F485971
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 928 | 295 | 1856 | 134 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10091225|Ga0105240_100912253 |
| Length | 164 |
| Sequence | VAVSLAERSDPADEFRAGERSYEQTPDKEAQMSTAASTLNVTQVGRVCITVADTDRAIDFYVGKLGFEKVVDVPMGPDMRWVEVQVAGTPTTIALAPPPSGKQAGGTDTGICLDTSDIDADHAALQAAGVDVDAEIARWGAPVPPMFWFRDPDGNSLIVVEPLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 92 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 138 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 140 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 141 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 150 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 152 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 153 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 154 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 155 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 156 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 178 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 186 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 266 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 268 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 269 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 270 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 271 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 272 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 273 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 290 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.12 |
| Metatranscriptomes | 3.88 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 13.15 |
| Rhizosphere | 86.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105240_10091225 | 3300009093 | Bacteria | 3723 |
| 2 | Ga0070658_10011268 | 3300005327 | Bacteria | 7167 |
| 3 | Ga0070683_100000320 | 3300005329 | Bacteria | 33119 |
| 4 | Ga0070683_100016774 | 3300005329 | Bacteria | 6461 |
| 5 | Ga0070683_100023619 | 3300005329 | Bacteria | 5500 |
| 6 | Ga0070683_100270987 | 3300005329 | Bacteria | 1615 |
| 7 | Ga0070683_100440773 | 3300005329 | Bacteria | 1243 |
| 8 | Ga0070680_100027859 | 3300005336 | Bacteria | 4527 |
| 9 | Ga0070680_100031401 | 3300005336 | Bacteria | 4270 |
| 10 | Ga0070680_100080186 | 3300005336 | Bacteria | 2692 |
| 11 | Ga0070680_100240578 | 3300005336 | Bacteria | 1530 |
| 12 | Ga0070680_100399361 | 3300005336 | Bacteria | 1172 |
| 13 | Ga0070680_101322199 | 3300005336 | Bacteria | 624 |
| 14 | Ga0070682_100159254 | 3300005337 | Bacteria | 1557 |
| 15 | Ga0068868_100037222 | 3300005338 | Bacteria | 3771 |
| 16 | Ga0068868_100634520 | 3300005338 | Bacteria | 950 |
| 17 | Ga0070660_100002588 | 3300005339 | Bacteria | 12413 |
| 18 | Ga0070660_100046649 | 3300005339 | Bacteria | 3321 |
| 19 | Ga0070660_100069624 | 3300005339 | Bacteria | 2744 |
| 20 | Ga0070660_101180188 | 3300005339 | Bacteria | 649 |
| 21 | Ga0070691_10041326 | 3300005341 | Bacteria | 2180 |
| 22 | Ga0070661_100112139 | 3300005344 | Bacteria | 2037 |
| 23 | Ga0070661_100126942 | 3300005344 | Bacteria | 1914 |
| 24 | Ga0070661_100969948 | 3300005344 | Unclassified | 704 |
| 25 | Ga0070675_100475032 | 3300005354 | Bacteria | 1124 |
| 26 | Ga0070675_101319678 | 3300005354 | Bacteria | 665 |
| 27 | Ga0070671_100254010 | 3300005355 | Bacteria | 1493 |
| 28 | Ga0070671_100634187 | 3300005355 | Bacteria | 925 |
| 29 | Ga0070671_101007797 | 3300005355 | Bacteria | 730 |
| 30 | Ga0070674_100306495 | 3300005356 | Bacteria | 1268 |
| 31 | Ga0070659_100062863 | 3300005366 | Bacteria | 2935 |
| 32 | Ga0070703_10203563 | 3300005406 | Bacteria | 778 |
| 33 | Ga0070709_10004535 | 3300005434 | Bacteria | 7495 |
| 34 | Ga0070714_100009674 | 3300005435 | Bacteria | 7591 |
| 35 | Ga0070714_100026376 | 3300005435 | Bacteria | 4802 |
| 36 | Ga0070714_100105772 | 3300005435 | Bacteria | 2485 |
| 37 | Ga0070714_100134500 | 3300005435 | Bacteria | 2212 |
| 38 | Ga0070714_100209421 | 3300005435 | Bacteria | 1786 |
| 39 | Ga0070714_101359375 | 3300005435 | Bacteria | 693 |
| 40 | Ga0070713_100001075 | 3300005436 | Bacteria | 17478 |
| 41 | Ga0070713_100003268 | 3300005436 | Bacteria | 10694 |
| 42 | Ga0070713_100456590 | 3300005436 | Bacteria | 1201 |
| 43 | Ga0070713_100697621 | 3300005436 | Bacteria | 969 |
| 44 | Ga0070710_10033542 | 3300005437 | Bacteria | 2788 |
| 45 | Ga0070710_10071838 | 3300005437 | Bacteria | 1997 |
| 46 | Ga0070710_10395798 | 3300005437 | Unclassified | 925 |
| 47 | Ga0070710_10460151 | 3300005437 | Bacteria | 864 |
| 48 | Ga0070701_11028706 | 3300005438 | Bacteria | 576 |
| 49 | Ga0070711_100038865 | 3300005439 | Bacteria | 3202 |
| 50 | Ga0070711_100565495 | 3300005439 | Bacteria | 945 |
| 51 | Ga0070705_100317068 | 3300005440 | Bacteria | 1124 |
| 52 | Ga0070705_100475659 | 3300005440 | Bacteria | 943 |
| 53 | Ga0070708_100014377 | 3300005445 | Bacteria | 6511 |
| 54 | Ga0070708_100176260 | 3300005445 | Bacteria | 1998 |
| 55 | Ga0070708_100809103 | 3300005445 | Bacteria | 881 |
| 56 | Ga0070663_101486132 | 3300005455 | Unclassified | 602 |
| 57 | Ga0070678_100026384 | 3300005456 | Bacteria | 3927 |
| 58 | Ga0070678_100576557 | 3300005456 | Unclassified | 1002 |
| 59 | Ga0070678_101467200 | 3300005456 | Unclassified | 638 |
| 60 | Ga0070681_10001517 | 3300005458 | Bacteria | 20575 |
| 61 | Ga0070681_10021893 | 3300005458 | Bacteria | 6411 |
| 62 | Ga0070681_10027815 | 3300005458 | Bacteria | 5686 |
| 63 | Ga0070681_10033059 | 3300005458 | Bacteria | 5192 |
| 64 | Ga0070681_10256237 | 3300005458 | Bacteria | 1662 |
| 65 | Ga0070681_10543920 | 3300005458 | Unclassified | 1075 |
| 66 | Ga0070681_10773278 | 3300005458 | Bacteria | 877 |
| 67 | Ga0068867_100453799 | 3300005459 | Bacteria | 1093 |
| 68 | Ga0070706_100021256 | 3300005467 | Bacteria | 5977 |
| 69 | Ga0070706_100359949 | 3300005467 | Unclassified | 1356 |
| 70 | Ga0070707_100001869 | 3300005468 | Bacteria | 20252 |
| 71 | Ga0070707_100029672 | 3300005468 | Bacteria | 5206 |
| 72 | Ga0070707_100364594 | 3300005468 | Bacteria | 1404 |
| 73 | Ga0070707_100507490 | 3300005468 | Bacteria | 1168 |
| 74 | Ga0070707_101334382 | 3300005468 | Bacteria | 684 |
| 75 | Ga0070698_100429085 | 3300005471 | Unclassified | 1256 |
| 76 | Ga0070698_100632042 | 3300005471 | Unclassified | 1011 |
| 77 | Ga0070699_100049873 | 3300005518 | Bacteria | 3623 |
| 78 | Ga0070699_100481307 | 3300005518 | Bacteria | 1127 |
| 79 | Ga0070699_100654442 | 3300005518 | Bacteria | 959 |
| 80 | Ga0070679_100011048 | 3300005530 | Bacteria | 8589 |
| 81 | Ga0070679_100028886 | 3300005530 | Bacteria | 5470 |
| 82 | Ga0070679_100031716 | 3300005530 | Bacteria | 5223 |
| 83 | Ga0070679_100063108 | 3300005530 | Bacteria | 3693 |
| 84 | Ga0070679_100066373 | 3300005530 | Bacteria | 3597 |
| 85 | Ga0070679_100376282 | 3300005530 | Unclassified | 1367 |
| 86 | Ga0070679_101260174 | 3300005530 | Unclassified | 685 |
| 87 | Ga0070684_100000431 | 3300005535 | Bacteria | 28771 |
| 88 | Ga0070684_100096345 | 3300005535 | Bacteria | 2637 |
| 89 | Ga0070684_100099255 | 3300005535 | Bacteria | 2598 |
| 90 | Ga0070684_100158129 | 3300005535 | Bacteria | 2055 |
| 91 | Ga0070684_100244645 | 3300005535 | Unclassified | 1639 |
| 92 | Ga0070684_100640454 | 3300005535 | Bacteria | 989 |
| 93 | Ga0070684_100794958 | 3300005535 | Bacteria | 884 |
| 94 | Ga0070684_101436989 | 3300005535 | Bacteria | 650 |
| 95 | Ga0070697_100334005 | 3300005536 | Bacteria | 1307 |
| 96 | Ga0070697_100365298 | 3300005536 | Unclassified | 1248 |
| 97 | Ga0070697_100532938 | 3300005536 | Bacteria | 1029 |
| 98 | Ga0070697_100944025 | 3300005536 | Unclassified | 766 |
| 99 | Ga0070686_100091418 | 3300005544 | Bacteria | 2036 |
| 100 | Ga0070695_100000003 | 3300005545 | Bacteria | 111545 |
| 101 | Ga0070695_100197941 | 3300005545 | Bacteria | 1434 |
| 102 | Ga0070696_100255123 | 3300005546 | Bacteria | 1328 |
| 103 | Ga0070696_100331914 | 3300005546 | Bacteria | 1173 |
| 104 | Ga0070696_101801681 | 3300005546 | Bacteria | 529 |
| 105 | Ga0070693_100001852 | 3300005547 | Bacteria | 9664 |
| 106 | Ga0070704_101147233 | 3300005549 | Bacteria | 707 |
| 107 | Ga0068855_100015594 | 3300005563 | Bacteria | 9143 |
| 108 | Ga0068855_100044514 | 3300005563 | Bacteria | 5251 |
| 109 | Ga0068855_100239117 | 3300005563 | Bacteria | 2030 |
| 110 | Ga0068857_100350010 | 3300005577 | Bacteria | 1368 |
| 111 | Ga0068857_100364512 | 3300005577 | Bacteria | 1340 |
| 112 | Ga0068857_101760455 | 3300005577 | Bacteria | 606 |
| 113 | Ga0068854_101012864 | 3300005578 | Bacteria | 736 |
| 114 | Ga0068856_100023327 | 3300005614 | Bacteria | 6016 |
| 115 | Ga0068856_100230631 | 3300005614 | Bacteria | 1867 |
| 116 | Ga0068856_100330551 | 3300005614 | Bacteria | 1542 |
| 117 | Ga0068856_100429430 | 3300005614 | Bacteria | 1341 |
| 118 | Ga0068856_101240227 | 3300005614 | Bacteria | 762 |
| 119 | Ga0070702_100246759 | 3300005615 | Bacteria | 1208 |
| 120 | Ga0068852_101470636 | 3300005616 | Bacteria | 703 |
| 121 | Ga0068866_10938474 | 3300005718 | Unclassified | 611 |
| 122 | Ga0068870_10121360 | 3300005840 | Bacteria | 1506 |
| 123 | Ga0068863_100169003 | 3300005841 | Bacteria | 2097 |
| 124 | Ga0068863_101842486 | 3300005841 | Bacteria | 615 |
| 125 | Ga0070717_10006950 | 3300006028 | Bacteria | 8362 |
| 126 | Ga0070717_10017759 | 3300006028 | Bacteria | 5541 |
| 127 | Ga0070717_10021347 | 3300006028 | Bacteria | 5102 |
| 128 | Ga0070717_10027430 | 3300006028 | Bacteria | 4552 |
| 129 | Ga0070717_10030201 | 3300006028 | Bacteria | 4354 |
| 130 | Ga0070717_10772105 | 3300006028 | Bacteria | 874 |
| 131 | Ga0070717_11517073 | 3300006028 | Bacteria | 608 |
| 132 | Ga0070715_10002011 | 3300006163 | Bacteria | 6131 |
| 133 | Ga0070716_100004105 | 3300006173 | Bacteria | 6909 |
| 134 | Ga0070716_100031456 | 3300006173 | Bacteria | 2886 |
| 135 | Ga0070712_100024588 | 3300006175 | Bacteria | 3994 |
| 136 | Ga0070712_100277498 | 3300006175 | Bacteria | 1349 |
| 137 | Ga0070712_100751833 | 3300006175 | Bacteria | 834 |
| 138 | Ga0070712_100796032 | 3300006175 | Unclassified | 811 |
| 139 | Ga0070712_100874555 | 3300006175 | Unclassified | 774 |
| 140 | Ga0070712_100988340 | 3300006175 | Bacteria | 728 |
| 141 | Ga0097621_100164799 | 3300006237 | Bacteria | 1908 |
| 142 | Ga0097621_100206263 | 3300006237 | Bacteria | 1708 |
| 143 | Ga0097621_100582801 | 3300006237 | Bacteria | 1021 |
| 144 | Ga0068871_100028151 | 3300006358 | Bacteria | 4403 |
| 145 | Ga0068871_100209122 | 3300006358 | Bacteria | 1687 |
| 146 | Ga0068871_100266399 | 3300006358 | Bacteria | 1496 |
| 147 | Ga0068871_100902970 | 3300006358 | Unclassified | 819 |
| 148 | Ga0075433_10357602 | 3300006852 | Bacteria | 1290 |
| 149 | Ga0075433_10417106 | 3300006852 | Bacteria | 1184 |
| 150 | Ga0075433_11315633 | 3300006852 | Bacteria | 626 |
| 151 | Ga0075433_11560194 | 3300006852 | Unclassified | 570 |
| 152 | Ga0075434_100053570 | 3300006871 | Bacteria | 4008 |
| 153 | Ga0075434_100150987 | 3300006871 | Bacteria | 2343 |
| 154 | Ga0075434_100163639 | 3300006871 | Bacteria | 2245 |
| 155 | Ga0075434_100346944 | 3300006871 | Bacteria | 1505 |
| 156 | Ga0075434_100695158 | 3300006871 | Unclassified | 1035 |
| 157 | Ga0068865_100700967 | 3300006881 | Bacteria | 865 |
| 158 | Ga0075435_100034410 | 3300007076 | Bacteria | 4014 |
| 159 | Ga0075435_100230618 | 3300007076 | Bacteria | 1573 |
| 160 | Ga0075435_100413035 | 3300007076 | Bacteria | 1162 |
| 161 | Ga0105240_10053723 | 3300009093 | Bacteria | 5054 |
| 162 | Ga0105240_10244655 | 3300009093 | Bacteria | 2078 |
| 163 | Ga0105240_10266310 | 3300009093 | Bacteria | 1975 |
| 164 | Ga0105240_10412394 | 3300009093 | Bacteria | 1519 |
| 165 | Ga0105245_10144131 | 3300009098 | Bacteria | 2246 |
| 166 | Ga0105245_10248959 | 3300009098 | Bacteria | 1725 |
| 167 | Ga0105245_11395512 | 3300009098 | Bacteria | 750 |
| 168 | Ga0105247_11104883 | 3300009101 | Bacteria | 626 |
| 169 | Ga0114129_10954462 | 3300009147 | Bacteria | 1083 |
| 170 | Ga0105243_10075126 | 3300009148 | Bacteria | 2742 |
| 171 | Ga0105243_10101554 | 3300009148 | Bacteria | 2388 |
| 172 | Ga0105243_10341224 | 3300009148 | Bacteria | 1372 |
| 173 | Ga0105241_10109855 | 3300009174 | Bacteria | 2206 |
| 174 | Ga0105242_10043710 | 3300009176 | Bacteria | 3625 |
| 175 | Ga0105242_10084950 | 3300009176 | Bacteria | 2653 |
| 176 | Ga0105242_10163927 | 3300009176 | Bacteria | 1948 |
| 177 | Ga0105242_12137556 | 3300009176 | Bacteria | 604 |
| 178 | Ga0105242_12592182 | 3300009176 | Unclassified | 556 |
| 179 | Ga0105248_10168095 | 3300009177 | Bacteria | 2472 |
| 180 | Ga0105248_10331001 | 3300009177 | Bacteria | 1715 |
| 181 | Ga0105248_10397209 | 3300009177 | Unclassified | 1552 |
| 182 | Ga0105237_10476229 | 3300009545 | Bacteria | 1255 |
| 183 | Ga0105237_12191029 | 3300009545 | Bacteria | 562 |
| 184 | Ga0105238_10304633 | 3300009551 | Bacteria | 1577 |
| 185 | Ga0105238_10662535 | 3300009551 | Bacteria | 1054 |
| 186 | Ga0105239_10659976 | 3300010375 | Unclassified | 1195 |
| 187 | Ga0105239_12861348 | 3300010375 | Bacteria | 563 |
| 188 | Ga0105246_10032406 | 3300011119 | Bacteria | 3465 |
| 189 | Ga0105246_11373586 | 3300011119 | Bacteria | 658 |
| 190 | Ga0157373_11242153 | 3300013100 | Bacteria | 562 |
| 191 | Ga0157370_10005691 | 3300013104 | Bacteria | 13930 |
| 192 | Ga0157369_10032553 | 3300013105 | Bacteria | 5733 |
| 193 | Ga0157369_10139012 | 3300013105 | Bacteria | 2571 |
| 194 | Ga0157369_10491344 | 3300013105 | Unclassified | 1270 |
| 195 | Ga0157369_10592755 | 3300013105 | Bacteria | 1144 |
| 196 | Ga0157369_11398126 | 3300013105 | Bacteria | 712 |
| 197 | Ga0157374_10192731 | 3300013296 | Bacteria | 1994 |
| 198 | Ga0157374_11326527 | 3300013296 | Bacteria | 742 |
| 199 | Ga0157378_10185952 | 3300013297 | Unclassified | 1957 |
| 200 | Ga0157378_10584486 | 3300013297 | Bacteria | 1126 |
| 201 | Ga0163162_10520728 | 3300013306 | Unclassified | 1319 |
| 202 | Ga0163162_10693529 | 3300013306 | Bacteria | 1140 |
| 203 | Ga0163162_12019709 | 3300013306 | Bacteria | 661 |
| 204 | Ga0157372_10327048 | 3300013307 | Bacteria | 1785 |
| 205 | Ga0157372_10407554 | 3300013307 | Bacteria | 1584 |
| 206 | Ga0157372_10898072 | 3300013307 | Bacteria | 1028 |
| 207 | Ga0157375_10082222 | 3300013308 | Bacteria | 3262 |
| 208 | Ga0157375_10407173 | 3300013308 | Bacteria | 1527 |
| 209 | Ga0157375_10498899 | 3300013308 | Bacteria | 1381 |
| 210 | Ga0163163_11129674 | 3300014325 | Bacteria | 846 |
| 211 | Ga0163163_11512249 | 3300014325 | Bacteria | 733 |
| 212 | Ga0157380_11481919 | 3300014326 | Bacteria | 731 |
| 213 | Ga0182008_10005743 | 3300014497 | Bacteria | 7025 |
| 214 | Ga0157379_10253928 | 3300014968 | Bacteria | 1597 |
| 215 | Ga0157376_10007490 | 3300014969 | Bacteria | 7799 |
| 216 | Ga0157376_10152755 | 3300014969 | Bacteria | 2084 |
| 217 | Ga0182006_1036896 | 3300015261 | Bacteria | 1941 |
| 218 | Ga0182007_10027794 | 3300015262 | Bacteria | 1948 |
| 219 | Ga0182007_10036157 | 3300015262 | Bacteria | 1662 |
| 220 | Ga0197907_10589986 | 3300020069 | Bacteria | 3146 |
| 221 | Ga0197907_10777264 | 3300020069 | Bacteria | 1176 |
| 222 | Ga0197907_11035475 | 3300020069 | Bacteria | 1382 |
| 223 | Ga0197907_11238147 | 3300020069 | Bacteria | 1653 |
| 224 | Ga0206356_10418925 | 3300020070 | Bacteria | 5905 |
| 225 | Ga0206356_10822865 | 3300020070 | Bacteria | 1085 |
| 226 | Ga0206356_11230150 | 3300020070 | Bacteria | 2988 |
| 227 | Ga0206356_11855689 | 3300020070 | Bacteria | 1909 |
| 228 | Ga0206349_1009309 | 3300020075 | Bacteria | 1749 |
| 229 | Ga0206349_1109861 | 3300020075 | Bacteria | 559 |
| 230 | Ga0206351_10930327 | 3300020077 | Unclassified | 545 |
| 231 | Ga0206352_10295053 | 3300020078 | Unclassified | 1185 |
| 232 | Ga0206352_10468852 | 3300020078 | Bacteria | 1127 |
| 233 | Ga0206352_10674228 | 3300020078 | Unclassified | 1161 |
| 234 | Ga0206350_10604927 | 3300020080 | Unclassified | 705 |
| 235 | Ga0206350_10822870 | 3300020080 | Unclassified | 795 |
| 236 | Ga0206350_11487435 | 3300020080 | Bacteria | 593 |
| 237 | Ga0206354_10111255 | 3300020081 | Bacteria | 3340 |
| 238 | Ga0206354_10660180 | 3300020081 | Bacteria | 562 |
| 239 | Ga0206354_10928650 | 3300020081 | Bacteria | 3337 |
| 240 | Ga0206354_11113594 | 3300020081 | Bacteria | 5230 |
| 241 | Ga0206354_11356773 | 3300020081 | Bacteria | 653 |
| 242 | Ga0206354_11530171 | 3300020081 | Bacteria | 544 |
| 243 | Ga0206353_10854756 | 3300020082 | Bacteria | 9578 |
| 244 | Ga0206353_10918167 | 3300020082 | Bacteria | 4663 |
| 245 | Ga0206353_11349432 | 3300020082 | Bacteria | 4280 |
| 246 | Ga0224712_10049988 | 3300022467 | Bacteria | 1622 |
| 247 | Ga0224712_10076579 | 3300022467 | Bacteria | 1371 |
| 248 | Ga0224712_10087425 | 3300022467 | Bacteria | 1299 |
| 249 | Ga0224712_10631060 | 3300022467 | Bacteria | 524 |
| 250 | Ga0224712_10682337 | 3300022467 | Bacteria | 505 |
| 251 | Ga0207692_10462419 | 3300025898 | Bacteria | 800 |
| 252 | Ga0207642_10255626 | 3300025899 | Bacteria | 996 |
| 253 | Ga0207642_10336915 | 3300025899 | Bacteria | 886 |
| 254 | Ga0207699_10007356 | 3300025906 | Bacteria | 5384 |
| 255 | Ga0207699_11162077 | 3300025906 | Bacteria | 572 |
| 256 | Ga0207643_10388001 | 3300025908 | Bacteria | 881 |
| 257 | Ga0207705_10014632 | 3300025909 | Bacteria | 5645 |
| 258 | Ga0207705_10120284 | 3300025909 | Bacteria | 1948 |
| 259 | Ga0207684_10428542 | 3300025910 | Unclassified | 1136 |
| 260 | Ga0207684_10472720 | 3300025910 | Unclassified | 1075 |
| 261 | Ga0207707_10025403 | 3300025912 | Bacteria | 5182 |
| 262 | Ga0207707_10106756 | 3300025912 | Bacteria | 2448 |
| 263 | Ga0207707_10107397 | 3300025912 | Bacteria | 2440 |
| 264 | Ga0207707_10138297 | 3300025912 | Bacteria | 2129 |
| 265 | Ga0207707_10199680 | 3300025912 | Bacteria | 1744 |
| 266 | Ga0207707_10229390 | 3300025912 | Bacteria | 1616 |
| 267 | Ga0207707_10362876 | 3300025912 | Unclassified | 1247 |
| 268 | Ga0207707_10386256 | 3300025912 | Bacteria | 1203 |
| 269 | Ga0207695_10099287 | 3300025913 | Unclassified | 2909 |
| 270 | Ga0207695_10270833 | 3300025913 | Bacteria | 1594 |
| 271 | Ga0207695_10373182 | 3300025913 | Unclassified | 1313 |
| 272 | Ga0207695_10486889 | 3300025913 | Bacteria | 1116 |
| 273 | Ga0207695_10498230 | 3300025913 | Bacteria | 1100 |
| 274 | Ga0207671_10227672 | 3300025914 | Bacteria | 1462 |
| 275 | Ga0207671_11404558 | 3300025914 | Bacteria | 541 |
| 276 | Ga0207693_10013795 | 3300025915 | Bacteria | 6505 |
| 277 | Ga0207693_10062148 | 3300025915 | Bacteria | 2926 |
| 278 | Ga0207693_10149242 | 3300025915 | Bacteria | 1838 |
| 279 | Ga0207693_10154333 | 3300025915 | Bacteria | 1806 |
| 280 | Ga0207693_10159884 | 3300025915 | Bacteria | 1772 |
| 281 | Ga0207693_10181970 | 3300025915 | Bacteria | 1654 |
| 282 | Ga0207693_10264668 | 3300025915 | Unclassified | 1348 |
| 283 | Ga0207693_10629982 | 3300025915 | Bacteria | 834 |
| 284 | Ga0207693_11347001 | 3300025915 | Unclassified | 532 |
| 285 | Ga0207663_10121719 | 3300025916 | Bacteria | 1788 |
| 286 | Ga0207663_10477949 | 3300025916 | Bacteria | 965 |
| 287 | Ga0207663_11612336 | 3300025916 | Bacteria | 522 |
| 288 | Ga0207660_10007441 | 3300025917 | Bacteria | 7086 |
| 289 | Ga0207660_10054159 | 3300025917 | Bacteria | 2862 |
| 290 | Ga0207660_10067098 | 3300025917 | Bacteria | 2597 |
| 291 | Ga0207660_10416856 | 3300025917 | Bacteria | 1083 |
| 292 | Ga0207660_10513825 | 3300025917 | Bacteria | 972 |
| 293 | Ga0207660_11019608 | 3300025917 | Bacteria | 675 |
| 294 | Ga0207657_10000331 | 3300025919 | Bacteria | 50115 |
| 295 | Ga0207657_10051361 | 3300025919 | Bacteria | 3583 |
| 296 | Ga0207657_10061155 | 3300025919 | Bacteria | 3231 |
| 297 | Ga0207657_10350420 | 3300025919 | Bacteria | 1164 |
| 298 | Ga0207649_10087175 | 3300025920 | Bacteria | 2036 |
| 299 | Ga0207649_10088948 | 3300025920 | Bacteria | 2018 |
| 300 | Ga0207649_10872583 | 3300025920 | Unclassified | 705 |
| 301 | Ga0207652_10007747 | 3300025921 | Bacteria | 8625 |
| 302 | Ga0207652_10097191 | 3300025921 | Bacteria | 2595 |
| 303 | Ga0207652_10133898 | 3300025921 | Bacteria | 2212 |
| 304 | Ga0207652_10165856 | 3300025921 | Bacteria | 1981 |
| 305 | Ga0207652_10183337 | 3300025921 | Unclassified | 1882 |
| 306 | Ga0207652_11035037 | 3300025921 | Unclassified | 720 |
| 307 | Ga0207652_11138739 | 3300025921 | Bacteria | 681 |
| 308 | Ga0207646_10000129 | 3300025922 | Bacteria | 102411 |
| 309 | Ga0207646_10026256 | 3300025922 | Bacteria | 5317 |
| 310 | Ga0207646_10735773 | 3300025922 | Bacteria | 881 |
| 311 | Ga0207659_10451447 | 3300025926 | Bacteria | 1083 |
| 312 | Ga0207659_10880250 | 3300025926 | Bacteria | 770 |
| 313 | Ga0207687_10002002 | 3300025927 | Bacteria | 14006 |
| 314 | Ga0207687_10156053 | 3300025927 | Bacteria | 1746 |
| 315 | Ga0207687_11939162 | 3300025927 | Unclassified | 503 |
| 316 | Ga0207700_10000036 | 3300025928 | Bacteria | 119429 |
| 317 | Ga0207700_10018638 | 3300025928 | Bacteria | 4671 |
| 318 | Ga0207700_10037237 | 3300025928 | Bacteria | 3521 |
| 319 | Ga0207700_10070616 | 3300025928 | Bacteria | 2685 |
| 320 | Ga0207700_10183054 | 3300025928 | Unclassified | 1756 |
| 321 | Ga0207700_11211493 | 3300025928 | Bacteria | 674 |
| 322 | Ga0207664_10005201 | 3300025929 | Bacteria | 8871 |
| 323 | Ga0207664_10112603 | 3300025929 | Bacteria | 2265 |
| 324 | Ga0207664_10139948 | 3300025929 | Bacteria | 2046 |
| 325 | Ga0207664_10150738 | 3300025929 | Bacteria | 1975 |
| 326 | Ga0207664_10174776 | 3300025929 | Bacteria | 1840 |
| 327 | Ga0207664_11580503 | 3300025929 | Unclassified | 578 |
| 328 | Ga0207644_10140113 | 3300025931 | Bacteria | 1862 |
| 329 | Ga0207644_11465445 | 3300025931 | Bacteria | 573 |
| 330 | Ga0207690_10016151 | 3300025932 | Bacteria | 4539 |
| 331 | Ga0207686_10002712 | 3300025934 | Bacteria | 9609 |
| 332 | Ga0207709_10126658 | 3300025935 | Bacteria | 1733 |
| 333 | Ga0207670_11720586 | 3300025936 | Unclassified | 533 |
| 334 | Ga0207665_10000716 | 3300025939 | Bacteria | 22500 |
| 335 | Ga0207665_10006441 | 3300025939 | Bacteria | 7790 |
| 336 | Ga0207665_10742948 | 3300025939 | Bacteria | 773 |
| 337 | Ga0207665_10932085 | 3300025939 | Bacteria | 689 |
| 338 | Ga0207665_11207019 | 3300025939 | Unclassified | 603 |
| 339 | Ga0207711_10163950 | 3300025941 | Bacteria | 2014 |
| 340 | Ga0207661_10000153 | 3300025944 | Bacteria | 44357 |
| 341 | Ga0207661_10009928 | 3300025944 | Bacteria | 6836 |
| 342 | Ga0207661_10038853 | 3300025944 | Bacteria | 3733 |
| 343 | Ga0207661_10117614 | 3300025944 | Bacteria | 2258 |
| 344 | Ga0207661_10123709 | 3300025944 | Bacteria | 2206 |
| 345 | Ga0207661_10167664 | 3300025944 | Bacteria | 1910 |
| 346 | Ga0207661_10890369 | 3300025944 | Unclassified | 820 |
| 347 | Ga0207679_10034583 | 3300025945 | Bacteria | 3567 |
| 348 | Ga0207679_10285951 | 3300025945 | Bacteria | 1416 |
| 349 | Ga0207667_10020985 | 3300025949 | Bacteria | 7245 |
| 350 | Ga0207667_10193880 | 3300025949 | Bacteria | 2084 |
| 351 | Ga0207667_10267163 | 3300025949 | Bacteria | 1749 |
| 352 | Ga0207667_11036521 | 3300025949 | Bacteria | 806 |
| 353 | Ga0207640_10314717 | 3300025981 | Bacteria | 1244 |
| 354 | Ga0207677_10007839 | 3300026023 | Bacteria | 5932 |
| 355 | Ga0207677_10350257 | 3300026023 | Bacteria | 1237 |
| 356 | Ga0207703_11557779 | 3300026035 | Bacteria | 636 |
| 357 | Ga0207639_10333782 | 3300026041 | Bacteria | 1350 |
| 358 | Ga0207678_10877289 | 3300026067 | Bacteria | 793 |
| 359 | Ga0207708_10696911 | 3300026075 | Bacteria | 868 |
| 360 | Ga0207702_10002831 | 3300026078 | Bacteria | 16231 |
| 361 | Ga0207702_10086354 | 3300026078 | Bacteria | 2736 |
| 362 | Ga0207702_10180699 | 3300026078 | Bacteria | 1943 |
| 363 | Ga0207702_10354177 | 3300026078 | Bacteria | 1405 |
| 364 | Ga0207641_10274558 | 3300026088 | Bacteria | 1583 |
| 365 | Ga0207641_12078639 | 3300026088 | Unclassified | 569 |
| 366 | Ga0207648_11099597 | 3300026089 | Bacteria | 745 |
| 367 | Ga0207674_10266240 | 3300026116 | Bacteria | 1661 |
| 368 | Ga0207674_10387798 | 3300026116 | Bacteria | 1350 |
| 369 | Ga0207675_100301235 | 3300026118 | Bacteria | 1561 |
| 370 | Ga0207683_10115722 | 3300026121 | Bacteria | 2404 |
| 371 | Ga0207683_10160367 | 3300026121 | Bacteria | 2033 |
| 372 | Ga0207698_10333122 | 3300026142 | Unclassified | 1426 |
| 373 | Ga0207698_10423826 | 3300026142 | Bacteria | 1278 |
| 374 | Ga0207698_12579660 | 3300026142 | Unclassified | 518 |
| 375 | Ga0268266_10300172 | 3300028379 | Bacteria | 1498 |
| 376 | Ga0265319_1004366 | 3300028563 | Bacteria | 7009 |
| 377 | Ga0265319_1056041 | 3300028563 | Bacteria | 1288 |
| 378 | Ga0265334_10060663 | 3300028573 | Bacteria | 1427 |
| 379 | Ga0265318_10013117 | 3300028577 | Bacteria | 3512 |
| 380 | Ga0265322_10032236 | 3300028654 | Bacteria | 1495 |
| 381 | Ga0265338_10044681 | 3300028800 | Bacteria | 4085 |
| 382 | Ga0265330_10032228 | 3300031235 | Bacteria | 2348 |
| 383 | Ga0265320_10038423 | 3300031240 | Bacteria | 2401 |
| 384 | Ga0265325_10312552 | 3300031241 | Unclassified | 699 |
| 385 | Ga0265329_10065229 | 3300031242 | Bacteria | 1152 |
| 386 | Ga0265339_10052859 | 3300031249 | Bacteria | 2211 |
| 387 | Ga0265331_10024994 | 3300031250 | Bacteria | 3017 |
| 388 | Ga0265327_10024417 | 3300031251 | Bacteria | 3553 |
| 389 | Ga0265327_10426389 | 3300031251 | Bacteria | 574 |
| 390 | Ga0265316_10050466 | 3300031344 | Bacteria | 3271 |
| 391 | Ga0265314_10047958 | 3300031711 | Bacteria | 3002 |
| 392 | Ga0265314_10345149 | 3300031711 | Bacteria | 821 |
| 393 | Ga0373959_0152494 | 3300034820 | Bacteria | 585 |
| 394 | Ga0373926_0010144 | 3300035083 | Bacteria | 3153 |
| 395 | Ga0373934_0185184 | 3300035086 | Bacteria | 856 |
| 396 | Ga0373944_0189419 | 3300035089 | Unclassified | 741 |
| 397 | Ga0373951_0013573 | 3300035091 | Bacteria | 1831 |
| 398 | Ga0373923_0261462 | 3300035111 | Bacteria | 812 |
| 399 | Ga0373936_0064043 | 3300035113 | Bacteria | 1506 |
| 400 | Ga0373936_0136139 | 3300035113 | Bacteria | 1058 |
| 401 | Ga0373945_0008136 | 3300035116 | Bacteria | 3409 |
| 402 | Ga0373945_0015496 | 3300035116 | Bacteria | 2566 |
| 403 | Ga0373945_0021885 | 3300035116 | Bacteria | 2200 |
| 404 | Ga0373945_0405744 | 3300035116 | Bacteria | 598 |
| 405 | Ga0373954_0414069 | 3300035118 | Bacteria | 667 |
| 406 | Ga0373956_0505953 | 3300035119 | Bacteria | 576 |
| 407 | Ga0373943_0000048 | 3300035170 | Bacteria | 41033 |
| 408 | Ga0373943_0000685 | 3300035170 | Bacteria | 14788 |
| 409 | Ga0373943_0745213 | 3300035170 | Bacteria | 582 |
| 410 | Ga0373946_0009234 | 3300035171 | Bacteria | 3628 |
| 411 | Ga0373955_0264570 | 3300035172 | Bacteria | 1033 |
| 412 | Ga0373924_0156056 | 3300035410 | Unclassified | 1000 |
| 413 | Ga0373935_0021359 | 3300035692 | Bacteria | 3964 |
| 414 | Ga0373935_0065680 | 3300035692 | Bacteria | 2329 |
| 415 | Ga0373927_0012161 | 3300035695 | Bacteria | 5725 |
| 416 | Ga0373927_0042475 | 3300035695 | Bacteria | 2945 |
| 417 | Ga0373927_0058785 | 3300035695 | Bacteria | 2487 |
| 418 | Ga0373933_0240788 | 3300035724 | Bacteria | 1164 |
| 419 | Ga0373933_0472663 | 3300035724 | Bacteria | 821 |
| 420 | Ga0373947_0002244 | 3300035725 | Bacteria | 11689 |
| 421 | Ga0373947_0002751 | 3300035725 | Bacteria | 10526 |
| 422 | Ga0373947_0473517 | 3300035725 | Bacteria | 849 |
| 423 | Ga0373947_1020353 | 3300035725 | Bacteria | 564 |
| 424 | Ga0373937_0460508 | 3300036401 | Bacteria | 1208 |
| 425 | Ga0373937_0472354 | 3300036401 | Bacteria | 1191 |
| 426 | Ga0373937_0664447 | 3300036401 | Unclassified | 988 |
| 427 | Ga0373937_0837873 | 3300036401 | Bacteria | 868 |
| 428 | Ga0373925_0004043 | 3300037068 | Bacteria | 11141 |
| 429 | Ga0373925_0014494 | 3300037068 | Bacteria | 5697 |
| 430 | Ga0373925_0026473 | 3300037068 | Bacteria | 4243 |
| 431 | Ga0395899_0344313 | 3300037312 | Bacteria | 999 |
| 432 | Ga0395900_0125204 | 3300037418 | Bacteria | 2636 |
| 433 | Ga0395900_0463473 | 3300037418 | Bacteria | 1222 |
| 434 | Ga0395900_0504989 | 3300037418 | Bacteria | 1159 |
| 435 | Ga0395900_1042242 | 3300037418 | Bacteria | 737 |
| 436 | Ga0395898_0471895 | 3300037466 | Bacteria | 1194 |
| 437 | Ga0395898_0505219 | 3300037466 | Bacteria | 1150 |
| 438 | Ga0395898_0563672 | 3300037466 | Bacteria | 1081 |
| 439 | Ga0395898_1625040 | 3300037466 | Bacteria | 570 |
| 440 | Ga0395905_1359942 | 3300037471 | Bacteria | 614 |
| 441 | Ga0395901_0129091 | 3300038443 | Bacteria | 2657 |
| 442 | Ga0395901_0162696 | 3300038443 | Bacteria | 2344 |
| 443 | Ga0395901_0181546 | 3300038443 | Bacteria | 2207 |
| 444 | Ga0395901_1433605 | 3300038443 | Unclassified | 648 |
| 445 | Ga0436360_0951907 | 3300039438 | Bacteria | 1541 |
| 446 | Ga0436362_0108004 | 3300039453 | Bacteria | 717 |
| 447 | Ga0451795_0066248 | 3300041456 | Bacteria | 684 |
| 448 | Ga0451839_0426424 | 3300041496 | Bacteria | 859 |
| 449 | Ga0466969_0000842 | 3300044656 | Bacteria | 16661 |
| 450 | Ga0466969_0004072 | 3300044656 | Bacteria | 7750 |
| 451 | Ga0466969_0075746 | 3300044656 | Bacteria | 1612 |
| 452 | Ga0466969_0515156 | 3300044656 | Bacteria | 546 |
| 453 | Ga0453683_0863321 | 3300044673 | Bacteria | 597 |
| 454 | Ga0466965_0017811 | 3300044683 | Bacteria | 3397 |
| 455 | Ga0466965_0137224 | 3300044683 | Bacteria | 1271 |
| 456 | Ga0466965_0374188 | 3300044683 | Bacteria | 783 |
| 457 | Ga0466966_0019638 | 3300044684 | Bacteria | 4446 |
| 458 | Ga0466966_0025858 | 3300044684 | Bacteria | 3834 |
| 459 | Ga0466966_0072370 | 3300044684 | Bacteria | 2158 |
| 460 | Ga0466966_0110869 | 3300044684 | Bacteria | 1691 |
| 461 | Ga0466966_0121364 | 3300044684 | Bacteria | 1605 |
| 462 | Ga0466966_0172808 | 3300044684 | Bacteria | 1312 |
| 463 | Ga0466966_0265844 | 3300044684 | Bacteria | 1032 |
| 464 | Ga0466961_0006416 | 3300044693 | Bacteria | 7469 |
| 465 | Ga0466961_0016296 | 3300044693 | Bacteria | 4773 |
| 466 | Ga0466961_0041683 | 3300044693 | Bacteria | 2943 |
| 467 | Ga0466961_0078398 | 3300044693 | Bacteria | 2092 |
| 468 | Ga0466963_0000768 | 3300044694 | Bacteria | 15875 |
| 469 | Ga0466963_0001745 | 3300044694 | Bacteria | 11840 |
| 470 | Ga0466963_0001777 | 3300044694 | Bacteria | 11736 |
| 471 | Ga0466963_0002439 | 3300044694 | Bacteria | 10401 |
| 472 | Ga0466963_0003819 | 3300044694 | Bacteria | 8685 |
| 473 | Ga0466963_0007553 | 3300044694 | Bacteria | 6488 |
| 474 | Ga0466963_0024908 | 3300044694 | Bacteria | 3811 |
| 475 | Ga0466963_0027782 | 3300044694 | Bacteria | 3627 |
| 476 | Ga0466963_0037939 | 3300044694 | Bacteria | 3149 |
| 477 | Ga0466963_0071413 | 3300044694 | Bacteria | 2336 |
| 478 | Ga0466963_0088170 | 3300044694 | Bacteria | 2111 |
| 479 | Ga0466963_0091552 | 3300044694 | Bacteria | 2071 |
| 480 | Ga0466963_0121532 | 3300044694 | Unclassified | 1798 |
| 481 | Ga0466963_0210761 | 3300044694 | Bacteria | 1359 |
| 482 | Ga0466963_0518397 | 3300044694 | Bacteria | 842 |
| 483 | Ga0466963_1137526 | 3300044694 | Bacteria | 549 |
| 484 | Ga0466963_1301669 | 3300044694 | Bacteria | 510 |
| 485 | Ga0466964_0001896 | 3300044706 | Bacteria | 7302 |
| 486 | Ga0466964_0002170 | 3300044706 | Bacteria | 6937 |
| 487 | Ga0466964_0013934 | 3300044706 | Bacteria | 3053 |
| 488 | Ga0466964_0029103 | 3300044706 | Bacteria | 2179 |
| 489 | Ga0466964_0064074 | 3300044706 | Bacteria | 1537 |
| 490 | Ga0466964_0385655 | 3300044706 | Unclassified | 728 |
| 491 | Ga0466964_0421196 | 3300044706 | Bacteria | 702 |
| 492 | Ga0466964_0671534 | 3300044706 | Bacteria | 575 |
| 493 | Ga0466971_0001398 | 3300044719 | Bacteria | 10130 |
| 494 | Ga0466971_0006829 | 3300044719 | Bacteria | 4966 |
| 495 | Ga0466971_0028646 | 3300044719 | Bacteria | 2491 |
| 496 | Ga0466971_0077393 | 3300044719 | Bacteria | 1514 |
| 497 | Ga0466971_0098841 | 3300044719 | Bacteria | 1340 |
| 498 | Ga0466971_0661718 | 3300044719 | Bacteria | 523 |
| 499 | Ga0466968_0031264 | 3300044735 | Bacteria | 2208 |
| 500 | Ga0466968_0032205 | 3300044735 | Bacteria | 2179 |
| 501 | Ga0466968_0036509 | 3300044735 | Bacteria | 2060 |
| 502 | Ga0466968_0052237 | 3300044735 | Bacteria | 1748 |
| 503 | Ga0466968_0064943 | 3300044735 | Bacteria | 1579 |
| 504 | Ga0466968_0096907 | 3300044735 | Bacteria | 1313 |
| 505 | Ga0466968_0124879 | 3300044735 | Bacteria | 1167 |
| 506 | Ga0466968_0178214 | 3300044735 | Bacteria | 987 |
| 507 | Ga0466970_0098231 | 3300044765 | Bacteria | 1593 |
| 508 | Ga0466970_0148286 | 3300044765 | Bacteria | 1295 |
| 509 | Ga0466970_0580063 | 3300044765 | Bacteria | 649 |
| 510 | Ga0466957_0000936 | 3300044842 | Bacteria | 14934 |
| 511 | Ga0466957_0020308 | 3300044842 | Bacteria | 3908 |
| 512 | Ga0466957_0022022 | 3300044842 | Bacteria | 3757 |
| 513 | Ga0466957_0024494 | 3300044842 | Bacteria | 3571 |
| 514 | Ga0466957_0042911 | 3300044842 | Bacteria | 2737 |
| 515 | Ga0466957_0097137 | 3300044842 | Bacteria | 1852 |
| 516 | Ga0466957_0114251 | 3300044842 | Bacteria | 1715 |
| 517 | Ga0466957_0133885 | 3300044842 | Bacteria | 1591 |
| 518 | Ga0466957_0147819 | 3300044842 | Bacteria | 1518 |
| 519 | Ga0466957_0221069 | 3300044842 | Bacteria | 1251 |
| 520 | Ga0466960_0044545 | 3300044901 | Bacteria | 2116 |
| 521 | Ga0466960_0054487 | 3300044901 | Bacteria | 1942 |
| 522 | Ga0466960_0743900 | 3300044901 | Unclassified | 591 |
| 523 | Ga0466959_0004897 | 3300045049 | Bacteria | 9067 |
| 524 | Ga0466959_0012854 | 3300045049 | Bacteria | 6057 |
| 525 | Ga0466959_0020896 | 3300045049 | Bacteria | 4825 |
| 526 | Ga0466959_0026355 | 3300045049 | Bacteria | 4308 |
| 527 | Ga0466959_0033913 | 3300045049 | Bacteria | 3776 |
| 528 | Ga0466959_1121566 | 3300045049 | Bacteria | 523 |
| 529 | Ga0451576_1694029 | 3300045051 | Bacteria | 655 |
| 530 | Ga0466958_0002388 | 3300045836 | Bacteria | 9400 |
| 531 | Ga0466958_0002635 | 3300045836 | Bacteria | 9070 |
| 532 | Ga0466958_0003001 | 3300045836 | Bacteria | 8647 |
| 533 | Ga0466958_0004176 | 3300045836 | Bacteria | 7587 |
| 534 | Ga0466958_0021359 | 3300045836 | Bacteria | 3781 |
| 535 | Ga0466958_0043813 | 3300045836 | Bacteria | 2696 |
| 536 | Ga0466958_0056855 | 3300045836 | Bacteria | 2377 |
| 537 | Ga0466958_0067910 | 3300045836 | Bacteria | 2178 |
| 538 | Ga0466958_0208862 | 3300045836 | Bacteria | 1243 |
| 539 | Ga0466958_0224364 | 3300045836 | Bacteria | 1199 |
| 540 | Ga0466958_0239138 | 3300045836 | Unclassified | 1160 |
| 541 | Ga0466958_0268988 | 3300045836 | Bacteria | 1091 |
| 542 | Ga0466967_0001386 | 3300045976 | Bacteria | 13990 |
| 543 | Ga0466967_0006433 | 3300045976 | Bacteria | 8310 |
| 544 | Ga0466967_0008724 | 3300045976 | Bacteria | 7464 |
| 545 | Ga0466967_0021581 | 3300045976 | Bacteria | 5235 |
| 546 | Ga0466967_0022089 | 3300045976 | Bacteria | 5184 |
| 547 | Ga0466967_0046731 | 3300045976 | Bacteria | 3770 |
| 548 | Ga0466967_0055137 | 3300045976 | Bacteria | 3501 |
| 549 | Ga0466967_0086288 | 3300045976 | Bacteria | 2843 |
| 550 | Ga0466967_0093421 | 3300045976 | Bacteria | 2737 |
| 551 | Ga0466967_0111020 | 3300045976 | Bacteria | 2519 |
| 552 | Ga0466967_0117893 | 3300045976 | Bacteria | 2448 |
| 553 | Ga0466967_0278196 | 3300045976 | Bacteria | 1605 |
| 554 | Ga0466967_0319298 | 3300045976 | Bacteria | 1497 |
| 555 | Ga0466967_0343144 | 3300045976 | Bacteria | 1444 |
| 556 | Ga0466967_0453499 | 3300045976 | Bacteria | 1253 |
| 557 | Ga0466967_0585853 | 3300045976 | Unclassified | 1100 |
| 558 | Ga0466967_0876124 | 3300045976 | Bacteria | 892 |
| 559 | Ga0466967_1250787 | 3300045976 | Bacteria | 739 |
| 560 | Ga0466967_2043506 | 3300045976 | Bacteria | 569 |
| 561 | Ga0466967_2501360 | 3300045976 | Bacteria | 511 |
| 562 | Ga0495592_0056902 | 3300046454 | Bacteria | 2888 |
| 563 | Ga0495592_0071165 | 3300046454 | Bacteria | 2532 |
| 564 | Ga0495592_0309658 | 3300046454 | Unclassified | 1024 |
| 565 | Ga0495592_0317017 | 3300046454 | Bacteria | 1009 |
| 566 | Ga0495603_0016728 | 3300046455 | Bacteria | 4436 |
| 567 | Ga0495603_0028893 | 3300046455 | Bacteria | 3345 |
| 568 | Ga0495629_0000159 | 3300046459 | Bacteria | 59616 |
| 569 | Ga0495629_0010159 | 3300046459 | Bacteria | 6862 |
| 570 | Ga0495629_0030459 | 3300046459 | Bacteria | 3825 |
| 571 | Ga0495629_0137646 | 3300046459 | Bacteria | 1700 |
| 572 | Ga0495629_0147555 | 3300046459 | Bacteria | 1635 |
| 573 | Ga0495629_0229927 | 3300046459 | Bacteria | 1278 |
| 574 | Ga0495629_0441701 | 3300046459 | Bacteria | 881 |
| 575 | Ga0495641_0002695 | 3300046461 | Bacteria | 13801 |
| 576 | Ga0495641_0009222 | 3300046461 | Bacteria | 5892 |
| 577 | Ga0495641_0520777 | 3300046461 | Unclassified | 542 |
| 578 | Ga0495651_0035829 | 3300046462 | Bacteria | 3863 |
| 579 | Ga0495651_0105648 | 3300046462 | Bacteria | 2088 |
| 580 | Ga0495651_0112045 | 3300046462 | Bacteria | 2016 |
| 581 | Ga0495651_0147514 | 3300046462 | Unclassified | 1699 |
| 582 | Ga0495651_0244697 | 3300046462 | Bacteria | 1228 |
| 583 | Ga0495651_0448389 | 3300046462 | Bacteria | 834 |
| 584 | Ga0495651_0846652 | 3300046462 | Unclassified | 562 |
| 585 | Ga0495653_0016911 | 3300046463 | Bacteria | 5933 |
| 586 | Ga0495653_0057407 | 3300046463 | Bacteria | 2962 |
| 587 | Ga0495653_0069160 | 3300046463 | Bacteria | 2646 |
| 588 | Ga0495653_0109752 | 3300046463 | Bacteria | 1985 |
| 589 | Ga0495653_0314202 | 3300046463 | Bacteria | 1018 |
| 590 | Ga0495580_0022526 | 3300046472 | Bacteria | 4635 |
| 591 | Ga0495582_0000036 | 3300046473 | Bacteria | 71283 |
| 592 | Ga0495582_0042097 | 3300046473 | Bacteria | 2516 |
| 593 | Ga0495582_0059376 | 3300046473 | Unclassified | 2110 |
| 594 | Ga0495582_0078245 | 3300046473 | Bacteria | 1834 |
| 595 | Ga0495582_0118557 | 3300046473 | Bacteria | 1490 |
| 596 | Ga0495605_0092480 | 3300046474 | Bacteria | 1400 |
| 597 | Ga0495639_0001197 | 3300046475 | Bacteria | 11707 |
| 598 | Ga0495639_0029376 | 3300046475 | Bacteria | 2440 |
| 599 | Ga0495639_0171242 | 3300046475 | Bacteria | 1054 |
| 600 | Ga0495662_0003844 | 3300046476 | Bacteria | 7571 |
| 601 | Ga0495664_0018479 | 3300046477 | Bacteria | 3995 |
| 602 | Ga0495664_0136521 | 3300046477 | Bacteria | 1486 |
| 603 | Ga0495664_0177344 | 3300046477 | Unclassified | 1292 |
| 604 | Ga0495664_0466565 | 3300046477 | Bacteria | 755 |
| 605 | Ga0495585_0041719 | 3300046492 | Bacteria | 2573 |
| 606 | Ga0495594_0049960 | 3300046499 | Unclassified | 2300 |
| 607 | Ga0495594_0310944 | 3300046499 | Unclassified | 898 |
| 608 | Ga0495594_0402442 | 3300046499 | Bacteria | 779 |
| 609 | Ga0495594_0503303 | 3300046499 | Unclassified | 688 |
| 610 | Ga0495594_0673902 | 3300046499 | Bacteria | 585 |
| 611 | Ga0495596_0130879 | 3300046500 | Bacteria | 974 |
| 612 | Ga0495607_0282902 | 3300046501 | Bacteria | 786 |
| 613 | Ga0495608_0198905 | 3300046511 | Bacteria | 1263 |
| 614 | Ga0495608_0226250 | 3300046511 | Bacteria | 1172 |
| 615 | Ga0495608_0256957 | 3300046511 | Bacteria | 1088 |
| 616 | Ga0495608_0346922 | 3300046511 | Bacteria | 914 |
| 617 | Ga0495618_0098067 | 3300046514 | Bacteria | 1875 |
| 618 | Ga0495618_0476620 | 3300046514 | Unclassified | 755 |
| 619 | Ga0495618_0594951 | 3300046514 | Unclassified | 659 |
| 620 | Ga0495628_0154580 | 3300046516 | Bacteria | 1746 |
| 621 | Ga0495628_0882640 | 3300046516 | Bacteria | 621 |
| 622 | Ga0495628_1197341 | 3300046516 | Bacteria | 515 |
| 623 | Ga0495630_0004782 | 3300046517 | Bacteria | 9498 |
| 624 | Ga0495630_0018175 | 3300046517 | Bacteria | 5162 |
| 625 | Ga0495630_0095762 | 3300046517 | Bacteria | 2244 |
| 626 | Ga0495630_0346132 | 3300046517 | Bacteria | 1137 |
| 627 | Ga0495630_0803836 | 3300046517 | Unclassified | 718 |
| 628 | Ga0495631_0049048 | 3300046518 | Bacteria | 1850 |
| 629 | Ga0495637_0135657 | 3300046520 | Bacteria | 937 |
| 630 | Ga0495644_0001492 | 3300046523 | Bacteria | 9540 |
| 631 | Ga0495663_0227259 | 3300046525 | Bacteria | 657 |
| 632 | Ga0495666_0002137 | 3300046526 | Bacteria | 9819 |
| 633 | Ga0495666_0529734 | 3300046526 | Unclassified | 526 |
| 634 | Ga0495652_0088127 | 3300046529 | Bacteria | 2544 |
| 635 | Ga0495652_0105994 | 3300046529 | Bacteria | 2270 |
| 636 | Ga0495652_0235158 | 3300046529 | Bacteria | 1367 |
| 637 | Ga0495652_0803946 | 3300046529 | Unclassified | 626 |
| 638 | Ga0495652_0867497 | 3300046529 | Bacteria | 597 |
| 639 | Ga0495665_0455393 | 3300046531 | Bacteria | 646 |
| 640 | Ga0495665_0645141 | 3300046531 | Unclassified | 527 |
| 641 | Ga0495640_0032678 | 3300046533 | Bacteria | 3704 |
| 642 | Ga0495640_0110004 | 3300046533 | Bacteria | 1801 |
| 643 | Ga0495586_0016243 | 3300046535 | Bacteria | 3959 |
| 644 | Ga0495586_0136460 | 3300046535 | Bacteria | 1375 |
| 645 | Ga0495586_0452715 | 3300046535 | Bacteria | 740 |
| 646 | Ga0495586_0581845 | 3300046535 | Bacteria | 647 |
| 647 | Ga0495587_0216494 | 3300046536 | Bacteria | 1081 |
| 648 | Ga0495587_0259394 | 3300046536 | Bacteria | 976 |
| 649 | Ga0495587_0323471 | 3300046536 | Unclassified | 861 |
| 650 | Ga0495587_0657815 | 3300046536 | Bacteria | 575 |
| 651 | Ga0495587_0690007 | 3300046536 | Bacteria | 560 |
| 652 | Ga0495598_0128874 | 3300046537 | Unclassified | 865 |
| 653 | Ga0495645_0081206 | 3300046543 | Bacteria | 2326 |
| 654 | Ga0495645_0110078 | 3300046543 | Bacteria | 1950 |
| 655 | Ga0495645_0597771 | 3300046543 | Bacteria | 679 |
| 656 | Ga0495645_0750593 | 3300046543 | Bacteria | 589 |
| 657 | Ga0495667_0084220 | 3300046559 | Bacteria | 2064 |
| 658 | Ga0495667_0093000 | 3300046559 | Bacteria | 1952 |
| 659 | Ga0495667_0108861 | 3300046559 | Unclassified | 1790 |
| 660 | Ga0495667_0306109 | 3300046559 | Bacteria | 1006 |
| 661 | Ga0495667_0384729 | 3300046559 | Bacteria | 884 |
| 662 | Ga0495667_0457616 | 3300046559 | Bacteria | 801 |
| 663 | Ga0495656_0000672 | 3300046615 | Bacteria | 10975 |
| 664 | Ga0495634_0018092 | 3300046642 | Bacteria | 5020 |
| 665 | Ga0495634_0040709 | 3300046642 | Bacteria | 3158 |
| 666 | Ga0495634_0065359 | 3300046642 | Bacteria | 2411 |
| 667 | Ga0495611_0022727 | 3300046648 | Bacteria | 2715 |
| 668 | Ga0495635_0038756 | 3300046663 | Bacteria | 3298 |
| 669 | Ga0495635_0272923 | 3300046663 | Bacteria | 1137 |
| 670 | Ga0495635_0742033 | 3300046663 | Bacteria | 635 |
| 671 | Ga0495659_0451116 | 3300046664 | Bacteria | 560 |
| 672 | Ga0495661_0050966 | 3300046665 | Bacteria | 2502 |
| 673 | Ga0495588_0167292 | 3300046674 | Bacteria | 1163 |
| 674 | Ga0495588_0182258 | 3300046674 | Bacteria | 1110 |
| 675 | Ga0495588_0697703 | 3300046674 | Bacteria | 531 |
| 676 | Ga0495657_0034744 | 3300046675 | Bacteria | 3499 |
| 677 | Ga0495657_0037950 | 3300046675 | Bacteria | 3317 |
| 678 | Ga0495657_0055931 | 3300046675 | Bacteria | 2631 |
| 679 | Ga0495657_0719482 | 3300046675 | Unclassified | 573 |
| 680 | Ga0495599_0371656 | 3300046678 | Unclassified | 855 |
| 681 | Ga0495599_0448368 | 3300046678 | Bacteria | 764 |
| 682 | Ga0495599_0595524 | 3300046678 | Bacteria | 644 |
| 683 | Ga0495646_0025809 | 3300046680 | Bacteria | 3694 |
| 684 | Ga0495646_0094551 | 3300046680 | Bacteria | 1721 |
| 685 | Ga0495646_0259731 | 3300046680 | Bacteria | 928 |
| 686 | Ga0495646_0505782 | 3300046680 | Bacteria | 620 |
| 687 | Ga0495647_0001238 | 3300046681 | Bacteria | 7877 |
| 688 | Ga0495647_0004455 | 3300046681 | Bacteria | 4551 |
| 689 | Ga0495647_0020964 | 3300046681 | Bacteria | 2350 |
| 690 | Ga0495658_0029366 | 3300046683 | Bacteria | 2976 |
| 691 | Ga0495658_0091185 | 3300046683 | Bacteria | 1805 |
| 692 | Ga0495658_0108637 | 3300046683 | Bacteria | 1665 |
| 693 | Ga0495658_0406005 | 3300046683 | Unclassified | 869 |
| 694 | Ga0495658_0434581 | 3300046683 | Bacteria | 838 |
| 695 | Ga0495613_0001777 | 3300046689 | Bacteria | 16372 |
| 696 | Ga0495613_0027163 | 3300046689 | Bacteria | 4259 |
| 697 | Ga0495613_0431518 | 3300046689 | Unclassified | 895 |
| 698 | Ga0495613_0631434 | 3300046689 | Bacteria | 710 |
| 699 | Ga0495613_1006931 | 3300046689 | Bacteria | 535 |
| 700 | Ga0495613_1107328 | 3300046689 | Bacteria | 505 |
| 701 | Ga0495624_0002893 | 3300046690 | Bacteria | 12849 |
| 702 | Ga0495624_0003155 | 3300046690 | Bacteria | 12286 |
| 703 | Ga0495624_0035813 | 3300046690 | Bacteria | 3203 |
| 704 | Ga0495624_0744529 | 3300046690 | Bacteria | 581 |
| 705 | Ga0495670_0414714 | 3300046691 | Bacteria | 728 |
| 706 | Ga0495589_0542491 | 3300046794 | Bacteria | 530 |
| 707 | Ga0495600_0016740 | 3300046809 | Bacteria | 4659 |
| 708 | Ga0495600_0029027 | 3300046809 | Bacteria | 3581 |
| 709 | Ga0495600_0654272 | 3300046809 | Bacteria | 635 |
| 710 | Ga0495581_0000587 | 3300047315 | Bacteria | 19001 |
| 711 | Ga0495581_0593883 | 3300047315 | Unclassified | 641 |
| 712 | Ga0495604_0478700 | 3300047317 | Bacteria | 810 |
| 713 | Ga0495604_0580953 | 3300047317 | Bacteria | 720 |
| 714 | Ga0495674_0018004 | 3300047319 | Bacteria | 6575 |
| 715 | Ga0495674_0025174 | 3300047319 | Bacteria | 5462 |
| 716 | Ga0495674_0043646 | 3300047319 | Bacteria | 3990 |
| 717 | Ga0495674_0043942 | 3300047319 | Bacteria | 3973 |
| 718 | Ga0495674_0077334 | 3300047319 | Bacteria | 2861 |
| 719 | Ga0495674_0335701 | 3300047319 | Bacteria | 1229 |
| 720 | Ga0495674_0452822 | 3300047319 | Bacteria | 1031 |
| 721 | Ga0495674_0701146 | 3300047319 | Bacteria | 794 |
| 722 | Ga0495674_1484384 | 3300047319 | Bacteria | 502 |
| 723 | Ga0495676_0000361 | 3300047321 | Bacteria | 37295 |
| 724 | Ga0495676_0283901 | 3300047321 | Bacteria | 1120 |
| 725 | Ga0495676_0330210 | 3300047321 | Bacteria | 1023 |
| 726 | Ga0495680_0002866 | 3300047322 | Bacteria | 17323 |
| 727 | Ga0495680_0025668 | 3300047322 | Bacteria | 4873 |
| 728 | Ga0495680_0030352 | 3300047322 | Bacteria | 4413 |
| 729 | Ga0495680_0057909 | 3300047322 | Bacteria | 2995 |
| 730 | Ga0495680_0134465 | 3300047322 | Bacteria | 1814 |
| 731 | Ga0495680_0170936 | 3300047322 | Bacteria | 1573 |
| 732 | Ga0495680_0172337 | 3300047322 | Bacteria | 1566 |
| 733 | Ga0495680_0661118 | 3300047322 | Bacteria | 693 |
| 734 | Ga0495680_0664010 | 3300047322 | Bacteria | 692 |
| 735 | Ga0495683_0084980 | 3300047323 | Bacteria | 1539 |
| 736 | Ga0495675_0115303 | 3300047444 | Bacteria | 1675 |
| 737 | Ga0495675_0185388 | 3300047444 | Bacteria | 1272 |
| 738 | Ga0495675_0653039 | 3300047444 | Bacteria | 592 |
| 739 | Ga0495685_107384 | 3300047447 | Bacteria | 920 |
| 740 | Ga0495684_0017217 | 3300047471 | Bacteria | 5563 |
| 741 | Ga0495684_0071627 | 3300047471 | Bacteria | 2633 |
| 742 | Ga0495684_0105928 | 3300047471 | Bacteria | 2124 |
| 743 | Ga0495684_0117953 | 3300047471 | Bacteria | 2000 |
| 744 | Ga0495684_0143072 | 3300047471 | Bacteria | 1792 |
| 745 | Ga0495593_0043996 | 3300047673 | Bacteria | 2390 |
| 746 | Ga0495593_0103176 | 3300047673 | Bacteria | 1461 |
| 747 | Ga0495602_0274683 | 3300048088 | Bacteria | 1244 |
| 748 | Ga0495602_0362157 | 3300048088 | Bacteria | 1044 |
| 749 | Ga0495602_0371249 | 3300048088 | Bacteria | 1027 |
| 750 | Ga0495602_0931945 | 3300048088 | Bacteria | 576 |
| 751 | Ga0495614_0000877 | 3300048089 | Bacteria | 12748 |
| 752 | Ga0495614_0071446 | 3300048089 | Bacteria | 1496 |
| 753 | Ga0496100_0030073 | 3300048903 | Bacteria | 3365 |
| 754 | Ga0496100_0100222 | 3300048903 | Bacteria | 1995 |
| 755 | Ga0496100_0147364 | 3300048903 | Unclassified | 1675 |
| 756 | Ga0496100_0297075 | 3300048903 | Bacteria | 1208 |
| 757 | Ga0496100_0634741 | 3300048903 | Bacteria | 831 |
| 758 | Ga0496100_0714923 | 3300048903 | Unclassified | 782 |
| 759 | Ga0496100_1086725 | 3300048903 | Bacteria | 630 |
| 760 | Ga0496100_1180556 | 3300048903 | Bacteria | 604 |
| 761 | Ga0496101_0000947 | 3300048904 | Bacteria | 17119 |
| 762 | Ga0496101_0002071 | 3300048904 | Bacteria | 12211 |
| 763 | Ga0496101_0008977 | 3300048904 | Bacteria | 6553 |
| 764 | Ga0496101_0041668 | 3300048904 | Bacteria | 3275 |
| 765 | Ga0496101_0125412 | 3300048904 | Unclassified | 1945 |
| 766 | Ga0496101_0242271 | 3300048904 | Bacteria | 1403 |
| 767 | Ga0496102_0000889 | 3300048905 | Bacteria | 28364 |
| 768 | Ga0496102_0039679 | 3300048905 | Bacteria | 4255 |
| 769 | Ga0496102_0046909 | 3300048905 | Bacteria | 3925 |
| 770 | Ga0496102_0054082 | 3300048905 | Bacteria | 3660 |
| 771 | Ga0496102_0119891 | 3300048905 | Bacteria | 2456 |
| 772 | Ga0496102_0297779 | 3300048905 | Bacteria | 1520 |
| 773 | Ga0496102_0456677 | 3300048905 | Bacteria | 1198 |
| 774 | Ga0496102_1240672 | 3300048905 | Unclassified | 665 |
| 775 | Ga0496103_0017841 | 3300048906 | Bacteria | 4252 |
| 776 | Ga0496103_0026685 | 3300048906 | Bacteria | 3496 |
| 777 | Ga0496103_0062063 | 3300048906 | Bacteria | 2326 |
| 778 | Ga0496103_0140689 | 3300048906 | Bacteria | 1543 |
| 779 | Ga0496103_0163078 | 3300048906 | Bacteria | 1430 |
| 780 | Ga0496103_0189745 | 3300048906 | Bacteria | 1321 |
| 781 | Ga0496104_0002177 | 3300048907 | Bacteria | 17000 |
| 782 | Ga0496104_0002279 | 3300048907 | Bacteria | 16544 |
| 783 | Ga0496104_0044575 | 3300048907 | Bacteria | 4167 |
| 784 | Ga0496104_0098521 | 3300048907 | Bacteria | 2798 |
| 785 | Ga0496104_0129103 | 3300048907 | Bacteria | 2427 |
| 786 | Ga0496104_0451861 | 3300048907 | Unclassified | 1197 |
| 787 | Ga0496104_0652172 | 3300048907 | Bacteria | 961 |
| 788 | Ga0496105_0000123 | 3300048908 | Bacteria | 52367 |
| 789 | Ga0496105_0002447 | 3300048908 | Bacteria | 13431 |
| 790 | Ga0496105_0014622 | 3300048908 | Bacteria | 6250 |
| 791 | Ga0496105_0119218 | 3300048908 | Bacteria | 2177 |
| 792 | Ga0496105_0135449 | 3300048908 | Bacteria | 2029 |
| 793 | Ga0496105_0151699 | 3300048908 | Unclassified | 1905 |
| 794 | Ga0496105_0212469 | 3300048908 | Bacteria | 1576 |
| 795 | Ga0496105_0724261 | 3300048908 | Bacteria | 762 |
| 796 | Ga0496105_0795687 | 3300048908 | Bacteria | 719 |
| 797 | Ga0496105_1219770 | 3300048908 | Bacteria | 553 |
| 798 | Ga0496105_1307270 | 3300048908 | Unclassified | 529 |
| 799 | Ga0496106_0014987 | 3300048909 | Bacteria | 5735 |
| 800 | Ga0496106_0027485 | 3300048909 | Bacteria | 4237 |
| 801 | Ga0496106_0031374 | 3300048909 | Bacteria | 3959 |
| 802 | Ga0496106_0146112 | 3300048909 | Bacteria | 1863 |
| 803 | Ga0496106_0328245 | 3300048909 | Bacteria | 1228 |
| 804 | Ga0496106_0577215 | 3300048909 | Bacteria | 901 |
| 805 | Ga0496107_0008144 | 3300048910 | Bacteria | 7249 |
| 806 | Ga0496107_0033250 | 3300048910 | Bacteria | 3689 |
| 807 | Ga0496107_0038792 | 3300048910 | Bacteria | 3416 |
| 808 | Ga0496107_0116613 | 3300048910 | Bacteria | 1966 |
| 809 | Ga0496107_0119064 | 3300048910 | Bacteria | 1944 |
| 810 | Ga0496107_0251066 | 3300048910 | Bacteria | 1316 |
| 811 | Ga0496107_0258660 | 3300048910 | Bacteria | 1295 |
| 812 | Ga0496107_0262572 | 3300048910 | Unclassified | 1285 |
| 813 | Ga0496107_0938164 | 3300048910 | Bacteria | 630 |
| 814 | Ga0496108_0056221 | 3300048911 | Bacteria | 3305 |
| 815 | Ga0496108_0063357 | 3300048911 | Bacteria | 3113 |
| 816 | Ga0496108_0083533 | 3300048911 | Bacteria | 2709 |
| 817 | Ga0496108_0085296 | 3300048911 | Bacteria | 2680 |
| 818 | Ga0496108_0352822 | 3300048911 | Bacteria | 1284 |
| 819 | Ga0496108_1625922 | 3300048911 | Bacteria | 534 |
| 820 | Ga0496109_0002406 | 3300048912 | Bacteria | 15672 |
| 821 | Ga0496109_0003079 | 3300048912 | Bacteria | 13905 |
| 822 | Ga0496109_0005647 | 3300048912 | Bacteria | 10464 |
| 823 | Ga0496109_0026855 | 3300048912 | Bacteria | 5135 |
| 824 | Ga0496109_0076164 | 3300048912 | Bacteria | 3085 |
| 825 | Ga0496109_0244240 | 3300048912 | Bacteria | 1690 |
| 826 | Ga0496109_0775548 | 3300048912 | Bacteria | 897 |
| 827 | Ga0496109_1061443 | 3300048912 | Bacteria | 747 |
| 828 | Ga0496110_0004567 | 3300048913 | Bacteria | 10753 |
| 829 | Ga0496110_0040976 | 3300048913 | Bacteria | 4038 |
| 830 | Ga0496110_1830876 | 3300048913 | Bacteria | 517 |
| 831 | Ga0496111_0000659 | 3300048914 | Bacteria | 18153 |
| 832 | Ga0496111_0019831 | 3300048914 | Bacteria | 4675 |
| 833 | Ga0496111_0041148 | 3300048914 | Bacteria | 3316 |
| 834 | Ga0496111_0096552 | 3300048914 | Bacteria | 2169 |
| 835 | Ga0496111_0107903 | 3300048914 | Bacteria | 2050 |
| 836 | Ga0496111_0122931 | 3300048914 | Bacteria | 1917 |
| 837 | Ga0496111_0164832 | 3300048914 | Bacteria | 1646 |
| 838 | Ga0496111_0381465 | 3300048914 | Unclassified | 1042 |
| 839 | Ga0496111_0422061 | 3300048914 | Bacteria | 985 |
| 840 | Ga0496112_0033021 | 3300048915 | Bacteria | 5026 |
| 841 | Ga0496112_0057379 | 3300048915 | Bacteria | 3833 |
| 842 | Ga0496112_0096176 | 3300048915 | Bacteria | 2932 |
| 843 | Ga0496112_0118840 | 3300048915 | Bacteria | 2613 |
| 844 | Ga0496112_0290932 | 3300048915 | Bacteria | 1579 |
| 845 | Ga0496112_0887264 | 3300048915 | Bacteria | 814 |
| 846 | Ga0496112_1496381 | 3300048915 | Bacteria | 589 |
| 847 | Ga0496112_1686297 | 3300048915 | Unclassified | 546 |
| 848 | Ga0496113_0088332 | 3300048916 | Bacteria | 2384 |
| 849 | Ga0496113_0109686 | 3300048916 | Bacteria | 2146 |
| 850 | Ga0496113_0408772 | 3300048916 | Bacteria | 1090 |
| 851 | Ga0496113_0776817 | 3300048916 | Unclassified | 762 |
| 852 | Ga0496113_1057759 | 3300048916 | Bacteria | 638 |
| 853 | Ga0496114_0000202 | 3300048917 | Bacteria | 43512 |
| 854 | Ga0496114_0001405 | 3300048917 | Bacteria | 18264 |
| 855 | Ga0496114_0050982 | 3300048917 | Bacteria | 3445 |
| 856 | Ga0496114_0056019 | 3300048917 | Bacteria | 3288 |
| 857 | Ga0496114_0063253 | 3300048917 | Bacteria | 3098 |
| 858 | Ga0496114_0107881 | 3300048917 | Unclassified | 2383 |
| 859 | Ga0496114_0141639 | 3300048917 | Bacteria | 2082 |
| 860 | Ga0496114_0149313 | 3300048917 | Unclassified | 2027 |
| 861 | Ga0496114_0322547 | 3300048917 | Bacteria | 1365 |
| 862 | Ga0496115_0001304 | 3300048918 | Bacteria | 17770 |
| 863 | Ga0496115_0007949 | 3300048918 | Bacteria | 7828 |
| 864 | Ga0496115_0018339 | 3300048918 | Bacteria | 5371 |
| 865 | Ga0496115_0085259 | 3300048918 | Bacteria | 2576 |
| 866 | Ga0496115_0166760 | 3300048918 | Bacteria | 1821 |
| 867 | Ga0496115_0237326 | 3300048918 | Unclassified | 1503 |
| 868 | Ga0496115_0327650 | 3300048918 | Unclassified | 1252 |
| 869 | Ga0496115_0437336 | 3300048918 | Bacteria | 1058 |
| 870 | Ga0496115_0442663 | 3300048918 | Bacteria | 1050 |
| 871 | Ga0496115_0466748 | 3300048918 | Bacteria | 1018 |
| 872 | Ga0496115_0466771 | 3300048918 | Bacteria | 1018 |
| 873 | Ga0496115_0684939 | 3300048918 | Bacteria | 807 |
| 874 | Ga0501038_0906107 | 3300049574 | Bacteria | 651 |
| 875 | Ga0501067_0020799 | 3300049583 | Bacteria | 3630 |
| 876 | Ga0501067_0417937 | 3300049583 | Bacteria | 748 |
| 877 | Ga0501068_0085197 | 3300049584 | Bacteria | 1945 |
| 878 | Ga0501068_0234356 | 3300049584 | Bacteria | 1168 |
| 879 | Ga0501068_0390531 | 3300049584 | Bacteria | 897 |
| 880 | Ga0501069_0016467 | 3300049585 | Bacteria | 3973 |
| 881 | Ga0501069_0019903 | 3300049585 | Bacteria | 3631 |
| 882 | Ga0501069_0040917 | 3300049585 | Bacteria | 2561 |
| 883 | Ga0501071_0088195 | 3300049587 | Bacteria | 2276 |
| 884 | Ga0501076_0463074 | 3300049592 | Bacteria | 1044 |
| 885 | nmdc:mga05p37_1400006_c1 | 3300050507 | Unclassified | 704 |
| 886 | nmdc:mga0n895_125532_c1 | 3300050512 | Bacteria | 2590 |
| 887 | nmdc:mga0n895_327670_c1 | 3300050512 | Bacteria | 1552 |
| 888 | nmdc:mga0n895_579537_c1 | 3300050512 | Bacteria | 1126 |
| 889 | nmdc:mga0n895_595820_c1 | 3300050512 | Bacteria | 1108 |
| 890 | nmdc:mga0rr50_294547_c1 | 3300050513 | Bacteria | 1356 |
| 891 | nmdc:mga0rr50_550607_c1 | 3300050513 | Bacteria | 982 |
| 892 | nmdc:mga0rr50_710640_c1 | 3300050513 | Bacteria | 858 |
| 893 | nmdc:mga08x19_232209_c1 | 3300050514 | Bacteria | 1270 |
| 894 | nmdc:mga0a205_11791_c2 | 3300050515 | Bacteria | 6229 |
| 895 | nmdc:mga0a205_1274121_c1 | 3300050515 | Unclassified | 583 |
| 896 | nmdc:mga0a205_349004_c1 | 3300050515 | Bacteria | 1347 |
| 897 | nmdc:mga0a205_462571_c1 | 3300050515 | Bacteria | 1128 |
| 898 | Ga0495601_0029860 | 3300053077 | Bacteria | 3384 |
| 899 | Ga0495601_0048421 | 3300053077 | Bacteria | 2677 |
| 900 | Ga0495601_0150242 | 3300053077 | Bacteria | 1520 |
| 901 | Ga0495601_0166095 | 3300053077 | Bacteria | 1442 |
| 902 | Ga0495601_0206733 | 3300053077 | Bacteria | 1282 |
| 903 | Ga0495601_0894252 | 3300053077 | Bacteria | 561 |
| 904 | Ga0495601_1020642 | 3300053077 | Unclassified | 520 |
| 905 | Ga0495612_0003796 | 3300053078 | Bacteria | 6280 |
| 906 | Ga0495612_0119383 | 3300053078 | Bacteria | 1133 |
| 907 | Ga0495612_0413618 | 3300053078 | Unclassified | 614 |
| 908 | Ga0495595_0047752 | 3300053084 | Bacteria | 1975 |
| 909 | Ga0495595_0093362 | 3300053084 | Bacteria | 1446 |
| 910 | Ga0495619_0001672 | 3300053085 | Bacteria | 14668 |
| 911 | Ga0495619_0009375 | 3300053085 | Bacteria | 6176 |
| 912 | Ga0495619_0049593 | 3300053085 | Bacteria | 2769 |
| 913 | Ga0495619_0181059 | 3300053085 | Bacteria | 1458 |
| 914 | Ga0495619_0299704 | 3300053085 | Bacteria | 1113 |
| 915 | Ga0495619_0355037 | 3300053085 | Bacteria | 1014 |
| 916 | Ga0495619_0813709 | 3300053085 | Bacteria | 631 |
| 917 | Ga0500566_0012003 | 3300053094 | Bacteria | 5101 |
| 918 | Ga0587070_064177 | 3300059491 | Unclassified | 767 |
| 919 | Ga0587073_0168726 | 3300059492 | Bacteria | 633 |
| 920 | Ga0587106_073502 | 3300059605 | Unclassified | 652 |
| 921 | Ga0587067_169181 | 3300059640 | Bacteria | 562 |
| 922 | Ga0587079_098818 | 3300059647 | Bacteria | 694 |
| 923 | Ga0466962_0000760 | 3300061719 | Bacteria | 14449 |
| 924 | Ga0466962_0003085 | 3300061719 | Bacteria | 7928 |
| 925 | Ga0466962_0006014 | 3300061719 | Bacteria | 5835 |
| 926 | Ga0466962_0066438 | 3300061719 | Bacteria | 1721 |
| 927 | Ga0466962_0067064 | 3300061719 | Bacteria | 1713 |
| 928 | Ga0466962_0090873 | 3300061719 | Bacteria | 1462 |
| 929 | Ga0105240_10091225 | |||
| 930 | Ga0070658_10011268 | |||
| 931 | Ga0070683_100000320 | |||
| 932 | Ga0070683_100016774 | |||
| 933 | Ga0070683_100023619 | |||
| 934 | Ga0070683_100270987 | |||
| 935 | Ga0070683_100440773 | |||
| 936 | Ga0070680_100027859 | |||
| 937 | Ga0070680_100031401 | |||
| 938 | Ga0070680_100080186 | |||
| 939 | Ga0070680_100240578 | |||
| 940 | Ga0070680_100399361 | |||
| 941 | Ga0070680_101322199 | |||
| 942 | Ga0070682_100159254 | |||
| 943 | Ga0068868_100037222 | |||
| 944 | Ga0068868_100634520 | |||
| 945 | Ga0070660_100002588 | |||
| 946 | Ga0070660_100046649 | |||
| 947 | Ga0070660_100069624 | |||
| 948 | Ga0070660_101180188 | |||
| 949 | Ga0070691_10041326 | |||
| 950 | Ga0070661_100112139 | |||
| 951 | Ga0070661_100126942 | |||
| 952 | Ga0070661_100969948 | |||
| 953 | Ga0070675_100475032 | |||
| 954 | Ga0070675_101319678 | |||
| 955 | Ga0070671_100254010 | |||
| 956 | Ga0070671_100634187 | |||
| 957 | Ga0070671_101007797 | |||
| 958 | Ga0070674_100306495 | |||
| 959 | Ga0070659_100062863 | |||
| 960 | Ga0070703_10203563 | |||
| 961 | Ga0070709_10004535 | |||
| 962 | Ga0070714_100009674 | |||
| 963 | Ga0070714_100026376 | |||
| 964 | Ga0070714_100105772 | |||
| 965 | Ga0070714_100134500 | |||
| 966 | Ga0070714_100209421 | |||
| 967 | Ga0070714_101359375 | |||
| 968 | Ga0070713_100001075 | |||
| 969 | Ga0070713_100003268 | |||
| 970 | Ga0070713_100456590 | |||
| 971 | Ga0070713_100697621 | |||
| 972 | Ga0070710_10033542 | |||
| 973 | Ga0070710_10071838 | |||
| 974 | Ga0070710_10395798 | |||
| 975 | Ga0070710_10460151 | |||
| 976 | Ga0070701_11028706 | |||
| 977 | Ga0070711_100038865 | |||
| 978 | Ga0070711_100565495 | |||
| 979 | Ga0070705_100317068 | |||
| 980 | Ga0070705_100475659 | |||
| 981 | Ga0070708_100014377 | |||
| 982 | Ga0070708_100176260 | |||
| 983 | Ga0070708_100809103 | |||
| 984 | Ga0070663_101486132 | |||
| 985 | Ga0070678_100026384 | |||
| 986 | Ga0070678_100576557 | |||
| 987 | Ga0070678_101467200 | |||
| 988 | Ga0070681_10001517 | |||
| 989 | Ga0070681_10021893 | |||
| 990 | Ga0070681_10027815 | |||
| 991 | Ga0070681_10033059 | |||
| 992 | Ga0070681_10256237 | |||
| 993 | Ga0070681_10543920 | |||
| 994 | Ga0070681_10773278 | |||
| 995 | Ga0068867_100453799 | |||
| 996 | Ga0070706_100021256 | |||
| 997 | Ga0070706_100359949 | |||
| 998 | Ga0070707_100001869 | |||
| 999 | Ga0070707_100029672 | |||
| 1000 | Ga0070707_100364594 | |||
| 1001 | Ga0070707_100507490 | |||
| 1002 | Ga0070707_101334382 | |||
| 1003 | Ga0070698_100429085 | |||
| 1004 | Ga0070698_100632042 | |||
| 1005 | Ga0070699_100049873 | |||
| 1006 | Ga0070699_100481307 | |||
| 1007 | Ga0070699_100654442 | |||
| 1008 | Ga0070679_100011048 | |||
| 1009 | Ga0070679_100028886 | |||
| 1010 | Ga0070679_100031716 | |||
| 1011 | Ga0070679_100063108 | |||
| 1012 | Ga0070679_100066373 | |||
| 1013 | Ga0070679_100376282 | |||
| 1014 | Ga0070679_101260174 | |||
| 1015 | Ga0070684_100000431 | |||
| 1016 | Ga0070684_100096345 | |||
| 1017 | Ga0070684_100099255 | |||
| 1018 | Ga0070684_100158129 | |||
| 1019 | Ga0070684_100244645 | |||
| 1020 | Ga0070684_100640454 | |||
| 1021 | Ga0070684_100794958 | |||
| 1022 | Ga0070684_101436989 | |||
| 1023 | Ga0070697_100334005 | |||
| 1024 | Ga0070697_100365298 | |||
| 1025 | Ga0070697_100532938 | |||
| 1026 | Ga0070697_100944025 | |||
| 1027 | Ga0070686_100091418 | |||
| 1028 | Ga0070695_100000003 | |||
| 1029 | Ga0070695_100197941 | |||
| 1030 | Ga0070696_100255123 | |||
| 1031 | Ga0070696_100331914 | |||
| 1032 | Ga0070696_101801681 | |||
| 1033 | Ga0070693_100001852 | |||
| 1034 | Ga0070704_101147233 | |||
| 1035 | Ga0068855_100015594 | |||
| 1036 | Ga0068855_100044514 | |||
| 1037 | Ga0068855_100239117 | |||
| 1038 | Ga0068857_100350010 | |||
| 1039 | Ga0068857_100364512 | |||
| 1040 | Ga0068857_101760455 | |||
| 1041 | Ga0068854_101012864 | |||
| 1042 | Ga0068856_100023327 | |||
| 1043 | Ga0068856_100230631 | |||
| 1044 | Ga0068856_100330551 | |||
| 1045 | Ga0068856_100429430 | |||
| 1046 | Ga0068856_101240227 | |||
| 1047 | Ga0070702_100246759 | |||
| 1048 | Ga0068852_101470636 | |||
| 1049 | Ga0068866_10938474 | |||
| 1050 | Ga0068870_10121360 | |||
| 1051 | Ga0068863_100169003 | |||
| 1052 | Ga0068863_101842486 | |||
| 1053 | Ga0070717_10006950 | |||
| 1054 | Ga0070717_10017759 | |||
| 1055 | Ga0070717_10021347 | |||
| 1056 | Ga0070717_10027430 | |||
| 1057 | Ga0070717_10030201 | |||
| 1058 | Ga0070717_10772105 | |||
| 1059 | Ga0070717_11517073 | |||
| 1060 | Ga0070715_10002011 | |||
| 1061 | Ga0070716_100004105 | |||
| 1062 | Ga0070716_100031456 | |||
| 1063 | Ga0070712_100024588 | |||
| 1064 | Ga0070712_100277498 | |||
| 1065 | Ga0070712_100751833 | |||
| 1066 | Ga0070712_100796032 | |||
| 1067 | Ga0070712_100874555 | |||
| 1068 | Ga0070712_100988340 | |||
| 1069 | Ga0097621_100164799 | |||
| 1070 | Ga0097621_100206263 | |||
| 1071 | Ga0097621_100582801 | |||
| 1072 | Ga0068871_100028151 | |||
| 1073 | Ga0068871_100209122 | |||
| 1074 | Ga0068871_100266399 | |||
| 1075 | Ga0068871_100902970 | |||
| 1076 | Ga0075433_10357602 | |||
| 1077 | Ga0075433_10417106 | |||
| 1078 | Ga0075433_11315633 | |||
| 1079 | Ga0075433_11560194 | |||
| 1080 | Ga0075434_100053570 | |||
| 1081 | Ga0075434_100150987 | |||
| 1082 | Ga0075434_100163639 | |||
| 1083 | Ga0075434_100346944 | |||
| 1084 | Ga0075434_100695158 | |||
| 1085 | Ga0068865_100700967 | |||
| 1086 | Ga0075435_100034410 | |||
| 1087 | Ga0075435_100230618 | |||
| 1088 | Ga0075435_100413035 | |||
| 1089 | Ga0105240_10053723 | |||
| 1090 | Ga0105240_10244655 | |||
| 1091 | Ga0105240_10266310 | |||
| 1092 | Ga0105240_10412394 | |||
| 1093 | Ga0105245_10144131 | |||
| 1094 | Ga0105245_10248959 | |||
| 1095 | Ga0105245_11395512 | |||
| 1096 | Ga0105247_11104883 | |||
| 1097 | Ga0114129_10954462 | |||
| 1098 | Ga0105243_10075126 | |||
| 1099 | Ga0105243_10101554 | |||
| 1100 | Ga0105243_10341224 | |||
| 1101 | Ga0105241_10109855 | |||
| 1102 | Ga0105242_10043710 | |||
| 1103 | Ga0105242_10084950 | |||
| 1104 | Ga0105242_10163927 | |||
| 1105 | Ga0105242_12137556 | |||
| 1106 | Ga0105242_12592182 | |||
| 1107 | Ga0105248_10168095 | |||
| 1108 | Ga0105248_10331001 | |||
| 1109 | Ga0105248_10397209 | |||
| 1110 | Ga0105237_10476229 | |||
| 1111 | Ga0105237_12191029 | |||
| 1112 | Ga0105238_10304633 | |||
| 1113 | Ga0105238_10662535 | |||
| 1114 | Ga0105239_10659976 | |||
| 1115 | Ga0105239_12861348 | |||
| 1116 | Ga0105246_10032406 | |||
| 1117 | Ga0105246_11373586 | |||
| 1118 | Ga0157373_11242153 | |||
| 1119 | Ga0157370_10005691 | |||
| 1120 | Ga0157369_10032553 | |||
| 1121 | Ga0157369_10139012 | |||
| 1122 | Ga0157369_10491344 | |||
| 1123 | Ga0157369_10592755 | |||
| 1124 | Ga0157369_11398126 | |||
| 1125 | Ga0157374_10192731 | |||
| 1126 | Ga0157374_11326527 | |||
| 1127 | Ga0157378_10185952 | |||
| 1128 | Ga0157378_10584486 | |||
| 1129 | Ga0163162_10520728 | |||
| 1130 | Ga0163162_10693529 | |||
| 1131 | Ga0163162_12019709 | |||
| 1132 | Ga0157372_10327048 | |||
| 1133 | Ga0157372_10407554 | |||
| 1134 | Ga0157372_10898072 | |||
| 1135 | Ga0157375_10082222 | |||
| 1136 | Ga0157375_10407173 | |||
| 1137 | Ga0157375_10498899 | |||
| 1138 | Ga0163163_11129674 | |||
| 1139 | Ga0163163_11512249 | |||
| 1140 | Ga0157380_11481919 | |||
| 1141 | Ga0182008_10005743 | |||
| 1142 | Ga0157379_10253928 | |||
| 1143 | Ga0157376_10007490 | |||
| 1144 | Ga0157376_10152755 | |||
| 1145 | Ga0182006_1036896 | |||
| 1146 | Ga0182007_10027794 | |||
| 1147 | Ga0182007_10036157 | |||
| 1148 | Ga0197907_10589986 | |||
| 1149 | Ga0197907_10777264 | |||
| 1150 | Ga0197907_11035475 | |||
| 1151 | Ga0197907_11238147 | |||
| 1152 | Ga0206356_10418925 | |||
| 1153 | Ga0206356_10822865 | |||
| 1154 | Ga0206356_11230150 | |||
| 1155 | Ga0206356_11855689 | |||
| 1156 | Ga0206349_1009309 | |||
| 1157 | Ga0206349_1109861 | |||
| 1158 | Ga0206351_10930327 | |||
| 1159 | Ga0206352_10295053 | |||
| 1160 | Ga0206352_10468852 | |||
| 1161 | Ga0206352_10674228 | |||
| 1162 | Ga0206350_10604927 | |||
| 1163 | Ga0206350_10822870 | |||
| 1164 | Ga0206350_11487435 | |||
| 1165 | Ga0206354_10111255 | |||
| 1166 | Ga0206354_10660180 | |||
| 1167 | Ga0206354_10928650 | |||
| 1168 | Ga0206354_11113594 | |||
| 1169 | Ga0206354_11356773 | |||
| 1170 | Ga0206354_11530171 | |||
| 1171 | Ga0206353_10854756 | |||
| 1172 | Ga0206353_10918167 | |||
| 1173 | Ga0206353_11349432 | |||
| 1174 | Ga0224712_10049988 | |||
| 1175 | Ga0224712_10076579 | |||
| 1176 | Ga0224712_10087425 | |||
| 1177 | Ga0224712_10631060 | |||
| 1178 | Ga0224712_10682337 | |||
| 1179 | Ga0207692_10462419 | |||
| 1180 | Ga0207642_10255626 | |||
| 1181 | Ga0207642_10336915 | |||
| 1182 | Ga0207699_10007356 | |||
| 1183 | Ga0207699_11162077 | |||
| 1184 | Ga0207643_10388001 | |||
| 1185 | Ga0207705_10014632 | |||
| 1186 | Ga0207705_10120284 | |||
| 1187 | Ga0207684_10428542 | |||
| 1188 | Ga0207684_10472720 | |||
| 1189 | Ga0207707_10025403 | |||
| 1190 | Ga0207707_10106756 | |||
| 1191 | Ga0207707_10107397 | |||
| 1192 | Ga0207707_10138297 | |||
| 1193 | Ga0207707_10199680 | |||
| 1194 | Ga0207707_10229390 | |||
| 1195 | Ga0207707_10362876 | |||
| 1196 | Ga0207707_10386256 | |||
| 1197 | Ga0207695_10099287 | |||
| 1198 | Ga0207695_10270833 | |||
| 1199 | Ga0207695_10373182 | |||
| 1200 | Ga0207695_10486889 | |||
| 1201 | Ga0207695_10498230 | |||
| 1202 | Ga0207671_10227672 | |||
| 1203 | Ga0207671_11404558 | |||
| 1204 | Ga0207693_10013795 | |||
| 1205 | Ga0207693_10062148 | |||
| 1206 | Ga0207693_10149242 | |||
| 1207 | Ga0207693_10154333 | |||
| 1208 | Ga0207693_10159884 | |||
| 1209 | Ga0207693_10181970 | |||
| 1210 | Ga0207693_10264668 | |||
| 1211 | Ga0207693_10629982 | |||
| 1212 | Ga0207693_11347001 | |||
| 1213 | Ga0207663_10121719 | |||
| 1214 | Ga0207663_10477949 | |||
| 1215 | Ga0207663_11612336 | |||
| 1216 | Ga0207660_10007441 | |||
| 1217 | Ga0207660_10054159 | |||
| 1218 | Ga0207660_10067098 | |||
| 1219 | Ga0207660_10416856 | |||
| 1220 | Ga0207660_10513825 | |||
| 1221 | Ga0207660_11019608 | |||
| 1222 | Ga0207657_10000331 | |||
| 1223 | Ga0207657_10051361 | |||
| 1224 | Ga0207657_10061155 | |||
| 1225 | Ga0207657_10350420 | |||
| 1226 | Ga0207649_10087175 | |||
| 1227 | Ga0207649_10088948 | |||
| 1228 | Ga0207649_10872583 | |||
| 1229 | Ga0207652_10007747 | |||
| 1230 | Ga0207652_10097191 | |||
| 1231 | Ga0207652_10133898 | |||
| 1232 | Ga0207652_10165856 | |||
| 1233 | Ga0207652_10183337 | |||
| 1234 | Ga0207652_11035037 | |||
| 1235 | Ga0207652_11138739 | |||
| 1236 | Ga0207646_10000129 | |||
| 1237 | Ga0207646_10026256 | |||
| 1238 | Ga0207646_10735773 | |||
| 1239 | Ga0207659_10451447 | |||
| 1240 | Ga0207659_10880250 | |||
| 1241 | Ga0207687_10002002 | |||
| 1242 | Ga0207687_10156053 | |||
| 1243 | Ga0207687_11939162 | |||
| 1244 | Ga0207700_10000036 | |||
| 1245 | Ga0207700_10018638 | |||
| 1246 | Ga0207700_10037237 | |||
| 1247 | Ga0207700_10070616 | |||
| 1248 | Ga0207700_10183054 | |||
| 1249 | Ga0207700_11211493 | |||
| 1250 | Ga0207664_10005201 | |||
| 1251 | Ga0207664_10112603 | |||
| 1252 | Ga0207664_10139948 | |||
| 1253 | Ga0207664_10150738 | |||
| 1254 | Ga0207664_10174776 | |||
| 1255 | Ga0207664_11580503 | |||
| 1256 | Ga0207644_10140113 | |||
| 1257 | Ga0207644_11465445 | |||
| 1258 | Ga0207690_10016151 | |||
| 1259 | Ga0207686_10002712 | |||
| 1260 | Ga0207709_10126658 | |||
| 1261 | Ga0207670_11720586 | |||
| 1262 | Ga0207665_10000716 | |||
| 1263 | Ga0207665_10006441 | |||
| 1264 | Ga0207665_10742948 | |||
| 1265 | Ga0207665_10932085 | |||
| 1266 | Ga0207665_11207019 | |||
| 1267 | Ga0207711_10163950 | |||
| 1268 | Ga0207661_10000153 | |||
| 1269 | Ga0207661_10009928 | |||
| 1270 | Ga0207661_10038853 | |||
| 1271 | Ga0207661_10117614 | |||
| 1272 | Ga0207661_10123709 | |||
| 1273 | Ga0207661_10167664 | |||
| 1274 | Ga0207661_10890369 | |||
| 1275 | Ga0207679_10034583 | |||
| 1276 | Ga0207679_10285951 | |||
| 1277 | Ga0207667_10020985 | |||
| 1278 | Ga0207667_10193880 | |||
| 1279 | Ga0207667_10267163 | |||
| 1280 | Ga0207667_11036521 | |||
| 1281 | Ga0207640_10314717 | |||
| 1282 | Ga0207677_10007839 | |||
| 1283 | Ga0207677_10350257 | |||
| 1284 | Ga0207703_11557779 | |||
| 1285 | Ga0207639_10333782 | |||
| 1286 | Ga0207678_10877289 | |||
| 1287 | Ga0207708_10696911 | |||
| 1288 | Ga0207702_10002831 | |||
| 1289 | Ga0207702_10086354 | |||
| 1290 | Ga0207702_10180699 | |||
| 1291 | Ga0207702_10354177 | |||
| 1292 | Ga0207641_10274558 | |||
| 1293 | Ga0207641_12078639 | |||
| 1294 | Ga0207648_11099597 | |||
| 1295 | Ga0207674_10266240 | |||
| 1296 | Ga0207674_10387798 | |||
| 1297 | Ga0207675_100301235 | |||
| 1298 | Ga0207683_10115722 | |||
| 1299 | Ga0207683_10160367 | |||
| 1300 | Ga0207698_10333122 | |||
| 1301 | Ga0207698_10423826 | |||
| 1302 | Ga0207698_12579660 | |||
| 1303 | Ga0268266_10300172 | |||
| 1304 | Ga0265319_1004366 | |||
| 1305 | Ga0265319_1056041 | |||
| 1306 | Ga0265334_10060663 | |||
| 1307 | Ga0265318_10013117 | |||
| 1308 | Ga0265322_10032236 | |||
| 1309 | Ga0265338_10044681 | |||
| 1310 | Ga0265330_10032228 | |||
| 1311 | Ga0265320_10038423 | |||
| 1312 | Ga0265325_10312552 | |||
| 1313 | Ga0265329_10065229 | |||
| 1314 | Ga0265339_10052859 | |||
| 1315 | Ga0265331_10024994 | |||
| 1316 | Ga0265327_10024417 | |||
| 1317 | Ga0265327_10426389 | |||
| 1318 | Ga0265316_10050466 | |||
| 1319 | Ga0265314_10047958 | |||
| 1320 | Ga0265314_10345149 | |||
| 1321 | Ga0373959_0152494 | |||
| 1322 | Ga0373926_0010144 | |||
| 1323 | Ga0373934_0185184 | |||
| 1324 | Ga0373944_0189419 | |||
| 1325 | Ga0373951_0013573 | |||
| 1326 | Ga0373923_0261462 | |||
| 1327 | Ga0373936_0064043 | |||
| 1328 | Ga0373936_0136139 | |||
| 1329 | Ga0373945_0008136 | |||
| 1330 | Ga0373945_0015496 | |||
| 1331 | Ga0373945_0021885 | |||
| 1332 | Ga0373945_0405744 | |||
| 1333 | Ga0373954_0414069 | |||
| 1334 | Ga0373956_0505953 | |||
| 1335 | Ga0373943_0000048 | |||
| 1336 | Ga0373943_0000685 | |||
| 1337 | Ga0373943_0745213 | |||
| 1338 | Ga0373946_0009234 | |||
| 1339 | Ga0373955_0264570 | |||
| 1340 | Ga0373924_0156056 | |||
| 1341 | Ga0373935_0021359 | |||
| 1342 | Ga0373935_0065680 | |||
| 1343 | Ga0373927_0012161 | |||
| 1344 | Ga0373927_0042475 | |||
| 1345 | Ga0373927_0058785 | |||
| 1346 | Ga0373933_0240788 | |||
| 1347 | Ga0373933_0472663 | |||
| 1348 | Ga0373947_0002244 | |||
| 1349 | Ga0373947_0002751 | |||
| 1350 | Ga0373947_0473517 | |||
| 1351 | Ga0373947_1020353 | |||
| 1352 | Ga0373937_0460508 | |||
| 1353 | Ga0373937_0472354 | |||
| 1354 | Ga0373937_0664447 | |||
| 1355 | Ga0373937_0837873 | |||
| 1356 | Ga0373925_0004043 | |||
| 1357 | Ga0373925_0014494 | |||
| 1358 | Ga0373925_0026473 | |||
| 1359 | Ga0395899_0344313 | |||
| 1360 | Ga0395900_0125204 | |||
| 1361 | Ga0395900_0463473 | |||
| 1362 | Ga0395900_0504989 | |||
| 1363 | Ga0395900_1042242 | |||
| 1364 | Ga0395898_0471895 | |||
| 1365 | Ga0395898_0505219 | |||
| 1366 | Ga0395898_0563672 | |||
| 1367 | Ga0395898_1625040 | |||
| 1368 | Ga0395905_1359942 | |||
| 1369 | Ga0395901_0129091 | |||
| 1370 | Ga0395901_0162696 | |||
| 1371 | Ga0395901_0181546 | |||
| 1372 | Ga0395901_1433605 | |||
| 1373 | Ga0436360_0951907 | |||
| 1374 | Ga0436362_0108004 | |||
| 1375 | Ga0451795_0066248 | |||
| 1376 | Ga0451839_0426424 | |||
| 1377 | Ga0466969_0000842 | |||
| 1378 | Ga0466969_0004072 | |||
| 1379 | Ga0466969_0075746 | |||
| 1380 | Ga0466969_0515156 | |||
| 1381 | Ga0453683_0863321 | |||
| 1382 | Ga0466965_0017811 | |||
| 1383 | Ga0466965_0137224 | |||
| 1384 | Ga0466965_0374188 | |||
| 1385 | Ga0466966_0019638 | |||
| 1386 | Ga0466966_0025858 | |||
| 1387 | Ga0466966_0072370 | |||
| 1388 | Ga0466966_0110869 | |||
| 1389 | Ga0466966_0121364 | |||
| 1390 | Ga0466966_0172808 | |||
| 1391 | Ga0466966_0265844 | |||
| 1392 | Ga0466961_0006416 | |||
| 1393 | Ga0466961_0016296 | |||
| 1394 | Ga0466961_0041683 | |||
| 1395 | Ga0466961_0078398 | |||
| 1396 | Ga0466963_0000768 | |||
| 1397 | Ga0466963_0001745 | |||
| 1398 | Ga0466963_0001777 | |||
| 1399 | Ga0466963_0002439 | |||
| 1400 | Ga0466963_0003819 | |||
| 1401 | Ga0466963_0007553 | |||
| 1402 | Ga0466963_0024908 | |||
| 1403 | Ga0466963_0027782 | |||
| 1404 | Ga0466963_0037939 | |||
| 1405 | Ga0466963_0071413 | |||
| 1406 | Ga0466963_0088170 | |||
| 1407 | Ga0466963_0091552 | |||
| 1408 | Ga0466963_0121532 | |||
| 1409 | Ga0466963_0210761 | |||
| 1410 | Ga0466963_0518397 | |||
| 1411 | Ga0466963_1137526 | |||
| 1412 | Ga0466963_1301669 | |||
| 1413 | Ga0466964_0001896 | |||
| 1414 | Ga0466964_0002170 | |||
| 1415 | Ga0466964_0013934 | |||
| 1416 | Ga0466964_0029103 | |||
| 1417 | Ga0466964_0064074 | |||
| 1418 | Ga0466964_0385655 | |||
| 1419 | Ga0466964_0421196 | |||
| 1420 | Ga0466964_0671534 | |||
| 1421 | Ga0466971_0001398 | |||
| 1422 | Ga0466971_0006829 | |||
| 1423 | Ga0466971_0028646 | |||
| 1424 | Ga0466971_0077393 | |||
| 1425 | Ga0466971_0098841 | |||
| 1426 | Ga0466971_0661718 | |||
| 1427 | Ga0466968_0031264 | |||
| 1428 | Ga0466968_0032205 | |||
| 1429 | Ga0466968_0036509 | |||
| 1430 | Ga0466968_0052237 | |||
| 1431 | Ga0466968_0064943 | |||
| 1432 | Ga0466968_0096907 | |||
| 1433 | Ga0466968_0124879 | |||
| 1434 | Ga0466968_0178214 | |||
| 1435 | Ga0466970_0098231 | |||
| 1436 | Ga0466970_0148286 | |||
| 1437 | Ga0466970_0580063 | |||
| 1438 | Ga0466957_0000936 | |||
| 1439 | Ga0466957_0020308 | |||
| 1440 | Ga0466957_0022022 | |||
| 1441 | Ga0466957_0024494 | |||
| 1442 | Ga0466957_0042911 | |||
| 1443 | Ga0466957_0097137 | |||
| 1444 | Ga0466957_0114251 | |||
| 1445 | Ga0466957_0133885 | |||
| 1446 | Ga0466957_0147819 | |||
| 1447 | Ga0466957_0221069 | |||
| 1448 | Ga0466960_0044545 | |||
| 1449 | Ga0466960_0054487 | |||
| 1450 | Ga0466960_0743900 | |||
| 1451 | Ga0466959_0004897 | |||
| 1452 | Ga0466959_0012854 | |||
| 1453 | Ga0466959_0020896 | |||
| 1454 | Ga0466959_0026355 | |||
| 1455 | Ga0466959_0033913 | |||
| 1456 | Ga0466959_1121566 | |||
| 1457 | Ga0451576_1694029 | |||
| 1458 | Ga0466958_0002388 | |||
| 1459 | Ga0466958_0002635 | |||
| 1460 | Ga0466958_0003001 | |||
| 1461 | Ga0466958_0004176 | |||
| 1462 | Ga0466958_0021359 | |||
| 1463 | Ga0466958_0043813 | |||
| 1464 | Ga0466958_0056855 | |||
| 1465 | Ga0466958_0067910 | |||
| 1466 | Ga0466958_0208862 | |||
| 1467 | Ga0466958_0224364 | |||
| 1468 | Ga0466958_0239138 | |||
| 1469 | Ga0466958_0268988 | |||
| 1470 | Ga0466967_0001386 | |||
| 1471 | Ga0466967_0006433 | |||
| 1472 | Ga0466967_0008724 | |||
| 1473 | Ga0466967_0021581 | |||
| 1474 | Ga0466967_0022089 | |||
| 1475 | Ga0466967_0046731 | |||
| 1476 | Ga0466967_0055137 | |||
| 1477 | Ga0466967_0086288 | |||
| 1478 | Ga0466967_0093421 | |||
| 1479 | Ga0466967_0111020 | |||
| 1480 | Ga0466967_0117893 | |||
| 1481 | Ga0466967_0278196 | |||
| 1482 | Ga0466967_0319298 | |||
| 1483 | Ga0466967_0343144 | |||
| 1484 | Ga0466967_0453499 | |||
| 1485 | Ga0466967_0585853 | |||
| 1486 | Ga0466967_0876124 | |||
| 1487 | Ga0466967_1250787 | |||
| 1488 | Ga0466967_2043506 | |||
| 1489 | Ga0466967_2501360 | |||
| 1490 | Ga0495592_0056902 | |||
| 1491 | Ga0495592_0071165 | |||
| 1492 | Ga0495592_0309658 | |||
| 1493 | Ga0495592_0317017 | |||
| 1494 | Ga0495603_0016728 | |||
| 1495 | Ga0495603_0028893 | |||
| 1496 | Ga0495629_0000159 | |||
| 1497 | Ga0495629_0010159 | |||
| 1498 | Ga0495629_0030459 | |||
| 1499 | Ga0495629_0137646 | |||
| 1500 | Ga0495629_0147555 | |||
| 1501 | Ga0495629_0229927 | |||
| 1502 | Ga0495629_0441701 | |||
| 1503 | Ga0495641_0002695 | |||
| 1504 | Ga0495641_0009222 | |||
| 1505 | Ga0495641_0520777 | |||
| 1506 | Ga0495651_0035829 | |||
| 1507 | Ga0495651_0105648 | |||
| 1508 | Ga0495651_0112045 | |||
| 1509 | Ga0495651_0147514 | |||
| 1510 | Ga0495651_0244697 | |||
| 1511 | Ga0495651_0448389 | |||
| 1512 | Ga0495651_0846652 | |||
| 1513 | Ga0495653_0016911 | |||
| 1514 | Ga0495653_0057407 | |||
| 1515 | Ga0495653_0069160 | |||
| 1516 | Ga0495653_0109752 | |||
| 1517 | Ga0495653_0314202 | |||
| 1518 | Ga0495580_0022526 | |||
| 1519 | Ga0495582_0000036 | |||
| 1520 | Ga0495582_0042097 | |||
| 1521 | Ga0495582_0059376 | |||
| 1522 | Ga0495582_0078245 | |||
| 1523 | Ga0495582_0118557 | |||
| 1524 | Ga0495605_0092480 | |||
| 1525 | Ga0495639_0001197 | |||
| 1526 | Ga0495639_0029376 | |||
| 1527 | Ga0495639_0171242 | |||
| 1528 | Ga0495662_0003844 | |||
| 1529 | Ga0495664_0018479 | |||
| 1530 | Ga0495664_0136521 | |||
| 1531 | Ga0495664_0177344 | |||
| 1532 | Ga0495664_0466565 | |||
| 1533 | Ga0495585_0041719 | |||
| 1534 | Ga0495594_0049960 | |||
| 1535 | Ga0495594_0310944 | |||
| 1536 | Ga0495594_0402442 | |||
| 1537 | Ga0495594_0503303 | |||
| 1538 | Ga0495594_0673902 | |||
| 1539 | Ga0495596_0130879 | |||
| 1540 | Ga0495607_0282902 | |||
| 1541 | Ga0495608_0198905 | |||
| 1542 | Ga0495608_0226250 | |||
| 1543 | Ga0495608_0256957 | |||
| 1544 | Ga0495608_0346922 | |||
| 1545 | Ga0495618_0098067 | |||
| 1546 | Ga0495618_0476620 | |||
| 1547 | Ga0495618_0594951 | |||
| 1548 | Ga0495628_0154580 | |||
| 1549 | Ga0495628_0882640 | |||
| 1550 | Ga0495628_1197341 | |||
| 1551 | Ga0495630_0004782 | |||
| 1552 | Ga0495630_0018175 | |||
| 1553 | Ga0495630_0095762 | |||
| 1554 | Ga0495630_0346132 | |||
| 1555 | Ga0495630_0803836 | |||
| 1556 | Ga0495631_0049048 | |||
| 1557 | Ga0495637_0135657 | |||
| 1558 | Ga0495644_0001492 | |||
| 1559 | Ga0495663_0227259 | |||
| 1560 | Ga0495666_0002137 | |||
| 1561 | Ga0495666_0529734 | |||
| 1562 | Ga0495652_0088127 | |||
| 1563 | Ga0495652_0105994 | |||
| 1564 | Ga0495652_0235158 | |||
| 1565 | Ga0495652_0803946 | |||
| 1566 | Ga0495652_0867497 | |||
| 1567 | Ga0495665_0455393 | |||
| 1568 | Ga0495665_0645141 | |||
| 1569 | Ga0495640_0032678 | |||
| 1570 | Ga0495640_0110004 | |||
| 1571 | Ga0495586_0016243 | |||
| 1572 | Ga0495586_0136460 | |||
| 1573 | Ga0495586_0452715 | |||
| 1574 | Ga0495586_0581845 | |||
| 1575 | Ga0495587_0216494 | |||
| 1576 | Ga0495587_0259394 | |||
| 1577 | Ga0495587_0323471 | |||
| 1578 | Ga0495587_0657815 | |||
| 1579 | Ga0495587_0690007 | |||
| 1580 | Ga0495598_0128874 | |||
| 1581 | Ga0495645_0081206 | |||
| 1582 | Ga0495645_0110078 | |||
| 1583 | Ga0495645_0597771 | |||
| 1584 | Ga0495645_0750593 | |||
| 1585 | Ga0495667_0084220 | |||
| 1586 | Ga0495667_0093000 | |||
| 1587 | Ga0495667_0108861 | |||
| 1588 | Ga0495667_0306109 | |||
| 1589 | Ga0495667_0384729 | |||
| 1590 | Ga0495667_0457616 | |||
| 1591 | Ga0495656_0000672 | |||
| 1592 | Ga0495634_0018092 | |||
| 1593 | Ga0495634_0040709 | |||
| 1594 | Ga0495634_0065359 | |||
| 1595 | Ga0495611_0022727 | |||
| 1596 | Ga0495635_0038756 | |||
| 1597 | Ga0495635_0272923 | |||
| 1598 | Ga0495635_0742033 | |||
| 1599 | Ga0495659_0451116 | |||
| 1600 | Ga0495661_0050966 | |||
| 1601 | Ga0495588_0167292 | |||
| 1602 | Ga0495588_0182258 | |||
| 1603 | Ga0495588_0697703 | |||
| 1604 | Ga0495657_0034744 | |||
| 1605 | Ga0495657_0037950 | |||
| 1606 | Ga0495657_0055931 | |||
| 1607 | Ga0495657_0719482 | |||
| 1608 | Ga0495599_0371656 | |||
| 1609 | Ga0495599_0448368 | |||
| 1610 | Ga0495599_0595524 | |||
| 1611 | Ga0495646_0025809 | |||
| 1612 | Ga0495646_0094551 | |||
| 1613 | Ga0495646_0259731 | |||
| 1614 | Ga0495646_0505782 | |||
| 1615 | Ga0495647_0001238 | |||
| 1616 | Ga0495647_0004455 | |||
| 1617 | Ga0495647_0020964 | |||
| 1618 | Ga0495658_0029366 | |||
| 1619 | Ga0495658_0091185 | |||
| 1620 | Ga0495658_0108637 | |||
| 1621 | Ga0495658_0406005 | |||
| 1622 | Ga0495658_0434581 | |||
| 1623 | Ga0495613_0001777 | |||
| 1624 | Ga0495613_0027163 | |||
| 1625 | Ga0495613_0431518 | |||
| 1626 | Ga0495613_0631434 | |||
| 1627 | Ga0495613_1006931 | |||
| 1628 | Ga0495613_1107328 | |||
| 1629 | Ga0495624_0002893 | |||
| 1630 | Ga0495624_0003155 | |||
| 1631 | Ga0495624_0035813 | |||
| 1632 | Ga0495624_0744529 | |||
| 1633 | Ga0495670_0414714 | |||
| 1634 | Ga0495589_0542491 | |||
| 1635 | Ga0495600_0016740 | |||
| 1636 | Ga0495600_0029027 | |||
| 1637 | Ga0495600_0654272 | |||
| 1638 | Ga0495581_0000587 | |||
| 1639 | Ga0495581_0593883 | |||
| 1640 | Ga0495604_0478700 | |||
| 1641 | Ga0495604_0580953 | |||
| 1642 | Ga0495674_0018004 | |||
| 1643 | Ga0495674_0025174 | |||
| 1644 | Ga0495674_0043646 | |||
| 1645 | Ga0495674_0043942 | |||
| 1646 | Ga0495674_0077334 | |||
| 1647 | Ga0495674_0335701 | |||
| 1648 | Ga0495674_0452822 | |||
| 1649 | Ga0495674_0701146 | |||
| 1650 | Ga0495674_1484384 | |||
| 1651 | Ga0495676_0000361 | |||
| 1652 | Ga0495676_0283901 | |||
| 1653 | Ga0495676_0330210 | |||
| 1654 | Ga0495680_0002866 | |||
| 1655 | Ga0495680_0025668 | |||
| 1656 | Ga0495680_0030352 | |||
| 1657 | Ga0495680_0057909 | |||
| 1658 | Ga0495680_0134465 | |||
| 1659 | Ga0495680_0170936 | |||
| 1660 | Ga0495680_0172337 | |||
| 1661 | Ga0495680_0661118 | |||
| 1662 | Ga0495680_0664010 | |||
| 1663 | Ga0495683_0084980 | |||
| 1664 | Ga0495675_0115303 | |||
| 1665 | Ga0495675_0185388 | |||
| 1666 | Ga0495675_0653039 | |||
| 1667 | Ga0495685_107384 | |||
| 1668 | Ga0495684_0017217 | |||
| 1669 | Ga0495684_0071627 | |||
| 1670 | Ga0495684_0105928 | |||
| 1671 | Ga0495684_0117953 | |||
| 1672 | Ga0495684_0143072 | |||
| 1673 | Ga0495593_0043996 | |||
| 1674 | Ga0495593_0103176 | |||
| 1675 | Ga0495602_0274683 | |||
| 1676 | Ga0495602_0362157 | |||
| 1677 | Ga0495602_0371249 | |||
| 1678 | Ga0495602_0931945 | |||
| 1679 | Ga0495614_0000877 | |||
| 1680 | Ga0495614_0071446 | |||
| 1681 | Ga0496100_0030073 | |||
| 1682 | Ga0496100_0100222 | |||
| 1683 | Ga0496100_0147364 | |||
| 1684 | Ga0496100_0297075 | |||
| 1685 | Ga0496100_0634741 | |||
| 1686 | Ga0496100_0714923 | |||
| 1687 | Ga0496100_1086725 | |||
| 1688 | Ga0496100_1180556 | |||
| 1689 | Ga0496101_0000947 | |||
| 1690 | Ga0496101_0002071 | |||
| 1691 | Ga0496101_0008977 | |||
| 1692 | Ga0496101_0041668 | |||
| 1693 | Ga0496101_0125412 | |||
| 1694 | Ga0496101_0242271 | |||
| 1695 | Ga0496102_0000889 | |||
| 1696 | Ga0496102_0039679 | |||
| 1697 | Ga0496102_0046909 | |||
| 1698 | Ga0496102_0054082 | |||
| 1699 | Ga0496102_0119891 | |||
| 1700 | Ga0496102_0297779 | |||
| 1701 | Ga0496102_0456677 | |||
| 1702 | Ga0496102_1240672 | |||
| 1703 | Ga0496103_0017841 | |||
| 1704 | Ga0496103_0026685 | |||
| 1705 | Ga0496103_0062063 | |||
| 1706 | Ga0496103_0140689 | |||
| 1707 | Ga0496103_0163078 | |||
| 1708 | Ga0496103_0189745 | |||
| 1709 | Ga0496104_0002177 | |||
| 1710 | Ga0496104_0002279 | |||
| 1711 | Ga0496104_0044575 | |||
| 1712 | Ga0496104_0098521 | |||
| 1713 | Ga0496104_0129103 | |||
| 1714 | Ga0496104_0451861 | |||
| 1715 | Ga0496104_0652172 | |||
| 1716 | Ga0496105_0000123 | |||
| 1717 | Ga0496105_0002447 | |||
| 1718 | Ga0496105_0014622 | |||
| 1719 | Ga0496105_0119218 | |||
| 1720 | Ga0496105_0135449 | |||
| 1721 | Ga0496105_0151699 | |||
| 1722 | Ga0496105_0212469 | |||
| 1723 | Ga0496105_0724261 | |||
| 1724 | Ga0496105_0795687 | |||
| 1725 | Ga0496105_1219770 | |||
| 1726 | Ga0496105_1307270 | |||
| 1727 | Ga0496106_0014987 | |||
| 1728 | Ga0496106_0027485 | |||
| 1729 | Ga0496106_0031374 | |||
| 1730 | Ga0496106_0146112 | |||
| 1731 | Ga0496106_0328245 | |||
| 1732 | Ga0496106_0577215 | |||
| 1733 | Ga0496107_0008144 | |||
| 1734 | Ga0496107_0033250 | |||
| 1735 | Ga0496107_0038792 | |||
| 1736 | Ga0496107_0116613 | |||
| 1737 | Ga0496107_0119064 | |||
| 1738 | Ga0496107_0251066 | |||
| 1739 | Ga0496107_0258660 | |||
| 1740 | Ga0496107_0262572 | |||
| 1741 | Ga0496107_0938164 | |||
| 1742 | Ga0496108_0056221 | |||
| 1743 | Ga0496108_0063357 | |||
| 1744 | Ga0496108_0083533 | |||
| 1745 | Ga0496108_0085296 | |||
| 1746 | Ga0496108_0352822 | |||
| 1747 | Ga0496108_1625922 | |||
| 1748 | Ga0496109_0002406 | |||
| 1749 | Ga0496109_0003079 | |||
| 1750 | Ga0496109_0005647 | |||
| 1751 | Ga0496109_0026855 | |||
| 1752 | Ga0496109_0076164 | |||
| 1753 | Ga0496109_0244240 | |||
| 1754 | Ga0496109_0775548 | |||
| 1755 | Ga0496109_1061443 | |||
| 1756 | Ga0496110_0004567 | |||
| 1757 | Ga0496110_0040976 | |||
| 1758 | Ga0496110_1830876 | |||
| 1759 | Ga0496111_0000659 | |||
| 1760 | Ga0496111_0019831 | |||
| 1761 | Ga0496111_0041148 | |||
| 1762 | Ga0496111_0096552 | |||
| 1763 | Ga0496111_0107903 | |||
| 1764 | Ga0496111_0122931 | |||
| 1765 | Ga0496111_0164832 | |||
| 1766 | Ga0496111_0381465 | |||
| 1767 | Ga0496111_0422061 | |||
| 1768 | Ga0496112_0033021 | |||
| 1769 | Ga0496112_0057379 | |||
| 1770 | Ga0496112_0096176 | |||
| 1771 | Ga0496112_0118840 | |||
| 1772 | Ga0496112_0290932 | |||
| 1773 | Ga0496112_0887264 | |||
| 1774 | Ga0496112_1496381 | |||
| 1775 | Ga0496112_1686297 | |||
| 1776 | Ga0496113_0088332 | |||
| 1777 | Ga0496113_0109686 | |||
| 1778 | Ga0496113_0408772 | |||
| 1779 | Ga0496113_0776817 | |||
| 1780 | Ga0496113_1057759 | |||
| 1781 | Ga0496114_0000202 | |||
| 1782 | Ga0496114_0001405 | |||
| 1783 | Ga0496114_0050982 | |||
| 1784 | Ga0496114_0056019 | |||
| 1785 | Ga0496114_0063253 | |||
| 1786 | Ga0496114_0107881 | |||
| 1787 | Ga0496114_0141639 | |||
| 1788 | Ga0496114_0149313 | |||
| 1789 | Ga0496114_0322547 | |||
| 1790 | Ga0496115_0001304 | |||
| 1791 | Ga0496115_0007949 | |||
| 1792 | Ga0496115_0018339 | |||
| 1793 | Ga0496115_0085259 | |||
| 1794 | Ga0496115_0166760 | |||
| 1795 | Ga0496115_0237326 | |||
| 1796 | Ga0496115_0327650 | |||
| 1797 | Ga0496115_0437336 | |||
| 1798 | Ga0496115_0442663 | |||
| 1799 | Ga0496115_0466748 | |||
| 1800 | Ga0496115_0466771 | |||
| 1801 | Ga0496115_0684939 | |||
| 1802 | Ga0501038_0906107 | |||
| 1803 | Ga0501067_0020799 | |||
| 1804 | Ga0501067_0417937 | |||
| 1805 | Ga0501068_0085197 | |||
| 1806 | Ga0501068_0234356 | |||
| 1807 | Ga0501068_0390531 | |||
| 1808 | Ga0501069_0016467 | |||
| 1809 | Ga0501069_0019903 | |||
| 1810 | Ga0501069_0040917 | |||
| 1811 | Ga0501071_0088195 | |||
| 1812 | Ga0501076_0463074 | |||
| 1813 | nmdc:mga05p37_1400006_c1 | |||
| 1814 | nmdc:mga0n895_125532_c1 | |||
| 1815 | nmdc:mga0n895_327670_c1 | |||
| 1816 | nmdc:mga0n895_579537_c1 | |||
| 1817 | nmdc:mga0n895_595820_c1 | |||
| 1818 | nmdc:mga0rr50_294547_c1 | |||
| 1819 | nmdc:mga0rr50_550607_c1 | |||
| 1820 | nmdc:mga0rr50_710640_c1 | |||
| 1821 | nmdc:mga08x19_232209_c1 | |||
| 1822 | nmdc:mga0a205_11791_c2 | |||
| 1823 | nmdc:mga0a205_1274121_c1 | |||
| 1824 | nmdc:mga0a205_349004_c1 | |||
| 1825 | nmdc:mga0a205_462571_c1 | |||
| 1826 | Ga0495601_0029860 | |||
| 1827 | Ga0495601_0048421 | |||
| 1828 | Ga0495601_0150242 | |||
| 1829 | Ga0495601_0166095 | |||
| 1830 | Ga0495601_0206733 | |||
| 1831 | Ga0495601_0894252 | |||
| 1832 | Ga0495601_1020642 | |||
| 1833 | Ga0495612_0003796 | |||
| 1834 | Ga0495612_0119383 | |||
| 1835 | Ga0495612_0413618 | |||
| 1836 | Ga0495595_0047752 | |||
| 1837 | Ga0495595_0093362 | |||
| 1838 | Ga0495619_0001672 | |||
| 1839 | Ga0495619_0009375 | |||
| 1840 | Ga0495619_0049593 | |||
| 1841 | Ga0495619_0181059 | |||
| 1842 | Ga0495619_0299704 | |||
| 1843 | Ga0495619_0355037 | |||
| 1844 | Ga0495619_0813709 | |||
| 1845 | Ga0500566_0012003 | |||
| 1846 | Ga0587070_064177 | |||
| 1847 | Ga0587073_0168726 | |||
| 1848 | Ga0587106_073502 | |||
| 1849 | Ga0587067_169181 | |||
| 1850 | Ga0587079_098818 | |||
| 1851 | Ga0466962_0000760 | |||
| 1852 | Ga0466962_0003085 | |||
| 1853 | Ga0466962_0006014 | |||
| 1854 | Ga0466962_0066438 | |||
| 1855 | Ga0466962_0067064 | |||
| 1856 | Ga0466962_0090873 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uhj-assembly2.cif.gz_B-3 | the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 | 0.8863 | 10 | 132 |
| 5ump-assembly1.cif.gz_B | crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8762 | 9 | 132 |
| 4hc5-assembly2.cif.gz_C | crystal structure of member of glyoxalase/bleomycin resistance protein/dioxygenase superfamily from sphaerobacter thermophilus dsm 20745 | 0.8678 | 10 | 130 |
| 5uhj-assembly2.cif.gz_B-3 | the crystal structure of a natural product biosynthetic enzyme from streptomyces sp. cb03234 | 0.8659 | 10 | 132 |
| 5umq-assembly1.cif.gz_A | crystal structure of tnms1, an antibiotic binding protein from streptomyces sp. cb03234 | 0.8604 | 9 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hc5C00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8906 | 10 | 130 | 3.10.180.10 |
| 4hc5C00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.87 | 10 | 130 | 3.10.180.10 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8557 | 10 | 132 | 3.10.180.10 |
| 5uhjB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8422 | 10 | 132 | 3.10.180.10 |
| 5ujpB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8288 | 12 | 130 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537XET1-F1-model_v4 | Glyoxalase | 0.9585 | 9 | 130 |
|
| AF-C7Q524-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9449 | 9 | 130 |
GO:0051213
|
| AF-A0A2V7TVF1-F1-model_v4 | Glyoxalase | 0.9351 | 9 | 130 |
|
| AF-A0A7W0GZV9-F1-model_v4 | VOC family protein | 0.9306 | 9 | 130 |
|
| AF-A0A1Q6XDX9-F1-model_v4 | Glyoxalase | 0.9272 | 1 | 133 |
|