F485878
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 925 | 756 | 361 | 434 |
Family's Representative Sequence
| Representative Sequence | 3300003187|JGI25151J46595_10018794|JGI25151J46595_100187941 |
| Length | 466 |
| Sequence | VRRKNERIGICVKAQDIAKGRGFLXRGIEWLGRMSKKXGIEALSRRAFLASAATVGAGALAXPAFAQSALDGLLNAPKRGNWDDQFDAKAASRTATAVLSNTPILXPQSVPSTQQAIMQYQQIASAGGWPXVNPGDQRLQLGVSSPAVQALRQRLAXTGDLPREAGLSNAFDSYVDGAVKRFQARHGLPADGVLGEFTLKAMNIPADVRLQQLNTNLIRLQTFPEDLGRRHLMVNIPAAYVEAVEDGSVATRHTAVVGRLSRPTHIVNSKVYEVILNPYWTAPRSIVEKDIMPLMRKDPTYLEKNAIRLIDGKGNEVAPETVDWNGEAPNLMFRQDPGKINAMASTKINFYNKNGEYMHDTPQQGLFNKLMRFESSGCVRVQNVRDLSTWLLRETPGWNRQQMEQVIASGTNTPIKLATEVPVYFVYISAWGMPDGVVQFRDDIYEMDGNAELALDTTSGMEQPVQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 13 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 14 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 15 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 16 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 17 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 18 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 19 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 20 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 21 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 22 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 23 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 24 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 25 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 26 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 27 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 28 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 29 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 30 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 33 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 34 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 35 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 36 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 37 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 42 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 43 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 44 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 45 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 46 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 47 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 48 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 49 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 50 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 51 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 52 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 53 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 54 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 55 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 56 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 57 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 58 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 59 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 60 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 61 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 62 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 63 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 64 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 65 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 66 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 67 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 68 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 69 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 70 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 71 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 72 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 73 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 74 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 75 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 76 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 77 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 78 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 79 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 80 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 81 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 82 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 83 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 84 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 85 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 86 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 87 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 88 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 89 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 90 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 91 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 92 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 93 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 94 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 95 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 96 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 97 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 98 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 99 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 100 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 101 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 102 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 103 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 104 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 105 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 106 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 107 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 108 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 109 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 110 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 111 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 112 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 113 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 114 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 115 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 116 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 117 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 118 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 119 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 120 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 121 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 122 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 123 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 124 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 125 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 126 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 127 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 128 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 129 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 130 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 131 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 132 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 133 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 134 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 135 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 136 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 137 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 138 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 139 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 140 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 141 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 142 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 143 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 144 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 145 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 146 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 147 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 148 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 149 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 150 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 151 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 152 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 153 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 154 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 155 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 156 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 157 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 158 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 159 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 160 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 161 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 162 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 163 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 164 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 165 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 166 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 167 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 168 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 169 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 170 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 171 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 172 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 173 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 174 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 175 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 176 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 177 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 178 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 179 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 180 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 181 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 182 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 183 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 184 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 185 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 186 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 187 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 188 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 189 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 190 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 191 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 192 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 193 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 194 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 195 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 196 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 197 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 198 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 199 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 200 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 201 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 202 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 203 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 204 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 205 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 206 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 207 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 208 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 209 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 210 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 211 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 212 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 213 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 214 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 215 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 216 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 217 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 218 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 219 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 220 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 221 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 222 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 223 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 224 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 225 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 226 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 227 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 228 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 229 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 230 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 231 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 232 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 233 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 234 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 235 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 236 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 237 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 238 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 239 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 240 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 241 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 242 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 243 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 244 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 245 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 246 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 247 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 248 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 249 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 250 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 251 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 252 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 253 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 254 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 255 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 256 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 257 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 258 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 259 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 260 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 261 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 262 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 263 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 264 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 265 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 266 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 267 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 268 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 269 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 270 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 271 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 272 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 273 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 274 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 275 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 276 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 277 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 278 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 279 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 280 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 281 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 282 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 283 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 284 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 285 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 286 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 287 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 288 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 289 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 290 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 291 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 292 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 293 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 294 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 295 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 296 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 297 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 298 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 299 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 300 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 301 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 302 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 303 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 304 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 305 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 306 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 307 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 308 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 309 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 310 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 311 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 312 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 313 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 314 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 315 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 316 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 317 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 318 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 319 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 320 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 321 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 322 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 323 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 324 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 325 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 326 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 327 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 328 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 329 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 330 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 331 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 332 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 333 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 334 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 335 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 336 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 337 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 338 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 339 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 340 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 341 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 342 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 343 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 344 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 345 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 346 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 347 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 348 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 349 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 350 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 351 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 352 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 353 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 354 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 355 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 356 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 357 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 358 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 359 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 360 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 361 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 362 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 363 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 364 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 365 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 366 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 367 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 368 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 369 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 370 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 371 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 372 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 373 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 374 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 375 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 376 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 377 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 378 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 379 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 380 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 381 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 382 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 383 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 384 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 385 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 386 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 387 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 388 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 389 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 390 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 391 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 392 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 393 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 394 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 395 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 396 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 397 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 398 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 399 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 400 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 401 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 402 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 403 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 404 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 405 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 406 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 407 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 408 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 409 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 410 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 411 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 412 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 413 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 414 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 415 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 416 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 417 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 418 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 419 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 420 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 421 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 422 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 423 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 424 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 425 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 426 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 427 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 428 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 429 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 430 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 431 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 432 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 433 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 434 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 435 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 436 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 437 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 438 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 439 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 440 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 441 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 442 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 443 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 444 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 445 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 446 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 447 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 448 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 449 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 450 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 451 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 452 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 453 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 454 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 455 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 456 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 457 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 458 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 459 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 460 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 461 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 462 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 463 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 464 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 465 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 466 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 467 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 468 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 469 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 470 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 471 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 472 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 473 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 474 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 475 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 476 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 477 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 478 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 479 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 480 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 481 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 482 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 483 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 484 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 485 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 486 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 487 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 488 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 489 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 490 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 491 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 492 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 493 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 494 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 495 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 496 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 497 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 498 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 499 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 500 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 501 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 502 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 503 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 504 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 505 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 506 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 507 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 508 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 509 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 510 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 511 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 512 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 513 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 514 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 515 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 516 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 517 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 518 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 519 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 520 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 521 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 522 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 523 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 524 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 525 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 526 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 527 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 528 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 529 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 530 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 531 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 532 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 533 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 534 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 535 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 536 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 537 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 538 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 539 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 540 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 541 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 542 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 543 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 544 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 545 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 546 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 547 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 548 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 549 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 550 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 551 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 552 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 553 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 554 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 555 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 556 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 557 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 558 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 559 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 560 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 561 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 562 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 563 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 564 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 565 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 566 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 567 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 568 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 569 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 570 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 571 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 573 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 574 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 576 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 577 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 578 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 579 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 580 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 581 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 582 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 583 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 584 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 585 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 586 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 587 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 588 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 596 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 597 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 599 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 600 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 601 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 602 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 603 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 604 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 605 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 606 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 607 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 608 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 609 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 610 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 611 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 612 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 613 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 614 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 615 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 616 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 617 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 618 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 619 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 620 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 621 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 622 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 623 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 624 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 625 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 649 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 650 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 651 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 652 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 653 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 654 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 655 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 656 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 657 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 658 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 659 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 660 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 661 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 662 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 663 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 664 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 665 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 668 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 669 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 670 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 671 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 672 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 673 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 674 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 675 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 676 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 677 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 678 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 679 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 680 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 681 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 682 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 683 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 684 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 685 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 686 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 687 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 688 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 689 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 690 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 691 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 692 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 693 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 694 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 708 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 709 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 710 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 711 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 712 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 713 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 714 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 715 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 716 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 717 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 718 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 719 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 720 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 721 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 722 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 723 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 724 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 725 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 726 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 727 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 728 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 729 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 730 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 731 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 732 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 733 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 734 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 735 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 736 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 737 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 738 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 739 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 740 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 741 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 742 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 743 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 744 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 745 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 746 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 747 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 748 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 749 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 750 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 751 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 752 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 753 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 754 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 755 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 756 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 36.97 |
| Metatranscriptomes | 2.05 |
| Isolates | 60.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.54 |
| Bulb | 0 |
| Endosphere | 17.73 |
| Nodule | 47.03 |
| Rhizoplane | 1.51 |
| Rhizosphere | 17.51 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000859 | 3300001979 | Bacteria | 13435 |
| 2 | JGI25162J39368_1001356 | 3300002737 | Bacteria | 13528 |
| 3 | JGI25162J39368_1001357 | 3300002737 | Bacteria | 13518 |
| 4 | JGI25158J39367_1000005 | 3300002739 | Bacteria | 65147 |
| 5 | JGI25152J39213_1001277 | 3300002773 | Bacteria | 11349 |
| 6 | JGI25152J39213_1002415 | 3300002773 | Bacteria | 7116 |
| 7 | JGI25159J45721_1000300 | 3300002987 | Bacteria | 23241 |
| 8 | JGI25151J46595_10000108 | 3300003187 | Bacteria | 112874 |
| 9 | JGI25151J46595_10000740 | 3300003187 | Bacteria | 26799 |
| 10 | JGI25151J46595_10008957 | 3300003187 | Bacteria | 4774 |
| 11 | JGI25151J46595_10009785 | 3300003187 | Bacteria | 4514 |
| 12 | JGI25151J46595_10018794 | 3300003187 | Bacteria | 2954 |
| 13 | JGI25165J46597_1001363 | 3300003214 | Bacteria | 13570 |
| 14 | JGI25165J46597_1001367 | 3300003214 | Bacteria | 13524 |
| 15 | JGI25165J46597_1003926 | 3300003214 | Bacteria | 3425 |
| 16 | JGI25153J46596_10008892 | 3300003215 | Bacteria | 4740 |
| 17 | JGI25160J50197_1000008 | 3300003354 | Bacteria | 289163 |
| 18 | JGI25160J50197_1000015 | 3300003354 | Bacteria | 250902 |
| 19 | JGI25160J50197_1005080 | 3300003354 | Bacteria | 5549 |
| 20 | JGI25160J50197_1017721 | 3300003354 | Bacteria | 2245 |
| 21 | JGI25161J50226_1000005 | 3300003374 | Bacteria | 292548 |
| 22 | JGI25161J50226_1000051 | 3300003374 | Bacteria | 110051 |
| 23 | JGI25161J50226_1000866 | 3300003374 | Bacteria | 11173 |
| 24 | JGI25161J50226_1002963 | 3300003374 | Bacteria | 4099 |
| 25 | Ga0055526_1001594 | 3300003771 | Bacteria | 15907 |
| 26 | Ga0055526_1002142 | 3300003771 | Bacteria | 13537 |
| 27 | Ga0055526_1015365 | 3300003771 | Bacteria | 3078 |
| 28 | Ga0055526_1020022 | 3300003771 | Bacteria | 2405 |
| 29 | Ga0055526_1030365 | 3300003771 | Bacteria | 1578 |
| 30 | Ga0055524_1015782 | 3300003775 | Bacteria | 2738 |
| 31 | Ga0055524_1025981 | 3300003775 | Bacteria | 1822 |
| 32 | Ga0055524_1031293 | 3300003775 | Bacteria | 1533 |
| 33 | Ga0055536_1005002 | 3300003781 | Bacteria | 6586 |
| 34 | Ga0055536_1017621 | 3300003781 | Bacteria | 2328 |
| 35 | Ga0055528_1000201 | 3300003790 | Bacteria | 50283 |
| 36 | Ga0055528_1004006 | 3300003790 | Bacteria | 7203 |
| 37 | Ga0055528_1004989 | 3300003790 | Bacteria | 6268 |
| 38 | Ga0055528_1012186 | 3300003790 | Bacteria | 3355 |
| 39 | Ga0055528_1021538 | 3300003790 | Bacteria | 2042 |
| 40 | Ga0055540_1000220 | 3300003792 | Bacteria | 53660 |
| 41 | Ga0055540_1008510 | 3300003792 | Bacteria | 3686 |
| 42 | Ga0055531_10012814 | 3300003794 | Bacteria | 3911 |
| 43 | Ga0055531_10020365 | 3300003794 | Bacteria | 2625 |
| 44 | Ga0058692_1006493 | 3300003856 | Bacteria | 3200 |
| 45 | Ga0058692_1009806 | 3300003856 | Bacteria | 2397 |
| 46 | Ga0055543_1000012 | 3300004625 | Bacteria | 186581 |
| 47 | Ga0055543_1000040 | 3300004625 | Bacteria | 122485 |
| 48 | Ga0055543_1000095 | 3300004625 | Bacteria | 77750 |
| 49 | Ga0055543_1001187 | 3300004625 | Bacteria | 10964 |
| 50 | Ga0065165_1000015 | 3300005262 | Bacteria | 289201 |
| 51 | Ga0065165_1000125 | 3300005262 | Bacteria | 130283 |
| 52 | Ga0065165_1001977 | 3300005262 | Bacteria | 19345 |
| 53 | Ga0065165_1006034 | 3300005262 | Bacteria | 6514 |
| 54 | Ga0065165_1017601 | 3300005262 | Bacteria | 2625 |
| 55 | Ga0070670_100010163 | 3300005331 | Bacteria | 8033 |
| 56 | Ga0070680_100092444 | 3300005336 | Bacteria | 2505 |
| 57 | Ga0070671_100036859 | 3300005355 | Bacteria | 4054 |
| 58 | Ga0070663_100048374 | 3300005455 | Bacteria | 3015 |
| 59 | Ga0070665_100010302 | 3300005548 | Bacteria | 9458 |
| 60 | Ga0068854_100006296 | 3300005578 | Bacteria | 7549 |
| 61 | Ga0068851_10011772 | 3300005834 | Bacteria | 4109 |
| 62 | Ga0081540_1028478 | 3300005983 | Bacteria | 3137 |
| 63 | Ga0075365_10043035 | 3300006038 | Bacteria | 2955 |
| 64 | Ga0075368_10000164 | 3300006042 | Bacteria | 17808 |
| 65 | Ga0075363_100028399 | 3300006048 | Bacteria | 2877 |
| 66 | Ga0075364_10006846 | 3300006051 | Bacteria | 6727 |
| 67 | Ga0075362_10006737 | 3300006177 | Bacteria | 4294 |
| 68 | Ga0075362_10068087 | 3300006177 | Bacteria | 1621 |
| 69 | Ga0075367_10000115 | 3300006178 | Bacteria | 23047 |
| 70 | Ga0075367_10018367 | 3300006178 | Bacteria | 3857 |
| 71 | Ga0075369_10023993 | 3300006186 | Bacteria | 2525 |
| 72 | Ga0075366_10008640 | 3300006195 | Bacteria | 5672 |
| 73 | Ga0075370_10007254 | 3300006353 | Bacteria | 5640 |
| 74 | Ga0075370_10009466 | 3300006353 | Bacteria | 5061 |
| 75 | Ga0079104_1000032 | 3300006946 | Bacteria | 203094 |
| 76 | Ga0079104_1003789 | 3300006946 | Bacteria | 6802 |
| 77 | Ga0079104_1009326 | 3300006946 | Bacteria | 3334 |
| 78 | Ga0099826_10000755 | 3300006948 | Bacteria | 17058 |
| 79 | Ga0105251_10008368 | 3300009011 | Bacteria | 6236 |
| 80 | Ga0105240_10000032 | 3300009093 | Bacteria | 283907 |
| 81 | Ga0105237_10003863 | 3300009545 | Bacteria | 17606 |
| 82 | Ga0123341_1000023 | 3300009765 | Bacteria | 75951 |
| 83 | Ga0123342_1032728 | 3300009766 | Bacteria | 2415 |
| 84 | Ga0105239_10016875 | 3300010375 | Bacteria | 8069 |
| 85 | Ga0157373_10003799 | 3300013100 | Bacteria | 11419 |
| 86 | Ga0157373_10011220 | 3300013100 | Bacteria | 6594 |
| 87 | Ga0157371_10000073 | 3300013102 | Bacteria | 163215 |
| 88 | Ga0157370_10011277 | 3300013104 | Bacteria | 9370 |
| 89 | Ga0157370_10018931 | 3300013104 | Bacteria | 6923 |
| 90 | Ga0157369_10018928 | 3300013105 | Bacteria | 7715 |
| 91 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 92 | Ga0182007_10002192 | 3300015262 | Bacteria | 9917 |
| 93 | Ga0182005_1009926 | 3300015265 | Bacteria | 2751 |
| 94 | Ga0183363_1284 | 3300015690 | Bacteria | 7435 |
| 95 | Ga0214544_1000017 | 3300021320 | Bacteria | 193638 |
| 96 | Ga0214542_1000006 | 3300021321 | Bacteria | 345164 |
| 97 | Ga0214543_1000003 | 3300021327 | Bacteria | 692327 |
| 98 | Ga0214543_1000014 | 3300021327 | Bacteria | 324986 |
| 99 | Ga0228711_1001210 | 3300022739 | Bacteria | 37182 |
| 100 | Ga0228710_1002040 | 3300022740 | Bacteria | 31310 |
| 101 | Ga0209436_100032 | 3300025208 | Bacteria | 80755 |
| 102 | Ga0209436_101743 | 3300025208 | Bacteria | 7151 |
| 103 | Ga0209437_100033 | 3300025233 | Bacteria | 512520 |
| 104 | Ga0209437_100075 | 3300025233 | Bacteria | 297202 |
| 105 | Ga0207425_1000031 | 3300025245 | Bacteria | 261181 |
| 106 | Ga0207425_1002001 | 3300025245 | Bacteria | 7612 |
| 107 | Ga0209677_100251 | 3300025253 | Bacteria | 36562 |
| 108 | Ga0209129_1000053 | 3300025258 | Bacteria | 262823 |
| 109 | Ga0209129_1000137 | 3300025258 | Bacteria | 123213 |
| 110 | Ga0209129_1000321 | 3300025258 | Bacteria | 42440 |
| 111 | Ga0209129_1000634 | 3300025258 | Bacteria | 23492 |
| 112 | Ga0209129_1008793 | 3300025258 | Bacteria | 2756 |
| 113 | Ga0209233_1000064 | 3300025261 | Bacteria | 392156 |
| 114 | Ga0209233_1000223 | 3300025261 | Bacteria | 103765 |
| 115 | Ga0209233_1000301 | 3300025261 | Bacteria | 59293 |
| 116 | Ga0209673_1000041 | 3300025273 | Bacteria | 307397 |
| 117 | Ga0209673_1000319 | 3300025273 | Bacteria | 88129 |
| 118 | Ga0209673_1000692 | 3300025273 | Bacteria | 48181 |
| 119 | Ga0209673_1002263 | 3300025273 | Bacteria | 13859 |
| 120 | Ga0209673_1003422 | 3300025273 | Bacteria | 9386 |
| 121 | Ga0209673_1009437 | 3300025273 | Bacteria | 4225 |
| 122 | Ga0209673_1022909 | 3300025273 | Bacteria | 2140 |
| 123 | Ga0209130_1000006 | 3300025284 | Bacteria | 596528 |
| 124 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 125 | Ga0209130_1000018 | 3300025284 | Bacteria | 388301 |
| 126 | Ga0209676_1008408 | 3300025292 | Bacteria | 4607 |
| 127 | Ga0209676_1008917 | 3300025292 | Bacteria | 4405 |
| 128 | Ga0209025_1000087 | 3300025294 | Bacteria | 261181 |
| 129 | Ga0209025_1000149 | 3300025294 | Bacteria | 173393 |
| 130 | Ga0209025_1000195 | 3300025294 | Bacteria | 148218 |
| 131 | Ga0209025_1000199 | 3300025294 | Bacteria | 146058 |
| 132 | Ga0209025_1001254 | 3300025294 | Bacteria | 35128 |
| 133 | Ga0209025_1002107 | 3300025294 | Bacteria | 22461 |
| 134 | Ga0209025_1014170 | 3300025294 | Bacteria | 4935 |
| 135 | Ga0209025_1020309 | 3300025294 | Bacteria | 3640 |
| 136 | Ga0209564_1000330 | 3300025295 | Bacteria | 92033 |
| 137 | Ga0209564_1000431 | 3300025295 | Bacteria | 72866 |
| 138 | Ga0209564_1003222 | 3300025295 | Bacteria | 11442 |
| 139 | Ga0209564_1011696 | 3300025295 | Bacteria | 3905 |
| 140 | Ga0209564_1019798 | 3300025295 | Bacteria | 2497 |
| 141 | Ga0209758_1000081 | 3300025297 | Bacteria | 261181 |
| 142 | Ga0209758_1000333 | 3300025297 | Bacteria | 88318 |
| 143 | Ga0209758_1000939 | 3300025297 | Bacteria | 39327 |
| 144 | Ga0209758_1001529 | 3300025297 | Bacteria | 26686 |
| 145 | Ga0209758_1002147 | 3300025297 | Bacteria | 20766 |
| 146 | Ga0209758_1002928 | 3300025297 | Bacteria | 16440 |
| 147 | Ga0209758_1003165 | 3300025297 | Bacteria | 15463 |
| 148 | Ga0209758_1003784 | 3300025297 | Bacteria | 13337 |
| 149 | Ga0209758_1028214 | 3300025297 | Bacteria | 2380 |
| 150 | Ga0209050_1012960 | 3300025298 | Bacteria | 3766 |
| 151 | Ga0209050_1014207 | 3300025298 | Bacteria | 3455 |
| 152 | Ga0209050_1025576 | 3300025298 | Bacteria | 2001 |
| 153 | Ga0209256_1000445 | 3300025299 | Bacteria | 63065 |
| 154 | Ga0209256_1001312 | 3300025299 | Bacteria | 26677 |
| 155 | Ga0209256_1001741 | 3300025299 | Bacteria | 20794 |
| 156 | Ga0209256_1004309 | 3300025299 | Bacteria | 9057 |
| 157 | Ga0209256_1006324 | 3300025299 | Bacteria | 6335 |
| 158 | Ga0209256_1014745 | 3300025299 | Bacteria | 2785 |
| 159 | Ga0207426_1000044 | 3300025302 | Bacteria | 428043 |
| 160 | Ga0207426_1000064 | 3300025302 | Bacteria | 358276 |
| 161 | Ga0207426_1000106 | 3300025302 | Bacteria | 244368 |
| 162 | Ga0207426_1000119 | 3300025302 | Bacteria | 221800 |
| 163 | Ga0207426_1001890 | 3300025302 | Bacteria | 15244 |
| 164 | Ga0209051_1000198 | 3300025303 | Bacteria | 106688 |
| 165 | Ga0209051_1002491 | 3300025303 | Bacteria | 13134 |
| 166 | Ga0209051_1013451 | 3300025303 | Bacteria | 3894 |
| 167 | Ga0209051_1019543 | 3300025303 | Bacteria | 2950 |
| 168 | Ga0209051_1034191 | 3300025303 | Bacteria | 1909 |
| 169 | Ga0209257_1001197 | 3300025304 | Bacteria | 32625 |
| 170 | Ga0209257_1005140 | 3300025304 | Bacteria | 9458 |
| 171 | Ga0209257_1009252 | 3300025304 | Bacteria | 5333 |
| 172 | Ga0209257_1014608 | 3300025304 | Bacteria | 3356 |
| 173 | Ga0207656_10018254 | 3300025321 | Bacteria | 2759 |
| 174 | Ga0207695_10000024 | 3300025913 | Bacteria | 632311 |
| 175 | Ga0207671_10001945 | 3300025914 | Bacteria | 22801 |
| 176 | Ga0207650_10008087 | 3300025925 | Bacteria | 7167 |
| 177 | Ga0207644_10022671 | 3300025931 | Bacteria | 4292 |
| 178 | Ga0207640_10004491 | 3300025981 | Bacteria | 7568 |
| 179 | Ga0207678_10040213 | 3300026067 | Bacteria | 4056 |
| 180 | Ga0207674_10057991 | 3300026116 | Bacteria | 3924 |
| 181 | Ga0209281_1000053 | 3300027111 | Bacteria | 309587 |
| 182 | Ga0209281_1000236 | 3300027111 | Bacteria | 113362 |
| 183 | Ga0209281_1000666 | 3300027111 | Bacteria | 36327 |
| 184 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 185 | Ga0209371_1004441 | 3300027312 | Bacteria | 6102 |
| 186 | Ga0209282_1000022 | 3300027666 | Bacteria | 173388 |
| 187 | Ga0209282_1000629 | 3300027666 | Bacteria | 17376 |
| 188 | Ga0268266_10020181 | 3300028379 | Bacteria | 5680 |
| 189 | Ga0307515_10000070 | 3300028794 | Bacteria | 239322 |
| 190 | Ga0307515_10104945 | 3300028794 | Bacteria | 3370 |
| 191 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 192 | Ga0307513_10003448 | 3300031456 | Bacteria | 21410 |
| 193 | Ga0307513_10177146 | 3300031456 | Bacteria | 2001 |
| 194 | Ga0307408_100137524 | 3300031548 | Bacteria | 1913 |
| 195 | Ga0307405_10033273 | 3300031731 | Bacteria | 3056 |
| 196 | Ga0307406_10019555 | 3300031901 | Bacteria | 3976 |
| 197 | Ga0307412_10002955 | 3300031911 | Bacteria | 9439 |
| 198 | Ga0307412_10110762 | 3300031911 | Bacteria | 1960 |
| 199 | Ga0315914_1000027 | 3300031967 | Bacteria | 106536 |
| 200 | Ga0307414_10065695 | 3300032004 | Bacteria | 2589 |
| 201 | Ga0307510_10114431 | 3300033180 | Bacteria | 2427 |
| 202 | Ga0315913_1000631 | 3300033430 | Bacteria | 33112 |
| 203 | Ga0315915_1000001 | 3300033464 | Bacteria | 481518 |
| 204 | Ga0373927_0000284 | 3300035695 | Bacteria | 39864 |
| 205 | Ga0395900_0063036 | 3300037418 | Bacteria | 3811 |
| 206 | Ga0395905_0000995 | 3300037471 | Bacteria | 36267 |
| 207 | Ga0395905_0036280 | 3300037471 | Bacteria | 4630 |
| 208 | Ga0439436_0017314 | 3300041404 | Bacteria | 2157 |
| 209 | Ga0439438_020294 | 3300041405 | Bacteria | 1866 |
| 210 | Ga0439465_0013547 | 3300041413 | Bacteria | 2540 |
| 211 | Ga0451833_1157444 | 3300041491 | Bacteria | 2654 |
| 212 | Ga0451835_0255854 | 3300041492 | Bacteria | 2012 |
| 213 | Ga0451839_1057034 | 3300041496 | Bacteria | 2091 |
| 214 | Ga0451846_69005 | 3300041502 | Bacteria | 1664 |
| 215 | Ga0451851_0207243 | 3300041507 | Bacteria | 2627 |
| 216 | Ga0451853_1390978 | 3300041512 | Bacteria | 3245 |
| 217 | Ga0450906_010224 | 3300042145 | Bacteria | 1778 |
| 218 | Ga0495592_0037212 | 3300046454 | Bacteria | 3664 |
| 219 | Ga0495638_0002549 | 3300046460 | Bacteria | 14778 |
| 220 | Ga0495638_0007747 | 3300046460 | Bacteria | 7670 |
| 221 | Ga0495638_0122082 | 3300046460 | Bacteria | 1538 |
| 222 | Ga0495650_0048934 | 3300046471 | Bacteria | 1758 |
| 223 | Ga0495585_0041032 | 3300046492 | Bacteria | 2596 |
| 224 | Ga0495583_0036641 | 3300046506 | Bacteria | 2331 |
| 225 | Ga0495606_0061695 | 3300046507 | Bacteria | 2396 |
| 226 | Ga0495616_0085046 | 3300046513 | Bacteria | 1507 |
| 227 | Ga0495631_0005743 | 3300046518 | Bacteria | 6474 |
| 228 | Ga0495643_0002708 | 3300046522 | Bacteria | 13646 |
| 229 | Ga0495643_0044882 | 3300046522 | Bacteria | 2400 |
| 230 | Ga0495643_0063585 | 3300046522 | Bacteria | 1951 |
| 231 | Ga0495654_0006131 | 3300046530 | Bacteria | 6882 |
| 232 | Ga0495597_0036349 | 3300046542 | Bacteria | 2218 |
| 233 | Ga0495622_0035575 | 3300046557 | Bacteria | 2322 |
| 234 | Ga0495633_0016142 | 3300046558 | Bacteria | 3859 |
| 235 | Ga0495633_0069864 | 3300046558 | Bacteria | 1639 |
| 236 | Ga0495634_0097732 | 3300046642 | Bacteria | 1900 |
| 237 | Ga0495611_0008016 | 3300046648 | Bacteria | 4486 |
| 238 | Ga0495625_0004700 | 3300046660 | Bacteria | 12790 |
| 239 | Ga0495588_0009893 | 3300046674 | Bacteria | 4421 |
| 240 | Ga0495657_0043660 | 3300046675 | Bacteria | 3055 |
| 241 | Ga0495670_0035678 | 3300046691 | Bacteria | 2478 |
| 242 | Ga0495600_0039695 | 3300046809 | Bacteria | 3065 |
| 243 | Ga0495604_0160267 | 3300047317 | Bacteria | 1590 |
| 244 | Ga0495681_0070005 | 3300047470 | Bacteria | 1592 |
| 245 | Ga0495686_0005635 | 3300047472 | Bacteria | 9816 |
| 246 | Ga0495686_0013717 | 3300047472 | Bacteria | 5615 |
| 247 | Ga0496104_0160056 | 3300048907 | Bacteria | 2160 |
| 248 | Ga0496106_0021882 | 3300048909 | Bacteria | 4749 |
| 249 | Ga0496110_0157486 | 3300048913 | Bacteria | 2058 |
| 250 | Ga0496111_0000394 | 3300048914 | Bacteria | 21881 |
| 251 | Ga0496113_0095501 | 3300048916 | Bacteria | 2298 |
| 252 | Ga0496116_0000135 | 3300048919 | Bacteria | 153165 |
| 253 | Ga0496116_0018203 | 3300048919 | Bacteria | 5425 |
| 254 | Ga0496116_0041620 | 3300048919 | Bacteria | 3150 |
| 255 | Ga0496116_0067013 | 3300048919 | Bacteria | 2294 |
| 256 | Ga0496117_0000002 | 3300048920 | Bacteria | 2483758 |
| 257 | Ga0496117_0001755 | 3300048920 | Bacteria | 29822 |
| 258 | Ga0496117_0046873 | 3300048920 | Bacteria | 3105 |
| 259 | Ga0496117_0048790 | 3300048920 | Bacteria | 3019 |
| 260 | Ga0496117_0060692 | 3300048920 | Bacteria | 2604 |
| 261 | Ga0496118_0000245 | 3300048921 | Bacteria | 96235 |
| 262 | Ga0496118_0002030 | 3300048921 | Bacteria | 28629 |
| 263 | Ga0496118_0064988 | 3300048921 | Bacteria | 2673 |
| 264 | Ga0496119_0091324 | 3300048922 | Bacteria | 1729 |
| 265 | Ga0496120_0002647 | 3300048923 | Bacteria | 17677 |
| 266 | Ga0496120_0066655 | 3300048923 | Bacteria | 1990 |
| 267 | Ga0496121_0000001 | 3300048924 | Bacteria | 1830318 |
| 268 | Ga0496121_0001362 | 3300048924 | Bacteria | 41630 |
| 269 | Ga0496121_0006201 | 3300048924 | Bacteria | 14983 |
| 270 | Ga0496121_0015347 | 3300048924 | Bacteria | 8035 |
| 271 | Ga0496121_0028847 | 3300048924 | Bacteria | 5154 |
| 272 | Ga0496121_0112936 | 3300048924 | Bacteria | 2068 |
| 273 | Ga0496121_0116653 | 3300048924 | Bacteria | 2024 |
| 274 | Ga0496122_0000001 | 3300048925 | Bacteria | 1827766 |
| 275 | Ga0496122_0000160 | 3300048925 | Bacteria | 159236 |
| 276 | Ga0496122_0001107 | 3300048925 | Bacteria | 46550 |
| 277 | Ga0496122_0007014 | 3300048925 | Bacteria | 12670 |
| 278 | Ga0496122_0099289 | 3300048925 | Bacteria | 1952 |
| 279 | Ga0496123_0000001 | 3300048926 | Bacteria | 1831497 |
| 280 | Ga0496123_0000034 | 3300048926 | Bacteria | 274836 |
| 281 | Ga0496123_0000562 | 3300048926 | Bacteria | 63590 |
| 282 | Ga0496123_0037857 | 3300048926 | Bacteria | 3400 |
| 283 | Ga0496123_0077534 | 3300048926 | Bacteria | 2040 |
| 284 | Ga0496123_0088665 | 3300048926 | Bacteria | 1846 |
| 285 | Ga0496124_0001469 | 3300048927 | Bacteria | 34707 |
| 286 | Ga0496124_0066650 | 3300048927 | Bacteria | 2997 |
| 287 | Ga0496124_0097690 | 3300048927 | Bacteria | 2384 |
| 288 | Ga0496124_0097841 | 3300048927 | Bacteria | 2382 |
| 289 | Ga0496124_0108584 | 3300048927 | Bacteria | 2237 |
| 290 | Ga0496125_0000001 | 3300048928 | Bacteria | 1766138 |
| 291 | Ga0496125_0001370 | 3300048928 | Bacteria | 35861 |
| 292 | Ga0496125_0060693 | 3300048928 | Bacteria | 3037 |
| 293 | Ga0496125_0130362 | 3300048928 | Bacteria | 1771 |
| 294 | Ga0496126_0004454 | 3300048929 | Bacteria | 16733 |
| 295 | Ga0496126_0006054 | 3300048929 | Bacteria | 13575 |
| 296 | Ga0496126_0226794 | 3300048929 | Bacteria | 1567 |
| 297 | Ga0495678_016910 | 3300049459 | Bacteria | 3319 |
| 298 | Ga0501032_0008794 | 3300049569 | Bacteria | 7347 |
| 299 | Ga0501032_0046225 | 3300049569 | Bacteria | 2942 |
| 300 | Ga0501033_0064692 | 3300049570 | Bacteria | 2691 |
| 301 | Ga0501037_0020278 | 3300049573 | Bacteria | 4908 |
| 302 | Ga0501037_0047976 | 3300049573 | Bacteria | 3130 |
| 303 | Ga0501043_0028608 | 3300049579 | Bacteria | 4374 |
| 304 | Ga0501046_0158451 | 3300049580 | Bacteria | 1704 |
| 305 | Ga0501048_0068593 | 3300049582 | Bacteria | 2505 |
| 306 | Ga0501048_0171987 | 3300049582 | Bacteria | 1535 |
| 307 | Ga0501080_0058668 | 3300049742 | Bacteria | 3582 |
| 308 | Ga0501083_0038328 | 3300049744 | Bacteria | 3259 |
| 309 | Ga0501035_0004000 | 3300049822 | Bacteria | 14065 |
| 310 | Ga0501035_0255515 | 3300049822 | Bacteria | 1487 |
| 311 | Ga0501044_0189764 | 3300049823 | Bacteria | 2018 |
| 312 | Ga0501044_0219805 | 3300049823 | Bacteria | 1851 |
| 313 | Ga0501044_0448324 | 3300049823 | Bacteria | 1197 |
| 314 | nmdc:mga03683_28255_c1 | 3300050489 | Bacteria | 2229 |
| 315 | nmdc:mga00v17_115_c2 | 3300050491 | Bacteria | 47780 |
| 316 | nmdc:mga00v17_13609_c1 | 3300050491 | Bacteria | 4521 |
| 317 | nmdc:mga00v17_47527_c1 | 3300050491 | Bacteria | 2600 |
| 318 | nmdc:mga0yw44_38638_c1 | 3300050492 | Bacteria | 2826 |
| 319 | nmdc:mga0yw44_577_c1 | 3300050492 | Bacteria | 13274 |
| 320 | nmdc:mga0yw44_7594_c1 | 3300050492 | Bacteria | 5347 |
| 321 | nmdc:mga04h51_596_c1 | 3300050495 | Bacteria | 8626 |
| 322 | nmdc:mga07m45_70741_c1 | 3300050496 | Bacteria | 1985 |
| 323 | nmdc:mga0sz30_27105_c1 | 3300050516 | Bacteria | 2352 |
| 324 | nmdc:mga0sz30_5572_c1 | 3300050516 | Bacteria | 4626 |
| 325 | Ga0495601_0031221 | 3300053077 | Bacteria | 3311 |
| 326 | Ga0500651_0056460 | 3300053093 | Bacteria | 2458 |
| 327 | Ga0500560_017969 | 3300053107 | Bacteria | 1963 |
| 328 | Ga0500569_006799 | 3300053109 | Bacteria | 2531 |
| 329 | Ga0500569_008217 | 3300053109 | Bacteria | 2378 |
| 330 | Ga0500572_003175 | 3300053111 | Bacteria | 3804 |
| 331 | Ga0500608_026032 | 3300053122 | Bacteria | 2744 |
| 332 | Ga0500618_000652 | 3300053125 | Bacteria | 20638 |
| 333 | Ga0500618_007330 | 3300053125 | Bacteria | 3155 |
| 334 | Ga0500618_009060 | 3300053125 | Bacteria | 2738 |
| 335 | Ga0500573_0003932 | 3300053140 | Bacteria | 7765 |
| 336 | Ga0500573_0052088 | 3300053140 | Bacteria | 2353 |
| 337 | Ga0500590_029414 | 3300053148 | Bacteria | 2850 |
| 338 | Ga0500616_0000744 | 3300053153 | Bacteria | 37551 |
| 339 | Ga0500616_0002152 | 3300053153 | Bacteria | 17051 |
| 340 | Ga0500622_0001081 | 3300053156 | Bacteria | 22678 |
| 341 | Ga0500622_0004478 | 3300053156 | Bacteria | 8759 |
| 342 | Ga0500633_0007646 | 3300053160 | Bacteria | 2735 |
| 343 | Ga0500636_0000021 | 3300053177 | Bacteria | 96861 |
| 344 | Ga0587066_002988 | 3300059490 | Bacteria | 1937 |
| 345 | Ga0587073_0006446 | 3300059492 | Bacteria | 1805 |
| 346 | Ga0587073_0009416 | 3300059492 | Bacteria | 1614 |
| 347 | Ga0587077_005137 | 3300059493 | Bacteria | 1770 |
| 348 | Ga0587077_009436 | 3300059493 | Bacteria | 1481 |
| 349 | Ga0587088_000928 | 3300059508 | Bacteria | 2791 |
| 350 | Ga0587088_003695 | 3300059508 | Bacteria | 1878 |
| 351 | Ga0587088_005028 | 3300059508 | Bacteria | 1715 |
| 352 | Ga0587090_000172 | 3300059510 | Bacteria | 4482 |
| 353 | Ga0587091_004100 | 3300059511 | Bacteria | 1887 |
| 354 | Ga0587099_001605 | 3300059622 | Bacteria | 1651 |
| 355 | Ga0587101_005696 | 3300059623 | Bacteria | 1394 |
| 356 | Ga0587128_002159 | 3300059630 | Bacteria | 2006 |
| 357 | Ga0587068_001007 | 3300059641 | Bacteria | 2967 |
| 358 | Ga0587072_000630 | 3300059643 | Bacteria | 3744 |
| 359 | Ga0587072_011635 | 3300059643 | Bacteria | 1442 |
| 360 | Ga0587079_005998 | 3300059647 | Bacteria | 1750 |
| 361 | Ga0587107_004199 | 3300059652 | Bacteria | 1449 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6tci-assembly1.cif.gz_A | the crystal structure of sleb n-terminal domain | 0.9264 | 94 | 161 |
| 5tv7-assembly2.cif.gz_B | 2.05 angstrom resolution crystal structure of peptidoglycan-binding protein from clostridioides difficile in complex with glutamine hydroxamate. | 0.9143 | 96 | 162 |
| 7ajx-assembly1.cif.gz_A | the x-ray structure of l,d-transpeptidase ldta from vibrio cholerae in complex with meropenem | 0.8374 | 69 | 415 |
| 6tci-assembly1.cif.gz_A | the crystal structure of sleb n-terminal domain | 0.8318 | 94 | 161 |
| 7kgm-assembly1.cif.gz_A | c. rodentium ycbb - ertapenem complex | 0.7908 | 41 | 415 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I1N5Y3_46_297_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9744 | 98 | 159 | 3.40.390.10 |
| af_Q94LQ4_46_318_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9414 | 100 | 160 | 3.40.390.10 |
| af_K7K641_72_302_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9239 | 100 | 157 | 3.40.390.10 |
| af_I1KXL7_50_332_3.40.390.10 | Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) | 0.9134 | 99 | 161 | 3.40.390.10 |
| af_L7N653_5_90_1.10.101.10 | Mainly Alpha;Orthogonal Bundle;Muramoyl-pentapeptide Carboxypeptidase; domain 1;PGBD-like superfamily/PGBD | 0.9055 | 95 | 161 | 1.10.101.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E2K1D8-F1-model_v4 | Uncharacterized protein | 0.953 | 68 | 218 |
|
| AF-A0A6I6GMM5-F1-model_v4 | L,D-transpeptidase family protein | 0.8933 | 67 | 414 |
GO:0008360
GO:0009252 GO:0016740 GO:0071555 |
| AF-A0A4Q5YAF8-F1-model_v4 | deleted | 0.8921 | 98 | 408 |
|
| AF-A0A3C0IN50-F1-model_v4 | Murein L,D-transpeptidase | 0.8898 | 72 | 409 |
GO:0008360
GO:0009252 GO:0016740 GO:0071555 |
| AF-A0A1M3G157-F1-model_v4 | L,D-TPase catalytic domain-containing protein | 0.8878 | 67 | 415 |
GO:0008360
GO:0009252 GO:0016740 GO:0071555 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar