F485936

General Info

Members Datasets Scaffolds Average Seq Length
927 370 1824 107

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10043844|JGI24740J21852_100438442
Length 106
Sequence VTTWLLLAAAIVSEVTATLSLKRALDQPGFYAVVVTGYVAAFVLLSLTLRQGLGIGVAYGIWAACGVALSAVGSKVFFGEPLTGLMIAGLVLIIGGVLLVELGSAH

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
202 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
207 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
208 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
209 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
217 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
218 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
219 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
220 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
221 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
222 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
223 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
224 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
225 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
226 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
229 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
230 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
231 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
232 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
233 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
234 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
237 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
238 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
239 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
240 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
241 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
244 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
247 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
248 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
249 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
250 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
251 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
252 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
253 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
254 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
259 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
260 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
261 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
266 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
271 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
272 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
273 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
283 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
284 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
285 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
286 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
287 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
288 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
289 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
290 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
291 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
292 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
293 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
294 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
295 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
296 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
297 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
298 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
299 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
300 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
301 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
302 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
303 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
304 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
305 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
306 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
315 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
316 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
317 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
320 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
321 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
322 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
323 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
324 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
325 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
329 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
330 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
331 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
332 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
333 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
334 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
341 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
342 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
343 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
346 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
347 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
348 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
349 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
350 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
351 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
358 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
359 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
360 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
361 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
362 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
363 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
364 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
365 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
366 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
367 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
368 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
369 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
370 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.6
Metatranscriptomes 0
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.29
Nodule 0
Rhizoplane 10.03
Rhizosphere 68.39
Stem 0
Stem Tuber 0
Unclassified 1.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10043844 3300001979 Bacteria 1331
2 JGI24746J21847_1054533 3300001977 Bacteria 566
3 JGI24735J21928_10034025 3300002067 Bacteria 1504
4 JGI24751J29686_10006850 3300002459 Bacteria 2324
5 rootH1_10404148 3300003323 Bacteria 1285
6 Ga0055540_1004454 3300003792 Bacteria 6293
7 Ga0055540_1010425 3300003792 Bacteria 3095
8 Ga0055540_1010759 3300003792 Bacteria 3018
9 Ga0055540_1016501 3300003792 Bacteria 2099
10 Ga0055540_1019834 3300003792 Bacteria 1800
11 Ga0070658_10115551 3300005327 Bacteria 2226
12 Ga0070658_11275292 3300005327 Unclassified 638
13 Ga0070676_10392934 3300005328 Bacteria 963
14 Ga0070690_100018598 3300005330 Bacteria 4200
15 Ga0070690_100050145 3300005330 Bacteria 2663
16 Ga0070670_100595260 3300005331 Bacteria 989
17 Ga0070670_100616019 3300005331 Bacteria 972
18 Ga0068869_100060511 3300005334 Bacteria 2775
19 Ga0070666_10005442 3300005335 Bacteria 7806
20 Ga0070680_100057141 3300005336 Bacteria 3190
21 Ga0070682_100052952 3300005337 Bacteria 2541
22 Ga0070682_100148687 3300005337 Bacteria 1605
23 Ga0068868_100000955 3300005338 Bacteria 19663
24 Ga0068868_100189176 3300005338 Bacteria 1711
25 Ga0068868_100189707 3300005338 Bacteria 1709
26 Ga0070660_100103413 3300005339 Bacteria 2259
27 Ga0070660_100251670 3300005339 Bacteria 1441
28 Ga0070660_100949183 3300005339 Bacteria 726
29 Ga0070689_100021315 3300005340 Bacteria 4823
30 Ga0070691_10007534 3300005341 Bacteria 4991
31 Ga0070691_10831612 3300005341 Bacteria 565
32 Ga0070661_100443224 3300005344 Bacteria 1032
33 Ga0070692_10251027 3300005345 Bacteria 1059
34 Ga0070692_11006562 3300005345 Bacteria 583
35 Ga0070668_100003467 3300005347 Bacteria 11642
36 Ga0070668_100003551 3300005347 Bacteria 11503
37 Ga0070668_100061074 3300005347 Bacteria 2920
38 Ga0070668_100088638 3300005347 Bacteria 2436
39 Ga0070668_100205948 3300005347 Bacteria 1616
40 Ga0070668_100240684 3300005347 Bacteria 1499
41 Ga0070669_100005262 3300005353 Bacteria 9342
42 Ga0070669_100213440 3300005353 Bacteria 1523
43 Ga0070669_100247318 3300005353 Bacteria 1419
44 Ga0070671_100024325 3300005355 Bacteria 4957
45 Ga0070674_100000313 3300005356 Bacteria 23878
46 Ga0070674_100018680 3300005356 Bacteria 4390
47 Ga0070674_100076723 3300005356 Bacteria 2377
48 Ga0070674_100621695 3300005356 Bacteria 915
49 Ga0070674_101037061 3300005356 Bacteria 721
50 Ga0070673_100228279 3300005364 Bacteria 1614
51 Ga0070673_101017229 3300005364 Unclassified 772
52 Ga0070688_100007669 3300005365 Bacteria 5827
53 Ga0070688_100032241 3300005365 Bacteria 3157
54 Ga0070688_101571594 3300005365 Bacteria 536
55 Ga0070659_100015525 3300005366 Bacteria 5703
56 Ga0070659_100152127 3300005366 Bacteria 1888
57 Ga0070659_100504557 3300005366 Bacteria 1031
58 Ga0070667_100000139 3300005367 Bacteria 92556
59 Ga0070667_100002238 3300005367 Bacteria 17035
60 Ga0070667_100008243 3300005367 Bacteria 8637
61 Ga0070667_100044646 3300005367 Bacteria 3722
62 Ga0070667_100210508 3300005367 Bacteria 1728
63 Ga0070667_100533633 3300005367 Bacteria 1077
64 Ga0070703_10013058 3300005406 Bacteria 2354
65 Ga0070703_10346014 3300005406 Bacteria 633
66 Ga0070709_10018822 3300005434 Bacteria 3985
67 Ga0070709_10023209 3300005434 Bacteria 3640
68 Ga0070714_100101051 3300005435 Bacteria 2541
69 Ga0070713_100816877 3300005436 Bacteria 894
70 Ga0070710_10001576 3300005437 Bacteria 10759
71 Ga0070710_10058051 3300005437 Bacteria 2194
72 Ga0070710_10665393 3300005437 Bacteria 731
73 Ga0070701_10000508 3300005438 Bacteria 13366
74 Ga0070711_100002308 3300005439 Bacteria 10826
75 Ga0070711_100009368 3300005439 Bacteria 6031
76 Ga0070705_100006878 3300005440 Bacteria 5588
77 Ga0070705_100085308 3300005440 Bacteria 1951
78 Ga0070700_100006009 3300005441 Bacteria 6458
79 Ga0070700_100228494 3300005441 Bacteria 1323
80 Ga0070700_100547652 3300005441 Bacteria 898
81 Ga0070694_100004970 3300005444 Bacteria 8011
82 Ga0070694_100938846 3300005444 Bacteria 716
83 Ga0070663_100000660 3300005455 Bacteria 18559
84 Ga0070663_100046048 3300005455 Bacteria 3084
85 Ga0070663_100098869 3300005455 Bacteria 2174
86 Ga0070663_100352085 3300005455 Bacteria 1192
87 Ga0070663_101191178 3300005455 Bacteria 669
88 Ga0070678_100000286 3300005456 Bacteria 23425
89 Ga0070678_100083145 3300005456 Bacteria 2433
90 Ga0070678_100094987 3300005456 Bacteria 2296
91 Ga0070678_100489963 3300005456 Bacteria 1083
92 Ga0070678_101528824 3300005456 Bacteria 625
93 Ga0070662_100131506 3300005457 Bacteria 1930
94 Ga0070662_100174116 3300005457 Bacteria 1692
95 Ga0070681_10044039 3300005458 Bacteria 4467
96 Ga0068867_100019853 3300005459 Bacteria 4789
97 Ga0068867_100543013 3300005459 Bacteria 1006
98 Ga0070685_10302038 3300005466 Bacteria 1079
99 Ga0070685_11231040 3300005466 Bacteria 570
100 Ga0070706_100533205 3300005467 Bacteria 1092
101 Ga0070679_100021590 3300005530 Bacteria 6286
102 Ga0070679_100280428 3300005530 Bacteria 1619
103 Ga0070679_100394989 3300005530 Bacteria 1329
104 Ga0070684_100489135 3300005535 Bacteria 1139
105 Ga0070684_101334004 3300005535 Bacteria 675
106 Ga0068853_100000658 3300005539 Bacteria 23753
107 Ga0068853_100008966 3300005539 Bacteria 8058
108 Ga0068853_101283333 3300005539 Bacteria 708
109 Ga0068853_101310891 3300005539 Bacteria 700
110 Ga0070672_100386832 3300005543 Bacteria 1197
111 Ga0070672_101439660 3300005543 Bacteria 617
112 Ga0070686_100112519 3300005544 Bacteria 1857
113 Ga0070695_100173826 3300005545 Bacteria 1521
114 Ga0070695_100298668 3300005545 Bacteria 1189
115 Ga0070696_100031766 3300005546 Bacteria 3621
116 Ga0070696_100042242 3300005546 Bacteria 3153
117 Ga0070693_100003047 3300005547 Bacteria 7773
118 Ga0070693_100134664 3300005547 Bacteria 1548
119 Ga0070693_100351193 3300005547 Unclassified 1009
120 Ga0070665_100004431 3300005548 Bacteria 14751
121 Ga0070665_100027903 3300005548 Bacteria 5684
122 Ga0070665_100603293 3300005548 Bacteria 1111
123 Ga0070665_101082530 3300005548 Bacteria 813
124 Ga0070704_100000300 3300005549 Bacteria 21883
125 Ga0068855_100058281 3300005563 Bacteria 4523
126 Ga0068855_100070048 3300005563 Bacteria 4081
127 Ga0068855_102551401 3300005563 Bacteria 508
128 Ga0070664_100802162 3300005564 Bacteria 880
129 Ga0068854_100003399 3300005578 Bacteria 9921
130 Ga0068854_100162053 3300005578 Bacteria 1733
131 Ga0068854_100208129 3300005578 Bacteria 1541
132 Ga0068856_100422385 3300005614 Bacteria 1353
133 Ga0070702_100003130 3300005615 Bacteria 7330
134 Ga0070702_100602937 3300005615 Bacteria 823
135 Ga0070702_100658916 3300005615 Bacteria 793
136 Ga0070702_101141524 3300005615 Bacteria 625
137 Ga0068852_100015154 3300005616 Bacteria 5967
138 Ga0068852_100734305 3300005616 Bacteria 999
139 Ga0068859_100002436 3300005617 Bacteria 18938
140 Ga0068859_100012232 3300005617 Bacteria 8630
141 Ga0068859_100482977 3300005617 Bacteria 1334
142 Ga0068859_100868252 3300005617 Bacteria 988
143 Ga0068864_100102321 3300005618 Bacteria 2542
144 Ga0068864_100115901 3300005618 Bacteria 2390
145 Ga0068864_100302396 3300005618 Bacteria 1498
146 Ga0068864_100905647 3300005618 Bacteria 871
147 Ga0068866_10000247 3300005718 Bacteria 25524
148 Ga0068866_10010847 3300005718 Bacteria 3920
149 Ga0068866_10213417 3300005718 Bacteria 1160
150 Ga0068866_10960368 3300005718 Bacteria 605
151 Ga0068861_100001058 3300005719 Bacteria 16932
152 Ga0068861_100046076 3300005719 Bacteria 3287
153 Ga0068861_100220480 3300005719 Bacteria 1603
154 Ga0068861_100971389 3300005719 Bacteria 809
155 Ga0068861_101251523 3300005719 Bacteria 720
156 Ga0068861_101474202 3300005719 Bacteria 667
157 Ga0068851_10104814 3300005834 Bacteria 1504
158 Ga0068870_10193854 3300005840 Bacteria 1228
159 Ga0068863_100000121 3300005841 Bacteria 81842
160 Ga0068863_100001259 3300005841 Bacteria 25248
161 Ga0068863_100294249 3300005841 Bacteria 1574
162 Ga0068858_100000762 3300005842 Bacteria 33735
163 Ga0068858_100009580 3300005842 Bacteria 9238
164 Ga0068858_100301757 3300005842 Bacteria 1528
165 Ga0068860_100000025 3300005843 Bacteria 271553
166 Ga0068860_100002200 3300005843 Bacteria 20511
167 Ga0068860_100116550 3300005843 Bacteria 2556
168 Ga0068860_100172448 3300005843 Bacteria 2090
169 Ga0068860_101597193 3300005843 Bacteria 674
170 Ga0068862_100000045 3300005844 Bacteria 155641
171 Ga0068862_100004091 3300005844 Bacteria 12367
172 Ga0068862_100119737 3300005844 Bacteria 2319
173 Ga0068862_100550476 3300005844 Bacteria 1102
174 Ga0081455_10122004 3300005937 Bacteria 2052
175 Ga0075365_10016984 3300006038 Bacteria 4443
176 Ga0075365_10056195 3300006038 Bacteria 2616
177 Ga0075365_10072377 3300006038 Bacteria 2322
178 Ga0075365_10203992 3300006038 Bacteria 1385
179 Ga0075365_10300655 3300006038 Bacteria 1129
180 Ga0075365_10328432 3300006038 Bacteria 1077
181 Ga0075365_10363069 3300006038 Unclassified 1021
182 Ga0075365_10621412 3300006038 Bacteria 764
183 Ga0075365_10665091 3300006038 Bacteria 736
184 Ga0075365_10883010 3300006038 Bacteria 630
185 Ga0075368_10005037 3300006042 Bacteria 4520
186 Ga0075368_10042880 3300006042 Bacteria 1781
187 Ga0075368_10072659 3300006042 Bacteria 1391
188 Ga0075363_100000849 3300006048 Bacteria 10643
189 Ga0075363_100000858 3300006048 Bacteria 10626
190 Ga0075363_100003499 3300006048 Bacteria 6687
191 Ga0075363_100003701 3300006048 Bacteria 6576
192 Ga0075363_100013733 3300006048 Bacteria 3938
193 Ga0075363_100049292 3300006048 Bacteria 2242
194 Ga0075363_100068588 3300006048 Bacteria 1923
195 Ga0075363_100132750 3300006048 Bacteria 1397
196 Ga0075363_100252630 3300006048 Bacteria 1015
197 Ga0075363_100693186 3300006048 Bacteria 615
198 Ga0075364_10001978 3300006051 Bacteria 11420
199 Ga0075364_10003210 3300006051 Bacteria 9273
200 Ga0075364_10013157 3300006051 Bacteria 5077
201 Ga0075364_10032399 3300006051 Bacteria 3359
202 Ga0075364_10038172 3300006051 Bacteria 3111
203 Ga0075364_10145149 3300006051 Bacteria 1597
204 Ga0075364_10268562 3300006051 Bacteria 1160
205 Ga0075364_10660838 3300006051 Bacteria 714
206 Ga0075364_10692437 3300006051 Bacteria 696
207 Ga0075364_10842521 3300006051 Bacteria 625
208 Ga0075364_10964273 3300006051 Bacteria 580
209 Ga0070715_10012764 3300006163 Bacteria 3069
210 Ga0070716_100005688 3300006173 Bacteria 6052
211 Ga0070716_100015621 3300006173 Bacteria 3904
212 Ga0070716_101287898 3300006173 Bacteria 590
213 Ga0070716_101481133 3300006173 Bacteria 554
214 Ga0070712_100000143 3300006175 Bacteria 37372
215 Ga0070712_100014598 3300006175 Bacteria 5042
216 Ga0070712_100901672 3300006175 Bacteria 762
217 Ga0075362_10051928 3300006177 Bacteria 1836
218 Ga0075362_10093057 3300006177 Bacteria 1401
219 Ga0075362_10253804 3300006177 Bacteria 865
220 Ga0075362_10336178 3300006177 Bacteria 754
221 Ga0075367_10003063 3300006178 Bacteria 7836
222 Ga0075367_10096044 3300006178 Bacteria 1808
223 Ga0075367_10320667 3300006178 Bacteria 976
224 Ga0075367_10396357 3300006178 Bacteria 873
225 Ga0075367_10873515 3300006178 Bacteria 573
226 Ga0075369_10001918 3300006186 Bacteria 7298
227 Ga0075369_10017616 3300006186 Bacteria 2898
228 Ga0075369_10021514 3300006186 Bacteria 2652
229 Ga0075369_10030904 3300006186 Bacteria 2257
230 Ga0075369_10047731 3300006186 Bacteria 1847
231 Ga0075369_10090784 3300006186 Bacteria 1363
232 Ga0075369_10347330 3300006186 Bacteria 696
233 Ga0075369_10379621 3300006186 Bacteria 665
234 Ga0075369_10620288 3300006186 Bacteria 518
235 Ga0075369_10650687 3300006186 Bacteria 506
236 Ga0075369_10661176 3300006186 Bacteria 502
237 Ga0097621_101248203 3300006237 Bacteria 701
238 Ga0097621_101683849 3300006237 Bacteria 604
239 Ga0075370_10001633 3300006353 Bacteria 9891
240 Ga0075370_10031074 3300006353 Bacteria 2981
241 Ga0075370_10034716 3300006353 Bacteria 2827
242 Ga0075370_10118523 3300006353 Bacteria 1540
243 Ga0075370_11018909 3300006353 Bacteria 508
244 Ga0068871_100186257 3300006358 Bacteria 1786
245 Ga0075428_100003580 3300006844 Bacteria 17020
246 Ga0075430_100006737 3300006846 Bacteria 9688
247 Ga0075431_100013252 3300006847 Bacteria 8327
248 Ga0068865_100002466 3300006881 Bacteria 10950
249 Ga0068865_100134113 3300006881 Bacteria 1858
250 Ga0068865_100278133 3300006881 Bacteria 1332
251 Ga0075436_100813780 3300006914 Bacteria 696
252 Ga0097620_100002436 3300006931 Bacteria 18938
253 Ga0097620_100012233 3300006931 Bacteria 8630
254 Ga0097620_100482975 3300006931 Bacteria 1334
255 Ga0097620_100868095 3300006931 Bacteria 988
256 Ga0075435_100825759 3300007076 Bacteria 807
257 Ga0105250_10034365 3300009092 Bacteria 2035
258 Ga0105240_12577793 3300009093 Bacteria 525
259 Ga0111539_13441419 3300009094 Bacteria 509
260 Ga0105245_10000924 3300009098 Bacteria 26664
261 Ga0105245_10289917 3300009098 Bacteria 1603
262 Ga0105245_11098805 3300009098 Bacteria 841
263 Ga0105245_11188133 3300009098 Bacteria 810
264 Ga0105247_10000010 3300009101 Bacteria 302475
265 Ga0105247_10000675 3300009101 Bacteria 26909
266 Ga0105247_10269445 3300009101 Bacteria 1171
267 Ga0114129_10058593 3300009147 Bacteria 5387
268 Ga0105243_10000904 3300009148 Bacteria 27915
269 Ga0105243_10105482 3300009148 Bacteria 2348
270 Ga0105243_11820626 3300009148 Bacteria 640
271 Ga0105241_10142108 3300009174 Bacteria 1955
272 Ga0105241_11287570 3300009174 Bacteria 696
273 Ga0105242_10001843 3300009176 Bacteria 16640
274 Ga0105242_10062077 3300009176 Bacteria 3075
275 Ga0105242_10260006 3300009176 Bacteria 1568
276 Ga0105248_10000100 3300009177 Bacteria 95523
277 Ga0105248_10011344 3300009177 Bacteria 9821
278 Ga0105248_10146125 3300009177 Bacteria 2668
279 Ga0105248_10545493 3300009177 Bacteria 1308
280 Ga0105248_10746562 3300009177 Bacteria 1104
281 Ga0105248_10914993 3300009177 Bacteria 990
282 Ga0105237_10002602 3300009545 Bacteria 22241
283 Ga0105237_10287227 3300009545 Bacteria 1648
284 Ga0105237_10554641 3300009545 Bacteria 1156
285 Ga0105238_10122792 3300009551 Bacteria 2576
286 Ga0105238_10465460 3300009551 Bacteria 1262
287 Ga0105238_10884457 3300009551 Bacteria 911
288 Ga0105249_10000010 3300009553 Bacteria 306939
289 Ga0105249_10002197 3300009553 Bacteria 16905
290 Ga0105249_10004083 3300009553 Bacteria 12600
291 Ga0105249_10275741 3300009553 Bacteria 1677
292 Ga0105249_12084620 3300009553 Bacteria 640
293 Ga0105249_12330840 3300009553 Bacteria 608
294 Ga0105249_13199711 3300009553 Bacteria 526
295 Ga0099796_10505413 3300010159 Bacteria 541
296 Ga0105239_10003573 3300010375 Bacteria 19012
297 Ga0105239_10042609 3300010375 Bacteria 4973
298 Ga0105239_10281181 3300010375 Bacteria 1873
299 Ga0105239_12904839 3300010375 Bacteria 559
300 Ga0105246_10211772 3300011119 Bacteria 1513
301 Ga0105246_10698532 3300011119 Bacteria 889
302 Ga0157371_10640503 3300013102 Bacteria 793
303 Ga0157369_10192774 3300013105 Bacteria 2141
304 Ga0157374_10198141 3300013296 Bacteria 1966
305 Ga0157374_10877200 3300013296 Bacteria 914
306 Ga0157374_12807644 3300013296 Unclassified 515
307 Ga0157378_10004458 3300013297 Bacteria 12308
308 Ga0157378_10194165 3300013297 Bacteria 1917
309 Ga0157378_11946989 3300013297 Bacteria 637
310 Ga0163162_10162859 3300013306 Bacteria 2353
311 Ga0163162_10239542 3300013306 Bacteria 1945
312 Ga0163162_10269645 3300013306 Bacteria 1834
313 Ga0163162_10711581 3300013306 Bacteria 1125
314 Ga0163162_11159900 3300013306 Bacteria 876
315 Ga0163162_11501300 3300013306 Bacteria 768
316 Ga0157372_10003489 3300013307 Bacteria 16949
317 Ga0157372_10131602 3300013307 Bacteria 2878
318 Ga0157372_10628651 3300013307 Bacteria 1251
319 Ga0157372_11268026 3300013307 Bacteria 851
320 Ga0157372_11435460 3300013307 Bacteria 795
321 Ga0157375_10001355 3300013308 Bacteria 21157
322 Ga0157375_10039356 3300013308 Bacteria 4550
323 Ga0157375_10373964 3300013308 Bacteria 1591
324 Ga0157375_11163219 3300013308 Bacteria 904
325 Ga0163163_10004746 3300014325 Bacteria 11651
326 Ga0163163_10007386 3300014325 Bacteria 9699
327 Ga0163163_10230754 3300014325 Bacteria 1900
328 Ga0157380_10001475 3300014326 Bacteria 15396
329 Ga0182008_10689498 3300014497 Bacteria 582
330 Ga0182008_10905462 3300014497 Bacteria 519
331 Ga0157377_10066387 3300014745 Bacteria 2074
332 Ga0157379_10004218 3300014968 Bacteria 12274
333 Ga0157379_10213257 3300014968 Bacteria 1748
334 Ga0157379_10524981 3300014968 Bacteria 1099
335 Ga0157376_10009099 3300014969 Bacteria 7198
336 Ga0157376_10163708 3300014969 Bacteria 2019
337 Ga0157376_11313779 3300014969 Bacteria 753
338 Ga0157376_11841668 3300014969 Bacteria 642
339 Ga0163161_10000661 3300017792 Bacteria 27527
340 Ga0163161_10042852 3300017792 Bacteria 3257
341 Ga0163161_10120592 3300017792 Bacteria 1970
342 Ga0163161_10227428 3300017792 Bacteria 1447
343 Ga0163161_10315976 3300017792 Bacteria 1233
344 Ga0213876_10492791 3300021384 Bacteria 652
345 Ga0209051_1000959 3300025303 Bacteria 28324
346 Ga0209051_1000994 3300025303 Bacteria 27264
347 Ga0209051_1001901 3300025303 Bacteria 16282
348 Ga0209051_1002561 3300025303 Bacteria 12838
349 Ga0209051_1009834 3300025303 Bacteria 4893
350 Ga0209051_1009902 3300025303 Bacteria 4867
351 Ga0209051_1069318 3300025303 Bacteria 1069
352 Ga0207696_1036909 3300025711 Bacteria 1449
353 Ga0207653_10029517 3300025885 Bacteria 1766
354 Ga0207653_10106535 3300025885 Bacteria 997
355 Ga0207692_10035367 3300025898 Bacteria 2427
356 Ga0207692_11076506 3300025898 Bacteria 532
357 Ga0207642_10000548 3300025899 Bacteria 11498
358 Ga0207642_10037054 3300025899 Bacteria 2099
359 Ga0207710_10000028 3300025900 Bacteria 304525
360 Ga0207710_10007747 3300025900 Bacteria 4543
361 Ga0207710_10033758 3300025900 Bacteria 2246
362 Ga0207688_10002154 3300025901 Bacteria 10592
363 Ga0207688_10263286 3300025901 Bacteria 1047
364 Ga0207680_10011797 3300025903 Bacteria 4429
365 Ga0207680_11092185 3300025903 Bacteria 570
366 Ga0207647_10003300 3300025904 Bacteria 12122
367 Ga0207647_10150764 3300025904 Bacteria 1359
368 Ga0207685_10020823 3300025905 Bacteria 2187
369 Ga0207699_10020736 3300025906 Bacteria 3529
370 Ga0207645_10003519 3300025907 Bacteria 11850
371 Ga0207643_10128503 3300025908 Bacteria 1506
372 Ga0207654_10232517 3300025911 Bacteria 1228
373 Ga0207707_10131596 3300025912 Bacteria 2188
374 Ga0207671_10020623 3300025914 Bacteria 5013
375 Ga0207693_10000790 3300025915 Bacteria 28276
376 Ga0207693_10003157 3300025915 Bacteria 14169
377 Ga0207663_10013025 3300025916 Bacteria 4510
378 Ga0207663_10015687 3300025916 Bacteria 4186
379 Ga0207660_10193035 3300025917 Bacteria 1587
380 Ga0207660_10241644 3300025917 Bacteria 1423
381 Ga0207657_10091874 3300025919 Bacteria 2530
382 Ga0207657_10166526 3300025919 Bacteria 1787
383 Ga0207657_10399115 3300025919 Bacteria 1082
384 Ga0207649_10430037 3300025920 Bacteria 993
385 Ga0207652_10017738 3300025921 Bacteria 5830
386 Ga0207681_10005564 3300025923 Bacteria 7741
387 Ga0207681_10055820 3300025923 Bacteria 2692
388 Ga0207681_10165185 3300025923 Bacteria 1673
389 Ga0207694_10144701 3300025924 Bacteria 1913
390 Ga0207694_10878483 3300025924 Bacteria 758
391 Ga0207694_11156330 3300025924 Bacteria 655
392 Ga0207650_10506881 3300025925 Bacteria 1009
393 Ga0207650_11025972 3300025925 Bacteria 702
394 Ga0207659_10085193 3300025926 Bacteria 2347
395 Ga0207659_10203202 3300025926 Bacteria 1584
396 Ga0207687_10000563 3300025927 Bacteria 25044
397 Ga0207687_10099938 3300025927 Bacteria 2133
398 Ga0207687_10272671 3300025927 Bacteria 1353
399 Ga0207687_11688142 3300025927 Bacteria 543
400 Ga0207700_10711238 3300025928 Bacteria 897
401 Ga0207664_10067863 3300025929 Bacteria 2863
402 Ga0207644_10016003 3300025931 Bacteria 5042
403 Ga0207644_10055659 3300025931 Bacteria 2852
404 Ga0207644_10261169 3300025931 Bacteria 1385
405 Ga0207690_10058954 3300025932 Bacteria 2599
406 Ga0207690_10276119 3300025932 Bacteria 1307
407 Ga0207706_10011263 3300025933 Bacteria 8151
408 Ga0207706_10029266 3300025933 Bacteria 4918
409 Ga0207706_10284764 3300025933 Bacteria 1441
410 Ga0207686_10001957 3300025934 Bacteria 11355
411 Ga0207686_10445124 3300025934 Bacteria 995
412 Ga0207709_10004110 3300025935 Bacteria 8478
413 Ga0207709_10183995 3300025935 Bacteria 1478
414 Ga0207670_10007890 3300025936 Bacteria 5977
415 Ga0207669_10000203 3300025937 Bacteria 27213
416 Ga0207669_10241808 3300025937 Bacteria 1338
417 Ga0207669_10357685 3300025937 Bacteria 1130
418 Ga0207669_10644919 3300025937 Bacteria 865
419 Ga0207704_10000241 3300025938 Bacteria 27067
420 Ga0207704_10212247 3300025938 Bacteria 1426
421 Ga0207704_10245631 3300025938 Bacteria 1340
422 Ga0207704_10777363 3300025938 Bacteria 798
423 Ga0207665_10000977 3300025939 Bacteria 19352
424 Ga0207665_10026348 3300025939 Bacteria 3838
425 Ga0207665_10756474 3300025939 Bacteria 766
426 Ga0207691_10913311 3300025940 Bacteria 735
427 Ga0207691_10929640 3300025940 Bacteria 727
428 Ga0207711_10000081 3300025941 Bacteria 102547
429 Ga0207711_10038413 3300025941 Bacteria 4071
430 Ga0207711_10179907 3300025941 Bacteria 1922
431 Ga0207711_10201432 3300025941 Bacteria 1816
432 Ga0207711_10871158 3300025941 Bacteria 838
433 Ga0207689_10048693 3300025942 Bacteria 3496
434 Ga0207689_10201240 3300025942 Bacteria 1644
435 Ga0207661_11812996 3300025944 Bacteria 556
436 Ga0207679_10904783 3300025945 Unclassified 807
437 Ga0207667_10123624 3300025949 Bacteria 2666
438 Ga0207667_11499988 3300025949 Bacteria 645
439 Ga0207651_10649531 3300025960 Bacteria 926
440 Ga0207712_10000016 3300025961 Bacteria 343014
441 Ga0207712_10002277 3300025961 Bacteria 12464
442 Ga0207712_10011858 3300025961 Bacteria 5556
443 Ga0207712_10918212 3300025961 Bacteria 774
444 Ga0207712_11102396 3300025961 Bacteria 707
445 Ga0207668_10000661 3300025972 Bacteria 21173
446 Ga0207668_10002798 3300025972 Bacteria 10198
447 Ga0207668_10018046 3300025972 Bacteria 4433
448 Ga0207668_10114432 3300025972 Bacteria 2030
449 Ga0207668_10305027 3300025972 Bacteria 1315
450 Ga0207640_10001411 3300025981 Bacteria 12988
451 Ga0207640_10039167 3300025981 Bacteria 2998
452 Ga0207640_10253619 3300025981 Bacteria 1367
453 Ga0207640_11934828 3300025981 Bacteria 534
454 Ga0207658_10002506 3300025986 Bacteria 13364
455 Ga0207658_10008105 3300025986 Bacteria 7157
456 Ga0207658_10010936 3300025986 Bacteria 6178
457 Ga0207658_10077715 3300025986 Bacteria 2533
458 Ga0207658_10107154 3300025986 Bacteria 2202
459 Ga0207658_10303029 3300025986 Bacteria 1377
460 Ga0207658_10832013 3300025986 Bacteria 839
461 Ga0207677_10013226 3300026023 Bacteria 4774
462 Ga0207677_10182680 3300026023 Bacteria 1651
463 Ga0207703_10004050 3300026035 Bacteria 12105
464 Ga0207703_10049725 3300026035 Bacteria 3390
465 Ga0207703_10456621 3300026035 Bacteria 1194
466 Ga0207639_10008039 3300026041 Bacteria 7209
467 Ga0207639_10050594 3300026041 Bacteria 3156
468 Ga0207639_10166239 3300026041 Bacteria 1864
469 Ga0207639_10764345 3300026041 Bacteria 899
470 Ga0207678_10001369 3300026067 Bacteria 22479
471 Ga0207678_10016049 3300026067 Bacteria 6578
472 Ga0207678_10045459 3300026067 Bacteria 3797
473 Ga0207678_10157864 3300026067 Bacteria 1937
474 Ga0207678_10981686 3300026067 Bacteria 747
475 Ga0207708_10003704 3300026075 Bacteria 11285
476 Ga0207708_10060379 3300026075 Bacteria 2894
477 Ga0207708_10350933 3300026075 Bacteria 1210
478 Ga0207708_11355432 3300026075 Bacteria 624
479 Ga0207702_10428741 3300026078 Bacteria 1280
480 Ga0207641_10010006 3300026088 Bacteria 7801
481 Ga0207641_10010349 3300026088 Bacteria 7667
482 Ga0207641_10285390 3300026088 Bacteria 1554
483 Ga0207641_10439044 3300026088 Bacteria 1260
484 Ga0207648_10004625 3300026089 Bacteria 14093
485 Ga0207648_10143895 3300026089 Bacteria 2102
486 Ga0207676_10048416 3300026095 Bacteria 3300
487 Ga0207676_10104119 3300026095 Bacteria 2360
488 Ga0207676_10265870 3300026095 Bacteria 1551
489 Ga0207675_100002734 3300026118 Bacteria 17365
490 Ga0207675_100028766 3300026118 Bacteria 5177
491 Ga0207675_100123732 3300026118 Bacteria 2449
492 Ga0207675_100298536 3300026118 Bacteria 1569
493 Ga0207675_101860942 3300026118 Bacteria 621
494 Ga0207675_101943174 3300026118 Bacteria 606
495 Ga0207683_10000819 3300026121 Bacteria 28484
496 Ga0207683_10029576 3300026121 Bacteria 4743
497 Ga0207683_10151233 3300026121 Bacteria 2095
498 Ga0207698_10196902 3300026142 Bacteria 1801
499 Ga0207698_10535161 3300026142 Bacteria 1146
500 Ga0207698_11235272 3300026142 Bacteria 761
501 Ga0209813_10002513 3300027866 Bacteria 4201
502 Ga0209813_10284279 3300027866 Bacteria 638
503 Ga0207428_10649456 3300027907 Bacteria 757
504 Ga0268266_10006503 3300028379 Bacteria 10692
505 Ga0268266_10035540 3300028379 Bacteria 4239
506 Ga0268265_10000056 3300028380 Bacteria 155720
507 Ga0268265_10004974 3300028380 Bacteria 9133
508 Ga0268264_10000053 3300028381 Bacteria 320368
509 Ga0268264_10001190 3300028381 Bacteria 25165
510 Ga0268264_10062434 3300028381 Bacteria 3128
511 Ga0268264_10207165 3300028381 Bacteria 1798
512 Ga0268264_11329339 3300028381 Bacteria 729
513 Ga0268264_11594481 3300028381 Bacteria 663
514 Ga0307408_100785156 3300031548 Bacteria 863
515 Ga0307408_101904976 3300031548 Bacteria 570
516 Ga0307405_10677306 3300031731 Bacteria 851
517 Ga0307405_12020239 3300031731 Bacteria 516
518 Ga0307413_10015328 3300031824 Bacteria 3925
519 Ga0307413_10191396 3300031824 Bacteria 1469
520 Ga0307413_10876730 3300031824 Bacteria 760
521 Ga0307410_10119989 3300031852 Bacteria 1916
522 Ga0307410_10854452 3300031852 Bacteria 777
523 Ga0307410_11169484 3300031852 Bacteria 669
524 Ga0307406_10000005 3300031901 Bacteria 155981
525 Ga0307406_10571414 3300031901 Bacteria 928
526 Ga0307407_10021756 3300031903 Bacteria 3315
527 Ga0307407_10292985 3300031903 Bacteria 1132
528 Ga0307412_10590259 3300031911 Bacteria 939
529 Ga0307412_10717860 3300031911 Bacteria 860
530 Ga0307412_12140744 3300031911 Bacteria 520
531 Ga0307409_100040073 3300031995 Bacteria 3483
532 Ga0307409_100057289 3300031995 Bacteria 3019
533 Ga0307409_100872455 3300031995 Bacteria 912
534 Ga0307416_100094011 3300032002 Bacteria 2584
535 Ga0307411_10096507 3300032005 Bacteria 2078
536 Ga0307411_10425873 3300032005 Bacteria 1104
537 Ga0307411_11432335 3300032005 Bacteria 633
538 Ga0307415_100034530 3300032126 Bacteria 3294
539 Ga0307415_100077491 3300032126 Bacteria 2361
540 Ga0307415_102289732 3300032126 Bacteria 530
541 Ga0373930_0043795 3300034816 Bacteria 961
542 Ga0373948_0166948 3300034817 Bacteria 558
543 Ga0373940_0085914 3300035088 Bacteria 937
544 Ga0373949_0059087 3300035090 Bacteria 983
545 Ga0373951_0060232 3300035091 Bacteria 949
546 Ga0373939_0081072 3300035114 Bacteria 1077
547 Ga0373941_0226789 3300035115 Bacteria 720
548 Ga0373943_0265007 3300035170 Bacteria 968
549 Ga0373955_0445736 3300035172 Bacteria 789
550 Ga0373931_0016228 3300035691 Bacteria 3663
551 Ga0373931_0043700 3300035691 Bacteria 2361
552 Ga0373925_0347410 3300037068 Bacteria 1204
553 Ga0395900_1292515 3300037418 Bacteria 644
554 Ga0395898_0521676 3300037466 Bacteria 1129
555 Ga0395898_1233487 3300037466 Bacteria 678
556 Ga0395901_0960669 3300038443 Bacteria 833
557 Ga0436365_0449045 3300039437 Bacteria 662
558 Ga0439461_0051336 3300041410 Bacteria 915
559 Ga0439466_0025579 3300041411 Bacteria 2060
560 Ga0439465_0000575 3300041413 Bacteria 11071
561 Ga0439465_0010742 3300041413 Bacteria 2872
562 Ga0439465_0010981 3300041413 Bacteria 2840
563 Ga0439465_0053851 3300041413 Bacteria 1322
564 Ga0451787_725883 3300041441 Bacteria 519
565 Ga0451793_0844392 3300041452 Bacteria 2024
566 Ga0451793_1056532 3300041452 Bacteria 1236
567 Ga0451793_1363041 3300041452 Bacteria 604
568 Ga0451797_1014546 3300041453 Bacteria 772
569 Ga0451800_0400527 3300041459 Bacteria 524
570 Ga0451806_553759 3300041462 Bacteria 563
571 Ga0451807_0114244 3300041486 Bacteria 856
572 Ga0451841_0717607 3300041498 Bacteria 638
573 Ga0451855_1821113 3300041511 Bacteria 715
574 Ga0451853_0324363 3300041512 Bacteria 813
575 Ga0451853_2774313 3300041512 Unclassified 508
576 Ga0451853_3370168 3300041512 Bacteria 817
577 Ga0439431_0001637 3300041997 Bacteria 4959
578 Ga0439442_016336 3300042002 Bacteria 1530
579 Ga0439442_089631 3300042002 Bacteria 661
580 Ga0439442_100331 3300042002 Bacteria 626
581 Ga0439445_0004220 3300042004 Bacteria 3251
582 Ga0439434_0003618 3300042435 Bacteria 4519
583 Ga0439435_0063363 3300042436 Bacteria 1081
584 Ga0466972_0018297 3300044658 Bacteria 3501
585 Ga0466972_0032471 3300044658 Bacteria 2563
586 Ga0466972_0168729 3300044658 Bacteria 1027
587 Ga0466972_0208637 3300044658 Bacteria 914
588 Ga0466965_0003871 3300044683 Bacteria 6611
589 Ga0466965_0009341 3300044683 Bacteria 4557
590 Ga0466965_0052700 3300044683 Bacteria 2021
591 Ga0466965_0685488 3300044683 Bacteria 587
592 Ga0466966_0539933 3300044684 Bacteria 701
593 Ga0466961_0356093 3300044693 Bacteria 890
594 Ga0466963_0052225 3300044694 Bacteria 2712
595 Ga0466963_0432827 3300044694 Bacteria 928
596 Ga0466964_0380751 3300044706 Bacteria 732
597 Ga0466971_0002164 3300044719 Bacteria 8308
598 Ga0466971_0082210 3300044719 Bacteria 1470
599 Ga0466968_0005668 3300044735 Bacteria 4677
600 Ga0466970_0033140 3300044765 Bacteria 2730
601 Ga0466970_0142123 3300044765 Bacteria 1322
602 Ga0466970_0251920 3300044765 Bacteria 989
603 Ga0466957_0003478 3300044842 Bacteria 8648
604 Ga0466957_0019698 3300044842 Bacteria 3969
605 Ga0466957_0217550 3300044842 Bacteria 1260
606 Ga0466960_0000012 3300044901 Bacteria 60091
607 Ga0466960_0021911 3300044901 Bacteria 2851
608 Ga0466960_0024597 3300044901 Bacteria 2718
609 Ga0466960_0045623 3300044901 Bacteria 2095
610 Ga0466960_0074750 3300044901 Bacteria 1694
611 Ga0466960_0124193 3300044901 Bacteria 1355
612 Ga0466960_0400898 3300044901 Bacteria 790
613 Ga0466959_0201478 3300045049 Bacteria 1385
614 Ga0466967_0006706 3300045976 Bacteria 8192
615 Ga0466967_0009125 3300045976 Bacteria 7336
616 Ga0466967_0090509 3300045976 Bacteria 2780
617 Ga0466967_0191181 3300045976 Bacteria 1934
618 Ga0466967_0275030 3300045976 Bacteria 1615
619 Ga0466967_1032382 3300045976 Bacteria 819
620 Ga0466967_1350295 3300045976 Bacteria 710
621 Ga0495603_0075271 3300046455 Bacteria 1982
622 Ga0495603_0141791 3300046455 Bacteria 1398
623 Ga0495603_0476102 3300046455 Bacteria 715
624 Ga0495590_0310163 3300046457 Unclassified 595
625 Ga0495590_0388269 3300046457 Bacteria 534
626 Ga0495629_0012034 3300046459 Bacteria 6272
627 Ga0495629_0268330 3300046459 Bacteria 1173
628 Ga0495638_0636597 3300046460 Bacteria 520
629 Ga0495641_0019102 3300046461 Bacteria 3518
630 Ga0495582_0151824 3300046473 Bacteria 1315
631 Ga0495582_0767184 3300046473 Bacteria 558
632 Ga0495605_0430140 3300046474 Bacteria 546
633 Ga0495639_0502027 3300046475 Bacteria 619
634 Ga0495662_0018494 3300046476 Bacteria 3374
635 Ga0495594_0504346 3300046499 Bacteria 687
636 Ga0495606_0010051 3300046507 Bacteria 7909
637 Ga0495606_0501357 3300046507 Viruses 613
638 Ga0495630_1164424 3300046517 Bacteria 583
639 Ga0495631_0399890 3300046518 Bacteria 585
640 Ga0495622_0245956 3300046557 Bacteria 788
641 Ga0495667_0526109 3300046559 Bacteria 740
642 Ga0495656_0663310 3300046615 Bacteria 560
643 Ga0495668_0070166 3300046616 Bacteria 1926
644 Ga0495668_0191170 3300046616 Bacteria 1121
645 Ga0495611_0476205 3300046648 Bacteria 568
646 Ga0495635_0146599 3300046663 Bacteria 1607
647 Ga0495635_0185833 3300046663 Bacteria 1412
648 Ga0495658_0038830 3300046683 Bacteria 2638
649 Ga0495658_0275090 3300046683 Unclassified 1062
650 Ga0495658_0678285 3300046683 Bacteria 660
651 Ga0495669_0506951 3300046684 Unclassified 587
652 Ga0495613_0313462 3300046689 Bacteria 1084
653 Ga0495624_0138498 3300046690 Bacteria 1491
654 Ga0495671_0111066 3300046692 Bacteria 1339
655 Ga0495671_0383740 3300046692 Bacteria 673
656 Ga0495600_0658930 3300046809 Unclassified 632
657 Ga0495581_0008541 3300047315 Bacteria 5936
658 Ga0495672_0081868 3300047320 Bacteria 1796
659 Ga0495672_0117362 3300047320 Bacteria 1420
660 Ga0495672_0144275 3300047320 Bacteria 1240
661 Ga0495676_0013817 3300047321 Bacteria 7239
662 Ga0495673_0005547 3300047469 Bacteria 7605
663 Ga0495686_0006416 3300047472 Bacteria 9008
664 Ga0495593_0017065 3300047673 Bacteria 4087
665 Ga0495614_0481367 3300048089 Bacteria 589
666 Ga0495626_0030123 3300048091 Bacteria 2619
667 Ga0496100_0000769 3300048903 Bacteria 15253
668 Ga0496100_0006691 3300048903 Bacteria 6306
669 Ga0496100_0077172 3300048903 Bacteria 2239
670 Ga0496100_0109579 3300048903 Bacteria 1916
671 Ga0496100_0576131 3300048903 Bacteria 872
672 Ga0496100_0750578 3300048903 Bacteria 763
673 Ga0496100_1197867 3300048903 Bacteria 599
674 Ga0496101_0000113 3300048904 Bacteria 81197
675 Ga0496101_0000688 3300048904 Bacteria 20371
676 Ga0496101_0005860 3300048904 Bacteria 7866
677 Ga0496101_0017078 3300048904 Bacteria 4915
678 Ga0496101_0066003 3300048904 Bacteria 2639
679 Ga0496101_0106800 3300048904 Bacteria 2103
680 Ga0496101_0312244 3300048904 Bacteria 1233
681 Ga0496101_0355607 3300048904 Bacteria 1151
682 Ga0496101_0483471 3300048904 Bacteria 978
683 Ga0496101_0581276 3300048904 Bacteria 886
684 Ga0496101_0606684 3300048904 Bacteria 865
685 Ga0496101_1176557 3300048904 Bacteria 601
686 Ga0496102_0000035 3300048905 Bacteria 213557
687 Ga0496102_0000480 3300048905 Bacteria 44338
688 Ga0496102_0001549 3300048905 Bacteria 20302
689 Ga0496102_0004278 3300048905 Bacteria 12068
690 Ga0496102_0030367 3300048905 Bacteria 4837
691 Ga0496102_0033527 3300048905 Bacteria 4615
692 Ga0496102_0355337 3300048905 Bacteria 1379
693 Ga0496102_0597921 3300048905 Bacteria 1026
694 Ga0496102_1438192 3300048905 Bacteria 608
695 Ga0496103_0000028 3300048906 Bacteria 213660
696 Ga0496103_0000969 3300048906 Bacteria 20338
697 Ga0496103_0002333 3300048906 Bacteria 11995
698 Ga0496103_0023642 3300048906 Bacteria 3707
699 Ga0496103_0048256 3300048906 Bacteria 2631
700 Ga0496104_0039637 3300048907 Bacteria 4411
701 Ga0496104_0303700 3300048907 Bacteria 1508
702 Ga0496104_0760970 3300048907 Bacteria 875
703 Ga0496104_0913832 3300048907 Bacteria 783
704 Ga0496105_0023967 3300048908 Bacteria 4957
705 Ga0496105_0123846 3300048908 Bacteria 2131
706 Ga0496105_0805500 3300048908 Bacteria 714
707 Ga0496106_0003822 3300048909 Bacteria 11228
708 Ga0496106_0011087 3300048909 Bacteria 6665
709 Ga0496106_0026642 3300048909 Bacteria 4305
710 Ga0496106_0173012 3300048909 Bacteria 1712
711 Ga0496106_0268590 3300048909 Bacteria 1365
712 Ga0496107_0001648 3300048910 Bacteria 13944
713 Ga0496107_0106706 3300048910 Bacteria 2057
714 Ga0496107_0137644 3300048910 Bacteria 1804
715 Ga0496107_0160420 3300048910 Bacteria 1666
716 Ga0496107_0209523 3300048910 Bacteria 1449
717 Ga0496107_0501726 3300048910 Bacteria 900
718 Ga0496107_0661223 3300048910 Bacteria 770
719 Ga0496108_0000268 3300048911 Bacteria 44819
720 Ga0496108_0021471 3300048911 Bacteria 5307
721 Ga0496108_0210398 3300048911 Bacteria 1688
722 Ga0496108_0396851 3300048911 Bacteria 1205
723 Ga0496109_0101967 3300048912 Bacteria 2664
724 Ga0496109_0162238 3300048912 Bacteria 2094
725 Ga0496109_0418712 3300048912 Bacteria 1265
726 Ga0496109_1089122 3300048912 Bacteria 736
727 Ga0496109_1738817 3300048912 Bacteria 557
728 Ga0496110_0092249 3300048913 Bacteria 2710
729 Ga0496110_0143219 3300048913 Bacteria 2161
730 Ga0496110_0174754 3300048913 Bacteria 1949
731 Ga0496110_0317140 3300048913 Bacteria 1420
732 Ga0496110_0913186 3300048913 Bacteria 784
733 Ga0496111_0136592 3300048914 Bacteria 1816
734 Ga0496111_0283388 3300048914 Bacteria 1229
735 Ga0496111_1213491 3300048914 Bacteria 534
736 Ga0496112_0011229 3300048915 Bacteria 8170
737 Ga0496112_0021704 3300048915 Bacteria 6108
738 Ga0496112_0026063 3300048915 Bacteria 5621
739 Ga0496112_0046620 3300048915 Bacteria 4252
740 Ga0496112_0093263 3300048915 Bacteria 2981
741 Ga0496113_0024715 3300048916 Bacteria 4275
742 Ga0496113_0048032 3300048916 Bacteria 3174
743 Ga0496113_0507779 3300048916 Bacteria 968
744 Ga0496114_0001266 3300048917 Bacteria 19081
745 Ga0496114_0120885 3300048917 Bacteria 2252
746 Ga0496114_0259246 3300048917 Bacteria 1531
747 Ga0496114_1329721 3300048917 Bacteria 606
748 Ga0496114_1495587 3300048917 Bacteria 563
749 Ga0496115_0002979 3300048918 Bacteria 12168
750 Ga0496115_0010273 3300048918 Bacteria 6988
751 Ga0496115_1151604 3300048918 Bacteria 585
752 Ga0496116_0000090 3300048919 Bacteria 212651
753 Ga0496116_0004318 3300048919 Bacteria 13601
754 Ga0496117_0000051 3300048920 Bacteria 285716
755 Ga0496117_0000319 3300048920 Bacteria 84245
756 Ga0496117_0269644 3300048920 Bacteria 918
757 Ga0496117_0504924 3300048920 Bacteria 585
758 Ga0496118_0000043 3300048921 Bacteria 285716
759 Ga0496118_0013375 3300048921 Bacteria 7768
760 Ga0496119_0003516 3300048922 Bacteria 16192
761 Ga0496119_0016938 3300048922 Bacteria 5513
762 Ga0496119_0058589 3300048922 Bacteria 2320
763 Ga0496119_0120024 3300048922 Bacteria 1446
764 Ga0496120_0002432 3300048923 Bacteria 18838
765 Ga0496120_0023398 3300048923 Bacteria 3868
766 Ga0496120_0051177 3300048923 Bacteria 2361
767 Ga0496120_0463118 3300048923 Bacteria 550
768 Ga0496121_0000080 3300048924 Bacteria 230195
769 Ga0496121_0005852 3300048924 Bacteria 15574
770 Ga0496121_0018295 3300048924 Bacteria 7076
771 Ga0496121_0047583 3300048924 Bacteria 3658
772 Ga0496122_0021259 3300048925 Bacteria 5816
773 Ga0496123_0007977 3300048926 Bacteria 9816
774 Ga0496124_0076974 3300048927 Bacteria 2752
775 Ga0496124_0870694 3300048927 Bacteria 550
776 Ga0496125_0040289 3300048928 Bacteria 4009
777 Ga0496125_0341136 3300048928 Bacteria 899
778 Ga0496126_0001415 3300048929 Bacteria 37973
779 Ga0496126_0006411 3300048929 Bacteria 13123
780 Ga0496126_0009171 3300048929 Bacteria 10555
781 Ga0496126_0131618 3300048929 Bacteria 2161
782 Ga0496126_0611172 3300048929 Bacteria 858
783 Ga0501032_0006987 3300049569 Bacteria 8274
784 Ga0501034_0045757 3300049571 Bacteria 4421
785 Ga0501034_0074037 3300049571 Bacteria 3414
786 Ga0501034_0207775 3300049571 Bacteria 1914
787 Ga0501034_0574134 3300049571 Bacteria 1035
788 Ga0501036_0008925 3300049572 Bacteria 8240
789 Ga0501036_0828690 3300049572 Bacteria 761
790 Ga0501037_0002048 3300049573 Bacteria 14614
791 Ga0501038_0061964 3300049574 Bacteria 3197
792 Ga0501039_0002873 3300049575 Bacteria 12887
793 Ga0501042_0219098 3300049578 Bacteria 1373
794 Ga0501043_0005964 3300049579 Bacteria 9793
795 Ga0501067_0260517 3300049583 Bacteria 965
796 Ga0501067_0685819 3300049583 Unclassified 576
797 Ga0501068_0059884 3300049584 Bacteria 2312
798 Ga0501069_0016692 3300049585 Bacteria 3945
799 Ga0501069_0034720 3300049585 Bacteria 2777
800 Ga0501070_0000247 3300049586 Bacteria 50837
801 Ga0501070_0001225 3300049586 Bacteria 22969
802 Ga0501070_0258293 3300049586 Bacteria 1424
803 Ga0501070_0458431 3300049586 Bacteria 1027
804 Ga0501070_0797926 3300049586 Bacteria 742
805 Ga0501070_0954356 3300049586 Bacteria 667
806 Ga0501071_0064404 3300049587 Bacteria 2660
807 Ga0501071_0238546 3300049587 Bacteria 1371
808 Ga0501071_0316405 3300049587 Bacteria 1185
809 Ga0501071_0717145 3300049587 Bacteria 770
810 Ga0501072_0204809 3300049588 Bacteria 1573
811 Ga0501073_0025433 3300049589 Bacteria 4246
812 Ga0501073_0772006 3300049589 Bacteria 663
813 Ga0501074_0009004 3300049590 Bacteria 7247
814 Ga0501075_0815792 3300049591 Bacteria 710
815 Ga0501077_0067976 3300049593 Bacteria 2259
816 Ga0501079_0051135 3300049741 Bacteria 3190
817 Ga0501079_0423376 3300049741 Bacteria 1045
818 Ga0501080_0190492 3300049742 Bacteria 1885
819 Ga0501080_0604972 3300049742 Bacteria 973
820 Ga0501044_0108406 3300049823 Bacteria 2787
821 Ga0501044_1429566 3300049823 Unclassified 557
822 Ga0501045_0178066 3300049824 Bacteria 1584
823 Ga0501045_1273846 3300049824 Bacteria 535
824 nmdc:mga03683_43812_c1 3300050489 Bacteria 1847
825 nmdc:mga03683_9238_c1 3300050489 Bacteria 3498
826 nmdc:mga03n38_123299_c2 3300050490 Bacteria 537
827 nmdc:mga03n38_1303_c1 3300050490 Bacteria 7038
828 nmdc:mga03n38_14602_c1 3300050490 Bacteria 3015
829 nmdc:mga03n38_175451_c1 3300050490 Bacteria 1095
830 nmdc:mga03n38_220549_c1 3300050490 Bacteria 990
831 nmdc:mga03n38_2238_c1 3300050490 Bacteria 5910
832 nmdc:mga03n38_406594_c1 3300050490 Bacteria 750
833 nmdc:mga03n38_477432_c1 3300050490 Bacteria 697
834 nmdc:mga03n38_7143_c1 3300050490 Bacteria 3932
835 nmdc:mga00v17_135200_c1 3300050491 Bacteria 1578
836 nmdc:mga00v17_179387_c1 3300050491 Bacteria 1366
837 nmdc:mga00v17_266811_c1 3300050491 Bacteria 1111
838 nmdc:mga00v17_279285_c1 3300050491 Bacteria 1084
839 nmdc:mga00v17_36101_c1 3300050491 Bacteria 2944
840 nmdc:mga00v17_84654_c1 3300050491 Bacteria 1985
841 nmdc:mga00v17_94300_c1 3300050491 Bacteria 1883
842 nmdc:mga00v17_95757_c1 3300050491 Bacteria 1869
843 nmdc:mga00v17_973_c1 3300050491 Bacteria 15341
844 nmdc:mga0yw44_11000_c1 3300050492 Bacteria 4645
845 nmdc:mga0yw44_177119_c1 3300050492 Bacteria 1402
846 nmdc:mga0yw44_184712_c1 3300050492 Bacteria 1373
847 nmdc:mga0yw44_24877_c1 3300050492 Bacteria 3395
848 nmdc:mga0yw44_363209_c1 3300050492 Archaea 976
849 nmdc:mga0yw44_479126_c1 3300050492 Bacteria 844
850 nmdc:mga0yw44_58128_c1 3300050492 Bacteria 2362
851 nmdc:mga0yw44_96665_c1 3300050492 Bacteria 1875
852 nmdc:mga0k408_196393_c1 3300050493 Bacteria 1204
853 nmdc:mga06z11_215497_c1 3300050494 Bacteria 1120
854 nmdc:mga06z11_288841_c1 3300050494 Bacteria 973
855 nmdc:mga06z11_426520_c1 3300050494 Bacteria 800
856 nmdc:mga06z11_506429_c1 3300050494 Bacteria 732
857 nmdc:mga06z11_73113_c1 3300050494 Bacteria 1820
858 nmdc:mga04h51_226449_c1 3300050495 Bacteria 743
859 nmdc:mga04h51_472882_c1 3300050495 Bacteria 532
860 nmdc:mga04h51_66635_c1 3300050495 Bacteria 1247
861 nmdc:mga07m45_21051_c1 3300050496 Bacteria 3548
862 nmdc:mga07m45_32020_c1 3300050496 Bacteria 2915
863 nmdc:mga07m45_39116_c1 3300050496 Bacteria 2649
864 nmdc:mga07m45_543198_c1 3300050496 Bacteria 672
865 nmdc:mga07m45_65235_c2 3300050496 Bacteria 697
866 nmdc:mga05p37_88411_c1 3300050507 Bacteria 3819
867 nmdc:mga0qj67_110491_c1 3300050509 Bacteria 2219
868 nmdc:mga06r32_24296_c1 3300050510 Bacteria 5622
869 nmdc:mga0rr50_739554_c1 3300050513 Bacteria 839
870 nmdc:mga0sz30_114081_c1 3300050516 Bacteria 1185
871 nmdc:mga0sz30_12880_c1 3300050516 Bacteria 781
872 nmdc:mga0sz30_14183_c1 3300050516 Bacteria 3132
873 nmdc:mga0sz30_144306_c1 3300050516 Bacteria 1052
874 nmdc:mga0sz30_33081_c1 3300050516 Bacteria 2147
875 nmdc:mga0sz30_38191_c1 3300050516 Bacteria 2011
876 nmdc:mga0sz30_502133_c1 3300050516 Bacteria 546
877 nmdc:mga0sz30_687_c1 3300050516 Bacteria 12504
878 nmdc:mga0sz30_89730_c1 3300050516 Bacteria 1336
879 Ga0495601_0585266 3300053077 Bacteria 717
880 Ga0500635_0001751 3300053080 Bacteria 5290
881 Ga0495655_0004672 3300053083 Bacteria 2363
882 Ga0495619_0117856 3300053085 Bacteria 1819
883 Ga0495619_0346953 3300053085 Bacteria 1027
884 Ga0500643_001231 3300053087 Bacteria 15236
885 Ga0500556_0092082 3300053104 Bacteria 1159
886 Ga0500562_047863 3300053108 Bacteria 1141
887 Ga0500652_036748 3300053131 Bacteria 1951
888 Ga0500568_0176013 3300053139 Bacteria 787
889 Ga0500577_0058698 3300053142 Bacteria 1473
890 Ga0500604_0012545 3300053151 Bacteria 2289
891 Ga0500616_0024369 3300053153 Bacteria 3363
892 Ga0500616_0224574 3300053153 Bacteria 817
893 Ga0500616_0270659 3300053153 Bacteria 717
894 Ga0500620_127940 3300053155 Bacteria 889
895 Ga0501084_1341360 3300054114 Bacteria 599
896 Ga0501082_0072934 3300060353 Bacteria 2957
897 Ga0501082_0984856 3300060353 Bacteria 737
898 Ga0466962_0046820 3300061719 Bacteria 2066
899 Ga0530510_1537205 3300061734 Bacteria 511
900 2738698147 2738541272 Bacteria 6848551
901 2739327922 2738543027 Bacteria 6409078
902 2753037804 2751185725 Bacteria 5740550
903 2753325672 2751185792 Bacteria 5739090
904 2784473169 2784132109 Bacteria 3141763
905 2857731717 2857729791 Bacteria 4040535
906 2858907189 2858902515 Bacteria 7086037
907 2902796322 2902792274 Bacteria 7270173
908 2902811218 2902810491 Bacteria 6794147
909 2902838093 2902837492 Bacteria 6697721
910 2908813837 2908811453 Bacteria 5478616
911 2928124378 2928121344 Bacteria 3972376
912 2939585401 2939582691 Bacteria 7088898
913 JGI24740J21852_10043844
914 JGI24746J21847_1054533
915 JGI24735J21928_10034025
916 JGI24751J29686_10006850
917 rootH1_10404148
918 Ga0055540_1004454
919 Ga0055540_1010425
920 Ga0055540_1010759
921 Ga0055540_1016501
922 Ga0055540_1019834
923 Ga0070658_10115551
924 Ga0070658_11275292
925 Ga0070676_10392934
926 Ga0070690_100018598
927 Ga0070690_100050145
928 Ga0070670_100595260
929 Ga0070670_100616019
930 Ga0068869_100060511
931 Ga0070666_10005442
932 Ga0070680_100057141
933 Ga0070682_100052952
934 Ga0070682_100148687
935 Ga0068868_100000955
936 Ga0068868_100189176
937 Ga0068868_100189707
938 Ga0070660_100103413
939 Ga0070660_100251670
940 Ga0070660_100949183
941 Ga0070689_100021315
942 Ga0070691_10007534
943 Ga0070691_10831612
944 Ga0070661_100443224
945 Ga0070692_10251027
946 Ga0070692_11006562
947 Ga0070668_100003467
948 Ga0070668_100003551
949 Ga0070668_100061074
950 Ga0070668_100088638
951 Ga0070668_100205948
952 Ga0070668_100240684
953 Ga0070669_100005262
954 Ga0070669_100213440
955 Ga0070669_100247318
956 Ga0070671_100024325
957 Ga0070674_100000313
958 Ga0070674_100018680
959 Ga0070674_100076723
960 Ga0070674_100621695
961 Ga0070674_101037061
962 Ga0070673_100228279
963 Ga0070673_101017229
964 Ga0070688_100007669
965 Ga0070688_100032241
966 Ga0070688_101571594
967 Ga0070659_100015525
968 Ga0070659_100152127
969 Ga0070659_100504557
970 Ga0070667_100000139
971 Ga0070667_100002238
972 Ga0070667_100008243
973 Ga0070667_100044646
974 Ga0070667_100210508
975 Ga0070667_100533633
976 Ga0070703_10013058
977 Ga0070703_10346014
978 Ga0070709_10018822
979 Ga0070709_10023209
980 Ga0070714_100101051
981 Ga0070713_100816877
982 Ga0070710_10001576
983 Ga0070710_10058051
984 Ga0070710_10665393
985 Ga0070701_10000508
986 Ga0070711_100002308
987 Ga0070711_100009368
988 Ga0070705_100006878
989 Ga0070705_100085308
990 Ga0070700_100006009
991 Ga0070700_100228494
992 Ga0070700_100547652
993 Ga0070694_100004970
994 Ga0070694_100938846
995 Ga0070663_100000660
996 Ga0070663_100046048
997 Ga0070663_100098869
998 Ga0070663_100352085
999 Ga0070663_101191178
1000 Ga0070678_100000286
1001 Ga0070678_100083145
1002 Ga0070678_100094987
1003 Ga0070678_100489963
1004 Ga0070678_101528824
1005 Ga0070662_100131506
1006 Ga0070662_100174116
1007 Ga0070681_10044039
1008 Ga0068867_100019853
1009 Ga0068867_100543013
1010 Ga0070685_10302038
1011 Ga0070685_11231040
1012 Ga0070706_100533205
1013 Ga0070679_100021590
1014 Ga0070679_100280428
1015 Ga0070679_100394989
1016 Ga0070684_100489135
1017 Ga0070684_101334004
1018 Ga0068853_100000658
1019 Ga0068853_100008966
1020 Ga0068853_101283333
1021 Ga0068853_101310891
1022 Ga0070672_100386832
1023 Ga0070672_101439660
1024 Ga0070686_100112519
1025 Ga0070695_100173826
1026 Ga0070695_100298668
1027 Ga0070696_100031766
1028 Ga0070696_100042242
1029 Ga0070693_100003047
1030 Ga0070693_100134664
1031 Ga0070693_100351193
1032 Ga0070665_100004431
1033 Ga0070665_100027903
1034 Ga0070665_100603293
1035 Ga0070665_101082530
1036 Ga0070704_100000300
1037 Ga0068855_100058281
1038 Ga0068855_100070048
1039 Ga0068855_102551401
1040 Ga0070664_100802162
1041 Ga0068854_100003399
1042 Ga0068854_100162053
1043 Ga0068854_100208129
1044 Ga0068856_100422385
1045 Ga0070702_100003130
1046 Ga0070702_100602937
1047 Ga0070702_100658916
1048 Ga0070702_101141524
1049 Ga0068852_100015154
1050 Ga0068852_100734305
1051 Ga0068859_100002436
1052 Ga0068859_100012232
1053 Ga0068859_100482977
1054 Ga0068859_100868252
1055 Ga0068864_100102321
1056 Ga0068864_100115901
1057 Ga0068864_100302396
1058 Ga0068864_100905647
1059 Ga0068866_10000247
1060 Ga0068866_10010847
1061 Ga0068866_10213417
1062 Ga0068866_10960368
1063 Ga0068861_100001058
1064 Ga0068861_100046076
1065 Ga0068861_100220480
1066 Ga0068861_100971389
1067 Ga0068861_101251523
1068 Ga0068861_101474202
1069 Ga0068851_10104814
1070 Ga0068870_10193854
1071 Ga0068863_100000121
1072 Ga0068863_100001259
1073 Ga0068863_100294249
1074 Ga0068858_100000762
1075 Ga0068858_100009580
1076 Ga0068858_100301757
1077 Ga0068860_100000025
1078 Ga0068860_100002200
1079 Ga0068860_100116550
1080 Ga0068860_100172448
1081 Ga0068860_101597193
1082 Ga0068862_100000045
1083 Ga0068862_100004091
1084 Ga0068862_100119737
1085 Ga0068862_100550476
1086 Ga0081455_10122004
1087 Ga0075365_10016984
1088 Ga0075365_10056195
1089 Ga0075365_10072377
1090 Ga0075365_10203992
1091 Ga0075365_10300655
1092 Ga0075365_10328432
1093 Ga0075365_10363069
1094 Ga0075365_10621412
1095 Ga0075365_10665091
1096 Ga0075365_10883010
1097 Ga0075368_10005037
1098 Ga0075368_10042880
1099 Ga0075368_10072659
1100 Ga0075363_100000849
1101 Ga0075363_100000858
1102 Ga0075363_100003499
1103 Ga0075363_100003701
1104 Ga0075363_100013733
1105 Ga0075363_100049292
1106 Ga0075363_100068588
1107 Ga0075363_100132750
1108 Ga0075363_100252630
1109 Ga0075363_100693186
1110 Ga0075364_10001978
1111 Ga0075364_10003210
1112 Ga0075364_10013157
1113 Ga0075364_10032399
1114 Ga0075364_10038172
1115 Ga0075364_10145149
1116 Ga0075364_10268562
1117 Ga0075364_10660838
1118 Ga0075364_10692437
1119 Ga0075364_10842521
1120 Ga0075364_10964273
1121 Ga0070715_10012764
1122 Ga0070716_100005688
1123 Ga0070716_100015621
1124 Ga0070716_101287898
1125 Ga0070716_101481133
1126 Ga0070712_100000143
1127 Ga0070712_100014598
1128 Ga0070712_100901672
1129 Ga0075362_10051928
1130 Ga0075362_10093057
1131 Ga0075362_10253804
1132 Ga0075362_10336178
1133 Ga0075367_10003063
1134 Ga0075367_10096044
1135 Ga0075367_10320667
1136 Ga0075367_10396357
1137 Ga0075367_10873515
1138 Ga0075369_10001918
1139 Ga0075369_10017616
1140 Ga0075369_10021514
1141 Ga0075369_10030904
1142 Ga0075369_10047731
1143 Ga0075369_10090784
1144 Ga0075369_10347330
1145 Ga0075369_10379621
1146 Ga0075369_10620288
1147 Ga0075369_10650687
1148 Ga0075369_10661176
1149 Ga0097621_101248203
1150 Ga0097621_101683849
1151 Ga0075370_10001633
1152 Ga0075370_10031074
1153 Ga0075370_10034716
1154 Ga0075370_10118523
1155 Ga0075370_11018909
1156 Ga0068871_100186257
1157 Ga0075428_100003580
1158 Ga0075430_100006737
1159 Ga0075431_100013252
1160 Ga0068865_100002466
1161 Ga0068865_100134113
1162 Ga0068865_100278133
1163 Ga0075436_100813780
1164 Ga0097620_100002436
1165 Ga0097620_100012233
1166 Ga0097620_100482975
1167 Ga0097620_100868095
1168 Ga0075435_100825759
1169 Ga0105250_10034365
1170 Ga0105240_12577793
1171 Ga0111539_13441419
1172 Ga0105245_10000924
1173 Ga0105245_10289917
1174 Ga0105245_11098805
1175 Ga0105245_11188133
1176 Ga0105247_10000010
1177 Ga0105247_10000675
1178 Ga0105247_10269445
1179 Ga0114129_10058593
1180 Ga0105243_10000904
1181 Ga0105243_10105482
1182 Ga0105243_11820626
1183 Ga0105241_10142108
1184 Ga0105241_11287570
1185 Ga0105242_10001843
1186 Ga0105242_10062077
1187 Ga0105242_10260006
1188 Ga0105248_10000100
1189 Ga0105248_10011344
1190 Ga0105248_10146125
1191 Ga0105248_10545493
1192 Ga0105248_10746562
1193 Ga0105248_10914993
1194 Ga0105237_10002602
1195 Ga0105237_10287227
1196 Ga0105237_10554641
1197 Ga0105238_10122792
1198 Ga0105238_10465460
1199 Ga0105238_10884457
1200 Ga0105249_10000010
1201 Ga0105249_10002197
1202 Ga0105249_10004083
1203 Ga0105249_10275741
1204 Ga0105249_12084620
1205 Ga0105249_12330840
1206 Ga0105249_13199711
1207 Ga0099796_10505413
1208 Ga0105239_10003573
1209 Ga0105239_10042609
1210 Ga0105239_10281181
1211 Ga0105239_12904839
1212 Ga0105246_10211772
1213 Ga0105246_10698532
1214 Ga0157371_10640503
1215 Ga0157369_10192774
1216 Ga0157374_10198141
1217 Ga0157374_10877200
1218 Ga0157374_12807644
1219 Ga0157378_10004458
1220 Ga0157378_10194165
1221 Ga0157378_11946989
1222 Ga0163162_10162859
1223 Ga0163162_10239542
1224 Ga0163162_10269645
1225 Ga0163162_10711581
1226 Ga0163162_11159900
1227 Ga0163162_11501300
1228 Ga0157372_10003489
1229 Ga0157372_10131602
1230 Ga0157372_10628651
1231 Ga0157372_11268026
1232 Ga0157372_11435460
1233 Ga0157375_10001355
1234 Ga0157375_10039356
1235 Ga0157375_10373964
1236 Ga0157375_11163219
1237 Ga0163163_10004746
1238 Ga0163163_10007386
1239 Ga0163163_10230754
1240 Ga0157380_10001475
1241 Ga0182008_10689498
1242 Ga0182008_10905462
1243 Ga0157377_10066387
1244 Ga0157379_10004218
1245 Ga0157379_10213257
1246 Ga0157379_10524981
1247 Ga0157376_10009099
1248 Ga0157376_10163708
1249 Ga0157376_11313779
1250 Ga0157376_11841668
1251 Ga0163161_10000661
1252 Ga0163161_10042852
1253 Ga0163161_10120592
1254 Ga0163161_10227428
1255 Ga0163161_10315976
1256 Ga0213876_10492791
1257 Ga0209051_1000959
1258 Ga0209051_1000994
1259 Ga0209051_1001901
1260 Ga0209051_1002561
1261 Ga0209051_1009834
1262 Ga0209051_1009902
1263 Ga0209051_1069318
1264 Ga0207696_1036909
1265 Ga0207653_10029517
1266 Ga0207653_10106535
1267 Ga0207692_10035367
1268 Ga0207692_11076506
1269 Ga0207642_10000548
1270 Ga0207642_10037054
1271 Ga0207710_10000028
1272 Ga0207710_10007747
1273 Ga0207710_10033758
1274 Ga0207688_10002154
1275 Ga0207688_10263286
1276 Ga0207680_10011797
1277 Ga0207680_11092185
1278 Ga0207647_10003300
1279 Ga0207647_10150764
1280 Ga0207685_10020823
1281 Ga0207699_10020736
1282 Ga0207645_10003519
1283 Ga0207643_10128503
1284 Ga0207654_10232517
1285 Ga0207707_10131596
1286 Ga0207671_10020623
1287 Ga0207693_10000790
1288 Ga0207693_10003157
1289 Ga0207663_10013025
1290 Ga0207663_10015687
1291 Ga0207660_10193035
1292 Ga0207660_10241644
1293 Ga0207657_10091874
1294 Ga0207657_10166526
1295 Ga0207657_10399115
1296 Ga0207649_10430037
1297 Ga0207652_10017738
1298 Ga0207681_10005564
1299 Ga0207681_10055820
1300 Ga0207681_10165185
1301 Ga0207694_10144701
1302 Ga0207694_10878483
1303 Ga0207694_11156330
1304 Ga0207650_10506881
1305 Ga0207650_11025972
1306 Ga0207659_10085193
1307 Ga0207659_10203202
1308 Ga0207687_10000563
1309 Ga0207687_10099938
1310 Ga0207687_10272671
1311 Ga0207687_11688142
1312 Ga0207700_10711238
1313 Ga0207664_10067863
1314 Ga0207644_10016003
1315 Ga0207644_10055659
1316 Ga0207644_10261169
1317 Ga0207690_10058954
1318 Ga0207690_10276119
1319 Ga0207706_10011263
1320 Ga0207706_10029266
1321 Ga0207706_10284764
1322 Ga0207686_10001957
1323 Ga0207686_10445124
1324 Ga0207709_10004110
1325 Ga0207709_10183995
1326 Ga0207670_10007890
1327 Ga0207669_10000203
1328 Ga0207669_10241808
1329 Ga0207669_10357685
1330 Ga0207669_10644919
1331 Ga0207704_10000241
1332 Ga0207704_10212247
1333 Ga0207704_10245631
1334 Ga0207704_10777363
1335 Ga0207665_10000977
1336 Ga0207665_10026348
1337 Ga0207665_10756474
1338 Ga0207691_10913311
1339 Ga0207691_10929640
1340 Ga0207711_10000081
1341 Ga0207711_10038413
1342 Ga0207711_10179907
1343 Ga0207711_10201432
1344 Ga0207711_10871158
1345 Ga0207689_10048693
1346 Ga0207689_10201240
1347 Ga0207661_11812996
1348 Ga0207679_10904783
1349 Ga0207667_10123624
1350 Ga0207667_11499988
1351 Ga0207651_10649531
1352 Ga0207712_10000016
1353 Ga0207712_10002277
1354 Ga0207712_10011858
1355 Ga0207712_10918212
1356 Ga0207712_11102396
1357 Ga0207668_10000661
1358 Ga0207668_10002798
1359 Ga0207668_10018046
1360 Ga0207668_10114432
1361 Ga0207668_10305027
1362 Ga0207640_10001411
1363 Ga0207640_10039167
1364 Ga0207640_10253619
1365 Ga0207640_11934828
1366 Ga0207658_10002506
1367 Ga0207658_10008105
1368 Ga0207658_10010936
1369 Ga0207658_10077715
1370 Ga0207658_10107154
1371 Ga0207658_10303029
1372 Ga0207658_10832013
1373 Ga0207677_10013226
1374 Ga0207677_10182680
1375 Ga0207703_10004050
1376 Ga0207703_10049725
1377 Ga0207703_10456621
1378 Ga0207639_10008039
1379 Ga0207639_10050594
1380 Ga0207639_10166239
1381 Ga0207639_10764345
1382 Ga0207678_10001369
1383 Ga0207678_10016049
1384 Ga0207678_10045459
1385 Ga0207678_10157864
1386 Ga0207678_10981686
1387 Ga0207708_10003704
1388 Ga0207708_10060379
1389 Ga0207708_10350933
1390 Ga0207708_11355432
1391 Ga0207702_10428741
1392 Ga0207641_10010006
1393 Ga0207641_10010349
1394 Ga0207641_10285390
1395 Ga0207641_10439044
1396 Ga0207648_10004625
1397 Ga0207648_10143895
1398 Ga0207676_10048416
1399 Ga0207676_10104119
1400 Ga0207676_10265870
1401 Ga0207675_100002734
1402 Ga0207675_100028766
1403 Ga0207675_100123732
1404 Ga0207675_100298536
1405 Ga0207675_101860942
1406 Ga0207675_101943174
1407 Ga0207683_10000819
1408 Ga0207683_10029576
1409 Ga0207683_10151233
1410 Ga0207698_10196902
1411 Ga0207698_10535161
1412 Ga0207698_11235272
1413 Ga0209813_10002513
1414 Ga0209813_10284279
1415 Ga0207428_10649456
1416 Ga0268266_10006503
1417 Ga0268266_10035540
1418 Ga0268265_10000056
1419 Ga0268265_10004974
1420 Ga0268264_10000053
1421 Ga0268264_10001190
1422 Ga0268264_10062434
1423 Ga0268264_10207165
1424 Ga0268264_11329339
1425 Ga0268264_11594481
1426 Ga0307408_100785156
1427 Ga0307408_101904976
1428 Ga0307405_10677306
1429 Ga0307405_12020239
1430 Ga0307413_10015328
1431 Ga0307413_10191396
1432 Ga0307413_10876730
1433 Ga0307410_10119989
1434 Ga0307410_10854452
1435 Ga0307410_11169484
1436 Ga0307406_10000005
1437 Ga0307406_10571414
1438 Ga0307407_10021756
1439 Ga0307407_10292985
1440 Ga0307412_10590259
1441 Ga0307412_10717860
1442 Ga0307412_12140744
1443 Ga0307409_100040073
1444 Ga0307409_100057289
1445 Ga0307409_100872455
1446 Ga0307416_100094011
1447 Ga0307411_10096507
1448 Ga0307411_10425873
1449 Ga0307411_11432335
1450 Ga0307415_100034530
1451 Ga0307415_100077491
1452 Ga0307415_102289732
1453 Ga0373930_0043795
1454 Ga0373948_0166948
1455 Ga0373940_0085914
1456 Ga0373949_0059087
1457 Ga0373951_0060232
1458 Ga0373939_0081072
1459 Ga0373941_0226789
1460 Ga0373943_0265007
1461 Ga0373955_0445736
1462 Ga0373931_0016228
1463 Ga0373931_0043700
1464 Ga0373925_0347410
1465 Ga0395900_1292515
1466 Ga0395898_0521676
1467 Ga0395898_1233487
1468 Ga0395901_0960669
1469 Ga0436365_0449045
1470 Ga0439461_0051336
1471 Ga0439466_0025579
1472 Ga0439465_0000575
1473 Ga0439465_0010742
1474 Ga0439465_0010981
1475 Ga0439465_0053851
1476 Ga0451787_725883
1477 Ga0451793_0844392
1478 Ga0451793_1056532
1479 Ga0451793_1363041
1480 Ga0451797_1014546
1481 Ga0451800_0400527
1482 Ga0451806_553759
1483 Ga0451807_0114244
1484 Ga0451841_0717607
1485 Ga0451855_1821113
1486 Ga0451853_0324363
1487 Ga0451853_2774313
1488 Ga0451853_3370168
1489 Ga0439431_0001637
1490 Ga0439442_016336
1491 Ga0439442_089631
1492 Ga0439442_100331
1493 Ga0439445_0004220
1494 Ga0439434_0003618
1495 Ga0439435_0063363
1496 Ga0466972_0018297
1497 Ga0466972_0032471
1498 Ga0466972_0168729
1499 Ga0466972_0208637
1500 Ga0466965_0003871
1501 Ga0466965_0009341
1502 Ga0466965_0052700
1503 Ga0466965_0685488
1504 Ga0466966_0539933
1505 Ga0466961_0356093
1506 Ga0466963_0052225
1507 Ga0466963_0432827
1508 Ga0466964_0380751
1509 Ga0466971_0002164
1510 Ga0466971_0082210
1511 Ga0466968_0005668
1512 Ga0466970_0033140
1513 Ga0466970_0142123
1514 Ga0466970_0251920
1515 Ga0466957_0003478
1516 Ga0466957_0019698
1517 Ga0466957_0217550
1518 Ga0466960_0000012
1519 Ga0466960_0021911
1520 Ga0466960_0024597
1521 Ga0466960_0045623
1522 Ga0466960_0074750
1523 Ga0466960_0124193
1524 Ga0466960_0400898
1525 Ga0466959_0201478
1526 Ga0466967_0006706
1527 Ga0466967_0009125
1528 Ga0466967_0090509
1529 Ga0466967_0191181
1530 Ga0466967_0275030
1531 Ga0466967_1032382
1532 Ga0466967_1350295
1533 Ga0495603_0075271
1534 Ga0495603_0141791
1535 Ga0495603_0476102
1536 Ga0495590_0310163
1537 Ga0495590_0388269
1538 Ga0495629_0012034
1539 Ga0495629_0268330
1540 Ga0495638_0636597
1541 Ga0495641_0019102
1542 Ga0495582_0151824
1543 Ga0495582_0767184
1544 Ga0495605_0430140
1545 Ga0495639_0502027
1546 Ga0495662_0018494
1547 Ga0495594_0504346
1548 Ga0495606_0010051
1549 Ga0495606_0501357
1550 Ga0495630_1164424
1551 Ga0495631_0399890
1552 Ga0495622_0245956
1553 Ga0495667_0526109
1554 Ga0495656_0663310
1555 Ga0495668_0070166
1556 Ga0495668_0191170
1557 Ga0495611_0476205
1558 Ga0495635_0146599
1559 Ga0495635_0185833
1560 Ga0495658_0038830
1561 Ga0495658_0275090
1562 Ga0495658_0678285
1563 Ga0495669_0506951
1564 Ga0495613_0313462
1565 Ga0495624_0138498
1566 Ga0495671_0111066
1567 Ga0495671_0383740
1568 Ga0495600_0658930
1569 Ga0495581_0008541
1570 Ga0495672_0081868
1571 Ga0495672_0117362
1572 Ga0495672_0144275
1573 Ga0495676_0013817
1574 Ga0495673_0005547
1575 Ga0495686_0006416
1576 Ga0495593_0017065
1577 Ga0495614_0481367
1578 Ga0495626_0030123
1579 Ga0496100_0000769
1580 Ga0496100_0006691
1581 Ga0496100_0077172
1582 Ga0496100_0109579
1583 Ga0496100_0576131
1584 Ga0496100_0750578
1585 Ga0496100_1197867
1586 Ga0496101_0000113
1587 Ga0496101_0000688
1588 Ga0496101_0005860
1589 Ga0496101_0017078
1590 Ga0496101_0066003
1591 Ga0496101_0106800
1592 Ga0496101_0312244
1593 Ga0496101_0355607
1594 Ga0496101_0483471
1595 Ga0496101_0581276
1596 Ga0496101_0606684
1597 Ga0496101_1176557
1598 Ga0496102_0000035
1599 Ga0496102_0000480
1600 Ga0496102_0001549
1601 Ga0496102_0004278
1602 Ga0496102_0030367
1603 Ga0496102_0033527
1604 Ga0496102_0355337
1605 Ga0496102_0597921
1606 Ga0496102_1438192
1607 Ga0496103_0000028
1608 Ga0496103_0000969
1609 Ga0496103_0002333
1610 Ga0496103_0023642
1611 Ga0496103_0048256
1612 Ga0496104_0039637
1613 Ga0496104_0303700
1614 Ga0496104_0760970
1615 Ga0496104_0913832
1616 Ga0496105_0023967
1617 Ga0496105_0123846
1618 Ga0496105_0805500
1619 Ga0496106_0003822
1620 Ga0496106_0011087
1621 Ga0496106_0026642
1622 Ga0496106_0173012
1623 Ga0496106_0268590
1624 Ga0496107_0001648
1625 Ga0496107_0106706
1626 Ga0496107_0137644
1627 Ga0496107_0160420
1628 Ga0496107_0209523
1629 Ga0496107_0501726
1630 Ga0496107_0661223
1631 Ga0496108_0000268
1632 Ga0496108_0021471
1633 Ga0496108_0210398
1634 Ga0496108_0396851
1635 Ga0496109_0101967
1636 Ga0496109_0162238
1637 Ga0496109_0418712
1638 Ga0496109_1089122
1639 Ga0496109_1738817
1640 Ga0496110_0092249
1641 Ga0496110_0143219
1642 Ga0496110_0174754
1643 Ga0496110_0317140
1644 Ga0496110_0913186
1645 Ga0496111_0136592
1646 Ga0496111_0283388
1647 Ga0496111_1213491
1648 Ga0496112_0011229
1649 Ga0496112_0021704
1650 Ga0496112_0026063
1651 Ga0496112_0046620
1652 Ga0496112_0093263
1653 Ga0496113_0024715
1654 Ga0496113_0048032
1655 Ga0496113_0507779
1656 Ga0496114_0001266
1657 Ga0496114_0120885
1658 Ga0496114_0259246
1659 Ga0496114_1329721
1660 Ga0496114_1495587
1661 Ga0496115_0002979
1662 Ga0496115_0010273
1663 Ga0496115_1151604
1664 Ga0496116_0000090
1665 Ga0496116_0004318
1666 Ga0496117_0000051
1667 Ga0496117_0000319
1668 Ga0496117_0269644
1669 Ga0496117_0504924
1670 Ga0496118_0000043
1671 Ga0496118_0013375
1672 Ga0496119_0003516
1673 Ga0496119_0016938
1674 Ga0496119_0058589
1675 Ga0496119_0120024
1676 Ga0496120_0002432
1677 Ga0496120_0023398
1678 Ga0496120_0051177
1679 Ga0496120_0463118
1680 Ga0496121_0000080
1681 Ga0496121_0005852
1682 Ga0496121_0018295
1683 Ga0496121_0047583
1684 Ga0496122_0021259
1685 Ga0496123_0007977
1686 Ga0496124_0076974
1687 Ga0496124_0870694
1688 Ga0496125_0040289
1689 Ga0496125_0341136
1690 Ga0496126_0001415
1691 Ga0496126_0006411
1692 Ga0496126_0009171
1693 Ga0496126_0131618
1694 Ga0496126_0611172
1695 Ga0501032_0006987
1696 Ga0501034_0045757
1697 Ga0501034_0074037
1698 Ga0501034_0207775
1699 Ga0501034_0574134
1700 Ga0501036_0008925
1701 Ga0501036_0828690
1702 Ga0501037_0002048
1703 Ga0501038_0061964
1704 Ga0501039_0002873
1705 Ga0501042_0219098
1706 Ga0501043_0005964
1707 Ga0501067_0260517
1708 Ga0501067_0685819
1709 Ga0501068_0059884
1710 Ga0501069_0016692
1711 Ga0501069_0034720
1712 Ga0501070_0000247
1713 Ga0501070_0001225
1714 Ga0501070_0258293
1715 Ga0501070_0458431
1716 Ga0501070_0797926
1717 Ga0501070_0954356
1718 Ga0501071_0064404
1719 Ga0501071_0238546
1720 Ga0501071_0316405
1721 Ga0501071_0717145
1722 Ga0501072_0204809
1723 Ga0501073_0025433
1724 Ga0501073_0772006
1725 Ga0501074_0009004
1726 Ga0501075_0815792
1727 Ga0501077_0067976
1728 Ga0501079_0051135
1729 Ga0501079_0423376
1730 Ga0501080_0190492
1731 Ga0501080_0604972
1732 Ga0501044_0108406
1733 Ga0501044_1429566
1734 Ga0501045_0178066
1735 Ga0501045_1273846
1736 nmdc:mga03683_43812_c1
1737 nmdc:mga03683_9238_c1
1738 nmdc:mga03n38_123299_c2
1739 nmdc:mga03n38_1303_c1
1740 nmdc:mga03n38_14602_c1
1741 nmdc:mga03n38_175451_c1
1742 nmdc:mga03n38_220549_c1
1743 nmdc:mga03n38_2238_c1
1744 nmdc:mga03n38_406594_c1
1745 nmdc:mga03n38_477432_c1
1746 nmdc:mga03n38_7143_c1
1747 nmdc:mga00v17_135200_c1
1748 nmdc:mga00v17_179387_c1
1749 nmdc:mga00v17_266811_c1
1750 nmdc:mga00v17_279285_c1
1751 nmdc:mga00v17_36101_c1
1752 nmdc:mga00v17_84654_c1
1753 nmdc:mga00v17_94300_c1
1754 nmdc:mga00v17_95757_c1
1755 nmdc:mga00v17_973_c1
1756 nmdc:mga0yw44_11000_c1
1757 nmdc:mga0yw44_177119_c1
1758 nmdc:mga0yw44_184712_c1
1759 nmdc:mga0yw44_24877_c1
1760 nmdc:mga0yw44_363209_c1
1761 nmdc:mga0yw44_479126_c1
1762 nmdc:mga0yw44_58128_c1
1763 nmdc:mga0yw44_96665_c1
1764 nmdc:mga0k408_196393_c1
1765 nmdc:mga06z11_215497_c1
1766 nmdc:mga06z11_288841_c1
1767 nmdc:mga06z11_426520_c1
1768 nmdc:mga06z11_506429_c1
1769 nmdc:mga06z11_73113_c1
1770 nmdc:mga04h51_226449_c1
1771 nmdc:mga04h51_472882_c1
1772 nmdc:mga04h51_66635_c1
1773 nmdc:mga07m45_21051_c1
1774 nmdc:mga07m45_32020_c1
1775 nmdc:mga07m45_39116_c1
1776 nmdc:mga07m45_543198_c1
1777 nmdc:mga07m45_65235_c2
1778 nmdc:mga05p37_88411_c1
1779 nmdc:mga0qj67_110491_c1
1780 nmdc:mga06r32_24296_c1
1781 nmdc:mga0rr50_739554_c1
1782 nmdc:mga0sz30_114081_c1
1783 nmdc:mga0sz30_12880_c1
1784 nmdc:mga0sz30_14183_c1
1785 nmdc:mga0sz30_144306_c1
1786 nmdc:mga0sz30_33081_c1
1787 nmdc:mga0sz30_38191_c1
1788 nmdc:mga0sz30_502133_c1
1789 nmdc:mga0sz30_687_c1
1790 nmdc:mga0sz30_89730_c1
1791 Ga0495601_0585266
1792 Ga0500635_0001751
1793 Ga0495655_0004672
1794 Ga0495619_0117856
1795 Ga0495619_0346953
1796 Ga0500643_001231
1797 Ga0500556_0092082
1798 Ga0500562_047863
1799 Ga0500652_036748
1800 Ga0500568_0176013
1801 Ga0500577_0058698
1802 Ga0500604_0012545
1803 Ga0500616_0024369
1804 Ga0500616_0224574
1805 Ga0500616_0270659
1806 Ga0500620_127940
1807 Ga0501084_1341360
1808 Ga0501082_0072934
1809 Ga0501082_0984856
1810 Ga0466962_0046820
1811 Ga0530510_1537205
1812 2738698147
1813 2739327922
1814 2753037804
1815 2753325672
1816 2784473169
1817 2857731717
1818 2858907189
1819 2902796322
1820 2902811218
1821 2902838093
1822 2908813837
1823 2928124378
1824 2939585401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00893

Multi_Drug_Res

Small Multidrug Resistance protein

2

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.857 2 102
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.8494 2 102
7szt-assembly1.cif.gz_A crystal structure of gdx-clo from small multidrug resistance family of transporters in low ph (protonated state) 0.8364 2 101
7ssu-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and methyltriphenylphosphonium 0.8273 2 102
7t00-assembly1.cif.gz_A structure of emre-d3 mutant in complex with monobody l10 and benzyltrimethylammonium 0.8203 2 102
ID Description Score Start End Superfamily
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9584 1 102 1.10.3730.20
af_P69212_3_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9466 2 102 1.10.3730.20
af_P69210_8_109_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9405 1 102 1.10.3730.20
af_P9WGF1_2_106_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9215 1 104 1.10.3730.20
af_P23895_1_110_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.9076 2 103 1.10.3730.20
ID Description Score Start End GO Terms
AF-A0A7I7WHK5-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9798 1 105 GO:0005886
GO:0022857
GO:0046677
AF-A0A839N2D0-F1-model_v4 Small multidrug resistance pump 0.9761 2 105 GO:0005886
GO:0022857
AF-A0A5A7XXH1-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9757 2 107 GO:0005886
GO:0022857
GO:0046677
AF-A0A3D9TN23-F1-model_v4 deleted 0.9749 1 105
AF-A0A259SFV6-F1-model_v4 QacE family quaternary ammonium compound efflux SMR transporter 0.9744 2 104 GO:0005886
GO:0022857

Map