F485871

General Info

Members Datasets Scaffolds Average Seq Length
924 520 594 105

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_080695|Ga0500643_080695_116_469
Length 117
Sequence MVAGDIRGVLPRSAIGYVTRDGEGFKGQLRTLSIRAPIEIVPNRRKAGDNHPDFRVNSEGVEVGAGWTRVGETSGKEYVSLSIAAPEFGPRRIYANLGRAAGQDDDDAFAIIWNPVD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
6 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
7 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
8 2512875024 Mesorhizobium loti R88b Isolate Nodule
9 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
10 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
11 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
12 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
13 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
14 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
15 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
16 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
17 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
18 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
19 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
20 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
21 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
22 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
23 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
24 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
25 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
26 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
27 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
28 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
29 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
30 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
31 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
32 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
33 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
34 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
35 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
36 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
37 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
38 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
39 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
40 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
41 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
42 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
43 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
44 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
45 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
46 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
47 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
48 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
49 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
50 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
51 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
52 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
53 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
54 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
55 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
56 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
57 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
58 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
59 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
60 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
61 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
62 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
63 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
64 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
65 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
66 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
67 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
68 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
69 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
70 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
71 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
72 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
73 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
74 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
75 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
76 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
77 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
78 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
79 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
80 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
81 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
82 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
83 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
84 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
85 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
86 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
87 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
88 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
89 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
90 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
91 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
92 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
93 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
94 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
95 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
96 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
97 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
98 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
99 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
100 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
101 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
102 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
103 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
104 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
105 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
106 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
107 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
108 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
109 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
110 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
111 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
112 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
113 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
114 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
115 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
116 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
117 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
118 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
119 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
120 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
121 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
122 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
123 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
124 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
125 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
126 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
127 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
128 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
129 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
130 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
131 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
132 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
133 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
134 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
135 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
136 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
137 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
138 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
139 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
140 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
141 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
142 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
143 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
144 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
145 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
146 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
147 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
148 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
149 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
150 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
151 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
152 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
153 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
154 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
155 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
156 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
157 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
158 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
159 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
160 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
161 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
162 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
163 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
164 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
165 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
166 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
167 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
168 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
169 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
170 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
171 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
172 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
173 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
174 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
175 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
176 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
177 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
178 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
179 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
180 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
181 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
182 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
183 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
184 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
185 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
186 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
187 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
188 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
189 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
190 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
191 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
192 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
193 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
194 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
195 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
196 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
197 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
198 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
199 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
200 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
201 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
202 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
203 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
204 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
205 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
206 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
207 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
208 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
209 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
210 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
211 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
212 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
213 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
214 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
215 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
216 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
217 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
218 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
219 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
220 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
221 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
222 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
223 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
224 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
225 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
226 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
227 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
228 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
229 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
230 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
231 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
232 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
233 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
234 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
235 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
236 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
237 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
238 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
239 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
240 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
241 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
242 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
243 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
244 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
245 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
246 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
247 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
248 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
249 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
250 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
251 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
252 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
253 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
254 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
255 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
256 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
257 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
258 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
259 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
260 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
261 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
262 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
263 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
264 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
265 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
266 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
267 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
268 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
269 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
270 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
271 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
272 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
273 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
274 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
275 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
276 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
277 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
278 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
279 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
280 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
281 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
282 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
283 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
284 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
285 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
286 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
287 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
288 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
289 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
290 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
291 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
292 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
293 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
294 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
295 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
296 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
297 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
298 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
299 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
300 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
301 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
302 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
303 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
304 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
305 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
306 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
307 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
308 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
309 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
310 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
311 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
312 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
313 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
314 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
315 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
316 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
317 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
318 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
319 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
320 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
321 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
322 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
323 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
324 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
325 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
326 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
327 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
328 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
329 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
330 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
331 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
332 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
333 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
334 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
335 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
336 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
337 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
338 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
339 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
340 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
341 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
342 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
343 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
344 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
345 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
346 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
347 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
348 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
349 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
350 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
351 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
352 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
353 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
354 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
355 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
356 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
358 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
359 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
360 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
361 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
362 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
363 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
364 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
409 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
410 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
411 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
412 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
414 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
416 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
417 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
418 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
419 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
420 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
421 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
422 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
423 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
424 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
425 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
426 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
427 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
428 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
429 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
430 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
431 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
432 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
433 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
434 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
435 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
436 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
437 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
438 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
439 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
440 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
441 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
442 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
443 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
444 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
445 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
446 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
447 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
448 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
449 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
450 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
451 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
452 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
453 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
454 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
455 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
456 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
457 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
458 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
459 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
460 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
461 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
462 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
463 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
464 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
465 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
466 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
467 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
468 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
469 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
471 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
472 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
473 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
476 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
477 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
478 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
479 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
480 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
481 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
482 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
483 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
484 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
485 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
486 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
487 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
488 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
489 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
490 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
491 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
492 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
493 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
494 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
495 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
496 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
497 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
498 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
499 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
500 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
501 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
502 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
503 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
504 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
505 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
506 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
507 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
508 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
509 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
510 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
511 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
512 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
513 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
514 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
515 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
516 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
517 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
518 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
519 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
520 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.29
Metatranscriptomes 0
Isolates 35.71

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.39
Nodule 33.55
Rhizoplane 1.73
Rhizosphere 53.14
Stem 0
Stem Tuber 0
Unclassified 5.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1165699 2162886007 Bacteria 3108
2 SwRhRL2b_contig_795850 2162886007 Bacteria 3790
3 JGI24736J21556_1002225 3300001904 Bacteria 3432
4 JGI24736J21556_1007043 3300001904 Bacteria 1895
5 JGI24741J21665_1011201 3300001915 Bacteria 1575
6 JGI24740J21852_10002439 3300001979 Bacteria 8437
7 JGI24740J21852_10008085 3300001979 Bacteria 4221
8 JGI24740J21852_10107512 3300001979 Bacteria 706
9 JGI24739J22299_10089621 3300001989 Bacteria 937
10 JGI24739J22299_10120832 3300001989 Bacteria 782
11 JGI24737J22298_10001659 3300001990 Bacteria 7940
12 JGI24737J22298_10012924 3300001990 Bacteria 2721
13 JGI24737J22298_10042416 3300001990 Bacteria 1394
14 JGI24735J21928_10001615 3300002067 Bacteria 7973
15 JGI24735J21928_10004865 3300002067 Bacteria 4480
16 JGI24735J21928_10008830 3300002067 Bacteria 3251
17 JGI24750J21931_1000318 3300002070 Bacteria 8222
18 JGI24750J21931_1083195 3300002070 Bacteria 534
19 JGI24738J21930_10001024 3300002075 Bacteria 7975
20 JGI24738J21930_10011266 3300002075 Bacteria 1969
21 JGI24751J29686_10000063 3300002459 Bacteria 60668
22 JGI25165J46597_1000098 3300003214 Bacteria 159458
23 JGI25153J46596_10000002 3300003215 Bacteria 653569
24 Ga0055530_10029487 3300003791 Bacteria 1466
25 Ga0055531_10053293 3300003794 Bacteria 1046
26 Ga0055531_10069289 3300003794 Bacteria 821
27 JGI25405J52794_10082627 3300003911 Bacteria 708
28 Ga0065704_10001128 3300005289 Bacteria 17214
29 Ga0065704_10322314 3300005289 Bacteria 851
30 Ga0065707_10163655 3300005295 Bacteria 1541
31 Ga0070658_10000088 3300005327 Bacteria 85441
32 Ga0070658_10004888 3300005327 Bacteria 10920
33 Ga0070658_10232524 3300005327 Bacteria 1561
34 Ga0070658_11896793 3300005327 Bacteria 515
35 Ga0070683_100297485 3300005329 Bacteria 1535
36 Ga0070683_101344247 3300005329 Bacteria 687
37 Ga0070690_100000177 3300005330 Bacteria 32685
38 Ga0070690_101760173 3300005330 Bacteria 505
39 Ga0070670_100000245 3300005331 Bacteria 48841
40 Ga0070666_10000014 3300005335 Bacteria 224479
41 Ga0070680_100005289 3300005336 Bacteria 9762
42 Ga0070660_100000780 3300005339 Bacteria 21157
43 Ga0070660_100045563 3300005339 Bacteria 3358
44 Ga0070660_101050121 3300005339 Bacteria 689
45 Ga0070691_10038377 3300005341 Bacteria 2261
46 Ga0070691_10201558 3300005341 Bacteria 1046
47 Ga0070687_100354976 3300005343 Bacteria 947
48 Ga0070661_100000018 3300005344 Bacteria 135723
49 Ga0070661_100004782 3300005344 Bacteria 9323
50 Ga0070661_100232067 3300005344 Bacteria 1418
51 Ga0070661_101865637 3300005344 Bacteria 511
52 Ga0070692_10051274 3300005345 Bacteria 2145
53 Ga0070668_101280493 3300005347 Bacteria 666
54 Ga0070669_100000048 3300005353 Bacteria 118472
55 Ga0070669_100613601 3300005353 Bacteria 912
56 Ga0070669_101708594 3300005353 Unclassified 549
57 Ga0070671_100001321 3300005355 Bacteria 18639
58 Ga0070673_101545758 3300005364 Bacteria 626
59 Ga0070659_100000216 3300005366 Bacteria 44373
60 Ga0070659_100107497 3300005366 Bacteria 2249
61 Ga0070659_100149285 3300005366 Bacteria 1906
62 Ga0070659_100225001 3300005366 Bacteria 1549
63 Ga0070659_100377777 3300005366 Bacteria 1193
64 Ga0070659_101656562 3300005366 Bacteria 572
65 Ga0070659_101685435 3300005366 Bacteria 567
66 Ga0070667_100000655 3300005367 Bacteria 33618
67 Ga0070667_100273640 3300005367 Bacteria 1515
68 Ga0070703_10002747 3300005406 Bacteria 5050
69 Ga0070705_100003523 3300005440 Bacteria 7663
70 Ga0070705_101444201 3300005440 Unclassified 575
71 Ga0070694_100002075 3300005444 Bacteria 11895
72 Ga0070694_100450044 3300005444 Bacteria 1016
73 Ga0070708_100720535 3300005445 Bacteria 938
74 Ga0070708_101575503 3300005445 Bacteria 611
75 Ga0070663_100039490 3300005455 Bacteria 3298
76 Ga0070663_100110416 3300005455 Bacteria 2065
77 Ga0070663_100214515 3300005455 Bacteria 1509
78 Ga0070663_100235489 3300005455 Bacteria 1443
79 Ga0070663_100588399 3300005455 Bacteria 934
80 Ga0070662_100000574 3300005457 Bacteria 22427
81 Ga0070662_100017381 3300005457 Bacteria 4849
82 Ga0070662_100106175 3300005457 Bacteria 2133
83 Ga0070662_100172547 3300005457 Bacteria 1699
84 Ga0070662_100292762 3300005457 Bacteria 1320
85 Ga0070662_100901034 3300005457 Bacteria 755
86 Ga0070681_10086932 3300005458 Bacteria 3079
87 Ga0068867_101399223 3300005459 Unclassified 649
88 Ga0070707_100123261 3300005468 Bacteria 2517
89 Ga0070698_100255017 3300005471 Bacteria 1686
90 Ga0070699_100015502 3300005518 Bacteria 6550
91 Ga0070699_101632418 3300005518 Unclassified 591
92 Ga0070699_101907526 3300005518 Bacteria 543
93 Ga0070679_100000100 3300005530 Bacteria 66347
94 Ga0070679_100951479 3300005530 Unclassified 803
95 Ga0070684_100396960 3300005535 Bacteria 1271
96 Ga0070697_100027326 3300005536 Bacteria 4564
97 Ga0068853_100000475 3300005539 Bacteria 27392
98 Ga0068853_100001731 3300005539 Bacteria 15995
99 Ga0068853_100069465 3300005539 Bacteria 3064
100 Ga0068853_100088393 3300005539 Bacteria 2720
101 Ga0068853_100164661 3300005539 Bacteria 2003
102 Ga0068853_100223032 3300005539 Bacteria 1722
103 Ga0070672_100100890 3300005543 Bacteria 2341
104 Ga0070672_100115374 3300005543 Bacteria 2193
105 Ga0070672_100336110 3300005543 Bacteria 1285
106 Ga0070672_101340007 3300005543 Bacteria 639
107 Ga0070686_100000002 3300005544 Bacteria 336303
108 Ga0070686_100040721 3300005544 Bacteria 2900
109 Ga0070695_100000776 3300005545 Bacteria 17174
110 Ga0070695_100005333 3300005545 Bacteria 7570
111 Ga0070696_100025382 3300005546 Bacteria 4029
112 Ga0070693_100118874 3300005547 Bacteria 1636
113 Ga0070693_100563020 3300005547 Unclassified 818
114 Ga0070665_100017512 3300005548 Bacteria 7195
115 Ga0070665_100559148 3300005548 Bacteria 1156
116 Ga0070665_100689342 3300005548 Bacteria 1035
117 Ga0070704_100001730 3300005549 Bacteria 11915
118 Ga0070704_100003383 3300005549 Bacteria 9142
119 Ga0068855_100000173 3300005563 Bacteria 82962
120 Ga0068855_100000486 3300005563 Bacteria 48988
121 Ga0068855_100000648 3300005563 Bacteria 42506
122 Ga0068855_100027484 3300005563 Bacteria 6804
123 Ga0068855_100035428 3300005563 Bacteria 5945
124 Ga0068855_100041641 3300005563 Bacteria 5444
125 Ga0068855_100053677 3300005563 Bacteria 4740
126 Ga0068855_100071700 3300005563 Bacteria 4027
127 Ga0068855_100094952 3300005563 Bacteria 3438
128 Ga0068855_100127616 3300005563 Bacteria 2907
129 Ga0068855_100540763 3300005563 Bacteria 1262
130 Ga0068855_100745425 3300005563 Bacteria 1045
131 Ga0068855_101042032 3300005563 Bacteria 858
132 Ga0068855_101584287 3300005563 Bacteria 670
133 Ga0070664_100008244 3300005564 Bacteria 8425
134 Ga0070664_100696608 3300005564 Bacteria 946
135 Ga0070664_100963903 3300005564 Bacteria 801
136 Ga0068857_100000037 3300005577 Bacteria 72271
137 Ga0068857_100000670 3300005577 Bacteria 25389
138 Ga0068857_100083024 3300005577 Bacteria 2862
139 Ga0068857_100178075 3300005577 Bacteria 1934
140 Ga0068857_100316500 3300005577 Bacteria 1440
141 Ga0068857_101729854 3300005577 Bacteria 611
142 Ga0068854_100000071 3300005578 Bacteria 73211
143 Ga0068854_100000295 3300005578 Bacteria 33183
144 Ga0068854_100004367 3300005578 Bacteria 8917
145 Ga0068854_100039312 3300005578 Bacteria 3332
146 Ga0068854_100593628 3300005578 Bacteria 944
147 Ga0068854_100852909 3300005578 Bacteria 797
148 Ga0068856_100008358 3300005614 Bacteria 10084
149 Ga0068856_100346887 3300005614 Bacteria 1503
150 Ga0068856_100547358 3300005614 Bacteria 1178
151 Ga0068856_101704939 3300005614 Bacteria 642
152 Ga0070702_100060989 3300005615 Bacteria 2195
153 Ga0068852_100000060 3300005616 Bacteria 73764
154 Ga0068852_100000450 3300005616 Bacteria 27149
155 Ga0068852_100000709 3300005616 Bacteria 21797
156 Ga0068852_100048301 3300005616 Bacteria 3635
157 Ga0068852_100164025 3300005616 Bacteria 2077
158 Ga0068852_100496157 3300005616 Bacteria 1215
159 Ga0068852_100736753 3300005616 Bacteria 997
160 Ga0068859_100044136 3300005617 Bacteria 4480
161 Ga0068859_100421645 3300005617 Bacteria 1431
162 Ga0068864_100000109 3300005618 Bacteria 80156
163 Ga0068864_100009846 3300005618 Bacteria 7882
164 Ga0068864_100032691 3300005618 Bacteria 4421
165 Ga0068851_10001264 3300005834 Bacteria 11009
166 Ga0068851_10026604 3300005834 Bacteria 2845
167 Ga0068851_10072879 3300005834 Bacteria 1780
168 Ga0068851_10230725 3300005834 Bacteria 1043
169 Ga0068863_100050187 3300005841 Bacteria 3956
170 Ga0068863_102213935 3300005841 Unclassified 560
171 Ga0068858_100000507 3300005842 Bacteria 40808
172 Ga0068860_100000001 3300005843 Bacteria 703043
173 Ga0068860_100019529 3300005843 Bacteria 6570
174 Ga0068860_100023878 3300005843 Bacteria 5911
175 Ga0068860_100152433 3300005843 Bacteria 2226
176 Ga0068860_100202870 3300005843 Bacteria 1922
177 Ga0068860_101362672 3300005843 Bacteria 730
178 Ga0068862_100000128 3300005844 Bacteria 88625
179 Ga0068862_100402633 3300005844 Unclassified 1280
180 Ga0081455_10005327 3300005937 Bacteria 14127
181 Ga0081539_10315535 3300005985 Bacteria 667
182 Ga0075365_10329684 3300006038 Bacteria 1075
183 Ga0075363_100195989 3300006048 Bacteria 1153
184 Ga0075367_10000157 3300006178 Bacteria 21309
185 Ga0075367_10246963 3300006178 Bacteria 1119
186 Ga0075369_10037536 3300006186 Bacteria 2064
187 Ga0075366_10208200 3300006195 Bacteria 1190
188 Ga0075370_10034233 3300006353 Bacteria 2848
189 Ga0075370_10349782 3300006353 Bacteria 883
190 Ga0075370_10835465 3300006353 Bacteria 562
191 Ga0075428_100079995 3300006844 Bacteria 3566
192 Ga0075430_100043343 3300006846 Bacteria 3802
193 Ga0097620_100044139 3300006931 Bacteria 4480
194 Ga0097620_100421662 3300006931 Bacteria 1431
195 Ga0079104_1005064 3300006946 Bacteria 5373
196 Ga0079104_1025888 3300006946 Bacteria 1524
197 Ga0079104_1055730 3300006946 Bacteria 866
198 Ga0079104_1076700 3300006946 Bacteria 693
199 Ga0105250_10242078 3300009092 Bacteria 769
200 Ga0105250_10570004 3300009092 Bacteria 521
201 Ga0105240_10000052 3300009093 Bacteria 232583
202 Ga0105240_10006734 3300009093 Bacteria 16825
203 Ga0105240_10007113 3300009093 Bacteria 16306
204 Ga0105240_10008661 3300009093 Bacteria 14524
205 Ga0105240_10235179 3300009093 Bacteria 2127
206 Ga0105240_10287243 3300009093 Bacteria 1887
207 Ga0105240_11411647 3300009093 Bacteria 732
208 Ga0105240_11588249 3300009093 Bacteria 684
209 Ga0105245_10000294 3300009098 Bacteria 47730
210 Ga0105247_10251351 3300009101 Bacteria 1208
211 Ga0105243_10067387 3300009148 Bacteria 2881
212 Ga0105243_12030858 3300009148 Bacteria 610
213 Ga0105241_10001363 3300009174 Bacteria 18614
214 Ga0105241_10090215 3300009174 Bacteria 2417
215 Ga0105248_10010635 3300009177 Bacteria 10148
216 Ga0105248_10095888 3300009177 Bacteria 3340
217 Ga0105248_12043660 3300009177 Bacteria 651
218 Ga0105237_10000378 3300009545 Bacteria 63407
219 Ga0105237_10039744 3300009545 Bacteria 4748
220 Ga0105237_10055645 3300009545 Bacteria 3962
221 Ga0105237_10222648 3300009545 Bacteria 1887
222 Ga0105237_10388742 3300009545 Bacteria 1400
223 Ga0105237_10643275 3300009545 Bacteria 1067
224 Ga0105238_10000912 3300009551 Bacteria 30323
225 Ga0105238_10001089 3300009551 Bacteria 27423
226 Ga0105238_10002804 3300009551 Bacteria 17388
227 Ga0105238_10002947 3300009551 Bacteria 16982
228 Ga0105238_10030532 3300009551 Bacteria 5486
229 Ga0105238_10031424 3300009551 Bacteria 5405
230 Ga0105238_10046330 3300009551 Bacteria 4389
231 Ga0105238_10068105 3300009551 Bacteria 3560
232 Ga0105238_10092256 3300009551 Bacteria 3016
233 Ga0105238_10698366 3300009551 Bacteria 1026
234 Ga0105238_11017676 3300009551 Bacteria 849
235 Ga0105249_10000005 3300009553 Bacteria 362467
236 Ga0105249_10009245 3300009553 Bacteria 8617
237 Ga0105249_10012758 3300009553 Bacteria 7408
238 Ga0105249_12052843 3300009553 Unclassified 644
239 Ga0105148_104761 3300009978 Bacteria 975
240 Ga0105239_10000232 3300010375 Bacteria 82037
241 Ga0105239_10040953 3300010375 Bacteria 5077
242 Ga0105239_10047285 3300010375 Bacteria 4716
243 Ga0105239_10349828 3300010375 Bacteria 1668
244 Ga0105239_10546007 3300010375 Bacteria 1320
245 Ga0105239_10687205 3300010375 Bacteria 1170
246 Ga0105239_11278368 3300010375 Bacteria 846
247 Ga0105239_13354114 3300010375 Bacteria 521
248 Ga0105246_10609175 3300011119 Bacteria 945
249 Ga0105246_11830796 3300011119 Unclassified 581
250 Ga0157373_10005064 3300013100 Bacteria 9903
251 Ga0157373_10097581 3300013100 Bacteria 2068
252 Ga0157373_10162024 3300013100 Bacteria 1574
253 Ga0157373_10200186 3300013100 Bacteria 1408
254 Ga0157373_10553420 3300013100 Bacteria 834
255 Ga0157371_10001141 3300013102 Bacteria 28613
256 Ga0157371_10086222 3300013102 Bacteria 2224
257 Ga0157371_10894387 3300013102 Bacteria 673
258 Ga0157370_10001089 3300013104 Bacteria 34040
259 Ga0157370_10003021 3300013104 Bacteria 19971
260 Ga0157370_10183250 3300013104 Bacteria 1945
261 Ga0157370_10200033 3300013104 Bacteria 1853
262 Ga0157369_10000632 3300013105 Bacteria 45648
263 Ga0157369_10015667 3300013105 Bacteria 8543
264 Ga0157369_10017908 3300013105 Bacteria 7952
265 Ga0157369_10627040 3300013105 Bacteria 1109
266 Ga0157369_11171167 3300013105 Bacteria 785
267 Ga0157369_11395223 3300013105 Bacteria 713
268 Ga0157374_10358274 3300013296 Bacteria 1450
269 Ga0157374_10689565 3300013296 Bacteria 1034
270 Ga0157378_10089372 3300013297 Bacteria 2797
271 Ga0163162_10336202 3300013306 Bacteria 1643
272 Ga0157372_10002816 3300013307 Bacteria 18789
273 Ga0157372_10150953 3300013307 Bacteria 2682
274 Ga0157372_13152796 3300013307 Bacteria 526
275 Ga0163163_10195588 3300014325 Bacteria 2070
276 Ga0157380_11782260 3300014326 Bacteria 674
277 Ga0157379_10003511 3300014968 Bacteria 13275
278 Ga0157379_12129181 3300014968 Bacteria 556
279 Ga0163161_10000106 3300017792 Bacteria 79467
280 Ga0163161_10259797 3300017792 Bacteria 1356
281 Ga0163161_10367987 3300017792 Bacteria 1146
282 Ga0213875_10006207 3300021388 Bacteria 6301
283 Ga0209674_110441 3300025226 Bacteria 990
284 Ga0207427_119840 3300025231 Bacteria 610
285 Ga0209437_125878 3300025233 Bacteria 646
286 Ga0209233_1000010 3300025261 Bacteria 1194329
287 Ga0209233_1000026 3300025261 Bacteria 678466
288 Ga0209455_1013793 3300025272 Bacteria 1860
289 Ga0209758_1000001 3300025297 Bacteria 1981790
290 Ga0209050_1000406 3300025298 Bacteria 80343
291 Ga0209257_1005161 3300025304 Bacteria 9424
292 Ga0209257_1011989 3300025304 Bacteria 4080
293 Ga0207697_10000121 3300025315 Bacteria 37017
294 Ga0207656_10000454 3300025321 Bacteria 13714
295 Ga0207656_10008391 3300025321 Bacteria 3800
296 Ga0207656_10037726 3300025321 Bacteria 2035
297 Ga0207656_10119203 3300025321 Bacteria 1227
298 Ga0207696_1208051 3300025711 Bacteria 513
299 Ga0207680_10000004 3300025903 Bacteria 827324
300 Ga0207647_10006656 3300025904 Bacteria 8398
301 Ga0207647_10015569 3300025904 Bacteria 5209
302 Ga0207647_10117185 3300025904 Bacteria 1572
303 Ga0207647_10619093 3300025904 Bacteria 596
304 Ga0207705_10000138 3300025909 Bacteria 78969
305 Ga0207705_10005315 3300025909 Bacteria 9636
306 Ga0207705_10213548 3300025909 Bacteria 1464
307 Ga0207705_11130111 3300025909 Bacteria 603
308 Ga0207654_10000427 3300025911 Bacteria 24174
309 Ga0207654_10002086 3300025911 Bacteria 10238
310 Ga0207654_10005142 3300025911 Bacteria 6602
311 Ga0207654_10204198 3300025911 Bacteria 1303
312 Ga0207654_10557832 3300025911 Bacteria 814
313 Ga0207707_10330595 3300025912 Bacteria 1315
314 Ga0207695_10000122 3300025913 Bacteria 232677
315 Ga0207695_10001920 3300025913 Bacteria 32321
316 Ga0207695_10002056 3300025913 Bacteria 30785
317 Ga0207695_10002363 3300025913 Bacteria 28020
318 Ga0207695_10012343 3300025913 Bacteria 10264
319 Ga0207695_10022675 3300025913 Bacteria 7118
320 Ga0207695_10028904 3300025913 Bacteria 6136
321 Ga0207671_10000222 3300025914 Bacteria 85244
322 Ga0207671_10016463 3300025914 Bacteria 5745
323 Ga0207671_10019223 3300025914 Bacteria 5228
324 Ga0207671_10141288 3300025914 Bacteria 1855
325 Ga0207671_10167784 3300025914 Bacteria 1703
326 Ga0207671_10284000 3300025914 Bacteria 1306
327 Ga0207660_10022455 3300025917 Bacteria 4251
328 Ga0207662_10295156 3300025918 Bacteria 1076
329 Ga0207662_11367897 3300025918 Unclassified 503
330 Ga0207657_10002145 3300025919 Bacteria 21378
331 Ga0207657_11013215 3300025919 Bacteria 637
332 Ga0207649_10000034 3300025920 Bacteria 136049
333 Ga0207649_10002825 3300025920 Bacteria 9571
334 Ga0207649_11534035 3300025920 Bacteria 527
335 Ga0207652_10000133 3300025921 Bacteria 80146
336 Ga0207652_11639433 3300025921 Unclassified 548
337 Ga0207681_10000050 3300025923 Bacteria 118481
338 Ga0207681_11015129 3300025923 Bacteria 696
339 Ga0207681_11182731 3300025923 Bacteria 642
340 Ga0207681_11456773 3300025923 Unclassified 574
341 Ga0207694_10000230 3300025924 Bacteria 53897
342 Ga0207694_10000611 3300025924 Bacteria 32401
343 Ga0207694_10000630 3300025924 Bacteria 31969
344 Ga0207694_10000844 3300025924 Bacteria 27280
345 Ga0207694_10003020 3300025924 Bacteria 13492
346 Ga0207694_10003984 3300025924 Bacteria 11643
347 Ga0207694_10005011 3300025924 Bacteria 10244
348 Ga0207694_10017772 3300025924 Bacteria 5374
349 Ga0207694_10021833 3300025924 Bacteria 4853
350 Ga0207694_10322962 3300025924 Bacteria 1274
351 Ga0207650_10000039 3300025925 Bacteria 204737
352 Ga0207687_10001319 3300025927 Bacteria 16976
353 Ga0207644_10000028 3300025931 Bacteria 142921
354 Ga0207690_10000052 3300025932 Bacteria 106112
355 Ga0207690_10173800 3300025932 Bacteria 1616
356 Ga0207690_10228136 3300025932 Bacteria 1428
357 Ga0207690_10288693 3300025932 Bacteria 1280
358 Ga0207690_10433123 3300025932 Bacteria 1054
359 Ga0207690_11187901 3300025932 Bacteria 637
360 Ga0207690_11561906 3300025932 Bacteria 552
361 Ga0207706_10002199 3300025933 Bacteria 19005
362 Ga0207706_10040418 3300025933 Bacteria 4133
363 Ga0207706_10070809 3300025933 Bacteria 3067
364 Ga0207709_10124475 3300025935 Bacteria 1746
365 Ga0207691_10341136 3300025940 Bacteria 1282
366 Ga0207691_10673946 3300025940 Bacteria 873
367 Ga0207711_10005403 3300025941 Bacteria 10801
368 Ga0207711_10060041 3300025941 Bacteria 3276
369 Ga0207689_10278481 3300025942 Bacteria 1385
370 Ga0207661_11168247 3300025944 Bacteria 708
371 Ga0207679_10066208 3300025945 Bacteria 2706
372 Ga0207679_10382189 3300025945 Bacteria 1235
373 Ga0207679_10678584 3300025945 Bacteria 934
374 Ga0207667_10000001 3300025949 Bacteria 1178522
375 Ga0207667_10000459 3300025949 Bacteria 54741
376 Ga0207667_10004045 3300025949 Bacteria 18017
377 Ga0207667_10006258 3300025949 Bacteria 14449
378 Ga0207667_10013903 3300025949 Bacteria 9195
379 Ga0207667_10043324 3300025949 Bacteria 4777
380 Ga0207667_10061872 3300025949 Bacteria 3916
381 Ga0207667_10088942 3300025949 Bacteria 3193
382 Ga0207651_11226016 3300025960 Bacteria 674
383 Ga0207712_10000001 3300025961 Bacteria 750309
384 Ga0207712_10001025 3300025961 Bacteria 19817
385 Ga0207712_10024738 3300025961 Bacteria 3981
386 Ga0207712_10030145 3300025961 Bacteria 3644
387 Ga0207712_10135203 3300025961 Bacteria 1884
388 Ga0207668_10063881 3300025972 Bacteria 2599
389 Ga0207640_10000041 3300025981 Bacteria 105374
390 Ga0207640_10000086 3300025981 Bacteria 73224
391 Ga0207640_10019858 3300025981 Bacteria 3978
392 Ga0207640_10075647 3300025981 Bacteria 2283
393 Ga0207640_10133334 3300025981 Bacteria 1799
394 Ga0207640_10381697 3300025981 Bacteria 1142
395 Ga0207640_10702335 3300025981 Bacteria 867
396 Ga0207640_11610826 3300025981 Bacteria 585
397 Ga0207658_10001581 3300025986 Bacteria 17579
398 Ga0207703_10003358 3300026035 Bacteria 13441
399 Ga0207639_10000081 3300026041 Bacteria 82747
400 Ga0207639_10000495 3300026041 Bacteria 27230
401 Ga0207639_10000519 3300026041 Bacteria 26590
402 Ga0207639_10003480 3300026041 Bacteria 10596
403 Ga0207639_10023205 3300026041 Bacteria 4477
404 Ga0207639_10035055 3300026041 Bacteria 3712
405 Ga0207639_10039794 3300026041 Bacteria 3505
406 Ga0207639_11468050 3300026041 Bacteria 640
407 Ga0207678_10016767 3300026067 Bacteria 6433
408 Ga0207678_10077255 3300026067 Bacteria 2852
409 Ga0207678_10131857 3300026067 Bacteria 2132
410 Ga0207678_10712641 3300026067 Bacteria 883
411 Ga0207678_11016168 3300026067 Bacteria 734
412 Ga0207702_10001212 3300026078 Bacteria 26157
413 Ga0207702_10013506 3300026078 Bacteria 6784
414 Ga0207702_10019567 3300026078 Bacteria 5603
415 Ga0207702_10164174 3300026078 Bacteria 2030
416 Ga0207702_11510606 3300026078 Bacteria 665
417 Ga0207641_10061456 3300026088 Bacteria 3204
418 Ga0207648_11443073 3300026089 Bacteria 647
419 Ga0207676_10000035 3300026095 Bacteria 204737
420 Ga0207676_10000373 3300026095 Bacteria 38263
421 Ga0207676_10075784 3300026095 Bacteria 2715
422 Ga0207674_10001593 3300026116 Bacteria 29207
423 Ga0207674_10003470 3300026116 Bacteria 19284
424 Ga0207674_10021996 3300026116 Bacteria 6859
425 Ga0207674_10192263 3300026116 Bacteria 1991
426 Ga0207674_10267776 3300026116 Bacteria 1656
427 Ga0207674_10349866 3300026116 Bacteria 1429
428 Ga0207674_11295992 3300026116 Bacteria 698
429 Ga0207675_100445303 3300026118 Bacteria 1283
430 Ga0207698_10000054 3300026142 Bacteria 82681
431 Ga0207698_10000357 3300026142 Bacteria 26870
432 Ga0207698_10000574 3300026142 Bacteria 21465
433 Ga0207698_10003339 3300026142 Bacteria 9657
434 Ga0207698_10006940 3300026142 Bacteria 7087
435 Ga0207698_10015464 3300026142 Bacteria 5109
436 Ga0207698_10466173 3300026142 Bacteria 1222
437 Ga0207698_10670860 3300026142 Bacteria 1029
438 Ga0207698_10721355 3300026142 Bacteria 993
439 Ga0207698_11820681 3300026142 Bacteria 624
440 Ga0207698_12135818 3300026142 Bacteria 573
441 Ga0209281_1006280 3300027111 Bacteria 3124
442 Ga0209281_1018975 3300027111 Bacteria 1365
443 Ga0209281_1056565 3300027111 Bacteria 610
444 Ga0209998_10118785 3300027717 Unclassified 665
445 Ga0209813_10000050 3300027866 Bacteria 48358
446 Ga0207428_10902368 3300027907 Bacteria 624
447 Ga0268266_10339734 3300028379 Bacteria 1409
448 Ga0268266_10759408 3300028379 Bacteria 936
449 Ga0268265_10000102 3300028380 Bacteria 106737
450 Ga0268265_10004378 3300028380 Bacteria 9816
451 Ga0268265_10406463 3300028380 Bacteria 1260
452 Ga0268264_10000006 3300028381 Bacteria 827324
453 Ga0268264_10007910 3300028381 Bacteria 8845
454 Ga0268264_10011655 3300028381 Bacteria 7251
455 Ga0268264_10011731 3300028381 Bacteria 7225
456 Ga0268264_10130223 3300028381 Bacteria 2229
457 Ga0268264_10178237 3300028381 Bacteria 1928
458 Ga0307517_10000875 3300028786 Bacteria 51286
459 Ga0307517_10034138 3300028786 Bacteria 5807
460 Ga0307517_10035187 3300028786 Bacteria 5679
461 Ga0307517_10051411 3300028786 Bacteria 4160
462 Ga0307517_10189109 3300028786 Bacteria 1311
463 Ga0307515_10300210 3300028794 Bacteria 1292
464 Ga0307513_10696404 3300031456 Bacteria 722
465 Ga0307408_100000067 3300031548 Bacteria 120790
466 Ga0307510_10108145 3300033180 Bacteria 2536
467 Ga0307510_10402613 3300033180 Bacteria 812
468 Ga0373948_0046403 3300034817 Bacteria 923
469 Ga0373939_0002076 3300035114 Bacteria 4776
470 Ga0373942_0010804 3300035207 Plasmid 2153
471 Ga0373927_0225378 3300035695 Bacteria 1231
472 Ga0373925_1516906 3300037068 Bacteria 548
473 Ga0395900_0947859 3300037418 Bacteria 782
474 Ga0395905_1343653 3300037471 Bacteria 619
475 Ga0436364_1318325 3300037853 Bacteria 19438
476 Ga0395901_0351250 3300038443 Bacteria 1522
477 Ga0395901_0447626 3300038443 Bacteria 1321
478 Ga0395901_0804351 3300038443 Bacteria 929
479 Ga0436365_1317422 3300039437 Bacteria 4837
480 Ga0451791_0444167 3300041451 Bacteria 623
481 Ga0451793_0529694 3300041452 Bacteria 711
482 Ga0439458_0175962 3300042157 Bacteria 580
483 Ga0466958_0426494 3300045836 Bacteria 857
484 Ga0495627_000110 3300046453 Bacteria 101742
485 Ga0495627_001084 3300046453 Bacteria 17875
486 Ga0495627_046234 3300046453 Bacteria 1323
487 Ga0495629_0123606 3300046459 Bacteria 1803
488 Ga0495638_0045181 3300046460 Bacteria 2772
489 Ga0495583_0000120 3300046506 Bacteria 133285
490 Ga0495583_0048376 3300046506 Bacteria 1952
491 Ga0495616_0121668 3300046513 Bacteria 1204
492 Ga0495630_1163449 3300046517 Unclassified 584
493 Ga0495632_0000112 3300046519 Bacteria 83248
494 Ga0495643_0057875 3300046522 Bacteria 2064
495 Ga0495648_0014058 3300046524 Bacteria 5886
496 Ga0495648_0409264 3300046524 Bacteria 604
497 Ga0495648_0493063 3300046524 Bacteria 527
498 Ga0495633_0017426 3300046558 Bacteria 3674
499 Ga0495668_0204805 3300046616 Bacteria 1080
500 Ga0495668_0330702 3300046616 Bacteria 836
501 Ga0495625_0024031 3300046660 Bacteria 4646
502 Ga0495625_0133650 3300046660 Bacteria 1679
503 Ga0495625_0288452 3300046660 Bacteria 1054
504 Ga0495625_0788048 3300046660 Bacteria 554
505 Ga0495670_0301335 3300046691 Bacteria 859
506 Ga0495687_000200 3300047443 Bacteria 85752
507 Ga0495687_152993 3300047443 Bacteria 786
508 Ga0495686_0000469 3300047472 Bacteria 60229
509 Ga0496100_1582580 3300048903 Unclassified 518
510 Ga0496101_0053638 3300048904 Bacteria 2910
511 Ga0496101_1032371 3300048904 Bacteria 646
512 Ga0496102_0257902 3300048905 Bacteria 1644
513 Ga0496102_1461328 3300048905 Unclassified 602
514 Ga0496103_0006078 3300048906 Bacteria 7213
515 Ga0496106_0004035 3300048909 Bacteria 10966
516 Ga0496106_0037937 3300048909 Bacteria 3605
517 Ga0496106_0545266 3300048909 Bacteria 931
518 Ga0496107_0005932 3300048910 Bacteria 8371
519 Ga0496112_0505880 3300048915 Bacteria 1143
520 Ga0496114_0481792 3300048917 Bacteria 1098
521 Ga0496115_0032342 3300048918 Bacteria 4127
522 Ga0496116_0206109 3300048919 Bacteria 1023
523 Ga0496116_0322665 3300048919 Bacteria 722
524 Ga0496121_0119204 3300048924 Bacteria 1996
525 Ga0496121_0172138 3300048924 Bacteria 1571
526 Ga0496122_0171468 3300048925 Bacteria 1307
527 Ga0496124_0002739 3300048927 Bacteria 22472
528 Ga0496124_0063407 3300048927 Bacteria 3087
529 Ga0496125_0011563 3300048928 Bacteria 8817
530 Ga0496125_0071374 3300048928 Bacteria 2713
531 Ga0496125_0147720 3300048928 Bacteria 1621
532 Ga0496126_0011486 3300048929 Bacteria 9161
533 Ga0496126_0159368 3300048929 Bacteria 1929
534 Ga0495678_025306 3300049459 Bacteria 2551
535 Ga0495682_0069998 3300049460 Bacteria 1263
536 Ga0501033_0457313 3300049570 Bacteria 886
537 Ga0501036_1006164 3300049572 Bacteria 682
538 Ga0501036_1432990 3300049572 Unclassified 560
539 Ga0501037_0981721 3300049573 Bacteria 551
540 Ga0501038_1226926 3300049574 Bacteria 544
541 Ga0501040_0363499 3300049576 Bacteria 1037
542 Ga0501040_1123383 3300049576 Unclassified 570
543 Ga0501041_0630792 3300049577 Unclassified 685
544 Ga0501042_0491677 3300049578 Unclassified 891
545 Ga0501047_0091336 3300049581 Bacteria 2923
546 Ga0501047_0093898 3300049581 Bacteria 2879
547 Ga0501047_0723820 3300049581 Bacteria 812
548 Ga0501047_1288199 3300049581 Bacteria 545
549 Ga0501048_0725016 3300049582 Bacteria 714
550 Ga0501070_0472701 3300049586 Bacteria 1009
551 Ga0501070_1382227 3300049586 Bacteria 535
552 Ga0501071_0130701 3300049587 Bacteria 1865
553 Ga0501072_0604222 3300049588 Unclassified 865
554 Ga0501075_0410518 3300049591 Bacteria 1032
555 Ga0501076_0394561 3300049592 Bacteria 1138
556 Ga0501077_0369111 3300049593 Unclassified 916
557 Ga0501249_000397 3300049679 Bacteria 11196
558 Ga0501079_0713898 3300049741 Unclassified 789
559 nmdc:mga03n38_190269_c1 3300050490 Bacteria 1057
560 nmdc:mga0yw44_177140_c1 3300050492 Bacteria 1402
561 nmdc:mga0k408_111219_c1 3300050493 Bacteria 608
562 nmdc:mga0k408_307063_c1 3300050493 Bacteria 947
563 nmdc:mga06z11_112384_c1 3300050494 Bacteria 1510
564 nmdc:mga06z11_54_c1 3300050494 Bacteria 48385
565 nmdc:mga04h51_32_c1 3300050495 Bacteria 48953
566 nmdc:mga07m45_28170_c1 3300050496 Bacteria 3100
567 nmdc:mga07m45_552709_c1 3300050496 Bacteria 666
568 nmdc:mga07m45_746589_c1 3300050496 Bacteria 562
569 nmdc:mga0qj67_1522703_c1 3300050509 Bacteria 514
570 nmdc:mga06r32_915235_c1 3300050510 Bacteria 833
571 Ga0500635_0335076 3300053080 Unclassified 598
572 Ga0500643_000090 3300053087 Bacteria 93938
573 Ga0500643_000573 3300053087 Bacteria 25547
574 Ga0500643_080695 3300053087 Bacteria 894
575 Ga0500644_0015454 3300053088 Bacteria 2177
576 Ga0500651_0021989 3300053093 Bacteria 3982
577 Ga0500651_0503868 3300053093 Bacteria 667
578 Ga0500651_0683851 3300053093 Unclassified 550
579 Ga0500555_000848 3300053103 Bacteria 10940
580 Ga0500595_057278 3300053119 Bacteria 1188
581 Ga0500559_0022081 3300053136 Bacteria 2699
582 Ga0500559_0025794 3300053136 Bacteria 2502
583 Ga0500559_0031307 3300053136 Bacteria 2282
584 Ga0500559_0064172 3300053136 Bacteria 1643
585 Ga0500577_0194816 3300053142 Bacteria 873
586 Ga0500590_000019 3300053148 Bacteria 44823
587 Ga0500590_000177 3300053148 Bacteria 19032
588 Ga0500590_167656 3300053148 Bacteria 970
589 Ga0500624_000002 3300053157 Bacteria 257900
590 Ga0500637_0122189 3300053178 Unclassified 1511
591 Ga0500570_008967 3300053724 Bacteria 5539
592 Ga0500570_009926 3300053724 Bacteria 5296
593 Ga0500596_036700 3300053735 Unclassified 773
594 Ga0500661_011276 3300055283 Bacteria 1618

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005347 Ga0070668_101280493 Ga0070668_1012804931 87
2 3300025972 Ga0207668_10063881 Ga0207668_100638814 87
3 3300049581 Ga0501047_0093898 Ga0501047_0093898_16_309 96
4 iso_pu_bacteria 2965119406 2965120430 98
5 iso_pu_bacteria 2922185730 2922192522 99
6 iso_pu_bacteria 2599185354 2600202113 101
7 iso_pu_bacteria 2919709256 2919712264 101
8 iso_pu_bacteria 2503198000 2503204172 102
9 iso_pu_bacteria 2508501123 2509118284 102
10 iso_pu_bacteria 2509276018 2509373840 102
11 iso_pu_bacteria 2509276022 2509398505 102
12 iso_pu_bacteria 2510065059 2510319613 102
13 iso_pu_bacteria 2512875016 2512934982 102
14 iso_pu_bacteria 2512875024 2512963344 102
15 iso_pu_bacteria 2513237164 2514034380 102
16 iso_pu_bacteria 2513237351 2514590660 102
17 iso_pu_bacteria 2597489875 2597815393 102
18 iso_pu_bacteria 2643221541 2643731426 102
19 iso_pu_bacteria 2643221606 2644042246 102
20 iso_pu_bacteria 2643221671 2644394112 102
21 iso_pu_bacteria 2687453392 2688600920 102
22 iso_pu_bacteria 2693429783 2694631823 102
23 iso_pu_bacteria 2693429784 2694639243 102
24 iso_pu_bacteria 2756170246 2756677636 102
25 iso_pu_bacteria 2791355123 2792751157 102
26 iso_pu_bacteria 2841734538 2841737968 102
27 iso_pu_bacteria 2844002411 2844002579 102
28 iso_pu_bacteria 2844009547 2844011710 102
29 iso_pu_bacteria 2847670302 2847674247 102
30 iso_pu_bacteria 2847686936 2847688771 102
31 iso_pu_bacteria 2856314179 2856317836 102
32 iso_pu_bacteria 2856320880 2856321242 102
33 iso_pu_bacteria 2856320880 2856322571 102
34 iso_pu_bacteria 2856334872 2856340772 102
35 iso_pu_bacteria 2856342000 2856344468 102
36 iso_pu_bacteria 2856349417 2856356066 102
37 iso_pu_bacteria 2856356410 2856363473 102
38 iso_pu_bacteria 2856364286 2856365452 102
39 iso_pu_bacteria 2856364286 2856366341 102
40 iso_pu_bacteria 2857349434 2857353821 102
41 iso_pu_bacteria 2857349434 2857356973 102
42 iso_pu_bacteria 2857349434 2857357693 102
43 iso_pu_bacteria 2857367948 2857369438 102
44 iso_pu_bacteria 2869162929 2869166147 102
45 iso_pu_bacteria 2869169390 2869170901 102
46 iso_pu_bacteria 2869234852 2869236401 102
47 iso_pu_bacteria 2869234852 2869238462 102
48 iso_pu_bacteria 2869242130 2869243865 102
49 iso_pu_bacteria 2869249662 2869250712 102
50 iso_pu_bacteria 2869256925 2869258057 102
51 iso_pu_bacteria 2869264136 2869265446 102
52 iso_pu_bacteria 2869271264 2869277929 102
53 iso_pu_bacteria 2869278585 2869281826 102
54 iso_pu_bacteria 2869278585 2869282177 102
55 iso_pu_bacteria 2869285874 2869286927 102
56 iso_pu_bacteria 2869285874 2869288248 102
57 iso_pu_bacteria 2871429161 2871434233 102
58 iso_pu_bacteria 2871435913 2871438005 102
59 iso_pu_bacteria 2871444079 2871450108 102
60 iso_pu_bacteria 2871451962 2871455666 102
61 iso_pu_bacteria 2871459585 2871464806 102
62 iso_pu_bacteria 2871466892 2871467021 102
63 iso_pu_bacteria 2871474448 2871478912 102
64 iso_pu_bacteria 2871481445 2871486386 102
65 iso_pu_bacteria 2871488783 2871490501 102
66 iso_pu_bacteria 2871495908 2871498203 102
67 iso_pu_bacteria 2874102143 2874105166 102
68 iso_pu_bacteria 2874109183 2874111364 102
69 iso_pu_bacteria 2874109183 2874113685 102
70 iso_pu_bacteria 2874116593 2874121270 102
71 iso_pu_bacteria 2874123672 2874124638 102
72 iso_pu_bacteria 2874131515 2874133314 102
73 iso_pu_bacteria 2874139085 2874140249 102
74 iso_pu_bacteria 2874139085 2874145499 102
75 iso_pu_bacteria 2874146452 2874147368 102
76 iso_pu_bacteria 2874146452 2874151882 102
77 iso_pu_bacteria 2874155637 2874156374 102
78 iso_pu_bacteria 2874155637 2874159514 102
79 iso_pu_bacteria 2874162495 2874166082 102
80 iso_pu_bacteria 2874168670 2874172794 102
81 iso_pu_bacteria 2876363079 2876366050 102
82 iso_pu_bacteria 2876369609 2876374935 102
83 iso_pu_bacteria 2876386047 2876388378 102
84 iso_pu_bacteria 2876392853 2876396637 102
85 iso_pu_bacteria 2876399893 2876406589 102
86 iso_pu_bacteria 2876406927 2876412927 102
87 iso_pu_bacteria 2876413966 2876414562 102
88 iso_pu_bacteria 2876413966 2876417932 102
89 iso_pu_bacteria 2876420981 2876423561 102
90 iso_pu_bacteria 2878035449 2878041238 102
91 iso_pu_bacteria 2878730984 2878734790 102
92 iso_pu_bacteria 2878730984 2878735409 102
93 iso_pu_bacteria 2878738818 2878741587 102
94 iso_pu_bacteria 2878745973 2878747108 102
95 iso_pu_bacteria 2878745973 2878749759 102
96 iso_pu_bacteria 2878753008 2878759435 102
97 iso_pu_bacteria 2878760144 2878762425 102
98 iso_pu_bacteria 2878767105 2878769392 102
99 iso_pu_bacteria 2878774303 2878779304 102
100 iso_pu_bacteria 2878781027 2878782673 102
101 iso_pu_bacteria 2878788777 2878789994 102
102 iso_pu_bacteria 2881147464 2881149004 102
103 iso_pu_bacteria 2881147464 2881154470 102
104 iso_pu_bacteria 2881155292 2881160240 102
105 iso_pu_bacteria 2881161766 2881163871 102
106 iso_pu_bacteria 2881161766 2881165840 102
107 iso_pu_bacteria 2881845957 2881849875 102
108 iso_pu_bacteria 2881845957 2881853023 102
109 iso_pu_bacteria 2881853255 2881854744 102
110 iso_pu_bacteria 2881861095 2881863005 102
111 iso_pu_bacteria 2881861095 2881868481 102
112 iso_pu_bacteria 2882632389 2882636705 102
113 iso_pu_bacteria 2882912400 2882915813 102
114 iso_pu_bacteria 2885305155 2885305231 102
115 iso_pu_bacteria 2885312484 2885315353 102
116 iso_pu_bacteria 2885318864 2885324993 102
117 iso_pu_bacteria 2885326080 2885330323 102
118 iso_pu_bacteria 2885334103 2885337277 102
119 iso_pu_bacteria 2885342637 2885343032 102
120 iso_pu_bacteria 2885350715 2885356866 102
121 iso_pu_bacteria 2888337043 2888337529 102
122 iso_pu_bacteria 2888343758 2888349543 102
123 iso_pu_bacteria 2888350351 2888351585 102
124 iso_pu_bacteria 2888350351 2888352511 102
125 iso_pu_bacteria 2888350351 2888354049 102
126 iso_pu_bacteria 2889010040 2889015761 102
127 iso_pu_bacteria 2889010040 2889016634 102
128 iso_pu_bacteria 2889016732 2889019189 102
129 iso_pu_bacteria 2903492973 2903500125 102
130 iso_pu_bacteria 2903492973 2903505214 102
131 iso_pu_bacteria 2903513507 2903518116 102
132 iso_pu_bacteria 2903513507 2903518532 102
133 iso_pu_bacteria 2903521522 2903526174 102
134 iso_pu_bacteria 2903528002 2903530464 102
135 iso_pu_bacteria 2903540706 2903543000 102
136 iso_pu_bacteria 2904659560 2904660876 102
137 iso_pu_bacteria 2904659560 2904663414 102
138 iso_pu_bacteria 2906308376 2906309280 102
139 iso_pu_bacteria 2906308376 2906310797 102
140 iso_pu_bacteria 2906321335 2906326930 102
141 iso_pu_bacteria 2906328253 2906330823 102
142 iso_pu_bacteria 2906354277 2906359911 102
143 iso_pu_bacteria 2906354277 2906360223 102
144 iso_pu_bacteria 2906363423 2906368083 102
145 iso_pu_bacteria 2906370794 2906373312 102
146 iso_pu_bacteria 2906378014 2906384277 102
147 iso_pu_bacteria 2906386501 2906391927 102
148 iso_pu_bacteria 2906393657 2906398804 102
149 iso_pu_bacteria 2906401398 2906404140 102
150 iso_pu_bacteria 2906408224 2906408653 102
151 iso_pu_bacteria 2906414383 2906417901 102
152 iso_pu_bacteria 2906427513 2906429636 102
153 iso_pu_bacteria 2919709256 2919710911 102
154 iso_pu_bacteria 2922130491 2922132368 102
155 iso_pu_bacteria 2922151315 2922152596 102
156 iso_pu_bacteria 2922158528 2922160505 102
157 iso_pu_bacteria 2922172374 2922177024 102
158 iso_pu_bacteria 2922178524 2922183207 102
159 iso_pu_bacteria 2922185730 2922193721 102
160 iso_pu_bacteria 2924718760 2924723424 102
161 iso_pu_bacteria 2924718760 2924724471 102
162 iso_pu_bacteria 2924726620 2924732043 102
163 iso_pu_bacteria 2924733363 2924739011 102
164 iso_pu_bacteria 2924741084 2924742308 102
165 iso_pu_bacteria 2924748358 2924754157 102
166 iso_pu_bacteria 2924754689 2924758025 102
167 iso_pu_bacteria 2924762789 2924766596 102
168 iso_pu_bacteria 2924776078 2924779269 102
169 iso_pu_bacteria 2924784321 2924790572 102
170 iso_pu_bacteria 2937813078 2937813639 102
171 iso_pu_bacteria 2937813078 2937817624 102
172 iso_pu_bacteria 2937822353 2937829432 102
173 iso_pu_bacteria 2937836603 2937837277 102
174 iso_pu_bacteria 2937848649 2937852811 102
175 iso_pu_bacteria 2937861824 2937861911 102
176 iso_pu_bacteria 2937868953 2937869401 102
177 iso_pu_bacteria 2937877337 2937878624 102
178 iso_pu_bacteria 2937877337 2937881446 102
179 iso_pu_bacteria 2937877337 2937881557 102
180 iso_pu_bacteria 2937891427 2937892655 102
181 iso_pu_bacteria 2937972304 2937976760 102
182 iso_pu_bacteria 2937972304 2937979307 102
183 iso_pu_bacteria 2937980651 2937981980 102
184 iso_pu_bacteria 2937994558 2937996853 102
185 iso_pu_bacteria 2958034702 2958036722 102
186 iso_pu_bacteria 2958034702 2958038018 102
187 iso_pu_bacteria 2958041894 2958046873 102
188 iso_pu_bacteria 2958041894 2958047795 102
189 iso_pu_bacteria 2958041894 2958049332 102
190 iso_pu_bacteria 2958064165 2958068575 102
191 iso_pu_bacteria 2958071322 2958075947 102
192 iso_pu_bacteria 2958084443 2958085777 102
193 iso_pu_bacteria 2958084443 2958087997 102
194 iso_pu_bacteria 2958084443 2958088687 102
195 iso_pu_bacteria 2958092219 2958097568 102
196 iso_pu_bacteria 2958100919 2958105160 102
197 iso_pu_bacteria 2958100919 2958105456 102
198 iso_pu_bacteria 2958108152 2958114283 102
199 iso_pu_bacteria 2958115193 2958115307 102
200 iso_pu_bacteria 2958115193 2958121831 102
201 iso_pu_bacteria 2958122699 2958128161 102
202 iso_pu_bacteria 2958130278 2958131327 102
203 iso_pu_bacteria 2958130278 2958132650 102
204 iso_pu_bacteria 2958137437 2958142269 102
205 iso_pu_bacteria 2958144490 2958149297 102
206 iso_pu_bacteria 2958144490 2958149700 102
207 iso_pu_bacteria 2958158011 2958164198 102
208 iso_pu_bacteria 2958165035 2958167321 102
209 iso_pu_bacteria 2958172287 2958177041 102
210 iso_pu_bacteria 2958172287 2958177341 102
211 iso_pu_bacteria 2958179912 2958181152 102
212 iso_pu_bacteria 2958179912 2958182464 102
213 iso_pu_bacteria 2961077736 2961078990 102
214 iso_pu_bacteria 2961077736 2961080309 102
215 iso_pu_bacteria 2961114664 2961116035 102
216 iso_pu_bacteria 2961114664 2961118441 102
217 iso_pu_bacteria 2961127735 2961131642 102
218 iso_pu_bacteria 2961136820 2961142160 102
219 iso_pu_bacteria 2961163497 2961165794 102
220 iso_pu_bacteria 2961170736 2961177622 102
221 iso_pu_bacteria 2961183825 2961186984 102
222 iso_pu_bacteria 2963644680 2963650642 102
223 iso_pu_bacteria 2965018300 2965020613 102
224 iso_pu_bacteria 2965032056 2965039763 102
225 iso_pu_bacteria 2965040258 2965045993 102
226 iso_pu_bacteria 2965047637 2965055387 102
227 iso_pu_bacteria 2965062239 2965066862 102
228 iso_pu_bacteria 2965062239 2965067053 102
229 iso_pu_bacteria 2965089291 2965094391 102
230 iso_pu_bacteria 2965102966 2965110697 102
231 iso_pu_bacteria 2965110997 2965114241 102
232 iso_pu_bacteria 2965119406 2965120146 102
233 iso_pu_bacteria 2967996073 2967997279 102
234 iso_pu_bacteria 2968003550 2968010599 102
235 iso_pu_bacteria 2968016561 2968021405 102
236 iso_pu_bacteria 2968016561 2968022517 102
237 iso_pu_bacteria 2968091066 2968094330 102
238 iso_pu_bacteria 2968110612 2968112020 102
239 iso_pu_bacteria 2968110612 2968114502 102
240 iso_pu_bacteria 2968117919 2968123915 102
241 iso_pu_bacteria 2968128360 2968131017 102
242 iso_pu_bacteria 2968138860 2968145914 102
243 iso_pu_bacteria 2968171901 2968174193 102
244 iso_pu_bacteria 2970469710 2970475101 102
245 iso_pu_bacteria 2970469710 2970476510 102
246 iso_pu_bacteria 2970489779 2970491273 102
247 iso_pu_bacteria 2970503327 2970510300 102
248 iso_pu_bacteria 2970510686 2970513908 102
249 iso_pu_bacteria 2970524798 2970528878 102
250 iso_pu_bacteria 2970532167 2970537084 102
251 iso_pu_bacteria 2970540015 2970542421 102
252 iso_pu_bacteria 2970547951 2970550295 102
253 iso_pu_bacteria 2970554993 2970557283 102
254 iso_pu_bacteria 2970593180 2970596431 102
255 iso_pu_bacteria 2970593180 2970596783 102
256 iso_pu_bacteria 2970619444 2970623788 102
257 iso_pu_bacteria 2970627176 2970633089 102
258 iso_pu_bacteria 2977821940 2977827968 102
259 iso_pu_bacteria 2977828996 2977835351 102
260 iso_pu_bacteria 2977843712 2977843968 102
261 iso_pu_bacteria 2977843712 2977847912 102
262 iso_pu_bacteria 2977851361 2977856134 102
263 iso_pu_bacteria 2977858184 2977860012 102
264 iso_pu_bacteria 2977864932 2977870909 102
265 iso_pu_bacteria 2977872689 2977879074 102
266 iso_pu_bacteria 2977898635 2977898730 102
267 iso_pu_bacteria 2977907340 2977913092 102
268 iso_pu_bacteria 2977915119 2977920515 102
269 iso_pu_bacteria 2977922695 2977925414 102
270 iso_pu_bacteria 2977935797 2977940718 102
271 iso_pu_bacteria 2977942078 2977946195 102
272 iso_pu_bacteria 2977942078 2977950186 102
273 iso_pu_bacteria 2977950692 2977957200 102
274 iso_pu_bacteria 2977957713 2977958711 102
275 iso_pu_bacteria 2977971508 2977975421 102
276 iso_pu_bacteria 2977971508 2977976099 102
277 iso_pu_bacteria 2977986579 2977991414 102
278 iso_pu_bacteria 2979710463 2979715540 102
279 iso_pu_bacteria 2979710463 2979715703 102
280 iso_pu_bacteria 2979742915 2979744281 102
281 iso_pu_bacteria 2979742915 2979745801 102
282 iso_pu_bacteria 2979742915 2979750843 102
283 iso_pu_bacteria 2979764755 2979766526 102
284 iso_pu_bacteria 2979772303 2979777799 102
285 iso_pu_bacteria 2979779861 2979781076 102
286 iso_pu_bacteria 2979793036 2979794781 102
287 iso_pu_bacteria 2979808191 2979815173 102
288 iso_pu_bacteria 2987636660 2987642767 102
289 iso_pu_bacteria 2987636660 2987644254 102
290 iso_pu_bacteria 2987636660 2987645196 102
291 iso_pu_bacteria 2987645492 2987649599 102
292 iso_pu_bacteria 2987652177 2987656092 102
293 iso_pu_bacteria 2987652177 2987656909 102
294 iso_pu_bacteria 2987659509 2987661800 102
295 iso_pu_bacteria 2987666974 2987670928 102
296 iso_pu_bacteria 2987673487 2987676131 102
297 iso_pu_bacteria 2996341866 2996345440 102
298 iso_pu_bacteria 2996348954 2996353473 102
299 iso_pu_bacteria 2996386984 2996393350 102
300 iso_pu_bacteria 3000135777 3000139198 102
301 iso_pu_bacteria 3004188549 3004190849 102
302 iso_pu_bacteria 3004195979 3004203485 102
303 iso_pu_bacteria 3004203850 3004206568 102
304 iso_pu_bacteria 3004203850 3004208403 102
305 iso_pu_bacteria 3004211236 3004214246 102
306 iso_pu_bacteria 3004218560 3004222673 102
307 iso_pu_bacteria 3004232784 3004236356 102
308 iso_pu_bacteria 3004232784 3004239952 102
309 iso_pu_bacteria 3004239961 3004244700 102
310 iso_pu_bacteria 3004248173 3004251925 102
311 iso_pu_bacteria 3004268573 3004273615 102
312 iso_pu_bacteria 3004275668 3004280155 102
313 iso_pu_bacteria 3004289098 3004289870 102
314 iso_pu_bacteria 3004289098 3004296948 102
315 iso_pu_bacteria 637000159 637078199 102
316 iso_pu_bacteria 649633066 649875386 102
317 iso_pu_bacteria 8002285264 8002287203 102
318 iso_pu_bacteria 8004300914 8004306213 102
319 iso_pu_bacteria 8004312739 8004319318 102
320 iso_pu_bacteria 8004361976 8004369041 102
321 iso_pu_bacteria 8004374579 8004380944 102
322 iso_pu_bacteria 8004387939 8004388970 102
323 iso_pu_bacteria 8004387939 8004390035 102
324 iso_pu_bacteria 8004395343 8004398077 102
325 iso_pu_bacteria 8004445564 8004446850 102
326 iso_pu_bacteria 8004633249 8004636553 102
327 iso_pu_bacteria 8004695233 8004703440 102
328 iso_pu_bacteria 8004703790 8004712674 102
329 iso_pu_bacteria 8004703790 8004714064 102
330 iso_pu_bacteria 8004714634 8004715539 102
331 iso_pu_bacteria 8004714634 8004718432 102
332 iso_pu_bacteria 8004727605 8004728374 102
333 iso_pu_bacteria 8055617313 8055623986 102
334 3300003215 JGI25153J46596_10000002 JGI25153J46596_10000002347 104
335 3300005457 Ga0070662_100172547 Ga0070662_1001725472 104
336 3300005539 Ga0068853_100164661 Ga0068853_1001646611 104
337 3300025226 Ga0209674_110441 Ga0209674_1104411 104
338 3300025272 Ga0209455_1013793 Ga0209455_10137931 104
339 3300025297 Ga0209758_1000001 Ga0209758_10000011144 104
340 3300053136 Ga0500559_0025794 Ga0500559_0025794_864_1181 104
341 3300001915 JGI24741J21665_1011201 JGI24741J21665_10112013 105
342 3300001979 JGI24740J21852_10002439 JGI24740J21852_100024393 105
343 3300001990 JGI24737J22298_10001659 JGI24737J22298_100016598 105
344 3300001990 JGI24737J22298_10012924 JGI24737J22298_100129243 105
345 3300002067 JGI24735J21928_10001615 JGI24735J21928_100016155 105
346 3300002067 JGI24735J21928_10004865 JGI24735J21928_100048656 105
347 3300002075 JGI24738J21930_10001024 JGI24738J21930_100010248 105
348 3300002459 JGI24751J29686_10000063 JGI24751J29686_1000006329 105
349 3300003214 JGI25165J46597_1000098 JGI25165J46597_100009812 105
350 3300003794 Ga0055531_10053293 Ga0055531_100532932 105
351 3300003794 Ga0055531_10069289 Ga0055531_100692891 105
352 3300005289 Ga0065704_10322314 Ga0065704_103223142 105
353 3300005295 Ga0065707_10163655 Ga0065707_101636553 105
354 3300005327 Ga0070658_10000088 Ga0070658_1000008837 105
355 3300005327 Ga0070658_10004888 Ga0070658_100048884 105
356 3300005327 Ga0070658_10232524 Ga0070658_102325244 105
357 3300005327 Ga0070658_11896793 Ga0070658_118967931 105
358 3300005329 Ga0070683_100297485 Ga0070683_1002974851 105
359 3300005331 Ga0070670_100000245 Ga0070670_10000024533 105
360 3300005339 Ga0070660_101050121 Ga0070660_1010501211 105
361 3300005344 Ga0070661_100000018 Ga0070661_10000001889 105
362 3300005344 Ga0070661_100004782 Ga0070661_1000047829 105
363 3300005344 Ga0070661_101865637 Ga0070661_1018656371 105
364 3300005353 Ga0070669_100613601 Ga0070669_1006136011 105
365 3300005364 Ga0070673_101545758 Ga0070673_1015457581 105
366 3300005366 Ga0070659_100149285 Ga0070659_1001492853 105
367 3300005366 Ga0070659_100377777 Ga0070659_1003777771 105
368 3300005366 Ga0070659_101656562 Ga0070659_1016565621 105
369 3300005366 Ga0070659_101685435 Ga0070659_1016854351 105
370 3300005457 Ga0070662_100000574 Ga0070662_10000057411 105
371 3300005457 Ga0070662_100292762 Ga0070662_1002927623 105
372 3300005518 Ga0070699_101907526 Ga0070699_1019075261 105
373 3300005530 Ga0070679_100000100 Ga0070679_1000001009 105
374 3300005539 Ga0068853_100000475 Ga0068853_10000047510 105
375 3300005539 Ga0068853_100001731 Ga0068853_10000173113 105
376 3300005543 Ga0070672_100100890 Ga0070672_1001008901 105
377 3300005543 Ga0070672_100115374 Ga0070672_1001153745 105
378 3300005543 Ga0070672_100336110 Ga0070672_1003361102 105
379 3300005543 Ga0070672_101340007 Ga0070672_1013400072 105
380 3300005547 Ga0070693_100118874 Ga0070693_1001188742 105
381 3300005548 Ga0070665_100689342 Ga0070665_1006893422 105
382 3300005563 Ga0068855_100000173 Ga0068855_10000017350 105
383 3300005563 Ga0068855_100000648 Ga0068855_1000006485 105
384 3300005563 Ga0068855_100035428 Ga0068855_1000354286 105
385 3300005563 Ga0068855_100041641 Ga0068855_1000416418 105
386 3300005563 Ga0068855_100094952 Ga0068855_1000949521 105
387 3300005564 Ga0070664_100008244 Ga0070664_1000082448 105
388 3300005564 Ga0070664_100696608 Ga0070664_1006966082 105
389 3300005577 Ga0068857_100000037 Ga0068857_10000003721 105
390 3300005577 Ga0068857_100000670 Ga0068857_1000006704 105
391 3300005578 Ga0068854_100000071 Ga0068854_10000007120 105
392 3300005578 Ga0068854_100000295 Ga0068854_10000029535 105
393 3300005578 Ga0068854_100852909 Ga0068854_1008529091 105
394 3300005614 Ga0068856_100346887 Ga0068856_1003468872 105
395 3300005616 Ga0068852_100000060 Ga0068852_10000006042 105
396 3300005616 Ga0068852_100000450 Ga0068852_10000045026 105
397 3300005616 Ga0068852_100496157 Ga0068852_1004961571 105
398 3300005616 Ga0068852_100736753 Ga0068852_1007367532 105
399 3300005618 Ga0068864_100000109 Ga0068864_10000010934 105
400 3300005834 Ga0068851_10001264 Ga0068851_100012647 105
401 3300005834 Ga0068851_10026604 Ga0068851_100266041 105
402 3300005834 Ga0068851_10072879 Ga0068851_100728792 105
403 3300005841 Ga0068863_100050187 Ga0068863_1000501873 105
404 3300005842 Ga0068858_100000507 Ga0068858_10000050733 105
405 3300005843 Ga0068860_100023878 Ga0068860_1000238786 105
406 3300005843 Ga0068860_100202870 Ga0068860_1002028704 105
407 3300005985 Ga0081539_10315535 Ga0081539_103155351 105
408 3300006048 Ga0075363_100195989 Ga0075363_1001959891 105
409 3300006178 Ga0075367_10000157 Ga0075367_100001576 105
410 3300009092 Ga0105250_10570004 Ga0105250_105700041 105
411 3300009093 Ga0105240_10000052 Ga0105240_10000052167 105
412 3300009093 Ga0105240_10007113 Ga0105240_1000711317 105
413 3300009093 Ga0105240_10235179 Ga0105240_102351794 105
414 3300009093 Ga0105240_11411647 Ga0105240_114116472 105
415 3300009101 Ga0105247_10251351 Ga0105247_102513513 105
416 3300009177 Ga0105248_10010635 Ga0105248_1001063510 105
417 3300009177 Ga0105248_10095888 Ga0105248_100958884 105
418 3300009545 Ga0105237_10000378 Ga0105237_1000037835 105
419 3300009551 Ga0105238_10000912 Ga0105238_1000091234 105
420 3300009551 Ga0105238_10001089 Ga0105238_1000108918 105
421 3300009551 Ga0105238_10002804 Ga0105238_100028048 105
422 3300009551 Ga0105238_10046330 Ga0105238_100463302 105
423 3300009551 Ga0105238_10698366 Ga0105238_106983662 105
424 3300009978 Ga0105148_104761 Ga0105148_1047612 105
425 3300010375 Ga0105239_10000232 Ga0105239_1000023234 105
426 3300013100 Ga0157373_10005064 Ga0157373_100050648 105
427 3300013100 Ga0157373_10162024 Ga0157373_101620242 105
428 3300013100 Ga0157373_10200186 Ga0157373_102001862 105
429 3300013100 Ga0157373_10553420 Ga0157373_105534201 105
430 3300013102 Ga0157371_10001141 Ga0157371_1000114125 105
431 3300013102 Ga0157371_10086222 Ga0157371_100862222 105
432 3300013102 Ga0157371_10894387 Ga0157371_108943871 105
433 3300013104 Ga0157370_10001089 Ga0157370_1000108934 105
434 3300013104 Ga0157370_10003021 Ga0157370_1000302110 105
435 3300013105 Ga0157369_10000632 Ga0157369_1000063211 105
436 3300013307 Ga0157372_10002816 Ga0157372_100028163 105
437 3300014968 Ga0157379_12129181 Ga0157379_121291811 105
438 3300017792 Ga0163161_10259797 Ga0163161_102597973 105
439 3300021388 Ga0213875_10006207 Ga0213875_100062076 105
440 3300025231 Ga0207427_119840 Ga0207427_1198401 105
441 3300025233 Ga0209437_125878 Ga0209437_1258781 105
442 3300025261 Ga0209233_1000026 Ga0209233_1000026577 105
443 3300025304 Ga0209257_1005161 Ga0209257_10051613 105
444 3300025304 Ga0209257_1011989 Ga0209257_10119892 105
445 3300025321 Ga0207656_10000454 Ga0207656_1000045414 105
446 3300025321 Ga0207656_10008391 Ga0207656_100083914 105
447 3300025904 Ga0207647_10006656 Ga0207647_100066568 105
448 3300025904 Ga0207647_10619093 Ga0207647_106190931 105
449 3300025909 Ga0207705_10000138 Ga0207705_1000013850 105
450 3300025909 Ga0207705_10005315 Ga0207705_100053154 105
451 3300025909 Ga0207705_11130111 Ga0207705_111301111 105
452 3300025911 Ga0207654_10204198 Ga0207654_102041983 105
453 3300025913 Ga0207695_10000122 Ga0207695_1000012251 105
454 3300025913 Ga0207695_10001920 Ga0207695_1000192034 105
455 3300025913 Ga0207695_10028904 Ga0207695_100289044 105
456 3300025914 Ga0207671_10000222 Ga0207671_1000022251 105
457 3300025919 Ga0207657_11013215 Ga0207657_110132151 105
458 3300025920 Ga0207649_10000034 Ga0207649_1000003489 105
459 3300025920 Ga0207649_10002825 Ga0207649_100028256 105
460 3300025921 Ga0207652_10000133 Ga0207652_1000013316 105
461 3300025923 Ga0207681_11015129 Ga0207681_110151291 105
462 3300025923 Ga0207681_11182731 Ga0207681_111827312 105
463 3300025924 Ga0207694_10000611 Ga0207694_1000061134 105
464 3300025924 Ga0207694_10000844 Ga0207694_100008445 105
465 3300025924 Ga0207694_10003020 Ga0207694_100030208 105
466 3300025924 Ga0207694_10003984 Ga0207694_100039847 105
467 3300025925 Ga0207650_10000039 Ga0207650_10000039136 105
468 3300025932 Ga0207690_10173800 Ga0207690_101738002 105
469 3300025932 Ga0207690_10433123 Ga0207690_104331232 105
470 3300025932 Ga0207690_11187901 Ga0207690_111879012 105
471 3300025932 Ga0207690_11561906 Ga0207690_115619061 105
472 3300025933 Ga0207706_10002199 Ga0207706_1000219917 105
473 3300025940 Ga0207691_10341136 Ga0207691_103411362 105
474 3300025940 Ga0207691_10673946 Ga0207691_106739461 105
475 3300025941 Ga0207711_10060041 Ga0207711_100600414 105
476 3300025944 Ga0207661_11168247 Ga0207661_111682471 105
477 3300025945 Ga0207679_10066208 Ga0207679_100662082 105
478 3300025945 Ga0207679_10678584 Ga0207679_106785841 105
479 3300025949 Ga0207667_10000001 Ga0207667_10000001635 105
480 3300025949 Ga0207667_10006258 Ga0207667_1000625813 105
481 3300025949 Ga0207667_10043324 Ga0207667_100433243 105
482 3300025949 Ga0207667_10061872 Ga0207667_100618722 105
483 3300025960 Ga0207651_11226016 Ga0207651_112260161 105
484 3300025981 Ga0207640_10000041 Ga0207640_1000004153 105
485 3300025981 Ga0207640_10000086 Ga0207640_1000008618 105
486 3300025981 Ga0207640_10702335 Ga0207640_107023351 105
487 3300025981 Ga0207640_11610826 Ga0207640_116108261 105
488 3300026035 Ga0207703_10003358 Ga0207703_100033589 105
489 3300026041 Ga0207639_10000081 Ga0207639_1000008135 105
490 3300026041 Ga0207639_10000495 Ga0207639_1000049519 105
491 3300026041 Ga0207639_10000519 Ga0207639_1000051926 105
492 3300026041 Ga0207639_10003480 Ga0207639_100034806 105
493 3300026067 Ga0207678_10077255 Ga0207678_100772552 105
494 3300026067 Ga0207678_11016168 Ga0207678_110161681 105
495 3300026078 Ga0207702_10164174 Ga0207702_101641741 105
496 3300026088 Ga0207641_10061456 Ga0207641_100614563 105
497 3300026095 Ga0207676_10000035 Ga0207676_1000003580 105
498 3300026116 Ga0207674_10001593 Ga0207674_100015938 105
499 3300026116 Ga0207674_10003470 Ga0207674_100034701 105
500 3300026142 Ga0207698_10000054 Ga0207698_1000005434 105
501 3300026142 Ga0207698_10000357 Ga0207698_1000035726 105
502 3300026142 Ga0207698_10466173 Ga0207698_104661731 105
503 3300026142 Ga0207698_10670860 Ga0207698_106708602 105
504 3300026142 Ga0207698_12135818 Ga0207698_121358181 105
505 3300027866 Ga0209813_10000050 Ga0209813_100000506 105
506 3300027907 Ga0207428_10902368 Ga0207428_109023681 105
507 3300028381 Ga0268264_10011655 Ga0268264_100116553 105
508 3300028381 Ga0268264_10178237 Ga0268264_101782371 105
509 3300028786 Ga0307517_10034138 Ga0307517_100341386 105
510 3300028786 Ga0307517_10035187 Ga0307517_100351875 105
511 3300028786 Ga0307517_10051411 Ga0307517_100514115 105
512 3300028794 Ga0307515_10300210 Ga0307515_103002101 105
513 3300035695 Ga0373927_0225378 Ga0373927_0225378_367_687 105
514 3300037068 Ga0373925_1516906 Ga0373925_1516906_135_455 105
515 3300037853 Ga0436364_1318325 Ga0436364_1318325_13440_13760 105
516 3300038443 Ga0395901_0351250 Ga0395901_0351250_353_673 105
517 3300038443 Ga0395901_0447626 Ga0395901_0447626_271_591 105
518 3300039437 Ga0436365_1317422 Ga0436365_1317422_219_539 105
519 3300041452 Ga0451793_0529694 Ga0451793_0529694_24_344 105
520 3300046453 Ga0495627_000110 Ga0495627_000110_41900_42220 105
521 3300046459 Ga0495629_0123606 Ga0495629_0123606_1451_1771 105
522 3300046460 Ga0495638_0045181 Ga0495638_0045181_55_375 105
523 3300046506 Ga0495583_0000120 Ga0495583_0000120_83109_83429 105
524 3300046506 Ga0495583_0048376 Ga0495583_0048376_1433_1753 105
525 3300046513 Ga0495616_0121668 Ga0495616_0121668_564_884 105
526 3300046519 Ga0495632_0000112 Ga0495632_0000112_17883_18203 105
527 3300046524 Ga0495648_0409264 Ga0495648_0409264_264_584 105
528 3300046558 Ga0495633_0017426 Ga0495633_0017426_2426_2746 105
529 3300046616 Ga0495668_0204805 Ga0495668_0204805_51_371 105
530 3300046660 Ga0495625_0288452 Ga0495625_0288452_469_789 105
531 3300046691 Ga0495670_0301335 Ga0495670_0301335_152_472 105
532 3300047443 Ga0495687_000200 Ga0495687_000200_11527_11847 105
533 3300048904 Ga0496101_0053638 Ga0496101_0053638_2575_2895 105
534 3300048917 Ga0496114_0481792 Ga0496114_0481792_665_985 105
535 3300048919 Ga0496116_0322665 Ga0496116_0322665_257_577 105
536 3300048925 Ga0496122_0171468 Ga0496122_0171468_785_1105 105
537 3300048927 Ga0496124_0002739 Ga0496124_0002739_17309_17629 105
538 3300048928 Ga0496125_0147720 Ga0496125_0147720_779_1099 105
539 3300049459 Ga0495678_025306 Ga0495678_025306_119_439 105
540 3300049460 Ga0495682_0069998 Ga0495682_0069998_139_459 105
541 3300049570 Ga0501033_0457313 Ga0501033_0457313_379_699 105
542 3300049586 Ga0501070_0472701 Ga0501070_0472701_601_921 105
543 3300050490 nmdc:mga03n38_190269_c1 nmdc:mga03n38_190269_c1_656_976 105
544 3300050494 nmdc:mga06z11_54_c1 nmdc:mga06z11_54_c1_43843_44163 105
545 3300050495 nmdc:mga04h51_32_c1 nmdc:mga04h51_32_c1_4223_4543 105
546 3300053087 Ga0500643_000090 Ga0500643_000090_91684_92004 105
547 3300053087 Ga0500643_000573 Ga0500643_000573_191_511 105
548 3300053087 Ga0500643_080695 Ga0500643_080695_116_469 105
549 3300053093 Ga0500651_0503868 Ga0500651_0503868_182_508 105
550 3300053103 Ga0500555_000848 Ga0500555_000848_5637_5957 105
551 3300053136 Ga0500559_0064172 Ga0500559_0064172_310_630 105
552 3300053142 Ga0500577_0194816 Ga0500577_0194816_535_855 105
553 3300053148 Ga0500590_000177 Ga0500590_000177_3986_4306 105
554 3300053148 Ga0500590_167656 Ga0500590_167656_402_722 105
555 3300053157 Ga0500624_000002 Ga0500624_000002_213078_213398 105
556 3300053724 Ga0500570_008967 Ga0500570_008967_1671_1991 105
557 3300053724 Ga0500570_009926 Ga0500570_009926_3044_3364 105
558 3300053735 Ga0500596_036700 Ga0500596_036700_440_760 105
559 3300055283 Ga0500661_011276 Ga0500661_011276_461_781 105
560 2162886007 SwRhRL2b_contig_1165699 SwRhRL2b_0476.00002550 106
561 2162886007 SwRhRL2b_contig_795850 SwRhRL2b_0299.00000670 106
562 3300001904 JGI24736J21556_1002225 JGI24736J21556_10022251 106
563 3300001904 JGI24736J21556_1007043 JGI24736J21556_10070434 106
564 3300001979 JGI24740J21852_10008085 JGI24740J21852_100080855 106
565 3300001979 JGI24740J21852_10107512 JGI24740J21852_101075121 106
566 3300001989 JGI24739J22299_10089621 JGI24739J22299_100896211 106
567 3300001989 JGI24739J22299_10120832 JGI24739J22299_101208322 106
568 3300001990 JGI24737J22298_10042416 JGI24737J22298_100424161 106
569 3300002067 JGI24735J21928_10008830 JGI24735J21928_100088304 106
570 3300002070 JGI24750J21931_1000318 JGI24750J21931_10003186 106
571 3300002070 JGI24750J21931_1083195 JGI24750J21931_10831951 106
572 3300002075 JGI24738J21930_10011266 JGI24738J21930_100112664 106
573 3300003791 Ga0055530_10029487 Ga0055530_100294873 106
574 3300003911 JGI25405J52794_10082627 JGI25405J52794_100826271 106
575 3300005289 Ga0065704_10001128 Ga0065704_100011285 106
576 3300005329 Ga0070683_101344247 Ga0070683_1013442471 106
577 3300005330 Ga0070690_100000177 Ga0070690_10000017733 106
578 3300005330 Ga0070690_101760173 Ga0070690_1017601731 106
579 3300005335 Ga0070666_10000014 Ga0070666_10000014231 106
580 3300005336 Ga0070680_100005289 Ga0070680_10000528912 106
581 3300005339 Ga0070660_100000780 Ga0070660_10000078011 106
582 3300005339 Ga0070660_100045563 Ga0070660_1000455632 106
583 3300005341 Ga0070691_10038377 Ga0070691_100383772 106
584 3300005341 Ga0070691_10201558 Ga0070691_102015582 106
585 3300005343 Ga0070687_100354976 Ga0070687_1003549761 106
586 3300005344 Ga0070661_100232067 Ga0070661_1002320671 106
587 3300005345 Ga0070692_10051274 Ga0070692_100512742 106
588 3300005353 Ga0070669_100000048 Ga0070669_10000004835 106
589 3300005353 Ga0070669_101708594 Ga0070669_1017085941 106
590 3300005355 Ga0070671_100001321 Ga0070671_10000132119 106
591 3300005366 Ga0070659_100000216 Ga0070659_10000021625 106
592 3300005366 Ga0070659_100107497 Ga0070659_1001074974 106
593 3300005366 Ga0070659_100225001 Ga0070659_1002250012 106
594 3300005367 Ga0070667_100000655 Ga0070667_10000065536 106
595 3300005367 Ga0070667_100273640 Ga0070667_1002736401 106
596 3300005406 Ga0070703_10002747 Ga0070703_100027475 106
597 3300005440 Ga0070705_100003523 Ga0070705_1000035238 106
598 3300005440 Ga0070705_101444201 Ga0070705_1014442011 106
599 3300005444 Ga0070694_100002075 Ga0070694_1000020758 106
600 3300005444 Ga0070694_100450044 Ga0070694_1004500441 106
601 3300005445 Ga0070708_100720535 Ga0070708_1007205351 106
602 3300005445 Ga0070708_101575503 Ga0070708_1015755031 106
603 3300005455 Ga0070663_100039490 Ga0070663_1000394902 106
604 3300005455 Ga0070663_100110416 Ga0070663_1001104162 106
605 3300005455 Ga0070663_100214515 Ga0070663_1002145151 106
606 3300005455 Ga0070663_100235489 Ga0070663_1002354892 106
607 3300005455 Ga0070663_100588399 Ga0070663_1005883991 106
608 3300005457 Ga0070662_100017381 Ga0070662_1000173813 106
609 3300005457 Ga0070662_100106175 Ga0070662_1001061755 106
610 3300005457 Ga0070662_100901034 Ga0070662_1009010342 106
611 3300005458 Ga0070681_10086932 Ga0070681_100869324 106
612 3300005459 Ga0068867_101399223 Ga0068867_1013992231 106
613 3300005468 Ga0070707_100123261 Ga0070707_1001232613 106
614 3300005471 Ga0070698_100255017 Ga0070698_1002550172 106
615 3300005518 Ga0070699_100015502 Ga0070699_1000155022 106
616 3300005518 Ga0070699_101632418 Ga0070699_1016324181 106
617 3300005530 Ga0070679_100951479 Ga0070679_1009514792 106
618 3300005535 Ga0070684_100396960 Ga0070684_1003969601 106
619 3300005536 Ga0070697_100027326 Ga0070697_1000273261 106
620 3300005539 Ga0068853_100069465 Ga0068853_1000694654 106
621 3300005539 Ga0068853_100088393 Ga0068853_1000883935 106
622 3300005539 Ga0068853_100223032 Ga0068853_1002230323 106
623 3300005544 Ga0070686_100000002 Ga0070686_100000002350 106
624 3300005544 Ga0070686_100040721 Ga0070686_1000407212 106
625 3300005545 Ga0070695_100000776 Ga0070695_10000077620 106
626 3300005545 Ga0070695_100005333 Ga0070695_1000053334 106
627 3300005546 Ga0070696_100025382 Ga0070696_1000253821 106
628 3300005547 Ga0070693_100563020 Ga0070693_1005630201 106
629 3300005548 Ga0070665_100017512 Ga0070665_1000175125 106
630 3300005548 Ga0070665_100559148 Ga0070665_1005591482 106
631 3300005549 Ga0070704_100001730 Ga0070704_1000017303 106
632 3300005549 Ga0070704_100003383 Ga0070704_1000033834 106
633 3300005563 Ga0068855_100000486 Ga0068855_10000048637 106
634 3300005563 Ga0068855_100027484 Ga0068855_1000274847 106
635 3300005563 Ga0068855_100053677 Ga0068855_1000536775 106
636 3300005563 Ga0068855_100071700 Ga0068855_1000717005 106
637 3300005563 Ga0068855_100127616 Ga0068855_1001276164 106
638 3300005563 Ga0068855_100540763 Ga0068855_1005407631 106
639 3300005563 Ga0068855_100745425 Ga0068855_1007454252 106
640 3300005563 Ga0068855_101042032 Ga0068855_1010420321 106
641 3300005563 Ga0068855_101584287 Ga0068855_1015842871 106
642 3300005564 Ga0070664_100963903 Ga0070664_1009639032 106
643 3300005577 Ga0068857_100083024 Ga0068857_1000830241 106
644 3300005577 Ga0068857_100178075 Ga0068857_1001780751 106
645 3300005577 Ga0068857_100316500 Ga0068857_1003165002 106
646 3300005577 Ga0068857_101729854 Ga0068857_1017298541 106
647 3300005578 Ga0068854_100004367 Ga0068854_1000043674 106
648 3300005578 Ga0068854_100039312 Ga0068854_1000393126 106
649 3300005578 Ga0068854_100593628 Ga0068854_1005936282 106
650 3300005614 Ga0068856_100008358 Ga0068856_1000083586 106
651 3300005614 Ga0068856_100547358 Ga0068856_1005473582 106
652 3300005614 Ga0068856_101704939 Ga0068856_1017049391 106
653 3300005615 Ga0070702_100060989 Ga0070702_1000609891 106
654 3300005616 Ga0068852_100000709 Ga0068852_10000070911 106
655 3300005616 Ga0068852_100048301 Ga0068852_1000483012 106
656 3300005616 Ga0068852_100164025 Ga0068852_1001640252 106
657 3300005617 Ga0068859_100044136 Ga0068859_1000441363 106
658 3300005617 Ga0068859_100421645 Ga0068859_1004216451 106
659 3300005618 Ga0068864_100009846 Ga0068864_1000098464 106
660 3300005618 Ga0068864_100032691 Ga0068864_1000326912 106
661 3300005834 Ga0068851_10230725 Ga0068851_102307253 106
662 3300005841 Ga0068863_102213935 Ga0068863_1022139351 106
663 3300005843 Ga0068860_100000001 Ga0068860_100000001742 106
664 3300005843 Ga0068860_100019529 Ga0068860_1000195294 106
665 3300005843 Ga0068860_100152433 Ga0068860_1001524333 106
666 3300005843 Ga0068860_101362672 Ga0068860_1013626721 106
667 3300005844 Ga0068862_100000128 Ga0068862_10000012835 106
668 3300005844 Ga0068862_100402633 Ga0068862_1004026333 106
669 3300005937 Ga0081455_10005327 Ga0081455_1000532719 106
670 3300006038 Ga0075365_10329684 Ga0075365_103296842 106
671 3300006178 Ga0075367_10246963 Ga0075367_102469632 106
672 3300006186 Ga0075369_10037536 Ga0075369_100375361 106
673 3300006195 Ga0075366_10208200 Ga0075366_102082002 106
674 3300006353 Ga0075370_10034233 Ga0075370_100342336 106
675 3300006353 Ga0075370_10349782 Ga0075370_103497822 106
676 3300006353 Ga0075370_10835465 Ga0075370_108354651 106
677 3300006844 Ga0075428_100079995 Ga0075428_1000799956 106
678 3300006846 Ga0075430_100043343 Ga0075430_1000433432 106
679 3300006931 Ga0097620_100044139 Ga0097620_1000441393 106
680 3300006931 Ga0097620_100421662 Ga0097620_1004216622 106
681 3300006946 Ga0079104_1005064 Ga0079104_10050645 106
682 3300006946 Ga0079104_1025888 Ga0079104_10258881 106
683 3300006946 Ga0079104_1055730 Ga0079104_10557301 106
684 3300006946 Ga0079104_1076700 Ga0079104_10767001 106
685 3300009092 Ga0105250_10242078 Ga0105250_102420781 106
686 3300009093 Ga0105240_10006734 Ga0105240_100067346 106
687 3300009093 Ga0105240_10008661 Ga0105240_100086619 106
688 3300009093 Ga0105240_10287243 Ga0105240_102872432 106
689 3300009093 Ga0105240_11588249 Ga0105240_115882491 106
690 3300009098 Ga0105245_10000294 Ga0105245_1000029428 106
691 3300009148 Ga0105243_10067387 Ga0105243_100673874 106
692 3300009148 Ga0105243_12030858 Ga0105243_120308581 106
693 3300009174 Ga0105241_10001363 Ga0105241_100013638 106
694 3300009174 Ga0105241_10090215 Ga0105241_100902154 106
695 3300009177 Ga0105248_12043660 Ga0105248_120436601 106
696 3300009545 Ga0105237_10039744 Ga0105237_100397445 106
697 3300009545 Ga0105237_10055645 Ga0105237_100556454 106
698 3300009545 Ga0105237_10222648 Ga0105237_102226482 106
699 3300009545 Ga0105237_10388742 Ga0105237_103887423 106
700 3300009545 Ga0105237_10643275 Ga0105237_106432751 106
701 3300009551 Ga0105238_10002947 Ga0105238_100029477 106
702 3300009551 Ga0105238_10030532 Ga0105238_100305325 106
703 3300009551 Ga0105238_10031424 Ga0105238_100314242 106
704 3300009551 Ga0105238_10068105 Ga0105238_100681053 106
705 3300009551 Ga0105238_10092256 Ga0105238_100922564 106
706 3300009551 Ga0105238_11017676 Ga0105238_110176761 106
707 3300009553 Ga0105249_10000005 Ga0105249_100000057 106
708 3300009553 Ga0105249_10009245 Ga0105249_100092455 106
709 3300009553 Ga0105249_10012758 Ga0105249_100127584 106
710 3300009553 Ga0105249_12052843 Ga0105249_120528431 106
711 3300010375 Ga0105239_10040953 Ga0105239_100409532 106
712 3300010375 Ga0105239_10047285 Ga0105239_100472855 106
713 3300010375 Ga0105239_10349828 Ga0105239_103498283 106
714 3300010375 Ga0105239_10546007 Ga0105239_105460071 106
715 3300010375 Ga0105239_10687205 Ga0105239_106872051 106
716 3300010375 Ga0105239_11278368 Ga0105239_112783682 106
717 3300010375 Ga0105239_13354114 Ga0105239_133541141 106
718 3300011119 Ga0105246_10609175 Ga0105246_106091751 106
719 3300011119 Ga0105246_11830796 Ga0105246_118307961 106
720 3300013100 Ga0157373_10097581 Ga0157373_100975812 106
721 3300013104 Ga0157370_10183250 Ga0157370_101832501 106
722 3300013104 Ga0157370_10200033 Ga0157370_102000334 106
723 3300013105 Ga0157369_10015667 Ga0157369_100156675 106
724 3300013105 Ga0157369_10017908 Ga0157369_1001790812 106
725 3300013105 Ga0157369_10627040 Ga0157369_106270402 106
726 3300013105 Ga0157369_11171167 Ga0157369_111711671 106
727 3300013105 Ga0157369_11395223 Ga0157369_113952231 106
728 3300013296 Ga0157374_10358274 Ga0157374_103582741 106
729 3300013296 Ga0157374_10689565 Ga0157374_106895651 106
730 3300013297 Ga0157378_10089372 Ga0157378_100893722 106
731 3300013306 Ga0163162_10336202 Ga0163162_103362021 106
732 3300013307 Ga0157372_10150953 Ga0157372_101509534 106
733 3300013307 Ga0157372_13152796 Ga0157372_131527961 106
734 3300014325 Ga0163163_10195588 Ga0163163_101955881 106
735 3300014326 Ga0157380_11782260 Ga0157380_117822601 106
736 3300014968 Ga0157379_10003511 Ga0157379_1000351120 106
737 3300017792 Ga0163161_10000106 Ga0163161_1000010676 106
738 3300017792 Ga0163161_10367987 Ga0163161_103679871 106
739 3300025261 Ga0209233_1000010 Ga0209233_1000010731 106
740 3300025298 Ga0209050_1000406 Ga0209050_100040614 106
741 3300025315 Ga0207697_10000121 Ga0207697_1000012133 106
742 3300025321 Ga0207656_10037726 Ga0207656_100377261 106
743 3300025321 Ga0207656_10119203 Ga0207656_101192031 106
744 3300025711 Ga0207696_1208051 Ga0207696_12080511 106
745 3300025903 Ga0207680_10000004 Ga0207680_10000004133 106
746 3300025904 Ga0207647_10015569 Ga0207647_100155695 106
747 3300025904 Ga0207647_10117185 Ga0207647_101171854 106
748 3300025909 Ga0207705_10213548 Ga0207705_102135482 106
749 3300025911 Ga0207654_10000427 Ga0207654_100004276 106
750 3300025911 Ga0207654_10002086 Ga0207654_100020865 106
751 3300025911 Ga0207654_10005142 Ga0207654_100051425 106
752 3300025911 Ga0207654_10557832 Ga0207654_105578321 106
753 3300025912 Ga0207707_10330595 Ga0207707_103305951 106
754 3300025913 Ga0207695_10002056 Ga0207695_1000205618 106
755 3300025913 Ga0207695_10002363 Ga0207695_1000236322 106
756 3300025913 Ga0207695_10012343 Ga0207695_100123439 106
757 3300025913 Ga0207695_10022675 Ga0207695_100226755 106
758 3300025914 Ga0207671_10016463 Ga0207671_100164634 106
759 3300025914 Ga0207671_10019223 Ga0207671_100192235 106
760 3300025914 Ga0207671_10141288 Ga0207671_101412882 106
761 3300025914 Ga0207671_10167784 Ga0207671_101677842 106
762 3300025914 Ga0207671_10284000 Ga0207671_102840003 106
763 3300025917 Ga0207660_10022455 Ga0207660_100224554 106
764 3300025918 Ga0207662_10295156 Ga0207662_102951561 106
765 3300025918 Ga0207662_11367897 Ga0207662_113678971 106
766 3300025919 Ga0207657_10002145 Ga0207657_1000214511 106
767 3300025920 Ga0207649_11534035 Ga0207649_115340352 106
768 3300025921 Ga0207652_11639433 Ga0207652_116394331 106
769 3300025923 Ga0207681_10000050 Ga0207681_1000005035 106
770 3300025923 Ga0207681_11456773 Ga0207681_114567731 106
771 3300025924 Ga0207694_10000230 Ga0207694_1000023018 106
772 3300025924 Ga0207694_10000630 Ga0207694_100006305 106
773 3300025924 Ga0207694_10005011 Ga0207694_100050119 106
774 3300025924 Ga0207694_10017772 Ga0207694_100177725 106
775 3300025924 Ga0207694_10021833 Ga0207694_100218332 106
776 3300025924 Ga0207694_10322962 Ga0207694_103229621 106
777 3300025927 Ga0207687_10001319 Ga0207687_1000131913 106
778 3300025931 Ga0207644_10000028 Ga0207644_10000028133 106
779 3300025932 Ga0207690_10000052 Ga0207690_1000005252 106
780 3300025932 Ga0207690_10228136 Ga0207690_102281361 106
781 3300025932 Ga0207690_10288693 Ga0207690_102886933 106
782 3300025933 Ga0207706_10040418 Ga0207706_100404185 106
783 3300025933 Ga0207706_10070809 Ga0207706_100708092 106
784 3300025935 Ga0207709_10124475 Ga0207709_101244752 106
785 3300025941 Ga0207711_10005403 Ga0207711_100054036 106
786 3300025942 Ga0207689_10278481 Ga0207689_102784811 106
787 3300025945 Ga0207679_10382189 Ga0207679_103821891 106
788 3300025949 Ga0207667_10000459 Ga0207667_1000045937 106
789 3300025949 Ga0207667_10004045 Ga0207667_1000404524 106
790 3300025949 Ga0207667_10013903 Ga0207667_100139034 106
791 3300025949 Ga0207667_10088942 Ga0207667_100889425 106
792 3300025961 Ga0207712_10000001 Ga0207712_100000017 106
793 3300025961 Ga0207712_10001025 Ga0207712_100010258 106
794 3300025961 Ga0207712_10024738 Ga0207712_100247384 106
795 3300025961 Ga0207712_10030145 Ga0207712_100301455 106
796 3300025961 Ga0207712_10135203 Ga0207712_101352032 106
797 3300025981 Ga0207640_10019858 Ga0207640_100198583 106
798 3300025981 Ga0207640_10075647 Ga0207640_100756474 106
799 3300025981 Ga0207640_10133334 Ga0207640_101333342 106
800 3300025981 Ga0207640_10381697 Ga0207640_103816972 106
801 3300025986 Ga0207658_10001581 Ga0207658_1000158118 106
802 3300026041 Ga0207639_10023205 Ga0207639_100232053 106
803 3300026041 Ga0207639_10035055 Ga0207639_100350555 106
804 3300026041 Ga0207639_10039794 Ga0207639_100397945 106
805 3300026041 Ga0207639_11468050 Ga0207639_114680501 106
806 3300026067 Ga0207678_10016767 Ga0207678_100167679 106
807 3300026067 Ga0207678_10131857 Ga0207678_101318572 106
808 3300026067 Ga0207678_10712641 Ga0207678_107126413 106
809 3300026078 Ga0207702_10001212 Ga0207702_1000121224 106
810 3300026078 Ga0207702_10013506 Ga0207702_100135065 106
811 3300026078 Ga0207702_10019567 Ga0207702_100195675 106
812 3300026078 Ga0207702_11510606 Ga0207702_115106062 106
813 3300026089 Ga0207648_11443073 Ga0207648_114430731 106
814 3300026095 Ga0207676_10000373 Ga0207676_1000037340 106
815 3300026095 Ga0207676_10075784 Ga0207676_100757843 106
816 3300026116 Ga0207674_10021996 Ga0207674_100219965 106
817 3300026116 Ga0207674_10192263 Ga0207674_101922632 106
818 3300026116 Ga0207674_10267776 Ga0207674_102677763 106
819 3300026116 Ga0207674_10349866 Ga0207674_103498661 106
820 3300026116 Ga0207674_11295992 Ga0207674_112959921 106
821 3300026118 Ga0207675_100445303 Ga0207675_1004453032 106
822 3300026142 Ga0207698_10000574 Ga0207698_1000057413 106
823 3300026142 Ga0207698_10003339 Ga0207698_100033394 106
824 3300026142 Ga0207698_10006940 Ga0207698_100069406 106
825 3300026142 Ga0207698_10015464 Ga0207698_100154644 106
826 3300026142 Ga0207698_10721355 Ga0207698_107213551 106
827 3300026142 Ga0207698_11820681 Ga0207698_118206812 106
828 3300027111 Ga0209281_1006280 Ga0209281_10062804 106
829 3300027111 Ga0209281_1018975 Ga0209281_10189753 106
830 3300027111 Ga0209281_1056565 Ga0209281_10565651 106
831 3300027717 Ga0209998_10118785 Ga0209998_101187851 106
832 3300028379 Ga0268266_10339734 Ga0268266_103397342 106
833 3300028379 Ga0268266_10759408 Ga0268266_107594081 106
834 3300028380 Ga0268265_10000102 Ga0268265_1000010278 106
835 3300028380 Ga0268265_10004378 Ga0268265_100043789 106
836 3300028380 Ga0268265_10406463 Ga0268265_104064633 106
837 3300028381 Ga0268264_10000006 Ga0268264_10000006133 106
838 3300028381 Ga0268264_10007910 Ga0268264_100079103 106
839 3300028381 Ga0268264_10011731 Ga0268264_100117312 106
840 3300028381 Ga0268264_10130223 Ga0268264_101302232 106
841 3300028786 Ga0307517_10000875 Ga0307517_1000087551 106
842 3300028786 Ga0307517_10189109 Ga0307517_101891092 106
843 3300031456 Ga0307513_10696404 Ga0307513_106964042 106
844 3300031548 Ga0307408_100000067 Ga0307408_10000006730 106
845 3300033180 Ga0307510_10108145 Ga0307510_101081453 106
846 3300033180 Ga0307510_10402613 Ga0307510_104026132 106
847 3300034817 Ga0373948_0046403 Ga0373948_0046403_374_697 106
848 3300035114 Ga0373939_0002076 Ga0373939_0002076_3981_4304 106
849 3300035207 Ga0373942_0010804 Ga0373942_0010804_118_441 106
850 3300037418 Ga0395900_0947859 Ga0395900_0947859_363_686 106
851 3300037471 Ga0395905_1343653 Ga0395905_1343653_45_368 106
852 3300038443 Ga0395901_0804351 Ga0395901_0804351_21_344 106
853 3300041451 Ga0451791_0444167 Ga0451791_0444167_104_424 106
854 3300042157 Ga0439458_0175962 Ga0439458_0175962_99_422 106
855 3300045836 Ga0466958_0426494 Ga0466958_0426494_121_444 106
856 3300046453 Ga0495627_001084 Ga0495627_001084_13336_13656 106
857 3300046453 Ga0495627_046234 Ga0495627_046234_58_378 106
858 3300046517 Ga0495630_1163449 Ga0495630_1163449_72_395 106
859 3300046522 Ga0495643_0057875 Ga0495643_0057875_1720_2043 106
860 3300046524 Ga0495648_0014058 Ga0495648_0014058_4095_4415 106
861 3300046524 Ga0495648_0493063 Ga0495648_0493063_158_478 106
862 3300046616 Ga0495668_0330702 Ga0495668_0330702_469_792 106
863 3300046660 Ga0495625_0024031 Ga0495625_0024031_790_1113 106
864 3300046660 Ga0495625_0133650 Ga0495625_0133650_37_357 106
865 3300046660 Ga0495625_0788048 Ga0495625_0788048_154_474 106
866 3300047443 Ga0495687_152993 Ga0495687_152993_426_749 106
867 3300047472 Ga0495686_0000469 Ga0495686_0000469_29644_29967 106
868 3300048903 Ga0496100_1582580 Ga0496100_1582580_157_480 106
869 3300048904 Ga0496101_1032371 Ga0496101_1032371_137_457 106
870 3300048905 Ga0496102_0257902 Ga0496102_0257902_10_333 106
871 3300048905 Ga0496102_1461328 Ga0496102_1461328_203_526 106
872 3300048906 Ga0496103_0006078 Ga0496103_0006078_6800_7123 106
873 3300048909 Ga0496106_0004035 Ga0496106_0004035_81_404 106
874 3300048909 Ga0496106_0037937 Ga0496106_0037937_118_441 106
875 3300048909 Ga0496106_0545266 Ga0496106_0545266_486_806 106
876 3300048910 Ga0496107_0005932 Ga0496107_0005932_8007_8330 106
877 3300048915 Ga0496112_0505880 Ga0496112_0505880_270_593 106
878 3300048918 Ga0496115_0032342 Ga0496115_0032342_3686_4009 106
879 3300048919 Ga0496116_0206109 Ga0496116_0206109_484_804 106
880 3300048924 Ga0496121_0119204 Ga0496121_0119204_322_642 106
881 3300048924 Ga0496121_0172138 Ga0496121_0172138_1228_1548 106
882 3300048927 Ga0496124_0063407 Ga0496124_0063407_1593_1913 106
883 3300048928 Ga0496125_0011563 Ga0496125_0011563_4789_5109 106
884 3300048928 Ga0496125_0071374 Ga0496125_0071374_1291_1611 106
885 3300048929 Ga0496126_0011486 Ga0496126_0011486_4783_5103 106
886 3300048929 Ga0496126_0159368 Ga0496126_0159368_1586_1912 106
887 3300049572 Ga0501036_1006164 Ga0501036_1006164_347_670 106
888 3300049572 Ga0501036_1432990 Ga0501036_1432990_188_511 106
889 3300049573 Ga0501037_0981721 Ga0501037_0981721_41_364 106
890 3300049574 Ga0501038_1226926 Ga0501038_1226926_41_364 106
891 3300049576 Ga0501040_0363499 Ga0501040_0363499_585_908 106
892 3300049576 Ga0501040_1123383 Ga0501040_1123383_107_430 106
893 3300049577 Ga0501041_0630792 Ga0501041_0630792_314_637 106
894 3300049578 Ga0501042_0491677 Ga0501042_0491677_43_366 106
895 3300049581 Ga0501047_0091336 Ga0501047_0091336_1149_1469 106
896 3300049581 Ga0501047_0723820 Ga0501047_0723820_329_649 106
897 3300049581 Ga0501047_1288199 Ga0501047_1288199_43_363 106
898 3300049582 Ga0501048_0725016 Ga0501048_0725016_316_636 106
899 3300049586 Ga0501070_1382227 Ga0501070_1382227_169_489 106
900 3300049587 Ga0501071_0130701 Ga0501071_0130701_200_520 106
901 3300049588 Ga0501072_0604222 Ga0501072_0604222_407_730 106
902 3300049591 Ga0501075_0410518 Ga0501075_0410518_602_925 106
903 3300049592 Ga0501076_0394561 Ga0501076_0394561_315_638 106
904 3300049593 Ga0501077_0369111 Ga0501077_0369111_88_411 106
905 3300049679 Ga0501249_000397 Ga0501249_000397_6185_6505 106
906 3300049741 Ga0501079_0713898 Ga0501079_0713898_456_779 106
907 3300050492 nmdc:mga0yw44_177140_c1 nmdc:mga0yw44_177140_c1_83_406 106
908 3300050493 nmdc:mga0k408_111219_c1 nmdc:mga0k408_111219_c1_214_534 106
909 3300050493 nmdc:mga0k408_307063_c1 nmdc:mga0k408_307063_c1_21_341 106
910 3300050494 nmdc:mga06z11_112384_c1 nmdc:mga06z11_112384_c1_1071_1394 106
911 3300050496 nmdc:mga07m45_28170_c1 nmdc:mga07m45_28170_c1_2186_2506 106
912 3300050496 nmdc:mga07m45_552709_c1 nmdc:mga07m45_552709_c1_235_558 106
913 3300050496 nmdc:mga07m45_746589_c1 nmdc:mga07m45_746589_c1_225_545 106
914 3300050509 nmdc:mga0qj67_1522703_c1 nmdc:mga0qj67_1522703_c1_40_363 106
915 3300050510 nmdc:mga06r32_915235_c1 nmdc:mga06r32_915235_c1_183_506 106
916 3300053080 Ga0500635_0335076 Ga0500635_0335076_45_368 106
917 3300053088 Ga0500644_0015454 Ga0500644_0015454_1004_1330 106
918 3300053093 Ga0500651_0021989 Ga0500651_0021989_633_959 106
919 3300053093 Ga0500651_0683851 Ga0500651_0683851_184_507 106
920 3300053119 Ga0500595_057278 Ga0500595_057278_82_402 106
921 3300053136 Ga0500559_0022081 Ga0500559_0022081_1540_1866 106
922 3300053136 Ga0500559_0031307 Ga0500559_0031307_1151_1477 106
923 3300053148 Ga0500590_000019 Ga0500590_000019_39601_39921 106
924 3300053178 Ga0500637_0122189 Ga0500637_0122189_564_887 106

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05284

DUF736

Protein of unknown function (DUF736)

14

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tt9-assembly2.cif.gz_C structure of the c-terminal spoa domain of shigella flexneri spa33 0.563 24 72
5hut-assembly1.cif.gz_A structure of candida albicans trehalose-6-phosphate synthase in complex with udp-glucose 0.5502 3 23
1o6a-assembly1.cif.gz_A crystal structure of a c-terminal fragment of the putative flagellar motor switch protein flin (tm0680) from thermotoga maritima at 1.85 a resolution 0.5273 22 77
1yab-assembly2.cif.gz_B structure of t. maritima flin flagellar rotor protein 0.5263 24 77
1o6a-assembly1.cif.gz_B crystal structure of a c-terminal fragment of the putative flagellar motor switch protein flin (tm0680) from thermotoga maritima at 1.85 a resolution 0.5207 24 77
ID Description Score Start End Superfamily
af_Q5ANJ0_28_112_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.6298 37 72 3.30.200.20
af_A0A0P0X457_113_319_2.120.10.80 Mainly Beta;6 Propeller;Neuraminidase;Kelch-type beta propeller 0.6235 53 100 2.120.10.80
af_Q7XZV4_359_445_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6205 53 87 3.30.160.20
af_Q21764_3_113_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.5565 53 99 3.30.505.10
3tfyA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5417 43 79 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A530B8C4-F1-model_v4 deleted 0.9498 29 104
AF-A0A530QZT3-F1-model_v4 DUF736 family protein 0.9245 19 104
AF-A0A440Y3V5-F1-model_v4 DUF736 family protein 0.8975 19 86
AF-A0A530B8C4-F1-model_v4 deleted 0.8935 29 104
AF-A0A062V8W0-F1-model_v4 DUF736 domain-containing protein 0.881 53 104

Feature Viewer

pLDDT pTM Quality
89.88 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map