0070710_10071838
974 Ga0070710_10395798
975 Ga0070710_10460151
976 Ga0070701_11028706
977 Ga0070711_100038865
978 Ga0070711_100565495
979 Ga0070705_100317068
980 Ga0070705_100475659
981 Ga0070708_100014377
982 Ga0070708_100176260
983 Ga0070708_100809103
984 Ga0070663_101486132
985 Ga0070678_100026384
986 Ga0070678_100576557
987 Ga0070678_101467200
988 Ga0070681_10001517
989 Ga0070681_10021893
990 Ga0070681_10027815
991 Ga0070681_10033059
992 Ga0070681_10256237
993 Ga0070681_10543920
994 Ga0070681_10773278
995 Ga0068867_100453799
996 Ga0070706_100021256
997 Ga0070706_100359949
998 Ga0070707_100001869
999 Ga0070707_100029672
1000 Ga0070707_100364594
1001 Ga0070707_100507490
1002 Ga0070707_101334382
1003 Ga0070698_100429085
1004 Ga0070698_100632042
1005 Ga0070699_100049873
1006 Ga0070699_100481307
1007 Ga0070699_100654442
1008 Ga0070679_100011048
1009 Ga0070679_100028886
1010 Ga0070679_100031716
1011 Ga0070679_100063108
1012 Ga0070679_100066373
1013 Ga0070679_100376282
1014 Ga0070679_101260174
1015 Ga0070684_100000431
1016 Ga0070684_100096345
1017 Ga0070684_100099255
1018 Ga0070684_100158129
1019 Ga0070684_100244645
1020 Ga0070684_100640454
1021 Ga0070684_100794958
1022 Ga0070684_101436989
1023 Ga0070697_100334005
1024 Ga0070697_100365298
1025 Ga0070697_100532938
1026 Ga0070697_100944025
1027 Ga0070686_100091418
1028 Ga0070695_100000003
1029 Ga0070695_100197941
1030 Ga0070696_100255123
1031 Ga0070696_100331914
1032 Ga0070696_101801681
1033 Ga0070693_100001852
1034 Ga0070704_101147233
1035 Ga0068855_100015594
1036 Ga0068855_100044514
1037 Ga0068855_100239117
1038 Ga0068857_100350010
1039 Ga0068857_100364512
1040 Ga0068857_101760455
1041 Ga0068854_101012864
1042 Ga0068856_100023327
1043 Ga0068856_100230631
1044 Ga0068856_100330551
1045 Ga0068856_100429430
1046 Ga0068856_101240227
1047 Ga0070702_100246759
1048 Ga0068852_101470636
1049 Ga0068866_10938474
1050 Ga0068870_10121360
1051 Ga0068863_100169003
1052 Ga0068863_101842486
1053 Ga0070717_10006950
1054 Ga0070717_10017759
1055 Ga0070717_10021347
1056 Ga0070717_10027430
1057 Ga0070717_10030201
1058 Ga0070717_10772105
1059 Ga0070717_11517073
1060 Ga0070715_10002011
1061 Ga0070716_100004105
1062 Ga0070716_100031456
1063 Ga0070712_100024588
1064 Ga0070712_100277498
1065 Ga0070712_100751833
1066 Ga0070712_100796032
1067 Ga0070712_100874555
1068 Ga0070712_100988340
1069 Ga0097621_100164799
1070 Ga0097621_100206263
1071 Ga0097621_100582801
1072 Ga0068871_100028151
1073 Ga0068871_100209122
1074 Ga0068871_100266399
1075 Ga0068871_100902970
1076 Ga0075433_10357602
1077 Ga0075433_10417106
1078 Ga0075433_11315633
1079 Ga0075433_11560194
1080 Ga0075434_100053570
1081 Ga0075434_100150987
1082 Ga0075434_100163639
1083 Ga0075434_100346944
1084 Ga0075434_100695158
1085 Ga0068865_100700967
1086 Ga0075435_100034410
1087 Ga0075435_100230618
1088 Ga0075435_100413035
1089 Ga0105240_10053723
1090 Ga0105240_10244655
1091 Ga0105240_10266310
1092 Ga0105240_10412394
1093 Ga0105245_10144131
1094 Ga0105245_10248959
1095 Ga0105245_11395512
1096 Ga0105247_11104883
1097 Ga0114129_10954462
1098 Ga0105243_10075126
1099 Ga0105243_10101554
1100 Ga0105243_10341224
1101 Ga0105241_10109855
1102 Ga0105242_10043710
1103 Ga0105242_10084950
1104 Ga0105242_10163927
1105 Ga0105242_12137556
1106 Ga0105242_12592182
1107 Ga0105248_10168095
1108 Ga0105248_10331001
1109 Ga0105248_10397209
1110 Ga0105237_10476229
1111 Ga0105237_12191029
1112 Ga0105238_10304633
1113 Ga0105238_10662535
1114 Ga0105239_10659976
1115 Ga0105239_12861348
1116 Ga0105246_10032406
1117 Ga0105246_11373586
1118 Ga0157373_11242153
1119 Ga0157370_10005691
1120 Ga0157369_10032553
1121 Ga0157369_10139012
1122 Ga0157369_10491344
1123 Ga0157369_10592755
1124 Ga0157369_11398126
1125 Ga0157374_10192731
1126 Ga0157374_11326527
1127 Ga0157378_10185952
1128 Ga0157378_10584486
1129 Ga0163162_10520728
1130 Ga0163162_10693529
1131 Ga0163162_12019709
1132 Ga0157372_10327048
1133 Ga0157372_10407554
1134 Ga0157372_10898072
1135 Ga0157375_10082222
1136 Ga0157375_10407173
1137 Ga0157375_10498899
1138 Ga0163163_11129674
1139 Ga0163163_11512249
1140 Ga0157380_11481919
1141 Ga0182008_10005743
1142 Ga0157379_10253928
1143 Ga0157376_10007490
1144 Ga0157376_10152755
1145 Ga0182006_1036896
1146 Ga0182007_10027794
1147 Ga0182007_10036157
1148 Ga0197907_10589986
1149 Ga0197907_10777264
1150 Ga0197907_11035475
1151 Ga0197907_11238147
1152 Ga0206356_10418925
1153 Ga0206356_10822865
1154 Ga0206356_11230150
1155 Ga0206356_11855689
1156 Ga0206349_1009309
1157 Ga0206349_1109861
1158 Ga0206351_10930327
1159 Ga0206352_10295053
1160 Ga0206352_10468852
1161 Ga0206352_10674228
1162 Ga0206350_10604927
1163 Ga0206350_10822870
1164 Ga0206350_11487435
1165 Ga0206354_10111255
1166 Ga0206354_10660180
1167 Ga0206354_10928650
1168 Ga0206354_11113594
1169 Ga0206354_11356773
1170 Ga0206354_11530171
1171 Ga0206353_10854756
1172 Ga0206353_10918167
1173 Ga0206353_11349432
1174 Ga0224712_10049988
1175 Ga0224712_10076579
1176 Ga0224712_10087425
1177 Ga0224712_10631060
1178 Ga0224712_10682337
1179 Ga0207692_10462419
1180 Ga0207642_10255626
1181 Ga0207642_10336915
1182 Ga0207699_10007356
1183 Ga0207699_11162077
1184 Ga0207643_10388001
1185 Ga0207705_10014632
1186 Ga0207705_10120284
1187 Ga0207684_10428542
1188 Ga0207684_10472720
1189 Ga0207707_10025403
1190 Ga0207707_10106756
1191 Ga0207707_10107397
1192 Ga0207707_10138297
1193 Ga0207707_10199680
1194 Ga0207707_10229390
1195 Ga0207707_10362876
1196 Ga0207707_10386256
1197 Ga0207695_10099287
1198 Ga0207695_10270833
1199 Ga0207695_10373182
1200 Ga0207695_10486889
1201 Ga0207695_10498230
1202 Ga0207671_10227672
1203 Ga0207671_11404558
1204 Ga0207693_10013795
1205 Ga0207693_10062148
1206 Ga0207693_10149242
1207 Ga0207693_10154333
1208 Ga0207693_10159884
1209 Ga0207693_10181970
1210 Ga0207693_10264668
1211 Ga0207693_10629982
1212 Ga0207693_11347001
1213 Ga0207663_10121719
1214 Ga0207663_10477949
1215 Ga0207663_11612336
1216 Ga0207660_10007441
1217 Ga0207660_10054159
1218 Ga0207660_10067098
1219 Ga0207660_10416856
1220 Ga0207660_10513825
1221 Ga0207660_11019608
1222 Ga0207657_10000331
1223 Ga0207657_10051361
1224 Ga0207657_10061155
1225 Ga0207657_10350420
1226 Ga0207649_10087175
1227 Ga0207649_10088948
1228 Ga0207649_10872583
1229 Ga0207652_10007747
1230 Ga0207652_10097191
1231 Ga0207652_10133898
1232 Ga0207652_10165856
1233 Ga0207652_10183337
1234 Ga0207652_11035037
1235 Ga0207652_11138739
1236 Ga0207646_10000129
1237 Ga0207646_10026256
1238 Ga0207646_10735773
1239 Ga0207659_10451447
1240 Ga0207659_10880250
1241 Ga0207687_10002002
1242 Ga0207687_10156053
1243 Ga0207687_11939162
1244 Ga0207700_10000036
1245 Ga0207700_10018638
1246 Ga0207700_10037237
1247 Ga0207700_10070616
1248 Ga0207700_10183054
1249 Ga0207700_11211493
1250 Ga0207664_10005201
1251 Ga0207664_10112603
1252 Ga0207664_10139948
1253 Ga0207664_10150738
1254 Ga0207664_10174776
1255 Ga0207664_11580503
1256 Ga0207644_10140113
1257 Ga0207644_11465445
1258 Ga0207690_10016151
1259 Ga0207686_10002712
1260 Ga0207709_10126658
1261 Ga0207670_11720586
1262 Ga0207665_10000716
1263 Ga0207665_10006441
1264 Ga0207665_10742948
1265 Ga0207665_10932085
1266 Ga0207665_11207019
1267 Ga0207711_10163950
1268 Ga0207661_10000153
1269 Ga0207661_10009928
1270 Ga0207661_10038853
1271 Ga0207661_10117614
1272 Ga0207661_10123709
1273 Ga0207661_10167664
1274 Ga0207661_10890369
1275 Ga0207679_10034583
1276 Ga0207679_10285951
1277 Ga0207667_10020985
1278 Ga0207667_10193880
1279 Ga0207667_10267163
1280 Ga0207667_11036521
1281 Ga0207640_10314717
1282 Ga0207677_10007839
1283 Ga0207677_10350257
1284 Ga0207703_11557779
1285 Ga0207639_10333782
1286 Ga0207678_10877289
1287 Ga0207708_10696911
1288 Ga0207702_10002831
1289 Ga0207702_10086354
1290 Ga0207702_10180699
1291 Ga0207702_10354177
1292 Ga0207641_10274558
1293 Ga0207641_12078639
1294 Ga0207648_11099597
1295 Ga0207674_10266240
1296 Ga0207674_10387798
1297 Ga0207675_100301235
1298 Ga0207683_10115722
1299 Ga0207683_10160367
1300 Ga0207698_10333122
1301 Ga0207698_10423826
1302 Ga0207698_12579660
1303 Ga0268266_10300172
1304 Ga0265319_1004366
1305 Ga0265319_1056041
1306 Ga0265334_10060663
1307 Ga0265318_10013117
1308 Ga0265322_10032236
1309 Ga0265338_10044681
1310 Ga0265330_10032228
1311 Ga0265320_10038423
1312 Ga0265325_10312552
1313 Ga0265329_10065229
1314 Ga0265339_10052859
1315 Ga0265331_10024994
1316 Ga0265327_10024417
1317 Ga0265327_10426389
1318 Ga0265316_10050466
1319 Ga0265314_10047958
1320 Ga0265314_10345149
1321 Ga0373959_0152494
1322 Ga0373926_0010144
1323 Ga0373934_0185184
1324 Ga0373944_0189419
1325 Ga0373951_0013573
1326 Ga0373923_0261462
1327 Ga0373936_0064043
1328 Ga0373936_0136139
1329 Ga0373945_0008136
1330 Ga0373945_0015496
1331 Ga0373945_0021885
1332 Ga0373945_0405744
1333 Ga0373954_0414069
1334 Ga0373956_0505953
1335 Ga0373943_0000048
1336 Ga0373943_0000685
1337 Ga0373943_0745213
1338 Ga0373946_0009234
1339 Ga0373955_0264570
1340 Ga0373924_0156056
1341 Ga0373935_0021359
1342 Ga0373935_0065680
1343 Ga0373927_0012161
1344 Ga0373927_0042475
1345 Ga0373927_0058785
1346 Ga0373933_0240788
1347 Ga0373933_0472663
1348 Ga0373947_0002244
1349 Ga0373947_0002751
1350 Ga0373947_0473517
1351 Ga0373947_1020353
1352 Ga0373937_0460508
1353 Ga0373937_0472354
1354 Ga0373937_0664447
1355 Ga0373937_0837873
1356 Ga0373925_0004043
1357 Ga0373925_0014494
1358 Ga0373925_0026473
1359 Ga0395899_0344313
1360 Ga0395900_0125204
1361 Ga0395900_0463473
1362 Ga0395900_0504989
1363 Ga0395900_1042242
1364 Ga0395898_0471895
1365 Ga0395898_0505219
1366 Ga0395898_0563672
1367 Ga0395898_1625040
1368 Ga0395905_1359942
1369 Ga0395901_0129091
1370 Ga0395901_0162696
1371 Ga0395901_0181546
1372 Ga0395901_1433605
1373 Ga0436360_0951907
1374 Ga0436362_0108004
1375 Ga0451795_0066248
1376 Ga0451839_0426424
1377 Ga0466969_0000842
1378 Ga0466969_0004072
1379 Ga0466969_0075746
1380 Ga0466969_0515156
1381 Ga0453683_0863321
1382 Ga0466965_0017811
1383 Ga0466965_0137224
1384 Ga0466965_0374188
1385 Ga0466966_0019638
1386 Ga0466966_0025858
1387 Ga0466966_0072370
1388 Ga0466966_0110869
1389 Ga0466966_0121364
1390 Ga0466966_0172808
1391 Ga0466966_0265844
1392 Ga0466961_0006416
1393 Ga0466961_0016296
1394 Ga0466961_0041683
1395 Ga0466961_0078398
1396 Ga0466963_0000768
1397 Ga0466963_0001745
1398 Ga0466963_0001777
1399 Ga0466963_0002439
1400 Ga0466963_0003819
1401 Ga0466963_0007553
1402 Ga0466963_0024908
1403 Ga0466963_0027782
1404 Ga0466963_0037939
1405 Ga0466963_0071413
1406 Ga0466963_0088170
1407 Ga0466963_0091552
1408 Ga0466963_0121532
1409 Ga0466963_0210761
1410 Ga0466963_0518397
1411 Ga0466963_1137526
1412 Ga0466963_1301669
1413 Ga0466964_0001896
1414 Ga0466964_0002170
1415 Ga0466964_0013934
1416 Ga0466964_0029103
1417 Ga0466964_0064074
1418 Ga0466964_0385655
1419 Ga0466964_0421196
1420 Ga0466964_0671534
1421 Ga0466971_0001398
1422 Ga0466971_0006829
1423 Ga0466971_0028646
1424 Ga0466971_0077393
1425 Ga0466971_0098841
1426 Ga0466971_0661718
1427 Ga0466968_0031264
1428 Ga0466968_0032205
1429 Ga0466968_0036509
1430 Ga0466968_0052237
1431 Ga0466968_0064943
1432 Ga0466968_0096907
1433 Ga0466968_0124879
1434 Ga0466968_0178214
1435 Ga0466970_0098231
1436 Ga0466970_0148286
1437 Ga0466970_0580063
1438 Ga0466957_0000936
1439 Ga0466957_0020308
1440 Ga0466957_0022022
1441 Ga0466957_0024494
1442 Ga0466957_0042911
1443 Ga0466957_0097137
1444 Ga0466957_0114251
1445 Ga0466957_0133885
1446 Ga0466957_0147819
1447 Ga0466957_0221069
1448 Ga0466960_0044545
1449 Ga0466960_0054487
1450 Ga0466960_0743900
1451 Ga0466959_0004897
1452 Ga0466959_0012854
1453 Ga0466959_0020896
1454 Ga0466959_0026355
1455 Ga0466959_0033913
1456 Ga0466959_1121566
1457 Ga0451576_1694029
1458 Ga0466958_0002388
1459 Ga0466958_0002635
1460 Ga0466958_0003001
1461 Ga0466958_0004176
1462 Ga0466958_0021359
1463 Ga0466958_0043813
1464 Ga0466958_0056855
1465 Ga0466958_0067910
1466 Ga0466958_0208862
1467 Ga0466958_0224364
1468 Ga0466958_0239138
1469 Ga0466958_0268988
1470 Ga0466967_0001386
1471 Ga0466967_0006433
1472 Ga0466967_0008724
1473 Ga0466967_0021581
1474 Ga0466967_0022089
1475 Ga0466967_0046731
1476 Ga0466967_0055137
1477 Ga0466967_0086288
1478 Ga0466967_0093421
1479 Ga0466967_0111020
1480 Ga0466967_0117893
1481 Ga0466967_0278196
1482 Ga0466967_0319298
1483 Ga0466967_0343144
1484 Ga0466967_0453499
1485 Ga0466967_0585853
1486 Ga0466967_0876124
1487 Ga0466967_1250787
1488 Ga0466967_2043506
1489 Ga0466967_2501360
1490 Ga0495592_0056902
1491 Ga0495592_0071165
1492 Ga0495592_0309658
1493 Ga0495592_0317017
1494 Ga0495603_0016728
1495 Ga0495603_0028893
1496 Ga0495629_0000159
1497 Ga0495629_0010159
1498 Ga0495629_0030459
1499 Ga0495629_0137646
1500 Ga0495629_0147555
1501 Ga0495629_0229927
1502 Ga0495629_0441701
1503 Ga0495641_0002695
1504 Ga0495641_0009222
1505 Ga0495641_0520777
1506 Ga0495651_0035829
1507 Ga0495651_0105648
1508 Ga0495651_0112045
1509 Ga0495651_0147514
1510 Ga0495651_0244697
1511 Ga0495651_0448389
1512 Ga0495651_0846652
1513 Ga0495653_0016911
1514 Ga0495653_0057407
1515 Ga0495653_0069160
1516 Ga0495653_0109752
1517 Ga0495653_0314202
1518 Ga0495580_0022526
1519 Ga0495582_0000036
1520 Ga0495582_0042097
1521 Ga0495582_0059376
1522 Ga0495582_0078245
1523 Ga0495582_0118557
1524 Ga0495605_0092480
1525 Ga0495639_0001197
1526 Ga0495639_0029376
1527 Ga0495639_0171242
1528 Ga0495662_0003844
1529 Ga0495664_0018479
1530 Ga0495664_0136521
1531 Ga0495664_0177344
1532 Ga0495664_0466565
1533 Ga0495585_0041719
1534 Ga0495594_0049960
1535 Ga0495594_0310944
1536 Ga0495594_0402442
1537 Ga0495594_0503303
1538 Ga0495594_0673902
1539 Ga0495596_0130879
1540 Ga0495607_0282902
1541 Ga0495608_0198905
1542 Ga0495608_0226250
1543 Ga0495608_0256957
1544 Ga0495608_0346922
1545 Ga0495618_0098067
1546 Ga0495618_0476620
1547 Ga0495618_0594951
1548 Ga0495628_0154580
1549 Ga0495628_0882640
1550 Ga0495628_1197341
1551 Ga0495630_0004782
1552 Ga0495630_0018175
1553 Ga0495630_0095762
1554 Ga0495630_0346132
1555 Ga0495630_0803836
1556 Ga0495631_0049048
1557 Ga0495637_0135657
1558 Ga0495644_0001492
1559 Ga0495663_0227259
1560 Ga0495666_0002137
1561 Ga0495666_0529734
1562 Ga0495652_0088127
1563 Ga0495652_0105994
1564 Ga0495652_0235158
1565 Ga0495652_0803946
1566 Ga0495652_0867497
1567 Ga0495665_0455393
1568 Ga0495665_0645141
1569 Ga0495640_0032678
1570 Ga0495640_0110004
1571 Ga0495586_0016243
1572 Ga0495586_0136460
1573 Ga0495586_0452715
1574 Ga0495586_0581845
1575 Ga0495587_0216494
1576 Ga0495587_0259394
1577 Ga0495587_0323471
1578 Ga0495587_0657815
1579 Ga0495587_0690007
1580 Ga0495598_0128874
1581 Ga0495645_0081206
1582 Ga0495645_0110078
1583 Ga0495645_0597771
1584 Ga0495645_0750593
1585 Ga0495667_0084220
1586 Ga0495667_0093000
1587 Ga0495667_0108861
1588 Ga0495667_0306109
1589 Ga0495667_0384729
1590 Ga0495667_0457616
1591 Ga0495656_0000672
1592 Ga0495634_0018092
1593 Ga0495634_0040709
1594 Ga0495634_0065359
1595 Ga0495611_0022727
1596 Ga0495635_0038756
1597 Ga0495635_0272923
1598 Ga0495635_0742033
1599 Ga0495659_0451116
1600 Ga0495661_0050966
1601 Ga0495588_0167292
1602 Ga0495588_0182258
1603 Ga0495588_0697703
1604 Ga0495657_0034744
1605 Ga0495657_0037950
1606 Ga0495657_0055931
1607 Ga0495657_0719482
1608 Ga0495599_0371656
1609 Ga0495599_0448368
1610 Ga0495599_0595524
1611 Ga0495646_0025809
1612 Ga0495646_0094551
1613 Ga0495646_0259731
1614 Ga0495646_0505782
1615 Ga0495647_0001238
1616 Ga0495647_0004455
1617 Ga0495647_0020964
1618 Ga0495658_0029366
1619 Ga0495658_0091185
1620 Ga0495658_0108637
1621 Ga0495658_0406005
1622 Ga0495658_0434581
1623 Ga0495613_0001777
1624 Ga0495613_0027163
1625 Ga0495613_0431518
1626 Ga0495613_0631434
1627 Ga0495613_1006931
1628 Ga0495613_1107328
1629 Ga0495624_0002893
1630 Ga0495624_0003155
1631 Ga0495624_0035813
1632 Ga0495624_0744529
1633 Ga0495670_0414714
1634 Ga0495589_0542491
1635 Ga0495600_0016740
1636 Ga0495600_0029027
1637 Ga0495600_0654272
1638 Ga0495581_0000587
1639 Ga0495581_0593883
1640 Ga0495604_0478700
1641 Ga0495604_0580953
1642 Ga0495674_0018004
1643 Ga0495674_0025174
1644 Ga0495674_0043646
1645 Ga0495674_0043942
1646 Ga0495674_0077334
1647 Ga0495674_0335701
1648 Ga0495674_0452822
1649 Ga0495674_0701146
1650 Ga0495674_1484384
1651 Ga0495676_0000361
1652 Ga0495676_0283901
1653 Ga0495676_0330210
1654 Ga0495680_0002866
1655 Ga0495680_0025668
1656 Ga0495680_0030352
1657 Ga0495680_0057909
1658 Ga0495680_0134465
1659 Ga0495680_0170936
1660 Ga0495680_0172337
1661 Ga0495680_0661118
1662 Ga0495680_0664010
1663 Ga0495683_0084980
1664 Ga0495675_0115303
1665 Ga0495675_0185388
1666 Ga0495675_0653039
1667 Ga0495685_107384
1668 Ga0495684_0017217
1669 Ga0495684_0071627
1670 Ga0495684_0105928
1671 Ga0495684_0117953
1672 Ga0495684_0143072
1673 Ga0495593_0043996
1674 Ga0495593_0103176
1675 Ga0495602_0274683
1676 Ga0495602_0362157
1677 Ga0495602_0371249
1678 Ga0495602_0931945
1679 Ga0495614_0000877
1680 Ga0495614_0071446
1681 Ga0496100_0030073
1682 Ga0496100_0100222
1683 Ga0496100_0147364
1684 Ga0496100_0297075
1685 Ga0496100_0634741
1686 Ga0496100_0714923
1687 Ga0496100_1086725
1688 Ga0496100_1180556
1689 Ga0496101_0000947
1690 Ga0496101_0002071
1691 Ga0496101_0008977
1692 Ga0496101_0041668
1693 Ga0496101_0125412
1694 Ga0496101_0242271
1695 Ga0496102_0000889
1696 Ga0496102_0039679
1697 Ga0496102_0046909
1698 Ga0496102_0054082
1699 Ga0496102_0119891
1700 Ga0496102_0297779
1701 Ga0496102_0456677
1702 Ga0496102_1240672
1703 Ga0496103_0017841
1704 Ga0496103_0026685
1705 Ga0496103_0062063
1706 Ga0496103_0140689
1707 Ga0496103_0163078
1708 Ga0496103_0189745
1709 Ga0496104_0002177
1710 Ga0496104_0002279
1711 Ga0496104_0044575
1712 Ga0496104_0098521
1713 Ga0496104_0129103
1714 Ga0496104_0451861
1715 Ga0496104_0652172
1716 Ga0496105_0000123
1717 Ga0496105_0002447
1718 Ga0496105_0014622
1719 Ga0496105_0119218
1720 Ga0496105_0135449
1721 Ga0496105_0151699
1722 Ga0496105_0212469
1723 Ga0496105_0724261
1724 Ga0496105_0795687
1725 Ga0496105_1219770
1726 Ga0496105_1307270
1727 Ga0496106_0014987
1728 Ga0496106_0027485
1729 Ga0496106_0031374
1730 Ga0496106_0146112
1731 Ga0496106_0328245
1732 Ga0496106_0577215
1733 Ga0496107_0008144
1734 Ga0496107_0033250
1735 Ga0496107_0038792
1736 Ga0496107_0116613
1737 Ga0496107_0119064
1738 Ga0496107_0251066
1739 Ga0496107_0258660
1740 Ga0496107_0262572
1741 Ga0496107_0938164
1742 Ga0496108_0056221
1743 Ga0496108_0063357
1744 Ga0496108_0083533
1745 Ga0496108_0085296
1746 Ga0496108_0352822
1747 Ga0496108_1625922
1748 Ga0496109_0002406
1749 Ga0496109_0003079
1750 Ga0496109_0005647
1751 Ga0496109_0026855
1752 Ga0496109_0076164
1753 Ga0496109_0244240
1754 Ga0496109_0775548
1755 Ga0496109_1061443
1756 Ga0496110_0004567
1757 Ga0496110_0040976
1758 Ga0496110_1830876
1759 Ga0496111_0000659
1760 Ga0496111_0019831
1761 Ga0496111_0041148
1762 Ga0496111_0096552
1763 Ga0496111_0107903
1764 Ga0496111_0122931
1765 Ga0496111_0164832
1766 Ga0496111_0381465
1767 Ga0496111_0422061
1768 Ga0496112_0033021
1769 Ga0496112_0057379
1770 Ga0496112_0096176
1771 Ga0496112_0118840
1772 Ga0496112_0290932
1773 Ga0496112_0887264
1774 Ga0496112_1496381
1775 Ga0496112_1686297
1776 Ga0496113_0088332
1777 Ga0496113_0109686
1778 Ga0496113_0408772
1779 Ga0496113_0776817
1780 Ga0496113_1057759
1781 Ga0496114_0000202
1782 Ga0496114_0001405
1783 Ga0496114_0050982
1784 Ga0496114_0056019
1785 Ga0496114_0063253
1786 Ga0496114_0107881
1787 Ga0496114_0141639
1788 Ga0496114_0149313
1789 Ga0496114_0322547
1790 Ga0496115_0001304
1791 Ga0496115_0007949
1792 Ga0496115_0018339
1793 Ga0496115_0085259
1794 Ga0496115_0166760
1795 Ga0496115_0237326
1796 Ga0496115_0327650
1797 Ga0496115_0437336
1798 Ga0496115_0442663
1799 Ga0496115_0466748
1800 Ga0496115_0466771
1801 Ga0496115_0684939
1802 Ga0501038_0906107
1803 Ga0501067_0020799
1804 Ga0501067_0417937
1805 Ga0501068_0085197
1806 Ga0501068_0234356
1807 Ga0501068_0390531
1808 Ga0501069_0016467
1809 Ga0501069_0019903
1810 Ga0501069_0040917
1811 Ga0501071_0088195
1812 Ga0501076_0463074
1813 nmdc:mga05p37_1400006_c1
1814 nmdc:mga0n895_125532_c1
1815 nmdc:mga0n895_327670_c1
1816 nmdc:mga0n895_579537_c1
1817 nmdc:mga0n895_595820_c1
1818 nmdc:mga0rr50_294547_c1
1819 nmdc:mga0rr50_550607_c1
1820 nmdc:mga0rr50_710640_c1
1821 nmdc:mga08x19_232209_c1
1822 nmdc:mga0a205_11791_c2
1823 nmdc:mga0a205_1274121_c1
1824 nmdc:mga0a205_349004_c1
1825 nmdc:mga0a205_462571_c1
1826 Ga0495601_0029860
1827 Ga0495601_0048421
1828 Ga0495601_0150242
1829 Ga0495601_0166095
1830 Ga0495601_0206733
1831 Ga0495601_0894252
1832 Ga0495601_1020642
1833 Ga0495612_0003796
1834 Ga0495612_0119383
1835 Ga0495612_0413618
1836 Ga0495595_0047752
1837 Ga0495595_0093362
1838 Ga0495619_0001672
1839 Ga0495619_0009375
1840 Ga0495619_0049593
1841 Ga0495619_0181059
1842 Ga0495619_0299704
1843 Ga0495619_0355037
1844 Ga0495619_0813709
1845 Ga0500566_0012003
1846 Ga0587070_064177
1847 Ga0587073_0168726
1848 Ga0587106_073502
1849 Ga0587067_169181
1850 Ga0587079_098818
1851 Ga0466962_0000760
1852 Ga0466962_0003085
1853 Ga0466962_0006014
1854 Ga0466962_0066438
1855 Ga0466962_0067064
1856 Ga0466962_0090873

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

43

159

0.89

PF18029

Glyoxalase_6

Glyoxalase-like domain

46

160

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8863 10 132
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8762 9 132
4hc5-assembly2.cif.gz_C crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 0.8678 10 130
5uhj-assembly2.cif.gz_B-3 the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 0.8659 10 132
5umq-assembly1.cif.gz_A crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 0.8604 9 131
ID Description Score Start End Superfamily
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8906 10 130 3.10.180.10
4hc5C00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.87 10 130 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8557 10 132 3.10.180.10
5uhjB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8422 10 132 3.10.180.10
5ujpB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8288 12 130 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A537XET1-F1-model_v4 Glyoxalase 0.9585 9 130
AF-C7Q524-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9449 9 130 GO:0051213
AF-A0A2V7TVF1-F1-model_v4 Glyoxalase 0.9351 9 130
AF-A0A7W0GZV9-F1-model_v4 VOC family protein 0.9306 9 130
AF-A0A1Q6XDX9-F1-model_v4 Glyoxalase 0.9272 1 133

Map