F485648

General Info

Members Datasets Scaffolds Average Seq Length
917 322 865 310

Family's Representative Sequence

Representative Sequence 3300046538|Ga0495609_0025283|Ga0495609_0025283_520_1506
Length 328
Sequence MSDFTSGFWNYYIITLTMLGVFGCAVLLYSQSKHKVKALKDASSKHHAPVGTTGHIWDEDLTELNTPMPRWWMWLFYITIVFGLAYLFLYPGLGDYAGKLGWKSSGQYGAELKQAEAEYGPLFNQYLKQDLPAVAADPKAQAIGERLFLTYCAQCHGSDARGNKGFPNLTDKDWLYGGAPDVIKTTIMNGRHGVMPPMGAALGSDKDVENVAHYVLSLSGGAADPIKSVFGKSKFNACMGCHTGAGTGNQALGAPNLTDKVWLYGGSAETIMETIRKGRNNTMPAFADFLGEGKVHVLAAYVWGLSNQPAVAAAPAQGNSNERAGTSH

Samples

Sample ID Description Type Environment
1 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
2 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
3 2547132512 Azospira oryzae 6a3 Isolate Unclassified
4 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
5 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
6 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
7 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
8 2643221556 Massilia sp. Root1485 Isolate Unclassified
9 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
10 2643221638 Duganella sp. Root336D2 Isolate Unclassified
11 2643221645 Massilia sp. Root351 Isolate Unclassified
12 2643221664 Massilia sp. Root418 Isolate Unclassified
13 2643221684 Massilia sp. Root133 Isolate Unclassified
14 2738541280 Massilia sp. GV090 Isolate Unclassified
15 2738541297 Duganella sp. GV083 Isolate Unclassified
16 2738541300 Massilia sp. GV016 Isolate Unclassified
17 2738541357 Duganella sp. GV053 Isolate Unclassified
18 2738543003 Duganella sp. GV066 Isolate Unclassified
19 2738543018 Massilia sp. GV045 Isolate Unclassified
20 2738543026 Duganella sp. GV089 Isolate Unclassified
21 2738543029 Duganella sp. GV039 Isolate Unclassified
22 2738543030 Massilia sp. GV097 Isolate Unclassified
23 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
24 2818991436 Collimonas arenae 515 Isolate Unclassified
25 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
26 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
27 2821131069 Duganella sp. 1224 Isolate Unclassified
28 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
29 2842711865 Duganella sp. R-73148 Isolate Unclassified
30 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
31 2857553236 Duganella sp. R-74557 Isolate Unclassified
32 2857558681 Duganella sp. R-74565 Isolate Unclassified
33 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
34 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
35 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
36 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
37 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
38 2904424332 Duganella sp. 1411 Isolate Rhizosphere
39 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
40 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
41 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
42 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
43 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
44 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
45 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
46 2919476304 Duganella sp. 3397 Isolate Unclassified
47 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
48 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
49 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
50 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
51 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
52 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
53 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
56 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
57 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
58 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
59 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
60 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
61 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
62 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
63 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
64 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
65 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
66 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
67 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
68 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
69 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
70 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
71 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
72 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
73 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
74 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
75 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
76 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
77 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
78 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
79 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
80 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
81 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
82 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
83 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
84 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
87 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
88 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
89 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
90 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
91 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
94 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
95 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
114 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
115 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
116 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
124 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
125 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
126 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
167 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
183 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
184 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
185 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
186 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
194 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
198 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
203 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
212 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
213 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
214 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
215 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
220 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
221 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
222 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
223 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
229 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
230 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
231 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
232 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
245 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
246 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
254 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
255 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
256 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
257 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
261 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
262 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
263 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
264 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
265 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
266 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
267 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
268 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
269 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
270 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
271 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
272 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
275 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
288 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
289 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
290 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
291 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
292 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
293 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
294 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
295 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
304 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
305 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
306 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
307 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
308 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
309 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
314 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
315 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
316 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
317 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
318 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
319 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
320 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
321 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
322 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.33
Metatranscriptomes 0.11
Isolates 5.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.8
Nodule 0.55
Rhizoplane 3.38
Rhizosphere 75.25
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000045 3300002704 Bacteria 85779
2 JGI25155J39150_1000256 3300002704 Bacteria 20230
3 JGI25156J39149_1000054 3300002705 Bacteria 88728
4 JGI25156J39149_1002432 3300002705 Bacteria 6680
5 JGI25162J39368_1003970 3300002737 Bacteria 3768
6 JGI25154J39366_1000083 3300002738 Bacteria 88728
7 JGI25154J39366_1000474 3300002738 Bacteria 20990
8 JGI25154J39366_1001206 3300002738 Bacteria 9789
9 JGI25158J39367_1002133 3300002739 Bacteria 3308
10 JGI25157J39369_1000208 3300002741 Bacteria 48951
11 JGI25152J39213_1002579 3300002773 Bacteria 6785
12 JGI25152J39213_1007431 3300002773 Bacteria 2837
13 JGI25150J39212_1002242 3300002774 Bacteria 4906
14 JGI25150J39212_1013348 3300002774 Bacteria 1427
15 JGI25159J45721_1001029 3300002987 Bacteria 11977
16 JGI25159J45721_1002206 3300002987 Bacteria 7551
17 JGI25153J46596_10012384 3300003215 Bacteria 3684
18 rootL2_10090070 3300003322 Bacteria 1381
19 rootL2_10174602 3300003322 Bacteria 2100
20 JGI25161J50226_1000734 3300003374 Bacteria 12666
21 Ga0055538_1000030 3300003751 Bacteria 200831
22 Ga0055539_1000040 3300003752 Bacteria 200831
23 Ga0055533_1000050 3300003756 Bacteria 200831
24 Ga0055532_1000099 3300003758 Bacteria 93811
25 Ga0055525_1000001 3300003759 Bacteria 1016948
26 Ga0055525_1000060 3300003759 Bacteria 200831
27 Ga0055529_1000015 3300003763 Bacteria 366950
28 Ga0055526_1000007 3300003771 Bacteria 321998
29 Ga0055526_1000054 3300003771 Bacteria 113702
30 Ga0055526_1000885 3300003771 Bacteria 22279
31 Ga0055526_1001567 3300003771 Bacteria 16105
32 Ga0055526_1011491 3300003771 Bacteria 3978
33 Ga0055537_1000005 3300003773 Bacteria 160497
34 Ga0055537_1003477 3300003773 Bacteria 4834
35 Ga0055524_1000038 3300003775 Bacteria 162683
36 Ga0055524_1002845 3300003775 Bacteria 8677
37 Ga0055524_1006360 3300003775 Bacteria 5129
38 Ga0055524_1028267 3300003775 Bacteria 1683
39 Ga0055534_1000127 3300003784 Bacteria 57100
40 Ga0055534_1001049 3300003784 Bacteria 12013
41 Ga0055528_1000063 3300003790 Bacteria 85587
42 Ga0055528_1002242 3300003790 Bacteria 10530
43 Ga0055530_10001675 3300003791 Bacteria 15727
44 Ga0055541_1000027 3300003841 Bacteria 200831
45 Ga0055543_1001698 3300004625 Bacteria 8318
46 Ga0065165_1000034 3300005262 Bacteria 214644
47 Ga0065165_1003016 3300005262 Bacteria 12704
48 Ga0065714_10008082 3300005288 Bacteria 4227
49 Ga0070658_10066568 3300005327 Bacteria 2943
50 Ga0070670_100002673 3300005331 Bacteria 14724
51 Ga0070660_100008707 3300005339 Bacteria 7103
52 Ga0070661_100017505 3300005344 Bacteria 5086
53 Ga0070661_100460774 3300005344 Bacteria 1012
54 Ga0070668_100108862 3300005347 Bacteria 2204
55 Ga0070673_100052053 3300005364 Bacteria 3211
56 Ga0070659_100000456 3300005366 Bacteria 30202
57 Ga0070659_100059246 3300005366 Bacteria 3023
58 Ga0070678_100599754 3300005456 Bacteria 983
59 Ga0070681_10224156 3300005458 Bacteria 1795
60 Ga0070672_100076017 3300005543 Bacteria 2682
61 Ga0068855_100000243 3300005563 Bacteria 68537
62 Ga0068855_100001100 3300005563 Bacteria 33596
63 Ga0068855_100011885 3300005563 Bacteria 10526
64 Ga0068855_100059076 3300005563 Bacteria 4488
65 Ga0068855_100280904 3300005563 Bacteria 1849
66 Ga0070664_100049799 3300005564 Bacteria 3543
67 Ga0070664_100148823 3300005564 Bacteria 2066
68 Ga0068854_100071853 3300005578 Bacteria 2532
69 Ga0068852_100245011 3300005616 Bacteria 1715
70 Ga0068852_100369736 3300005616 Bacteria 1404
71 Ga0068852_100415233 3300005616 Bacteria 1326
72 Ga0068864_100001909 3300005618 Bacteria 17108
73 Ga0068863_100003624 3300005841 Bacteria 15249
74 Ga0105244_10001568 3300009036 Bacteria 18161
75 Ga0105244_10030858 3300009036 Bacteria 2848
76 Ga0105240_10002667 3300009093 Bacteria 28399
77 Ga0105240_10012212 3300009093 Bacteria 11874
78 Ga0105240_10038896 3300009093 Bacteria 6098
79 Ga0105240_10280612 3300009093 Bacteria 1914
80 Ga0105245_10247558 3300009098 Bacteria 1730
81 Ga0105243_10058147 3300009148 Bacteria 3081
82 Ga0105243_10103814 3300009148 Bacteria 2364
83 Ga0105242_10091289 3300009176 Bacteria 2564
84 Ga0105237_10041247 3300009545 Bacteria 4656
85 Ga0105238_10000547 3300009551 Bacteria 39292
86 Ga0105239_10006605 3300010375 Bacteria 13429
87 Ga0105239_10322528 3300010375 Bacteria 1742
88 Ga0157370_10010253 3300013104 Bacteria 9894
89 Ga0157374_10121038 3300013296 Bacteria 2526
90 Ga0157372_10283305 3300013307 Bacteria 1927
91 Ga0163163_10005831 3300014325 Bacteria 10709
92 Ga0182008_10000542 3300014497 Bacteria 28046
93 Ga0182008_10065918 3300014497 Bacteria 1781
94 Ga0157376_10396373 3300014969 Bacteria 1333
95 Ga0182006_1000007 3300015261 Bacteria 452190
96 Ga0182006_1000023 3300015261 Bacteria 275031
97 Ga0182006_1002414 3300015261 Bacteria 10211
98 Ga0182007_10000022 3300015262 Bacteria 189018
99 Ga0182007_10002459 3300015262 Bacteria 9202
100 Ga0182007_10071288 3300015262 Bacteria 1138
101 Ga0182005_1000006 3300015265 Bacteria 515188
102 Ga0182005_1000010 3300015265 Bacteria 434103
103 Ga0163161_10228890 3300017792 Bacteria 1442
104 Ga0213872_10000087 3300021361 Bacteria 84858
105 Ga0213872_10000157 3300021361 Bacteria 62892
106 Ga0213872_10000703 3300021361 Bacteria 25156
107 Ga0213872_10016017 3300021361 Bacteria 3482
108 Ga0213872_10027347 3300021361 Bacteria 2618
109 Ga0209435_100034 3300025206 Bacteria 144486
110 Ga0209435_100074 3300025206 Bacteria 55837
111 Ga0209436_100040 3300025208 Bacteria 75392
112 Ga0209436_104332 3300025208 Bacteria 3528
113 Ga0209784_100005 3300025224 Bacteria 1040422
114 Ga0209566_100005 3300025225 Bacteria 1040422
115 Ga0209674_100009 3300025226 Bacteria 1040422
116 Ga0209147_100004 3300025229 Bacteria 1371850
117 Ga0209563_100007 3300025230 Bacteria 1579402
118 Ga0209563_100012 3300025230 Bacteria 1040422
119 Ga0209437_100072 3300025233 Bacteria 305152
120 Ga0209437_101483 3300025233 Bacteria 5640
121 Ga0209437_109253 3300025233 Bacteria 1545
122 Ga0209258_100417 3300025242 Bacteria 50597
123 Ga0207425_1000009 3300025245 Bacteria 593135
124 Ga0207425_1000036 3300025245 Bacteria 225783
125 Ga0207425_1001550 3300025245 Bacteria 9376
126 Ga0209646_1000042 3300025246 Bacteria 343923
127 Ga0209646_1000057 3300025246 Bacteria 266384
128 Ga0209646_1000118 3300025246 Bacteria 149446
129 Ga0209026_1000106 3300025250 Bacteria 149446
130 Ga0209026_1002894 3300025250 Bacteria 6033
131 Ga0209026_1006544 3300025250 Bacteria 2826
132 Ga0209677_100006 3300025253 Bacteria 1040422
133 Ga0209677_102284 3300025253 Bacteria 7391
134 Ga0209759_1000112 3300025256 Bacteria 143361
135 Ga0209759_1000190 3300025256 Bacteria 97956
136 Ga0209129_1000051 3300025258 Bacteria 267104
137 Ga0209129_1016008 3300025258 Bacteria 1520
138 Ga0209565_1000074 3300025263 Bacteria 164237
139 Ga0209565_1000662 3300025263 Bacteria 21980
140 Ga0209565_1001767 3300025263 Bacteria 8797
141 Ga0209565_1005640 3300025263 Bacteria 3618
142 Ga0209565_1021237 3300025263 Bacteria 1360
143 Ga0209455_1000031 3300025272 Bacteria 519952
144 Ga0209455_1010197 3300025272 Bacteria 2405
145 Ga0209673_1000129 3300025273 Bacteria 164238
146 Ga0209673_1006223 3300025273 Bacteria 5825
147 Ga0209130_1000016 3300025284 Bacteria 395540
148 Ga0209130_1000217 3300025284 Bacteria 75515
149 Ga0209130_1004379 3300025284 Bacteria 5385
150 Ga0209675_1000072 3300025291 Bacteria 164237
151 Ga0209675_1023079 3300025291 Bacteria 1619
152 Ga0209025_1004319 3300025294 Bacteria 12434
153 Ga0209564_1000010 3300025295 Bacteria 885399
154 Ga0209564_1000042 3300025295 Bacteria 392805
155 Ga0209564_1000160 3300025295 Bacteria 164214
156 Ga0209564_1000172 3300025295 Bacteria 155715
157 Ga0209564_1009057 3300025295 Bacteria 4795
158 Ga0209564_1016727 3300025295 Bacteria 2899
159 Ga0209758_1000054 3300025297 Bacteria 337655
160 Ga0209758_1000379 3300025297 Bacteria 77337
161 Ga0209050_1000040 3300025298 Bacteria 408492
162 Ga0209050_1000309 3300025298 Bacteria 99432
163 Ga0209050_1040797 3300025298 Bacteria 1287
164 Ga0209256_1000018 3300025299 Bacteria 568467
165 Ga0209256_1000125 3300025299 Bacteria 165336
166 Ga0209256_1000307 3300025299 Bacteria 85852
167 Ga0209256_1000553 3300025299 Bacteria 53682
168 Ga0209256_1001812 3300025299 Bacteria 20078
169 Ga0207426_1020060 3300025302 Bacteria 2329
170 Ga0209051_1001406 3300025303 Bacteria 20679
171 Ga0209051_1006685 3300025303 Bacteria 6450
172 Ga0209051_1009224 3300025303 Bacteria 5106
173 Ga0209257_1000054 3300025304 Bacteria 416957
174 Ga0207655_1002256 3300025728 Bacteria 15935
175 Ga0207655_1002948 3300025728 Bacteria 13082
176 Ga0207643_10197902 3300025908 Bacteria 1223
177 Ga0207707_10182984 3300025912 Bacteria 1829
178 Ga0207695_10000913 3300025913 Bacteria 52943
179 Ga0207695_10005170 3300025913 Bacteria 17468
180 Ga0207695_10019098 3300025913 Bacteria 7905
181 Ga0207695_10260951 3300025913 Bacteria 1630
182 Ga0207671_10011896 3300025914 Bacteria 7038
183 Ga0207657_10001579 3300025919 Bacteria 24470
184 Ga0207657_10018104 3300025919 Bacteria 6739
185 Ga0207649_10015582 3300025920 Bacteria 4270
186 Ga0207649_10321686 3300025920 Bacteria 1137
187 Ga0207694_10002807 3300025924 Bacteria 14066
188 Ga0207650_10007503 3300025925 Bacteria 7436
189 Ga0207650_10214918 3300025925 Bacteria 1545
190 Ga0207659_10022051 3300025926 Bacteria 4237
191 Ga0207690_10117401 3300025932 Bacteria 1926
192 Ga0207690_10178372 3300025932 Bacteria 1597
193 Ga0207686_10051518 3300025934 Bacteria 2565
194 Ga0207709_10037826 3300025935 Bacteria 2869
195 Ga0207709_10085497 3300025935 Bacteria 2045
196 Ga0207691_10078797 3300025940 Bacteria 2965
197 Ga0207679_10028672 3300025945 Bacteria 3866
198 Ga0207679_10122745 3300025945 Bacteria 2071
199 Ga0207667_10000301 3300025949 Bacteria 68551
200 Ga0207667_10008602 3300025949 Bacteria 12112
201 Ga0207667_10038852 3300025949 Bacteria 5077
202 Ga0207667_10086607 3300025949 Bacteria 3242
203 Ga0207667_10136832 3300025949 Bacteria 2522
204 Ga0207667_10222943 3300025949 Bacteria 1932
205 Ga0207668_10256405 3300025972 Bacteria 1423
206 Ga0207658_10125403 3300025986 Bacteria 2054
207 Ga0207702_10158586 3300026078 Bacteria 2065
208 Ga0207641_10003573 3300026088 Bacteria 13744
209 Ga0207676_10001593 3300026095 Bacteria 16712
210 Ga0207698_10187727 3300026142 Bacteria 1837
211 Ga0207698_10387524 3300026142 Bacteria 1331
212 Ga0209281_1004072 3300027111 Bacteria 4509
213 Ga0209282_1000005 3300027666 Bacteria 380858
214 Ga0316177_1040718 3300030731 Bacteria 2796
215 Ga0316181_1174308 3300030744 Bacteria 2472
216 Ga0265328_10048929 3300031239 Bacteria 1553
217 Ga0265327_10008459 3300031251 Bacteria 7654
218 Ga0265316_10000192 3300031344 Bacteria 70550
219 Ga0307408_100000144 3300031548 Bacteria 79329
220 Ga0307408_100002435 3300031548 Bacteria 13086
221 Ga0307408_100002837 3300031548 Bacteria 12018
222 Ga0307408_100003117 3300031548 Bacteria 11424
223 Ga0265314_10016398 3300031711 Bacteria 5853
224 Ga0307416_100013859 3300032002 Bacteria 5496
225 Ga0373933_0162110 3300035724 Bacteria 1420
226 Ga0395899_0004277 3300037312 Bacteria 11166
227 Ga0395899_0009167 3300037312 Bacteria 7600
228 Ga0395899_0017209 3300037312 Bacteria 5508
229 Ga0395899_0019216 3300037312 Bacteria 5193
230 Ga0395900_0000826 3300037418 Bacteria 40904
231 Ga0395900_0017822 3300037418 Bacteria 7248
232 Ga0395900_0019747 3300037418 Bacteria 6868
233 Ga0395900_0074854 3300037418 Bacteria 3480
234 Ga0395900_0131159 3300037418 Bacteria 2568
235 Ga0395900_0196452 3300037418 Bacteria 2043
236 Ga0395900_0272047 3300037418 Bacteria 1688
237 Ga0395900_0296765 3300037418 Bacteria 1603
238 Ga0395898_0040343 3300037466 Bacteria 4616
239 Ga0395898_0082471 3300037466 Bacteria 3099
240 Ga0395905_0000955 3300037471 Bacteria 37080
241 Ga0395905_0007217 3300037471 Bacteria 11081
242 Ga0395905_0033040 3300037471 Bacteria 4864
243 Ga0395905_0041777 3300037471 Bacteria 4303
244 Ga0395905_0079842 3300037471 Bacteria 3066
245 Ga0395905_0123194 3300037471 Bacteria 2437
246 Ga0395905_0245047 3300037471 Bacteria 1674
247 Ga0395905_0348570 3300037471 Bacteria 1372
248 Ga0395901_0000033 3300038443 Bacteria 232357
249 Ga0395901_0001938 3300038443 Bacteria 21317
250 Ga0395901_0010151 3300038443 Bacteria 9541
251 Ga0395901_0022786 3300038443 Bacteria 6421
252 Ga0395901_0031647 3300038443 Bacteria 5453
253 Ga0395901_0132471 3300038443 Bacteria 2619
254 Ga0395901_0132653 3300038443 Bacteria 2617
255 Ga0395901_0159990 3300038443 Bacteria 2365
256 Ga0395901_0216633 3300038443 Bacteria 2002
257 Ga0395901_0314493 3300038443 Bacteria 1621
258 Ga0395901_0452006 3300038443 Bacteria 1314
259 Ga0436361_0006435 3300039447 Bacteria 21805
260 Ga0436361_0428998 3300039447 Bacteria 1212
261 Ga0436361_0456588 3300039447 Bacteria 3208
262 Ga0436361_0492958 3300039447 Bacteria 54051
263 Ga0436361_0595316 3300039447 Bacteria 75842
264 Ga0436361_0835704 3300039447 Bacteria 1183
265 Ga0436361_0998063 3300039447 Bacteria 37334
266 Ga0436361_1217285 3300039447 Bacteria 9496
267 Ga0439448_0006050 3300042005 Bacteria 3468
268 Ga0439450_003927 3300042008 Bacteria 2500
269 Ga0439455_0022445 3300042012 Bacteria 1512
270 Ga0450904_000694 3300042139 Bacteria 5972
271 Ga0450893_0011512 3300042532 Bacteria 1462
272 Ga0466966_0039284 3300044684 Bacteria 3048
273 Ga0466963_0019225 3300044694 Bacteria 4281
274 Ga0466964_0000038 3300044706 Bacteria 27277
275 Ga0466964_0083204 3300044706 Bacteria 1378
276 Ga0466971_0230075 3300044719 Bacteria 880
277 Ga0466970_0006191 3300044765 Bacteria 5965
278 Ga0466957_0026106 3300044842 Bacteria 3464
279 Ga0466957_0045470 3300044842 Bacteria 2663
280 Ga0466967_0046032 3300045976 Bacteria 3795
281 Ga0466967_0052043 3300045976 Bacteria 3592
282 Ga0495617_000055 3300046452 Bacteria 102065
283 Ga0495617_000197 3300046452 Bacteria 37981
284 Ga0495617_000809 3300046452 Bacteria 15126
285 Ga0495617_008224 3300046452 Bacteria 3600
286 Ga0495617_015288 3300046452 Bacteria 2601
287 Ga0495627_000004 3300046453 Bacteria 640612
288 Ga0495627_000123 3300046453 Bacteria 94862
289 Ga0495627_008222 3300046453 Bacteria 3925
290 Ga0495627_024396 3300046453 Bacteria 1971
291 Ga0495592_0028251 3300046454 Bacteria 4249
292 Ga0495603_0060162 3300046455 Bacteria 2244
293 Ga0495590_0000012 3300046457 Bacteria 303377
294 Ga0495590_0002304 3300046457 Bacteria 7952
295 Ga0495590_0011927 3300046457 Bacteria 3237
296 Ga0495590_0015419 3300046457 Bacteria 2774
297 Ga0495590_0056039 3300046457 Bacteria 1377
298 Ga0495591_023414 3300046458 Bacteria 1979
299 Ga0495629_0094381 3300046459 Bacteria 2087
300 Ga0495638_0000047 3300046460 Bacteria 216004
301 Ga0495638_0002024 3300046460 Bacteria 17261
302 Ga0495638_0009661 3300046460 Bacteria 6746
303 Ga0495638_0011357 3300046460 Bacteria 6138
304 Ga0495638_0011670 3300046460 Bacteria 6051
305 Ga0495638_0047332 3300046460 Bacteria 2696
306 Ga0495638_0063804 3300046460 Bacteria 2270
307 Ga0495638_0082126 3300046460 Bacteria 1955
308 Ga0495651_0121657 3300046462 Bacteria 1916
309 Ga0495653_0000082 3300046463 Bacteria 80285
310 Ga0495653_0022531 3300046463 Bacteria 5095
311 Ga0495653_0096197 3300046463 Bacteria 2153
312 Ga0495650_0000226 3300046471 Bacteria 115930
313 Ga0495650_0000437 3300046471 Bacteria 66997
314 Ga0495650_0000462 3300046471 Bacteria 63149
315 Ga0495650_0001511 3300046471 Bacteria 22114
316 Ga0495650_0052773 3300046471 Bacteria 1667
317 Ga0495582_0003405 3300046473 Bacteria 8955
318 Ga0495582_0046243 3300046473 Bacteria 2397
319 Ga0495605_0000018 3300046474 Bacteria 270187
320 Ga0495605_0000035 3300046474 Bacteria 208069
321 Ga0495605_0000206 3300046474 Bacteria 72593
322 Ga0495605_0003120 3300046474 Bacteria 9985
323 Ga0495605_0003394 3300046474 Bacteria 9502
324 Ga0495605_0005369 3300046474 Bacteria 7466
325 Ga0495605_0008334 3300046474 Bacteria 5860
326 Ga0495605_0018918 3300046474 Bacteria 3687
327 Ga0495605_0029583 3300046474 Bacteria 2816
328 Ga0495605_0066553 3300046474 Bacteria 1711
329 Ga0495584_0000006 3300046491 Bacteria 301775
330 Ga0495584_0000570 3300046491 Bacteria 24884
331 Ga0495584_0001531 3300046491 Bacteria 13751
332 Ga0495584_0002419 3300046491 Bacteria 10590
333 Ga0495584_0002756 3300046491 Bacteria 9828
334 Ga0495584_0008363 3300046491 Bacteria 5359
335 Ga0495584_0010792 3300046491 Bacteria 4689
336 Ga0495584_0020430 3300046491 Bacteria 3364
337 Ga0495584_0020746 3300046491 Bacteria 3337
338 Ga0495584_0022479 3300046491 Bacteria 3200
339 Ga0495584_0022925 3300046491 Bacteria 3168
340 Ga0495584_0025346 3300046491 Bacteria 3007
341 Ga0495584_0042803 3300046491 Bacteria 2285
342 Ga0495584_0079987 3300046491 Bacteria 1644
343 Ga0495585_0000005 3300046492 Bacteria 328103
344 Ga0495585_0000049 3300046492 Bacteria 119546
345 Ga0495585_0000162 3300046492 Bacteria 71606
346 Ga0495585_0003133 3300046492 Bacteria 11336
347 Ga0495585_0006337 3300046492 Bacteria 7347
348 Ga0495585_0009264 3300046492 Bacteria 5915
349 Ga0495585_0013680 3300046492 Bacteria 4744
350 Ga0495585_0020793 3300046492 Bacteria 3772
351 Ga0495585_0024583 3300046492 Bacteria 3452
352 Ga0495585_0025442 3300046492 Bacteria 3390
353 Ga0495585_0040572 3300046492 Bacteria 2613
354 Ga0495585_0045473 3300046492 Bacteria 2450
355 Ga0495585_0050114 3300046492 Bacteria 2316
356 Ga0495585_0071327 3300046492 Bacteria 1893
357 Ga0495585_0086482 3300046492 Bacteria 1693
358 Ga0495585_0092960 3300046492 Bacteria 1622
359 Ga0495585_0104980 3300046492 Bacteria 1507
360 Ga0495594_0043180 3300046499 Bacteria 2470
361 Ga0495594_0061635 3300046499 Bacteria 2076
362 Ga0495594_0181046 3300046499 Bacteria 1199
363 Ga0495596_0000013 3300046500 Bacteria 125228
364 Ga0495596_0000570 3300046500 Bacteria 23022
365 Ga0495596_0001390 3300046500 Bacteria 13899
366 Ga0495596_0004436 3300046500 Bacteria 6830
367 Ga0495596_0005617 3300046500 Bacteria 5895
368 Ga0495596_0007448 3300046500 Bacteria 4936
369 Ga0495596_0007810 3300046500 Bacteria 4798
370 Ga0495596_0026349 3300046500 Bacteria 2344
371 Ga0495596_0027105 3300046500 Bacteria 2306
372 Ga0495607_0000447 3300046501 Bacteria 41522
373 Ga0495607_0001792 3300046501 Bacteria 18328
374 Ga0495607_0002443 3300046501 Bacteria 15135
375 Ga0495607_0004972 3300046501 Bacteria 9649
376 Ga0495607_0005432 3300046501 Bacteria 9128
377 Ga0495607_0007839 3300046501 Bacteria 7348
378 Ga0495607_0015793 3300046501 Bacteria 4884
379 Ga0495607_0024570 3300046501 Bacteria 3754
380 Ga0495607_0028489 3300046501 Bacteria 3446
381 Ga0495607_0040921 3300046501 Bacteria 2755
382 Ga0495607_0050499 3300046501 Bacteria 2420
383 Ga0495607_0051010 3300046501 Bacteria 2405
384 Ga0495607_0068780 3300046501 Bacteria 1984
385 Ga0495583_0000008 3300046506 Bacteria 411092
386 Ga0495583_0000092 3300046506 Bacteria 158865
387 Ga0495583_0000316 3300046506 Bacteria 76314
388 Ga0495583_0000480 3300046506 Bacteria 58370
389 Ga0495583_0001098 3300046506 Bacteria 29951
390 Ga0495583_0001357 3300046506 Bacteria 25354
391 Ga0495583_0005766 3300046506 Bacteria 8279
392 Ga0495583_0016772 3300046506 Bacteria 3919
393 Ga0495583_0017309 3300046506 Bacteria 3830
394 Ga0495583_0028977 3300046506 Bacteria 2714
395 Ga0495583_0053571 3300046506 Bacteria 1830
396 Ga0495583_0069315 3300046506 Bacteria 1553
397 Ga0495606_0000066 3300046507 Bacteria 181028
398 Ga0495606_0000101 3300046507 Bacteria 146752
399 Ga0495606_0000161 3300046507 Bacteria 117607
400 Ga0495606_0000409 3300046507 Bacteria 72543
401 Ga0495606_0000814 3300046507 Bacteria 47442
402 Ga0495606_0000830 3300046507 Bacteria 46705
403 Ga0495606_0002636 3300046507 Bacteria 20465
404 Ga0495606_0018361 3300046507 Bacteria 5247
405 Ga0495606_0025163 3300046507 Bacteria 4270
406 Ga0495606_0061775 3300046507 Bacteria 2394
407 Ga0495606_0115140 3300046507 Bacteria 1616
408 Ga0495608_0082455 3300046511 Bacteria 2088
409 Ga0495610_0000014 3300046512 Bacteria 444708
410 Ga0495610_0005574 3300046512 Bacteria 8902
411 Ga0495610_0005660 3300046512 Bacteria 8810
412 Ga0495610_0009501 3300046512 Bacteria 6139
413 Ga0495610_0012253 3300046512 Bacteria 5175
414 Ga0495616_0000020 3300046513 Bacteria 162840
415 Ga0495616_0000125 3300046513 Bacteria 66710
416 Ga0495616_0001133 3300046513 Bacteria 18867
417 Ga0495616_0001323 3300046513 Bacteria 17297
418 Ga0495616_0001444 3300046513 Bacteria 16538
419 Ga0495616_0014163 3300046513 Bacteria 4474
420 Ga0495616_0019529 3300046513 Bacteria 3696
421 Ga0495616_0022220 3300046513 Bacteria 3427
422 Ga0495616_0023004 3300046513 Bacteria 3358
423 Ga0495616_0041507 3300046513 Bacteria 2346
424 Ga0495616_0042080 3300046513 Bacteria 2327
425 Ga0495616_0064595 3300046513 Bacteria 1785
426 Ga0495618_0054139 3300046514 Bacteria 2538
427 Ga0495620_0017241 3300046515 Bacteria 3606
428 Ga0495628_0000315 3300046516 Bacteria 43763
429 Ga0495628_0007175 3300046516 Bacteria 9650
430 Ga0495631_0000295 3300046518 Bacteria 34905
431 Ga0495631_0002141 3300046518 Bacteria 11411
432 Ga0495631_0002183 3300046518 Bacteria 11297
433 Ga0495631_0004107 3300046518 Bacteria 7818
434 Ga0495631_0006181 3300046518 Bacteria 6204
435 Ga0495631_0018425 3300046518 Bacteria 3286
436 Ga0495631_0028420 3300046518 Bacteria 2550
437 Ga0495631_0035879 3300046518 Bacteria 2216
438 Ga0495631_0049023 3300046518 Bacteria 1850
439 Ga0495631_0050686 3300046518 Bacteria 1815
440 Ga0495632_0000029 3300046519 Bacteria 171022
441 Ga0495632_0000093 3300046519 Bacteria 91309
442 Ga0495632_0001267 3300046519 Bacteria 21431
443 Ga0495632_0005633 3300046519 Bacteria 8237
444 Ga0495632_0009088 3300046519 Bacteria 6017
445 Ga0495637_0001526 3300046520 Bacteria 13538
446 Ga0495637_0037740 3300046520 Bacteria 2095
447 Ga0495643_0000234 3300046522 Bacteria 84022
448 Ga0495643_0000388 3300046522 Bacteria 58226
449 Ga0495643_0001128 3300046522 Bacteria 26369
450 Ga0495643_0001450 3300046522 Bacteria 21831
451 Ga0495643_0003381 3300046522 Bacteria 11738
452 Ga0495643_0068080 3300046522 Bacteria 1874
453 Ga0495644_0000379 3300046523 Bacteria 20217
454 Ga0495644_0002875 3300046523 Bacteria 6826
455 Ga0495644_0009357 3300046523 Bacteria 3779
456 Ga0495644_0021369 3300046523 Bacteria 2469
457 Ga0495644_0023838 3300046523 Bacteria 2329
458 Ga0495644_0082728 3300046523 Bacteria 1210
459 Ga0495644_0086265 3300046523 Bacteria 1183
460 Ga0495648_0000019 3300046524 Bacteria 276407
461 Ga0495648_0000033 3300046524 Bacteria 199184
462 Ga0495648_0000207 3300046524 Bacteria 68660
463 Ga0495648_0000527 3300046524 Bacteria 41184
464 Ga0495648_0005556 3300046524 Bacteria 10456
465 Ga0495648_0007648 3300046524 Bacteria 8616
466 Ga0495648_0015834 3300046524 Bacteria 5452
467 Ga0495648_0025773 3300046524 Bacteria 3973
468 Ga0495648_0037659 3300046524 Bacteria 3104
469 Ga0495648_0038786 3300046524 Bacteria 3040
470 Ga0495648_0041135 3300046524 Bacteria 2922
471 Ga0495648_0048784 3300046524 Bacteria 2603
472 Ga0495663_0002070 3300046525 Bacteria 6143
473 Ga0495663_0008597 3300046525 Bacteria 2833
474 Ga0495666_0020595 3300046526 Bacteria 3266
475 Ga0495666_0030354 3300046526 Bacteria 2653
476 Ga0495642_0000005 3300046528 Bacteria 176726
477 Ga0495642_0000111 3300046528 Bacteria 46419
478 Ga0495642_0001868 3300046528 Bacteria 8991
479 Ga0495642_0002397 3300046528 Bacteria 7636
480 Ga0495642_0004661 3300046528 Bacteria 5311
481 Ga0495642_0009857 3300046528 Bacteria 3660
482 Ga0495642_0017398 3300046528 Bacteria 2809
483 Ga0495642_0024585 3300046528 Bacteria 2383
484 Ga0495642_0031655 3300046528 Bacteria 2121
485 Ga0495642_0032189 3300046528 Bacteria 2103
486 Ga0495642_0070602 3300046528 Bacteria 1460
487 Ga0495652_0046650 3300046529 Bacteria 3718
488 Ga0495652_0052476 3300046529 Bacteria 3477
489 Ga0495652_0149700 3300046529 Bacteria 1825
490 Ga0495654_0000014 3300046530 Bacteria 312126
491 Ga0495654_0003975 3300046530 Bacteria 8904
492 Ga0495654_0009835 3300046530 Bacteria 5226
493 Ga0495654_0017364 3300046530 Bacteria 3785
494 Ga0495654_0021587 3300046530 Bacteria 3348
495 Ga0495654_0027638 3300046530 Bacteria 2906
496 Ga0495654_0149023 3300046530 Bacteria 1036
497 Ga0495665_0050197 3300046531 Bacteria 2211
498 Ga0495586_0031016 3300046535 Bacteria 2862
499 Ga0495587_0080591 3300046536 Bacteria 1886
500 Ga0495609_0000122 3300046538 Bacteria 87165
501 Ga0495609_0000127 3300046538 Bacteria 82467
502 Ga0495609_0000377 3300046538 Bacteria 38049
503 Ga0495609_0000421 3300046538 Bacteria 35331
504 Ga0495609_0004431 3300046538 Bacteria 7680
505 Ga0495609_0016190 3300046538 Bacteria 3476
506 Ga0495609_0025283 3300046538 Bacteria 2723
507 Ga0495609_0034137 3300046538 Bacteria 2307
508 Ga0495609_0036766 3300046538 Bacteria 2210
509 Ga0495609_0037541 3300046538 Bacteria 2185
510 Ga0495621_0000839 3300046539 Bacteria 7815
511 Ga0495597_0000075 3300046542 Bacteria 86570
512 Ga0495597_0000244 3300046542 Bacteria 49472
513 Ga0495597_0000277 3300046542 Bacteria 46764
514 Ga0495597_0000378 3300046542 Bacteria 38615
515 Ga0495597_0001275 3300046542 Bacteria 18575
516 Ga0495597_0004294 3300046542 Bacteria 7873
517 Ga0495597_0004483 3300046542 Bacteria 7659
518 Ga0495597_0024107 3300046542 Bacteria 2809
519 Ga0495597_0084741 3300046542 Bacteria 1351
520 Ga0495645_0056984 3300046543 Bacteria 2837
521 Ga0495622_0000037 3300046557 Bacteria 119690
522 Ga0495622_0035652 3300046557 Bacteria 2319
523 Ga0495633_0000086 3300046558 Bacteria 124357
524 Ga0495633_0000091 3300046558 Bacteria 122383
525 Ga0495633_0000297 3300046558 Bacteria 56662
526 Ga0495633_0002740 3300046558 Bacteria 12191
527 Ga0495633_0002917 3300046558 Bacteria 11736
528 Ga0495633_0003169 3300046558 Bacteria 11120
529 Ga0495633_0005227 3300046558 Bacteria 8007
530 Ga0495633_0012297 3300046558 Bacteria 4562
531 Ga0495633_0013563 3300046558 Bacteria 4288
532 Ga0495633_0028627 3300046558 Bacteria 2713
533 Ga0495633_0032504 3300046558 Bacteria 2520
534 Ga0495633_0033608 3300046558 Bacteria 2472
535 Ga0495633_0049745 3300046558 Bacteria 1977
536 Ga0495633_0056472 3300046558 Bacteria 1844
537 Ga0495633_0078216 3300046558 Bacteria 1540
538 Ga0495633_0098470 3300046558 Bacteria 1358
539 Ga0495656_0001811 3300046615 Bacteria 7029
540 Ga0495656_0003025 3300046615 Bacteria 5652
541 Ga0495656_0006282 3300046615 Bacteria 4162
542 Ga0495656_0045968 3300046615 Bacteria 1845
543 Ga0495656_0055282 3300046615 Bacteria 1711
544 Ga0495656_0075222 3300046615 Bacteria 1510
545 Ga0495668_0000066 3300046616 Bacteria 178533
546 Ga0495668_0000579 3300046616 Bacteria 44604
547 Ga0495668_0000712 3300046616 Bacteria 40090
548 Ga0495668_0000987 3300046616 Bacteria 31002
549 Ga0495668_0001514 3300046616 Bacteria 22099
550 Ga0495668_0002104 3300046616 Bacteria 17216
551 Ga0495668_0005034 3300046616 Bacteria 9106
552 Ga0495668_0006539 3300046616 Bacteria 7615
553 Ga0495668_0007925 3300046616 Bacteria 6703
554 Ga0495668_0009537 3300046616 Bacteria 5951
555 Ga0495668_0014164 3300046616 Bacteria 4685
556 Ga0495668_0024190 3300046616 Bacteria 3455
557 Ga0495668_0025338 3300046616 Bacteria 3370
558 Ga0495668_0030873 3300046616 Bacteria 3021
559 Ga0495668_0031775 3300046616 Bacteria 2974
560 Ga0495668_0032788 3300046616 Bacteria 2920
561 Ga0495668_0163460 3300046616 Bacteria 1219
562 Ga0495611_0002764 3300046648 Bacteria 7871
563 Ga0495611_0004783 3300046648 Bacteria 5818
564 Ga0495611_0005095 3300046648 Bacteria 5631
565 Ga0495611_0009182 3300046648 Bacteria 4174
566 Ga0495611_0010718 3300046648 Bacteria 3881
567 Ga0495611_0021800 3300046648 Bacteria 2768
568 Ga0495611_0028529 3300046648 Bacteria 2444
569 Ga0495625_0000432 3300046660 Bacteria 63013
570 Ga0495625_0000931 3300046660 Bacteria 39360
571 Ga0495625_0001069 3300046660 Bacteria 35654
572 Ga0495625_0002528 3300046660 Bacteria 19665
573 Ga0495625_0002580 3300046660 Bacteria 19464
574 Ga0495625_0004594 3300046660 Bacteria 12980
575 Ga0495625_0007654 3300046660 Bacteria 9364
576 Ga0495625_0014160 3300046660 Bacteria 6380
577 Ga0495625_0024019 3300046660 Bacteria 4647
578 Ga0495625_0029530 3300046660 Bacteria 4098
579 Ga0495625_0039018 3300046660 Bacteria 3471
580 Ga0495625_0050856 3300046660 Bacteria 2972
581 Ga0495625_0103415 3300046660 Bacteria 1953
582 Ga0495625_0128854 3300046660 Bacteria 1715
583 Ga0495625_0146559 3300046660 Bacteria 1589
584 Ga0495635_0067746 3300046663 Bacteria 2448
585 Ga0495659_0000074 3300046664 Bacteria 42753
586 Ga0495659_0000368 3300046664 Bacteria 17465
587 Ga0495659_0009976 3300046664 Bacteria 3038
588 Ga0495661_0000198 3300046665 Bacteria 69566
589 Ga0495661_0000254 3300046665 Bacteria 61490
590 Ga0495661_0000654 3300046665 Bacteria 34904
591 Ga0495661_0001765 3300046665 Bacteria 17381
592 Ga0495661_0003108 3300046665 Bacteria 12456
593 Ga0495661_0009714 3300046665 Bacteria 6590
594 Ga0495661_0014208 3300046665 Bacteria 5335
595 Ga0495661_0014465 3300046665 Bacteria 5285
596 Ga0495661_0018067 3300046665 Bacteria 4644
597 Ga0495661_0021666 3300046665 Bacteria 4186
598 Ga0495661_0032911 3300046665 Bacteria 3273
599 Ga0495661_0036158 3300046665 Bacteria 3094
600 Ga0495661_0045002 3300046665 Bacteria 2701
601 Ga0495661_0058158 3300046665 Bacteria 2305
602 Ga0495661_0067259 3300046665 Bacteria 2105
603 Ga0495661_0088042 3300046665 Bacteria 1773
604 Ga0495661_0113437 3300046665 Bacteria 1507
605 Ga0495588_0000055 3300046674 Bacteria 280059
606 Ga0495588_0004945 3300046674 Bacteria 5913
607 Ga0495588_0018614 3300046674 Bacteria 3389
608 Ga0495588_0118742 3300046674 Bacteria 1393
609 Ga0495588_0155201 3300046674 Bacteria 1210
610 Ga0495588_0164768 3300046674 Bacteria 1172
611 Ga0495657_0030526 3300046675 Bacteria 3774
612 Ga0495599_0004724 3300046678 Bacteria 8091
613 Ga0495623_0019897 3300046679 Bacteria 4340
614 Ga0495646_0003302 3300046680 Bacteria 10043
615 Ga0495669_0000053 3300046684 Bacteria 79258
616 Ga0495669_0003999 3300046684 Bacteria 6067
617 Ga0495669_0013249 3300046684 Bacteria 3512
618 Ga0495669_0018939 3300046684 Bacteria 2966
619 Ga0495669_0033489 3300046684 Bacteria 2261
620 Ga0495669_0114592 3300046684 Bacteria 1261
621 Ga0495669_0161026 3300046684 Bacteria 1065
622 Ga0495613_0011139 3300046689 Bacteria 6678
623 Ga0495624_0063954 3300046690 Bacteria 2300
624 Ga0495624_0168484 3300046690 Bacteria 1336
625 Ga0495670_0000840 3300046691 Bacteria 14864
626 Ga0495670_0003303 3300046691 Bacteria 7948
627 Ga0495670_0003637 3300046691 Bacteria 7574
628 Ga0495670_0007293 3300046691 Bacteria 5434
629 Ga0495670_0014746 3300046691 Bacteria 3846
630 Ga0495670_0036166 3300046691 Bacteria 2460
631 Ga0495670_0043790 3300046691 Bacteria 2234
632 Ga0495671_0000294 3300046692 Bacteria 41764
633 Ga0495671_0000493 3300046692 Bacteria 30406
634 Ga0495671_0001143 3300046692 Bacteria 18230
635 Ga0495671_0001848 3300046692 Bacteria 13620
636 Ga0495671_0015630 3300046692 Bacteria 4062
637 Ga0495671_0022530 3300046692 Bacteria 3299
638 Ga0495671_0056155 3300046692 Bacteria 1949
639 Ga0495671_0089866 3300046692 Bacteria 1504
640 Ga0495671_0147816 3300046692 Bacteria 1144
641 Ga0495649_0001632 3300046694 Bacteria 16686
642 Ga0495649_0002517 3300046694 Bacteria 12864
643 Ga0495649_0002914 3300046694 Bacteria 11836
644 Ga0495649_0017973 3300046694 Bacteria 3985
645 Ga0495649_0029483 3300046694 Bacteria 3034
646 Ga0495649_0033827 3300046694 Bacteria 2813
647 Ga0495649_0056711 3300046694 Bacteria 2114
648 Ga0495589_0000049 3300046794 Bacteria 116553
649 Ga0495589_0000248 3300046794 Bacteria 44186
650 Ga0495589_0000732 3300046794 Bacteria 21182
651 Ga0495589_0017384 3300046794 Bacteria 3691
652 Ga0495589_0023524 3300046794 Bacteria 3139
653 Ga0495589_0025063 3300046794 Bacteria 3028
654 Ga0495589_0034199 3300046794 Bacteria 2552
655 Ga0495589_0148308 3300046794 Bacteria 1121
656 Ga0495589_0191931 3300046794 Bacteria 966
657 Ga0495600_0003375 3300046809 Bacteria 9393
658 Ga0495600_0092665 3300046809 Bacteria 1970
659 Ga0495660_0000167 3300046810 Bacteria 71094
660 Ga0495660_0000419 3300046810 Bacteria 35881
661 Ga0495660_0002961 3300046810 Bacteria 10619
662 Ga0495660_0007004 3300046810 Bacteria 6646
663 Ga0495660_0011538 3300046810 Bacteria 5126
664 Ga0495660_0012541 3300046810 Bacteria 4921
665 Ga0495660_0020217 3300046810 Bacteria 3816
666 Ga0495660_0024157 3300046810 Bacteria 3463
667 Ga0495660_0027283 3300046810 Bacteria 3232
668 Ga0495660_0094127 3300046810 Bacteria 1552
669 Ga0495660_0180040 3300046810 Bacteria 1023
670 Ga0495581_0048258 3300047315 Bacteria 2459
671 Ga0495581_0059508 3300047315 Bacteria 2207
672 Ga0495604_0011517 3300047317 Bacteria 7026
673 Ga0495604_0113077 3300047317 Bacteria 1976
674 Ga0495636_0001381 3300047318 Bacteria 9172
675 Ga0495636_0001424 3300047318 Bacteria 9048
676 Ga0495636_0038726 3300047318 Bacteria 1973
677 Ga0495636_0126537 3300047318 Bacteria 1134
678 Ga0495672_0000026 3300047320 Bacteria 340319
679 Ga0495672_0000226 3300047320 Bacteria 80307
680 Ga0495672_0005477 3300047320 Bacteria 10063
681 Ga0495672_0023423 3300047320 Bacteria 3996
682 Ga0495672_0027083 3300047320 Bacteria 3648
683 Ga0495672_0036485 3300047320 Bacteria 3018
684 Ga0495672_0199766 3300047320 Bacteria 1000
685 Ga0495676_0000030 3300047321 Bacteria 133637
686 Ga0495676_0063085 3300047321 Bacteria 2890
687 Ga0495676_0309762 3300047321 Bacteria 1063
688 Ga0495683_0000072 3300047323 Bacteria 104027
689 Ga0495683_0011411 3300047323 Bacteria 4675
690 Ga0495683_0026453 3300047323 Bacteria 2968
691 Ga0495683_0037071 3300047323 Bacteria 2473
692 Ga0495683_0037948 3300047323 Bacteria 2440
693 Ga0495683_0042743 3300047323 Bacteria 2284
694 Ga0495683_0049462 3300047323 Bacteria 2105
695 Ga0495683_0065004 3300047323 Bacteria 1800
696 Ga0495683_0120187 3300047323 Bacteria 1247
697 Ga0495687_000024 3300047443 Bacteria 316676
698 Ga0495687_000213 3300047443 Bacteria 83235
699 Ga0495687_000456 3300047443 Bacteria 50293
700 Ga0495687_000855 3300047443 Bacteria 32474
701 Ga0495687_000970 3300047443 Bacteria 29214
702 Ga0495687_001969 3300047443 Bacteria 17520
703 Ga0495687_003707 3300047443 Bacteria 10857
704 Ga0495677_0000017 3300047445 Bacteria 121483
705 Ga0495677_0000478 3300047445 Bacteria 17034
706 Ga0495677_0000650 3300047445 Bacteria 14031
707 Ga0495677_0003557 3300047445 Bacteria 6044
708 Ga0495677_0007617 3300047445 Bacteria 4040
709 Ga0495677_0008886 3300047445 Bacteria 3719
710 Ga0495677_0017215 3300047445 Bacteria 2620
711 Ga0495677_0026044 3300047445 Bacteria 2122
712 Ga0495677_0032325 3300047445 Bacteria 1905
713 Ga0495677_0033579 3300047445 Bacteria 1870
714 Ga0495677_0052114 3300047445 Bacteria 1508
715 Ga0495677_0084548 3300047445 Bacteria 1192
716 Ga0495677_0094802 3300047445 Bacteria 1126
717 Ga0495677_0128884 3300047445 Bacteria 968
718 Ga0495679_014141 3300047446 Bacteria 2969
719 Ga0495679_020250 3300047446 Bacteria 2319
720 Ga0495679_038105 3300047446 Bacteria 1507
721 Ga0495685_000263 3300047447 Bacteria 18095
722 Ga0495685_005104 3300047447 Bacteria 4274
723 Ga0495685_026805 3300047447 Bacteria 1982
724 Ga0495673_0000009 3300047469 Bacteria 731993
725 Ga0495673_0000012 3300047469 Bacteria 656908
726 Ga0495673_0007222 3300047469 Bacteria 6419
727 Ga0495673_0014443 3300047469 Bacteria 4107
728 Ga0495673_0067398 3300047469 Bacteria 1515
729 Ga0495681_0003096 3300047470 Bacteria 11665
730 Ga0495681_0006805 3300047470 Bacteria 7437
731 Ga0495681_0011676 3300047470 Bacteria 5212
732 Ga0495681_0030978 3300047470 Bacteria 2715
733 Ga0495681_0043297 3300047470 Bacteria 2172
734 Ga0495681_0044896 3300047470 Bacteria 2119
735 Ga0495681_0060524 3300047470 Bacteria 1747
736 Ga0495681_0061168 3300047470 Bacteria 1735
737 Ga0495681_0085133 3300047470 Bacteria 1404
738 Ga0495681_0103962 3300047470 Bacteria 1238
739 Ga0495686_0000062 3300047472 Bacteria 235234
740 Ga0495686_0000431 3300047472 Bacteria 65240
741 Ga0495686_0002226 3300047472 Bacteria 18792
742 Ga0495686_0048025 3300047472 Bacteria 2693
743 Ga0495686_0156380 3300047472 Bacteria 1335
744 Ga0495686_0210553 3300047472 Bacteria 1111
745 Ga0495593_0002258 3300047673 Bacteria 11560
746 Ga0495593_0020776 3300047673 Bacteria 3672
747 Ga0495593_0106482 3300047673 Bacteria 1434
748 Ga0495602_0050252 3300048088 Bacteria 3727
749 Ga0495602_0157991 3300048088 Bacteria 1773
750 Ga0495614_0057335 3300048089 Bacteria 1672
751 Ga0495615_0003336 3300048090 Bacteria 2676
752 Ga0495615_0008300 3300048090 Bacteria 2003
753 Ga0495626_0000202 3300048091 Bacteria 72266
754 Ga0495626_0001340 3300048091 Bacteria 19924
755 Ga0495626_0002145 3300048091 Bacteria 14272
756 Ga0495626_0003033 3300048091 Bacteria 11062
757 Ga0495626_0003131 3300048091 Bacteria 10834
758 Ga0495626_0003253 3300048091 Bacteria 10510
759 Ga0495626_0014993 3300048091 Bacteria 3975
760 Ga0495626_0025563 3300048091 Bacteria 2887
761 Ga0495626_0030964 3300048091 Bacteria 2578
762 Ga0495626_0076195 3300048091 Bacteria 1497
763 Ga0495626_0083539 3300048091 Bacteria 1414
764 Ga0495626_0088777 3300048091 Bacteria 1362
765 Ga0496100_0034984 3300048903 Bacteria 3157
766 Ga0496100_0203498 3300048903 Bacteria 1444
767 Ga0496101_0249842 3300048904 Bacteria 1382
768 Ga0496102_0000071 3300048905 Bacteria 154320
769 Ga0496102_0031176 3300048905 Bacteria 4780
770 Ga0496102_0114322 3300048905 Bacteria 2518
771 Ga0496102_0305413 3300048905 Bacteria 1499
772 Ga0496103_0006209 3300048906 Bacteria 7137
773 Ga0496103_0030941 3300048906 Bacteria 3258
774 Ga0496103_0033175 3300048906 Bacteria 3154
775 Ga0496103_0050773 3300048906 Bacteria 2566
776 Ga0496103_0143341 3300048906 Bacteria 1529
777 Ga0496104_0101788 3300048907 Bacteria 2751
778 Ga0496104_0275695 3300048907 Bacteria 1595
779 Ga0496104_0451729 3300048907 Bacteria 1197
780 Ga0496108_0070387 3300048911 Bacteria 2952
781 Ga0496109_0148947 3300048912 Bacteria 2190
782 Ga0496110_0001557 3300048913 Bacteria 16711
783 Ga0496110_0086963 3300048913 Bacteria 2791
784 Ga0496110_0126770 3300048913 Bacteria 2303
785 Ga0496111_0038096 3300048914 Bacteria 3443
786 Ga0496111_0077330 3300048914 Bacteria 2426
787 Ga0496111_0123990 3300048914 Bacteria 1909
788 Ga0496113_0029191 3300048916 Bacteria 3979
789 Ga0496113_0137320 3300048916 Bacteria 1922
790 Ga0496114_0144584 3300048917 Bacteria 2061
791 Ga0496115_0023301 3300048918 Bacteria 4803
792 Ga0496115_0239605 3300048918 Bacteria 1495
793 Ga0496115_0309751 3300048918 Bacteria 1293
794 Ga0496116_0002196 3300048919 Bacteria 20783
795 Ga0496116_0008492 3300048919 Bacteria 8903
796 Ga0496116_0043485 3300048919 Bacteria 3060
797 Ga0496116_0067960 3300048919 Bacteria 2273
798 Ga0496117_0000005 3300048920 Bacteria 777468
799 Ga0496118_0000022 3300048921 Bacteria 438602
800 Ga0496118_0044587 3300048921 Bacteria 3471
801 Ga0496121_0004994 3300048924 Bacteria 17366
802 Ga0496121_0006051 3300048924 Bacteria 15233
803 Ga0496121_0114687 3300048924 Bacteria 2047
804 Ga0496122_0000121 3300048925 Bacteria 181589
805 Ga0496122_0000263 3300048925 Bacteria 117762
806 Ga0496122_0001857 3300048925 Bacteria 32205
807 Ga0496122_0022503 3300048925 Bacteria 5599
808 Ga0496122_0078180 3300048925 Bacteria 2318
809 Ga0496123_0000040 3300048926 Bacteria 258569
810 Ga0496123_0000156 3300048926 Bacteria 139362
811 Ga0496123_0006176 3300048926 Bacteria 11711
812 Ga0496123_0034198 3300048926 Bacteria 3645
813 Ga0496123_0045315 3300048926 Bacteria 2998
814 Ga0496124_0005845 3300048927 Bacteria 13655
815 Ga0496124_0011979 3300048927 Bacteria 8623
816 Ga0496124_0038760 3300048927 Bacteria 4135
817 Ga0496124_0058411 3300048927 Bacteria 3245
818 Ga0496124_0060934 3300048927 Bacteria 3164
819 Ga0496124_0067409 3300048927 Bacteria 2978
820 Ga0496124_0077481 3300048927 Bacteria 2742
821 Ga0496124_0157902 3300048927 Bacteria 1771
822 Ga0496124_0210580 3300048927 Bacteria 1471
823 Ga0496124_0355674 3300048927 Bacteria 1034
824 Ga0496125_0000672 3300048928 Bacteria 57073
825 Ga0496125_0000720 3300048928 Bacteria 54770
826 Ga0496125_0000995 3300048928 Bacteria 44209
827 Ga0496125_0030196 3300048928 Bacteria 4852
828 Ga0496126_0006238 3300048929 Bacteria 13323
829 Ga0501307_003330 3300049162 Bacteria 1569
830 Ga0495678_000012 3300049459 Bacteria 333905
831 Ga0495678_000035 3300049459 Bacteria 200957
832 Ga0495678_000130 3300049459 Bacteria 88909
833 Ga0495678_000232 3300049459 Bacteria 63796
834 Ga0495678_000782 3300049459 Bacteria 28498
835 Ga0495678_001730 3300049459 Bacteria 16272
836 Ga0495678_002896 3300049459 Bacteria 11050
837 Ga0495678_025648 3300049459 Bacteria 2528
838 Ga0495678_027597 3300049459 Bacteria 2407
839 Ga0495682_0000210 3300049460 Bacteria 47048
840 Ga0495682_0001032 3300049460 Bacteria 16423
841 Ga0495682_0001446 3300049460 Bacteria 12830
842 Ga0495682_0004102 3300049460 Bacteria 6324
843 Ga0495682_0005703 3300049460 Bacteria 5140
844 Ga0495682_0012843 3300049460 Bacteria 3199
845 Ga0501034_0284748 3300049571 Bacteria 1592
846 Ga0501034_0369288 3300049571 Bacteria 1361
847 Ga0501069_0018296 3300049585 Bacteria 3779
848 Ga0501070_0004652 3300049586 Bacteria 11754
849 Ga0501074_0004908 3300049590 Bacteria 9587
850 Ga0501211_002271 3300049658 Bacteria 2043
851 Ga0501249_001082 3300049679 Bacteria 5782
852 Ga0501079_0010210 3300049741 Bacteria 7130
853 Ga0501080_0004308 3300049742 Bacteria 12635
854 Ga0501083_0014146 3300049744 Bacteria 5580
855 Ga0501269_000461 3300049766 Bacteria 8895
856 Ga0501035_0028204 3300049822 Bacteria 5124
857 Ga0501044_0049236 3300049823 Bacteria 4350
858 nmdc:mga03683_37356_c1 3300050489 Bacteria 1979
859 Ga0495601_0008185 3300053077 Bacteria 6167
860 Ga0500594_0036941 3300053118 Bacteria 1317
861 Ga0500595_003105 3300053119 Bacteria 7864
862 Ga0500618_000088 3300053125 Bacteria 74892
863 Ga0500573_0135707 3300053140 Bacteria 1359
864 Ga0500586_001756 3300053145 Bacteria 4691
865 Ga0500619_002584 3300053154 Bacteria 3522

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0452006 Ga0395901_0452006_25_795 251
2 3300046530 Ga0495654_0149023 Ga0495654_0149023_231_1013 255
3 3300044719 Ga0466971_0230075 Ga0466971_0230075_70_861 256
4 3300046674 Ga0495588_0164768 Ga0495588_0164768_374_1156 256
5 3300048927 Ga0496124_0355674 Ga0496124_0355674_223_1014 256
6 3300047321 Ga0495676_0309762 Ga0495676_0309762_13_798 257
7 3300014969 Ga0157376_10396373 Ga0157376_103963732 269
8 3300048907 Ga0496104_0451729 Ga0496104_0451729_226_1143 280
9 3300046474 Ga0495605_0003394 Ga0495605_0003394_8539_9450 282
10 3300046692 Ga0495671_0147816 Ga0495671_0147816_249_1121 284
11 3300047445 Ga0495677_0084548 Ga0495677_0084548_12_905 284
12 3300049658 Ga0501211_002271 Ga0501211_002271_89_976 288
13 3300047321 Ga0495676_0000030 Ga0495676_0000030_60594_61511 289
14 3300046459 Ga0495629_0094381 Ga0495629_0094381_553_1470 291
15 3300046473 Ga0495582_0003405 Ga0495582_0003405_4430_5347 291
16 3300046474 Ga0495605_0066553 Ga0495605_0066553_328_1245 291
17 3300046491 Ga0495584_0020430 Ga0495584_0020430_1028_1945 291
18 3300046492 Ga0495585_0092960 Ga0495585_0092960_17_934 291
19 3300046499 Ga0495594_0181046 Ga0495594_0181046_17_934 291
20 3300046500 Ga0495596_0000570 Ga0495596_0000570_8735_9652 291
21 3300046501 Ga0495607_0004972 Ga0495607_0004972_4589_5506 291
22 3300046518 Ga0495631_0035879 Ga0495631_0035879_709_1626 291
23 3300046518 Ga0495631_0049023 Ga0495631_0049023_43_960 291
24 3300046523 Ga0495644_0021369 Ga0495644_0021369_495_1412 291
25 3300046557 Ga0495622_0035652 Ga0495622_0035652_1058_1975 291
26 3300046558 Ga0495633_0056472 Ga0495633_0056472_438_1355 291
27 3300046616 Ga0495668_0032788 Ga0495668_0032788_1521_2438 291
28 3300046674 Ga0495588_0118742 Ga0495588_0118742_47_964 291
29 3300046684 Ga0495669_0000053 Ga0495669_0000053_13383_14300 291
30 3300046689 Ga0495613_0011139 Ga0495613_0011139_1504_2421 291
31 3300047315 Ga0495581_0048258 Ga0495581_0048258_617_1534 291
32 3300047323 Ga0495683_0026453 Ga0495683_0026453_347_1264 291
33 3300047323 Ga0495683_0120187 Ga0495683_0120187_312_1229 291
34 3300047470 Ga0495681_0061168 Ga0495681_0061168_482_1399 291
35 3300047673 Ga0495593_0106482 Ga0495593_0106482_265_1182 291
36 3300048089 Ga0495614_0057335 Ga0495614_0057335_218_1135 291
37 3300048091 Ga0495626_0025563 Ga0495626_0025563_1585_2502 291
38 iso_pu_bacteria 2547132512 2548848507 291
39 3300039447 Ga0436361_0456588 Ga0436361_0456588_1525_2490 292
40 3300046518 Ga0495631_0000295 Ga0495631_0000295_6634_7557 292
41 3300046616 Ga0495668_0002104 Ga0495668_0002104_11167_12090 292
42 3300046794 Ga0495589_0191931 Ga0495589_0191931_11_928 292
43 3300047472 Ga0495686_0210553 Ga0495686_0210553_121_1044 292
44 3300048913 Ga0496110_0086963 Ga0496110_0086963_979_1899 293
45 3300046474 Ga0495605_0018918 Ga0495605_0018918_1651_2574 294
46 3300046491 Ga0495584_0010792 Ga0495584_0010792_1964_2887 294
47 3300046491 Ga0495584_0020746 Ga0495584_0020746_2269_3216 294
48 3300046492 Ga0495585_0040572 Ga0495585_0040572_1484_2431 294
49 3300046500 Ga0495596_0007810 Ga0495596_0007810_3642_4589 294
50 3300046501 Ga0495607_0028489 Ga0495607_0028489_722_1669 294
51 3300046506 Ga0495583_0001357 Ga0495583_0001357_1410_2357 294
52 3300046513 Ga0495616_0042080 Ga0495616_0042080_1133_2080 294
53 3300046518 Ga0495631_0004107 Ga0495631_0004107_5678_6625 294
54 3300046519 Ga0495632_0005633 Ga0495632_0005633_5955_6902 294
55 3300046524 Ga0495648_0041135 Ga0495648_0041135_1908_2846 294
56 3300046528 Ga0495642_0017398 Ga0495642_0017398_1369_2316 294
57 3300046530 Ga0495654_0009835 Ga0495654_0009835_2919_3842 294
58 3300046538 Ga0495609_0004431 Ga0495609_0004431_6313_7251 294
59 3300046538 Ga0495609_0036766 Ga0495609_0036766_863_1786 294
60 3300046542 Ga0495597_0001275 Ga0495597_0001275_12413_13336 294
61 3300046615 Ga0495656_0055282 Ga0495656_0055282_234_1181 294
62 3300046616 Ga0495668_0025338 Ga0495668_0025338_1094_2017 294
63 3300046648 Ga0495611_0004783 Ga0495611_0004783_3714_4661 294
64 3300046665 Ga0495661_0014208 Ga0495661_0014208_871_1818 294
65 3300046665 Ga0495661_0058158 Ga0495661_0058158_895_1833 294
66 3300046684 Ga0495669_0161026 Ga0495669_0161026_83_1030 294
67 3300046691 Ga0495670_0043790 Ga0495670_0043790_840_1787 294
68 3300046794 Ga0495589_0023524 Ga0495589_0023524_1980_2903 294
69 3300046794 Ga0495589_0034199 Ga0495589_0034199_360_1307 294
70 3300047320 Ga0495672_0036485 Ga0495672_0036485_971_1894 294
71 3300047323 Ga0495683_0037071 Ga0495683_0037071_656_1603 294
72 3300047445 Ga0495677_0032325 Ga0495677_0032325_676_1623 294
73 3300047446 Ga0495679_038105 Ga0495679_038105_351_1298 294
74 3300047470 Ga0495681_0030978 Ga0495681_0030978_724_1671 294
75 3300048091 Ga0495626_0083539 Ga0495626_0083539_245_1222 294
76 3300049459 Ga0495678_027597 Ga0495678_027597_702_1649 294
77 iso_pu_bacteria 2600255292 2601671530 294
78 iso_pu_bacteria 2857547612 2857548636 294
79 iso_pu_bacteria 2885080285 2885082231 294
80 iso_pu_bacteria 2932410948 2932416031 294
81 iso_pu_bacteria 2932416698 2932421956 294
82 3300005563 Ga0068855_100001100 Ga0068855_10000110035 295
83 3300005563 Ga0068855_100059076 Ga0068855_1000590762 295
84 3300005616 Ga0068852_100245011 Ga0068852_1002450113 295
85 3300009093 Ga0105240_10002667 Ga0105240_100026679 295
86 3300025913 Ga0207695_10005170 Ga0207695_100051709 295
87 3300025949 Ga0207667_10008602 Ga0207667_100086026 295
88 3300025949 Ga0207667_10086607 Ga0207667_100866074 295
89 3300026142 Ga0207698_10187727 Ga0207698_101877272 295
90 3300046660 Ga0495625_0002528 Ga0495625_0002528_2682_3620 295
91 3300048919 Ga0496116_0002196 Ga0496116_0002196_3798_4736 295
92 3300048921 Ga0496118_0044587 Ga0496118_0044587_1534_2472 295
93 3300048925 Ga0496122_0000121 Ga0496122_0000121_44107_45045 295
94 3300048926 Ga0496123_0000040 Ga0496123_0000040_44407_45345 295
95 3300048927 Ga0496124_0058411 Ga0496124_0058411_1259_2197 295
96 3300048928 Ga0496125_0000720 Ga0496125_0000720_30432_31370 295
97 3300009148 Ga0105243_10058147 Ga0105243_100581472 296
98 3300025935 Ga0207709_10037826 Ga0207709_100378264 296
99 iso_pu_bacteria 2511231026 2511384664 296
100 iso_pu_bacteria 2521172590 2521559095 296
101 iso_pu_bacteria 2551306416 2553003907 296
102 iso_pu_bacteria 2765235838 2765568658 296
103 iso_pu_bacteria 2818991449 2819615605 296
104 iso_pu_bacteria 2839094727 2839096458 296
105 iso_pu_bacteria 2904439833 2904444842 296
106 iso_pu_bacteria 2904530477 2904532342 296
107 iso_pu_bacteria 2904584206 2904584784 296
108 iso_pu_bacteria 2904589729 2904591306 296
109 iso_pu_bacteria 2904601388 2904605151 296
110 iso_pu_bacteria 2919046199 2919048319 296
111 iso_pu_bacteria 2919079590 2919081155 296
112 iso_pu_bacteria 2923510766 2923512765 296
113 iso_pu_bacteria 2928130867 2928132767 296
114 3300005458 Ga0070681_10224156 Ga0070681_102241562 297
115 3300005563 Ga0068855_100011885 Ga0068855_1000118856 297
116 3300009093 Ga0105240_10280612 Ga0105240_102806123 297
117 3300013104 Ga0157370_10010253 Ga0157370_100102533 297
118 3300013307 Ga0157372_10283305 Ga0157372_102833053 297
119 3300025253 Ga0209677_102284 Ga0209677_1022844 297
120 3300025303 Ga0209051_1001406 Ga0209051_10014067 297
121 3300025303 Ga0209051_1006685 Ga0209051_10066852 297
122 3300025912 Ga0207707_10182984 Ga0207707_101829842 297
123 3300025913 Ga0207695_10260951 Ga0207695_102609511 297
124 3300025949 Ga0207667_10038852 Ga0207667_100388525 297
125 3300046460 Ga0495638_0000047 Ga0495638_0000047_151235_152182 297
126 3300046506 Ga0495583_0000092 Ga0495583_0000092_61430_62377 297
127 3300046524 Ga0495648_0000019 Ga0495648_0000019_209398_210345 297
128 3300046528 Ga0495642_0002397 Ga0495642_0002397_439_1386 297
129 3300046557 Ga0495622_0000037 Ga0495622_0000037_66702_67649 297
130 3300046558 Ga0495633_0000086 Ga0495633_0000086_7719_8666 297
131 3300046660 Ga0495625_0000432 Ga0495625_0000432_1547_2494 297
132 3300047472 Ga0495686_0000062 Ga0495686_0000062_198295_199254 297
133 3300048090 Ga0495615_0008300 Ga0495615_0008300_433_1380 297
134 3300049571 Ga0501034_0369288 Ga0501034_0369288_285_1217 297
135 3300049585 Ga0501069_0018296 Ga0501069_0018296_227_1159 297
136 3300049586 Ga0501070_0004652 Ga0501070_0004652_3999_4931 297
137 3300049590 Ga0501074_0004908 Ga0501074_0004908_6264_7196 297
138 3300049741 Ga0501079_0010210 Ga0501079_0010210_1456_2388 297
139 3300049742 Ga0501080_0004308 Ga0501080_0004308_4866_5798 297
140 3300049744 Ga0501083_0014146 Ga0501083_0014146_266_1198 297
141 3300049823 Ga0501044_0049236 Ga0501044_0049236_2132_3064 297
142 iso_pu_bacteria 2643221556 2643800025 297
143 iso_pu_bacteria 2643221684 2644475025 297
144 iso_pu_bacteria 8047673197 8047673533 297
145 3300005288 Ga0065714_10008082 Ga0065714_100080824 298
146 3300014497 Ga0182008_10000542 Ga0182008_100005423 298
147 3300015261 Ga0182006_1000007 Ga0182006_1000007368 298
148 3300015262 Ga0182007_10000022 Ga0182007_10000022114 298
149 3300015265 Ga0182005_1000010 Ga0182005_1000010345 298
150 3300046558 Ga0495633_0000091 Ga0495633_0000091_60301_61221 298
151 3300048914 Ga0496111_0077330 Ga0496111_0077330_1025_1945 298
152 3300048919 Ga0496116_0008492 Ga0496116_0008492_6772_7692 298
153 3300048920 Ga0496117_0000005 Ga0496117_0000005_63577_64497 298
154 3300048921 Ga0496118_0000022 Ga0496118_0000022_374106_375026 298
155 3300048924 Ga0496121_0004994 Ga0496121_0004994_10371_11291 298
156 3300048924 Ga0496121_0114687 Ga0496121_0114687_119_1039 298
157 3300048925 Ga0496122_0001857 Ga0496122_0001857_1362_2282 298
158 3300048926 Ga0496123_0034198 Ga0496123_0034198_1341_2261 298
159 3300048927 Ga0496124_0060934 Ga0496124_0060934_1313_2233 298
160 3300048928 Ga0496125_0030196 Ga0496125_0030196_3215_4135 298
161 3300049460 Ga0495682_0001446 Ga0495682_0001446_1139_2059 298
162 iso_pu_bacteria 2818991436 2819541439 298
163 3300003322 rootL2_10090070 rootL2_100900701 299
164 3300030731 Ga0316177_1040718 Ga0316177_10407182 299
165 3300046523 Ga0495644_0086265 Ga0495644_0086265_125_1063 299
166 iso_pu_bacteria 2643221554 2643792452 299
167 iso_pu_bacteria 2643221638 2644217031 299
168 3300003751 Ga0055538_1000030 Ga0055538_1000030153 300
169 3300003752 Ga0055539_1000040 Ga0055539_1000040153 300
170 3300003756 Ga0055533_1000050 Ga0055533_1000050153 300
171 3300003759 Ga0055525_1000060 Ga0055525_1000060153 300
172 3300003841 Ga0055541_1000027 Ga0055541_1000027153 300
173 3300005563 Ga0068855_100000243 Ga0068855_10000024344 300
174 3300005563 Ga0068855_100280904 Ga0068855_1002809043 300
175 3300005578 Ga0068854_100071853 Ga0068854_1000718533 300
176 3300009093 Ga0105240_10012212 Ga0105240_1001221211 300
177 3300009545 Ga0105237_10041247 Ga0105237_100412474 300
178 3300009551 Ga0105238_10000547 Ga0105238_1000054743 300
179 3300010375 Ga0105239_10006605 Ga0105239_100066056 300
180 3300015261 Ga0182006_1002414 Ga0182006_100241411 300
181 3300025224 Ga0209784_100005 Ga0209784_100005773 300
182 3300025225 Ga0209566_100005 Ga0209566_100005773 300
183 3300025226 Ga0209674_100009 Ga0209674_100009773 300
184 3300025230 Ga0209563_100012 Ga0209563_100012773 300
185 3300025253 Ga0209677_100006 Ga0209677_100006773 300
186 3300025913 Ga0207695_10000913 Ga0207695_1000091337 300
187 3300025914 Ga0207671_10011896 Ga0207671_100118966 300
188 3300025924 Ga0207694_10002807 Ga0207694_100028073 300
189 3300025949 Ga0207667_10000301 Ga0207667_1000030143 300
190 3300025949 Ga0207667_10222943 Ga0207667_102229433 300
191 3300026078 Ga0207702_10158586 Ga0207702_101585861 300
192 3300046522 Ga0495643_0000388 Ga0495643_0000388_55972_56895 300
193 3300046542 Ga0495597_0000075 Ga0495597_0000075_49632_50555 300
194 3300046665 Ga0495661_0000198 Ga0495661_0000198_1122_2066 300
195 3300046810 Ga0495660_0011538 Ga0495660_0011538_3265_4188 300
196 3300048907 Ga0496104_0275695 Ga0496104_0275695_147_1070 300
197 3300048919 Ga0496116_0043485 Ga0496116_0043485_1864_2778 300
198 iso_pu_bacteria 2643221603 2644031481 300
199 3300003322 rootL2_10174602 rootL2_101746023 301
200 3300003759 Ga0055525_1000001 Ga0055525_1000001669 301
201 3300005327 Ga0070658_10066568 Ga0070658_100665684 301
202 3300005344 Ga0070661_100460774 Ga0070661_1004607741 301
203 3300005366 Ga0070659_100059246 Ga0070659_1000592463 301
204 3300005456 Ga0070678_100599754 Ga0070678_1005997541 301
205 3300005616 Ga0068852_100369736 Ga0068852_1003697362 301
206 3300005616 Ga0068852_100415233 Ga0068852_1004152333 301
207 3300009098 Ga0105245_10247558 Ga0105245_102475582 301
208 3300009148 Ga0105243_10103814 Ga0105243_101038142 301
209 3300009176 Ga0105242_10091289 Ga0105242_100912893 301
210 3300010375 Ga0105239_10322528 Ga0105239_103225282 301
211 3300021361 Ga0213872_10000087 Ga0213872_1000008736 301
212 3300025230 Ga0209563_100007 Ga0209563_100007430 301
213 3300025919 Ga0207657_10018104 Ga0207657_100181046 301
214 3300025920 Ga0207649_10321686 Ga0207649_103216861 301
215 3300025932 Ga0207690_10117401 Ga0207690_101174013 301
216 3300025934 Ga0207686_10051518 Ga0207686_100515183 301
217 3300025935 Ga0207709_10085497 Ga0207709_100854973 301
218 3300025949 Ga0207667_10136832 Ga0207667_101368322 301
219 3300026142 Ga0207698_10387524 Ga0207698_103875241 301
220 3300031239 Ga0265328_10048929 Ga0265328_100489293 301
221 3300031251 Ga0265327_10008459 Ga0265327_100084594 301
222 3300031344 Ga0265316_10000192 Ga0265316_1000019211 301
223 3300037312 Ga0395899_0004277 Ga0395899_0004277_7913_8854 301
224 3300037312 Ga0395899_0009167 Ga0395899_0009167_3352_4293 301
225 3300037312 Ga0395899_0017209 Ga0395899_0017209_3177_4118 301
226 3300037312 Ga0395899_0019216 Ga0395899_0019216_2244_3185 301
227 3300037418 Ga0395900_0000826 Ga0395900_0000826_12414_13355 301
228 3300037418 Ga0395900_0017822 Ga0395900_0017822_4315_5256 301
229 3300037418 Ga0395900_0019747 Ga0395900_0019747_1526_2470 301
230 3300037418 Ga0395900_0074854 Ga0395900_0074854_271_1212 301
231 3300037418 Ga0395900_0131159 Ga0395900_0131159_443_1384 301
232 3300037418 Ga0395900_0196452 Ga0395900_0196452_879_1820 301
233 3300037418 Ga0395900_0272047 Ga0395900_0272047_103_1044 301
234 3300037418 Ga0395900_0296765 Ga0395900_0296765_92_1033 301
235 3300037466 Ga0395898_0040343 Ga0395898_0040343_318_1259 301
236 3300037466 Ga0395898_0082471 Ga0395898_0082471_653_1594 301
237 3300037471 Ga0395905_0007217 Ga0395905_0007217_499_1431 301
238 3300037471 Ga0395905_0033040 Ga0395905_0033040_572_1513 301
239 3300037471 Ga0395905_0079842 Ga0395905_0079842_2026_2961 301
240 3300037471 Ga0395905_0123194 Ga0395905_0123194_988_1929 301
241 3300037471 Ga0395905_0245047 Ga0395905_0245047_149_1075 301
242 3300037471 Ga0395905_0348570 Ga0395905_0348570_202_1143 301
243 3300038443 Ga0395901_0000033 Ga0395901_0000033_156034_156975 301
244 3300038443 Ga0395901_0001938 Ga0395901_0001938_7421_8362 301
245 3300038443 Ga0395901_0022786 Ga0395901_0022786_1191_2132 301
246 3300038443 Ga0395901_0031647 Ga0395901_0031647_2988_3932 301
247 3300038443 Ga0395901_0132471 Ga0395901_0132471_1610_2551 301
248 3300038443 Ga0395901_0132653 Ga0395901_0132653_1213_2154 301
249 3300038443 Ga0395901_0216633 Ga0395901_0216633_843_1784 301
250 3300039447 Ga0436361_0595316 Ga0436361_0595316_39424_40377 301
251 3300042005 Ga0439448_0006050 Ga0439448_0006050_1644_2582 301
252 3300042008 Ga0439450_003927 Ga0439450_003927_833_1771 301
253 3300042012 Ga0439455_0022445 Ga0439455_0022445_198_1136 301
254 3300042139 Ga0450904_000694 Ga0450904_000694_4170_5120 301
255 3300042532 Ga0450893_0011512 Ga0450893_0011512_440_1381 301
256 3300044684 Ga0466966_0039284 Ga0466966_0039284_1422_2363 301
257 3300044694 Ga0466963_0019225 Ga0466963_0019225_2867_3823 301
258 3300044706 Ga0466964_0000038 Ga0466964_0000038_24495_25433 301
259 3300044706 Ga0466964_0083204 Ga0466964_0083204_204_1148 301
260 3300044842 Ga0466957_0026106 Ga0466957_0026106_548_1501 301
261 3300044842 Ga0466957_0045470 Ga0466957_0045470_361_1317 301
262 3300045976 Ga0466967_0046032 Ga0466967_0046032_571_1527 301
263 3300045976 Ga0466967_0052043 Ga0466967_0052043_778_1716 301
264 3300046452 Ga0495617_000055 Ga0495617_000055_39134_40057 301
265 3300046452 Ga0495617_000197 Ga0495617_000197_35421_36353 301
266 3300046453 Ga0495627_000123 Ga0495627_000123_54542_55465 301
267 3300046453 Ga0495627_024396 Ga0495627_024396_44_976 301
268 3300046455 Ga0495603_0060162 Ga0495603_0060162_1212_2153 301
269 3300046457 Ga0495590_0002304 Ga0495590_0002304_917_1840 301
270 3300046457 Ga0495590_0015419 Ga0495590_0015419_343_1269 301
271 3300046457 Ga0495590_0056039 Ga0495590_0056039_343_1269 301
272 3300046458 Ga0495591_023414 Ga0495591_023414_327_1250 301
273 3300046460 Ga0495638_0011670 Ga0495638_0011670_3599_4531 301
274 3300046460 Ga0495638_0047332 Ga0495638_0047332_1049_1972 301
275 3300046460 Ga0495638_0063804 Ga0495638_0063804_969_1901 301
276 3300046474 Ga0495605_0000035 Ga0495605_0000035_140604_141527 301
277 3300046474 Ga0495605_0000206 Ga0495605_0000206_30014_30955 301
278 3300046474 Ga0495605_0003120 Ga0495605_0003120_1096_2037 301
279 3300046474 Ga0495605_0008334 Ga0495605_0008334_4347_5288 301
280 3300046474 Ga0495605_0029583 Ga0495605_0029583_1298_2230 301
281 3300046491 Ga0495584_0000006 Ga0495584_0000006_278876_279808 301
282 3300046491 Ga0495584_0002756 Ga0495584_0002756_7403_8335 301
283 3300046491 Ga0495584_0008363 Ga0495584_0008363_147_1070 301
284 3300046491 Ga0495584_0025346 Ga0495584_0025346_1743_2684 301
285 3300046491 Ga0495584_0042803 Ga0495584_0042803_1180_2112 301
286 3300046491 Ga0495584_0079987 Ga0495584_0079987_87_1019 301
287 3300046492 Ga0495585_0000005 Ga0495585_0000005_291726_292658 301
288 3300046492 Ga0495585_0000049 Ga0495585_0000049_39755_40687 301
289 3300046492 Ga0495585_0000162 Ga0495585_0000162_1298_2230 301
290 3300046492 Ga0495585_0003133 Ga0495585_0003133_9092_10024 301
291 3300046492 Ga0495585_0006337 Ga0495585_0006337_1192_2115 301
292 3300046492 Ga0495585_0020793 Ga0495585_0020793_2613_3545 301
293 3300046492 Ga0495585_0024583 Ga0495585_0024583_1474_2397 301
294 3300046492 Ga0495585_0025442 Ga0495585_0025442_320_1252 301
295 3300046492 Ga0495585_0045473 Ga0495585_0045473_22_945 301
296 3300046492 Ga0495585_0050114 Ga0495585_0050114_542_1474 301
297 3300046492 Ga0495585_0104980 Ga0495585_0104980_561_1484 301
298 3300046499 Ga0495594_0061635 Ga0495594_0061635_866_1789 301
299 3300046500 Ga0495596_0000013 Ga0495596_0000013_1365_2297 301
300 3300046500 Ga0495596_0004436 Ga0495596_0004436_4301_5224 301
301 3300046500 Ga0495596_0005617 Ga0495596_0005617_3403_4326 301
302 3300046500 Ga0495596_0026349 Ga0495596_0026349_1006_1929 301
303 3300046500 Ga0495596_0027105 Ga0495596_0027105_666_1598 301
304 3300046501 Ga0495607_0002443 Ga0495607_0002443_12729_13670 301
305 3300046501 Ga0495607_0005432 Ga0495607_0005432_6865_7806 301
306 3300046501 Ga0495607_0007839 Ga0495607_0007839_691_1632 301
307 3300046501 Ga0495607_0024570 Ga0495607_0024570_1082_2029 301
308 3300046501 Ga0495607_0040921 Ga0495607_0040921_1280_2212 301
309 3300046501 Ga0495607_0051010 Ga0495607_0051010_70_993 301
310 3300046506 Ga0495583_0000008 Ga0495583_0000008_347987_348925 301
311 3300046506 Ga0495583_0000480 Ga0495583_0000480_3087_4019 301
312 3300046506 Ga0495583_0016772 Ga0495583_0016772_1844_2776 301
313 3300046506 Ga0495583_0017309 Ga0495583_0017309_2614_3537 301
314 3300046506 Ga0495583_0069315 Ga0495583_0069315_35_967 301
315 3300046507 Ga0495606_0002636 Ga0495606_0002636_7686_8627 301
316 3300046507 Ga0495606_0018361 Ga0495606_0018361_3044_3976 301
317 3300046507 Ga0495606_0115140 Ga0495606_0115140_347_1270 301
318 3300046513 Ga0495616_0000020 Ga0495616_0000020_160121_161044 301
319 3300046513 Ga0495616_0000125 Ga0495616_0000125_7802_8743 301
320 3300046513 Ga0495616_0001444 Ga0495616_0001444_15162_16085 301
321 3300046513 Ga0495616_0014163 Ga0495616_0014163_3097_4020 301
322 3300046513 Ga0495616_0019529 Ga0495616_0019529_2015_2947 301
323 3300046513 Ga0495616_0022220 Ga0495616_0022220_1125_2066 301
324 3300046513 Ga0495616_0041507 Ga0495616_0041507_16_948 301
325 3300046513 Ga0495616_0064595 Ga0495616_0064595_431_1354 301
326 3300046515 Ga0495620_0017241 Ga0495620_0017241_132_1064 301
327 3300046518 Ga0495631_0002141 Ga0495631_0002141_3357_4280 301
328 3300046518 Ga0495631_0002183 Ga0495631_0002183_669_1592 301
329 3300046518 Ga0495631_0006181 Ga0495631_0006181_3912_4835 301
330 3300046518 Ga0495631_0018425 Ga0495631_0018425_1501_2433 301
331 3300046518 Ga0495631_0028420 Ga0495631_0028420_207_1139 301
332 3300046518 Ga0495631_0050686 Ga0495631_0050686_339_1262 301
333 3300046519 Ga0495632_0000093 Ga0495632_0000093_35429_36370 301
334 3300046519 Ga0495632_0001267 Ga0495632_0001267_19250_20197 301
335 3300046519 Ga0495632_0009088 Ga0495632_0009088_3613_4545 301
336 3300046520 Ga0495637_0037740 Ga0495637_0037740_193_1116 301
337 3300046522 Ga0495643_0001128 Ga0495643_0001128_2254_3195 301
338 3300046522 Ga0495643_0001450 Ga0495643_0001450_19590_20519 301
339 3300046522 Ga0495643_0003381 Ga0495643_0003381_1253_2200 301
340 3300046522 Ga0495643_0068080 Ga0495643_0068080_612_1535 301
341 3300046523 Ga0495644_0023838 Ga0495644_0023838_98_1030 301
342 3300046524 Ga0495648_0000033 Ga0495648_0000033_162811_163743 301
343 3300046524 Ga0495648_0000527 Ga0495648_0000527_1128_2051 301
344 3300046524 Ga0495648_0025773 Ga0495648_0025773_1625_2566 301
345 3300046524 Ga0495648_0038786 Ga0495648_0038786_1019_1942 301
346 3300046524 Ga0495648_0048784 Ga0495648_0048784_33_956 301
347 3300046525 Ga0495663_0008597 Ga0495663_0008597_705_1637 301
348 3300046528 Ga0495642_0000005 Ga0495642_0000005_102752_103675 301
349 3300046528 Ga0495642_0000111 Ga0495642_0000111_10050_10973 301
350 3300046528 Ga0495642_0001868 Ga0495642_0001868_7593_8531 301
351 3300046528 Ga0495642_0024585 Ga0495642_0024585_764_1696 301
352 3300046528 Ga0495642_0031655 Ga0495642_0031655_657_1598 301
353 3300046530 Ga0495654_0003975 Ga0495654_0003975_2074_2997 301
354 3300046530 Ga0495654_0017364 Ga0495654_0017364_1480_2403 301
355 3300046538 Ga0495609_0000122 Ga0495609_0000122_28260_29201 301
356 3300046538 Ga0495609_0034137 Ga0495609_0034137_247_1170 301
357 3300046542 Ga0495597_0000244 Ga0495597_0000244_16274_17197 301
358 3300046542 Ga0495597_0000277 Ga0495597_0000277_44432_45355 301
359 3300046542 Ga0495597_0004294 Ga0495597_0004294_1629_2552 301
360 3300046542 Ga0495597_0004483 Ga0495597_0004483_1544_2479 301
361 3300046542 Ga0495597_0024107 Ga0495597_0024107_931_1863 301
362 3300046558 Ga0495633_0002740 Ga0495633_0002740_1462_2385 301
363 3300046558 Ga0495633_0012297 Ga0495633_0012297_2065_2997 301
364 3300046558 Ga0495633_0013563 Ga0495633_0013563_1634_2566 301
365 3300046558 Ga0495633_0032504 Ga0495633_0032504_1083_2015 301
366 3300046558 Ga0495633_0049745 Ga0495633_0049745_491_1423 301
367 3300046558 Ga0495633_0098470 Ga0495633_0098470_227_1150 301
368 3300046615 Ga0495656_0006282 Ga0495656_0006282_1932_2864 301
369 3300046615 Ga0495656_0075222 Ga0495656_0075222_318_1250 301
370 3300046616 Ga0495668_0000987 Ga0495668_0000987_1401_2324 301
371 3300046616 Ga0495668_0005034 Ga0495668_0005034_683_1615 301
372 3300046616 Ga0495668_0009537 Ga0495668_0009537_1504_2427 301
373 3300046616 Ga0495668_0014164 Ga0495668_0014164_1480_2412 301
374 3300046616 Ga0495668_0024190 Ga0495668_0024190_2330_3262 301
375 3300046616 Ga0495668_0030873 Ga0495668_0030873_650_1573 301
376 3300046616 Ga0495668_0031775 Ga0495668_0031775_1604_2527 301
377 3300046648 Ga0495611_0002764 Ga0495611_0002764_2585_3517 301
378 3300046648 Ga0495611_0009182 Ga0495611_0009182_113_1045 301
379 3300046648 Ga0495611_0028529 Ga0495611_0028529_704_1627 301
380 3300046660 Ga0495625_0004594 Ga0495625_0004594_11238_12161 301
381 3300046660 Ga0495625_0050856 Ga0495625_0050856_661_1584 301
382 3300046660 Ga0495625_0103415 Ga0495625_0103415_646_1578 301
383 3300046660 Ga0495625_0128854 Ga0495625_0128854_132_1064 301
384 3300046665 Ga0495661_0000254 Ga0495661_0000254_29499_30440 301
385 3300046665 Ga0495661_0000654 Ga0495661_0000654_17894_18835 301
386 3300046665 Ga0495661_0003108 Ga0495661_0003108_10272_11195 301
387 3300046665 Ga0495661_0009714 Ga0495661_0009714_1334_2263 301
388 3300046665 Ga0495661_0014465 Ga0495661_0014465_1237_2184 301
389 3300046665 Ga0495661_0021666 Ga0495661_0021666_626_1558 301
390 3300046665 Ga0495661_0032911 Ga0495661_0032911_183_1106 301
391 3300046665 Ga0495661_0045002 Ga0495661_0045002_1531_2454 301
392 3300046665 Ga0495661_0088042 Ga0495661_0088042_228_1160 301
393 3300046674 Ga0495588_0000055 Ga0495588_0000055_179283_180236 301
394 3300046674 Ga0495588_0004945 Ga0495588_0004945_3601_4524 301
395 3300046674 Ga0495588_0018614 Ga0495588_0018614_1021_1944 301
396 3300046684 Ga0495669_0003999 Ga0495669_0003999_1417_2340 301
397 3300046684 Ga0495669_0013249 Ga0495669_0013249_1411_2334 301
398 3300046684 Ga0495669_0018939 Ga0495669_0018939_1833_2774 301
399 3300046684 Ga0495669_0033489 Ga0495669_0033489_172_1104 301
400 3300046684 Ga0495669_0114592 Ga0495669_0114592_16_948 301
401 3300046691 Ga0495670_0000840 Ga0495670_0000840_12912_13835 301
402 3300046691 Ga0495670_0003303 Ga0495670_0003303_1496_2428 301
403 3300046691 Ga0495670_0007293 Ga0495670_0007293_3776_4708 301
404 3300046691 Ga0495670_0014746 Ga0495670_0014746_1476_2408 301
405 3300046692 Ga0495671_0000294 Ga0495671_0000294_1246_2169 301
406 3300046692 Ga0495671_0015630 Ga0495671_0015630_1472_2395 301
407 3300046694 Ga0495649_0002517 Ga0495649_0002517_11764_12711 301
408 3300046694 Ga0495649_0029483 Ga0495649_0029483_130_1053 301
409 3300046794 Ga0495589_0000049 Ga0495589_0000049_104435_105376 301
410 3300046794 Ga0495589_0000248 Ga0495589_0000248_13120_14061 301
411 3300046794 Ga0495589_0000732 Ga0495589_0000732_1437_2360 301
412 3300046794 Ga0495589_0017384 Ga0495589_0017384_1664_2587 301
413 3300046794 Ga0495589_0148308 Ga0495589_0148308_19_951 301
414 3300046810 Ga0495660_0000167 Ga0495660_0000167_40140_41081 301
415 3300046810 Ga0495660_0024157 Ga0495660_0024157_245_1177 301
416 3300046810 Ga0495660_0027283 Ga0495660_0027283_166_1089 301
417 3300047318 Ga0495636_0038726 Ga0495636_0038726_1021_1953 301
418 3300047318 Ga0495636_0126537 Ga0495636_0126537_77_1015 301
419 3300047320 Ga0495672_0027083 Ga0495672_0027083_1367_2308 301
420 3300047323 Ga0495683_0000072 Ga0495683_0000072_98954_99886 301
421 3300047323 Ga0495683_0037948 Ga0495683_0037948_299_1231 301
422 3300047323 Ga0495683_0049462 Ga0495683_0049462_946_1869 301
423 3300047323 Ga0495683_0065004 Ga0495683_0065004_323_1255 301
424 3300047443 Ga0495687_000024 Ga0495687_000024_28260_29201 301
425 3300047443 Ga0495687_000456 Ga0495687_000456_13334_14257 301
426 3300047443 Ga0495687_000855 Ga0495687_000855_30014_30955 301
427 3300047443 Ga0495687_000970 Ga0495687_000970_4808_5749 301
428 3300047445 Ga0495677_0000017 Ga0495677_0000017_92290_93231 301
429 3300047445 Ga0495677_0000478 Ga0495677_0000478_1280_2227 301
430 3300047445 Ga0495677_0003557 Ga0495677_0003557_3824_4765 301
431 3300047445 Ga0495677_0008886 Ga0495677_0008886_595_1518 301
432 3300047445 Ga0495677_0017215 Ga0495677_0017215_147_1070 301
433 3300047445 Ga0495677_0026044 Ga0495677_0026044_454_1386 301
434 3300047446 Ga0495679_020250 Ga0495679_020250_1290_2213 301
435 3300047447 Ga0495685_026805 Ga0495685_026805_550_1482 301
436 3300047470 Ga0495681_0043297 Ga0495681_0043297_690_1622 301
437 3300047470 Ga0495681_0044896 Ga0495681_0044896_1039_1962 301
438 3300047470 Ga0495681_0085133 Ga0495681_0085133_245_1177 301
439 3300047470 Ga0495681_0103962 Ga0495681_0103962_159_1082 301
440 3300047472 Ga0495686_0000431 Ga0495686_0000431_46358_47281 301
441 3300047472 Ga0495686_0048025 Ga0495686_0048025_1488_2411 301
442 3300048091 Ga0495626_0000202 Ga0495626_0000202_41439_42380 301
443 3300048091 Ga0495626_0001340 Ga0495626_0001340_9510_10457 301
444 3300048091 Ga0495626_0002145 Ga0495626_0002145_1395_2318 301
445 3300048091 Ga0495626_0003033 Ga0495626_0003033_1380_2321 301
446 3300048091 Ga0495626_0014993 Ga0495626_0014993_656_1603 301
447 3300048091 Ga0495626_0030964 Ga0495626_0030964_1568_2491 301
448 3300048091 Ga0495626_0076195 Ga0495626_0076195_121_1068 301
449 3300048903 Ga0496100_0203498 Ga0496100_0203498_92_1036 301
450 3300048905 Ga0496102_0000071 Ga0496102_0000071_76670_77602 301
451 3300048905 Ga0496102_0000071 Ga0496102_0000071_91705_92640 301
452 3300048905 Ga0496102_0114322 Ga0496102_0114322_958_1890 301
453 3300048905 Ga0496102_0305413 Ga0496102_0305413_219_1160 301
454 3300048906 Ga0496103_0030941 Ga0496103_0030941_1143_2066 301
455 3300048906 Ga0496103_0033175 Ga0496103_0033175_1082_2014 301
456 3300048906 Ga0496103_0050773 Ga0496103_0050773_1213_2145 301
457 3300048906 Ga0496103_0143341 Ga0496103_0143341_213_1157 301
458 3300048907 Ga0496104_0101788 Ga0496104_0101788_1417_2361 301
459 3300048912 Ga0496109_0148947 Ga0496109_0148947_26_961 301
460 3300048913 Ga0496110_0001557 Ga0496110_0001557_1426_2349 301
461 3300048914 Ga0496111_0123990 Ga0496111_0123990_538_1461 301
462 3300048916 Ga0496113_0029191 Ga0496113_0029191_264_1205 301
463 3300048916 Ga0496113_0137320 Ga0496113_0137320_624_1565 301
464 3300048918 Ga0496115_0309751 Ga0496115_0309751_106_1029 301
465 3300048925 Ga0496122_0000263 Ga0496122_0000263_5072_6007 301
466 3300048925 Ga0496122_0022503 Ga0496122_0022503_433_1374 301
467 3300048925 Ga0496122_0078180 Ga0496122_0078180_1125_2066 301
468 3300048926 Ga0496123_0000156 Ga0496123_0000156_137146_138081 301
469 3300048926 Ga0496123_0006176 Ga0496123_0006176_1261_2202 301
470 3300048926 Ga0496123_0045315 Ga0496123_0045315_1725_2666 301
471 3300048927 Ga0496124_0005845 Ga0496124_0005845_9833_10789 301
472 3300048927 Ga0496124_0011979 Ga0496124_0011979_7161_8129 301
473 3300048927 Ga0496124_0038760 Ga0496124_0038760_58_981 301
474 3300048927 Ga0496124_0077481 Ga0496124_0077481_653_1603 301
475 3300048928 Ga0496125_0000672 Ga0496125_0000672_1340_2275 301
476 3300049459 Ga0495678_000035 Ga0495678_000035_195979_196902 301
477 3300049459 Ga0495678_000232 Ga0495678_000232_48253_49176 301
478 3300049460 Ga0495682_0000210 Ga0495682_0000210_45005_45928 301
479 3300049460 Ga0495682_0004102 Ga0495682_0004102_1057_1989 301
480 3300049460 Ga0495682_0012843 Ga0495682_0012843_1425_2348 301
481 3300049822 Ga0501035_0028204 Ga0501035_0028204_1472_2413 301
482 3300003771 Ga0055526_1000885 Ga0055526_100088519 302
483 3300003773 Ga0055537_1000005 Ga0055537_100000576 302
484 3300003775 Ga0055524_1000038 Ga0055524_100003888 302
485 3300003775 Ga0055524_1028267 Ga0055524_10282671 302
486 3300003784 Ga0055534_1000127 Ga0055534_10001276 302
487 3300003790 Ga0055528_1000063 Ga0055528_100006376 302
488 3300015262 Ga0182007_10002459 Ga0182007_100024593 302
489 3300015262 Ga0182007_10071288 Ga0182007_100712882 302
490 3300021361 Ga0213872_10000703 Ga0213872_1000070321 302
491 3300025263 Ga0209565_1000074 Ga0209565_100007479 302
492 3300025263 Ga0209565_1005640 Ga0209565_10056403 302
493 3300025273 Ga0209673_1000129 Ga0209673_100012982 302
494 3300025291 Ga0209675_1000072 Ga0209675_100007282 302
495 3300025295 Ga0209564_1000160 Ga0209564_100016081 302
496 3300025295 Ga0209564_1016727 Ga0209564_10167273 302
497 3300025299 Ga0209256_1000018 Ga0209256_1000018162 302
498 3300025299 Ga0209256_1000125 Ga0209256_100012582 302
499 3300027666 Ga0209282_1000005 Ga0209282_1000005157 302
500 3300039447 Ga0436361_0492958 Ga0436361_0492958_19785_20738 302
501 3300044765 Ga0466970_0006191 Ga0466970_0006191_4367_5296 302
502 3300046453 Ga0495627_008222 Ga0495627_008222_1585_2514 302
503 3300046454 Ga0495592_0028251 Ga0495592_0028251_1406_2365 302
504 3300046460 Ga0495638_0002024 Ga0495638_0002024_1298_2224 302
505 3300046462 Ga0495651_0121657 Ga0495651_0121657_902_1861 302
506 3300046463 Ga0495653_0022531 Ga0495653_0022531_3943_4902 302
507 3300046463 Ga0495653_0096197 Ga0495653_0096197_1030_1965 302
508 3300046473 Ga0495582_0046243 Ga0495582_0046243_45_986 302
509 3300046491 Ga0495584_0001531 Ga0495584_0001531_11991_12917 302
510 3300046491 Ga0495584_0002419 Ga0495584_0002419_947_1885 302
511 3300046492 Ga0495585_0086482 Ga0495585_0086482_321_1259 302
512 3300046499 Ga0495594_0043180 Ga0495594_0043180_641_1582 302
513 3300046500 Ga0495596_0001390 Ga0495596_0001390_686_1636 302
514 3300046500 Ga0495596_0007448 Ga0495596_0007448_3310_4245 302
515 3300046501 Ga0495607_0001792 Ga0495607_0001792_1489_2415 302
516 3300046506 Ga0495583_0001098 Ga0495583_0001098_26848_27777 302
517 3300046506 Ga0495583_0005766 Ga0495583_0005766_7319_8245 302
518 3300046506 Ga0495583_0028977 Ga0495583_0028977_1163_2092 302
519 3300046506 Ga0495583_0053571 Ga0495583_0053571_204_1133 302
520 3300046511 Ga0495608_0082455 Ga0495608_0082455_768_1727 302
521 3300046513 Ga0495616_0001133 Ga0495616_0001133_1183_2109 302
522 3300046514 Ga0495618_0054139 Ga0495618_0054139_699_1658 302
523 3300046516 Ga0495628_0000315 Ga0495628_0000315_25433_26392 302
524 3300046516 Ga0495628_0007175 Ga0495628_0007175_7269_8228 302
525 3300046519 Ga0495632_0000029 Ga0495632_0000029_116157_117086 302
526 3300046523 Ga0495644_0082728 Ga0495644_0082728_206_1135 302
527 3300046525 Ga0495663_0002070 Ga0495663_0002070_4100_5041 302
528 3300046526 Ga0495666_0020595 Ga0495666_0020595_70_1005 302
529 3300046526 Ga0495666_0030354 Ga0495666_0030354_1427_2368 302
530 3300046528 Ga0495642_0004661 Ga0495642_0004661_913_1842 302
531 3300046528 Ga0495642_0009857 Ga0495642_0009857_1507_2448 302
532 3300046529 Ga0495652_0052476 Ga0495652_0052476_1412_2371 302
533 3300046529 Ga0495652_0149700 Ga0495652_0149700_821_1756 302
534 3300046531 Ga0495665_0050197 Ga0495665_0050197_75_1013 302
535 3300046535 Ga0495586_0031016 Ga0495586_0031016_642_1580 302
536 3300046536 Ga0495587_0080591 Ga0495587_0080591_718_1653 302
537 3300046538 Ga0495609_0000127 Ga0495609_0000127_79953_80879 302
538 3300046538 Ga0495609_0037541 Ga0495609_0037541_1079_2017 302
539 3300046542 Ga0495597_0084741 Ga0495597_0084741_306_1244 302
540 3300046543 Ga0495645_0056984 Ga0495645_0056984_1393_2352 302
541 3300046558 Ga0495633_0078216 Ga0495633_0078216_592_1530 302
542 3300046615 Ga0495656_0001811 Ga0495656_0001811_5928_6869 302
543 3300046616 Ga0495668_0001514 Ga0495668_0001514_12836_13762 302
544 3300046616 Ga0495668_0163460 Ga0495668_0163460_249_1178 302
545 3300046660 Ga0495625_0002580 Ga0495625_0002580_8527_9453 302
546 3300046660 Ga0495625_0029530 Ga0495625_0029530_1189_2124 302
547 3300046663 Ga0495635_0067746 Ga0495635_0067746_756_1715 302
548 3300046664 Ga0495659_0000368 Ga0495659_0000368_8527_9453 302
549 3300046665 Ga0495661_0001765 Ga0495661_0001765_678_1604 302
550 3300046665 Ga0495661_0036158 Ga0495661_0036158_1506_2435 302
551 3300046674 Ga0495588_0155201 Ga0495588_0155201_170_1105 302
552 3300046675 Ga0495657_0030526 Ga0495657_0030526_2314_3273 302
553 3300046678 Ga0495599_0004724 Ga0495599_0004724_35_994 302
554 3300046679 Ga0495623_0019897 Ga0495623_0019897_1441_2400 302
555 3300046690 Ga0495624_0063954 Ga0495624_0063954_692_1627 302
556 3300046690 Ga0495624_0168484 Ga0495624_0168484_204_1163 302
557 3300046691 Ga0495670_0036166 Ga0495670_0036166_416_1354 302
558 3300046692 Ga0495671_0001143 Ga0495671_0001143_1882_2811 302
559 3300046692 Ga0495671_0001848 Ga0495671_0001848_963_1892 302
560 3300046694 Ga0495649_0001632 Ga0495649_0001632_7412_8338 302
561 3300046694 Ga0495649_0056711 Ga0495649_0056711_1112_2041 302
562 3300046794 Ga0495589_0025063 Ga0495589_0025063_1583_2521 302
563 3300046809 Ga0495600_0003375 Ga0495600_0003375_1305_2264 302
564 3300046809 Ga0495600_0092665 Ga0495600_0092665_661_1596 302
565 3300046810 Ga0495660_0012541 Ga0495660_0012541_1265_2191 302
566 3300046810 Ga0495660_0094127 Ga0495660_0094127_279_1211 302
567 3300047315 Ga0495581_0059508 Ga0495581_0059508_855_1793 302
568 3300047317 Ga0495604_0011517 Ga0495604_0011517_6034_6993 302
569 3300047317 Ga0495604_0113077 Ga0495604_0113077_700_1635 302
570 3300047318 Ga0495636_0001381 Ga0495636_0001381_835_1761 302
571 3300047320 Ga0495672_0199766 Ga0495672_0199766_29_964 302
572 3300047321 Ga0495676_0063085 Ga0495676_0063085_709_1644 302
573 3300047443 Ga0495687_001969 Ga0495687_001969_605_1534 302
574 3300047443 Ga0495687_003707 Ga0495687_003707_8706_9632 302
575 3300047445 Ga0495677_0000650 Ga0495677_0000650_12271_13197 302
576 3300047445 Ga0495677_0033579 Ga0495677_0033579_177_1106 302
577 3300047447 Ga0495685_005104 Ga0495685_005104_2642_3568 302
578 3300047469 Ga0495673_0014443 Ga0495673_0014443_1704_2639 302
579 3300047470 Ga0495681_0003096 Ga0495681_0003096_9905_10831 302
580 3300047470 Ga0495681_0006805 Ga0495681_0006805_1396_2325 302
581 3300047472 Ga0495686_0156380 Ga0495686_0156380_17_967 302
582 3300047673 Ga0495593_0002258 Ga0495593_0002258_9315_10250 302
583 3300047673 Ga0495593_0020776 Ga0495593_0020776_773_1711 302
584 3300048088 Ga0495602_0050252 Ga0495602_0050252_1286_2245 302
585 3300048088 Ga0495602_0157991 Ga0495602_0157991_654_1613 302
586 3300048090 Ga0495615_0003336 Ga0495615_0003336_1081_2022 302
587 3300048091 Ga0495626_0003131 Ga0495626_0003131_1516_2454 302
588 3300048091 Ga0495626_0003253 Ga0495626_0003253_6966_7904 302
589 3300048091 Ga0495626_0088777 Ga0495626_0088777_406_1341 302
590 3300048918 Ga0496115_0239605 Ga0496115_0239605_179_1114 302
591 3300049459 Ga0495678_001730 Ga0495678_001730_13880_14809 302
592 3300053077 Ga0495601_0008185 Ga0495601_0008185_1509_2468 302
593 3300053119 Ga0500595_003105 Ga0500595_003105_1391_2350 302
594 3300053140 Ga0500573_0135707 Ga0500573_0135707_80_1039 302
595 3300053154 Ga0500619_002584 Ga0500619_002584_38_1015 302
596 3300002739 JGI25158J39367_1002133 JGI25158J39367_10021332 303
597 3300002773 JGI25152J39213_1002579 JGI25152J39213_10025797 303
598 3300002773 JGI25152J39213_1007431 JGI25152J39213_10074311 303
599 3300002774 JGI25150J39212_1013348 JGI25150J39212_10133483 303
600 3300002987 JGI25159J45721_1001029 JGI25159J45721_100102911 303
601 3300002987 JGI25159J45721_1002206 JGI25159J45721_10022063 303
602 3300003215 JGI25153J46596_10012384 JGI25153J46596_100123842 303
603 3300003374 JGI25161J50226_1000734 JGI25161J50226_10007344 303
604 3300003771 Ga0055526_1001567 Ga0055526_10015671 303
605 3300003771 Ga0055526_1011491 Ga0055526_10114914 303
606 3300003773 Ga0055537_1003477 Ga0055537_10034776 303
607 3300003775 Ga0055524_1002845 Ga0055524_10028458 303
608 3300003775 Ga0055524_1006360 Ga0055524_10063604 303
609 3300003784 Ga0055534_1001049 Ga0055534_100104911 303
610 3300003790 Ga0055528_1002242 Ga0055528_100224210 303
611 3300003791 Ga0055530_10001675 Ga0055530_1000167517 303
612 3300004625 Ga0055543_1001698 Ga0055543_10016986 303
613 3300005262 Ga0065165_1000034 Ga0065165_1000034135 303
614 3300005262 Ga0065165_1003016 Ga0065165_10030164 303
615 3300005331 Ga0070670_100002673 Ga0070670_10000267314 303
616 3300005339 Ga0070660_100008707 Ga0070660_1000087074 303
617 3300005344 Ga0070661_100017505 Ga0070661_1000175055 303
618 3300005347 Ga0070668_100108862 Ga0070668_1001088622 303
619 3300005364 Ga0070673_100052053 Ga0070673_1000520534 303
620 3300005366 Ga0070659_100000456 Ga0070659_10000045622 303
621 3300005543 Ga0070672_100076017 Ga0070672_1000760173 303
622 3300005564 Ga0070664_100049799 Ga0070664_1000497992 303
623 3300005564 Ga0070664_100148823 Ga0070664_1001488232 303
624 3300005618 Ga0068864_100001909 Ga0068864_10000190917 303
625 3300005841 Ga0068863_100003624 Ga0068863_10000362410 303
626 3300013296 Ga0157374_10121038 Ga0157374_101210383 303
627 3300014325 Ga0163163_10005831 Ga0163163_100058314 303
628 3300017792 Ga0163161_10228890 Ga0163161_102288902 303
629 3300025208 Ga0209436_100040 Ga0209436_10004073 303
630 3300025208 Ga0209436_104332 Ga0209436_1043324 303
631 3300025245 Ga0207425_1000009 Ga0207425_1000009188 303
632 3300025245 Ga0207425_1000036 Ga0207425_1000036151 303
633 3300025258 Ga0209129_1000051 Ga0209129_1000051111 303
634 3300025258 Ga0209129_1016008 Ga0209129_10160083 303
635 3300025263 Ga0209565_1000662 Ga0209565_100066223 303
636 3300025263 Ga0209565_1001767 Ga0209565_10017676 303
637 3300025263 Ga0209565_1021237 Ga0209565_10212372 303
638 3300025273 Ga0209673_1006223 Ga0209673_10062236 303
639 3300025284 Ga0209130_1000016 Ga0209130_100001673 303
640 3300025284 Ga0209130_1000217 Ga0209130_10002174 303
641 3300025284 Ga0209130_1004379 Ga0209130_10043792 303
642 3300025291 Ga0209675_1023079 Ga0209675_10230792 303
643 3300025295 Ga0209564_1000172 Ga0209564_100017282 303
644 3300025295 Ga0209564_1009057 Ga0209564_10090576 303
645 3300025297 Ga0209758_1000054 Ga0209758_1000054188 303
646 3300025298 Ga0209050_1000040 Ga0209050_100004016 303
647 3300025298 Ga0209050_1000309 Ga0209050_100030919 303
648 3300025298 Ga0209050_1040797 Ga0209050_10407972 303
649 3300025299 Ga0209256_1000307 Ga0209256_100030723 303
650 3300025299 Ga0209256_1000553 Ga0209256_100055324 303
651 3300025299 Ga0209256_1001812 Ga0209256_10018126 303
652 3300025302 Ga0207426_1020060 Ga0207426_10200603 303
653 3300025303 Ga0209051_1009224 Ga0209051_10092244 303
654 3300025304 Ga0209257_1000054 Ga0209257_1000054382 303
655 3300025908 Ga0207643_10197902 Ga0207643_101979022 303
656 3300025919 Ga0207657_10001579 Ga0207657_1000157911 303
657 3300025920 Ga0207649_10015582 Ga0207649_100155822 303
658 3300025925 Ga0207650_10007503 Ga0207650_100075034 303
659 3300025926 Ga0207659_10022051 Ga0207659_100220513 303
660 3300025932 Ga0207690_10178372 Ga0207690_101783722 303
661 3300025940 Ga0207691_10078797 Ga0207691_100787974 303
662 3300025945 Ga0207679_10028672 Ga0207679_100286722 303
663 3300025945 Ga0207679_10122745 Ga0207679_101227452 303
664 3300025972 Ga0207668_10256405 Ga0207668_102564052 303
665 3300025986 Ga0207658_10125403 Ga0207658_101254032 303
666 3300026088 Ga0207641_10003573 Ga0207641_1000357310 303
667 3300026095 Ga0207676_10001593 Ga0207676_100015936 303
668 3300031548 Ga0307408_100002435 Ga0307408_1000024354 303
669 3300031548 Ga0307408_100003117 Ga0307408_10000311711 303
670 3300032002 Ga0307416_100013859 Ga0307416_1000138592 303
671 3300035724 Ga0373933_0162110 Ga0373933_0162110_52_1005 303
672 3300046457 Ga0495590_0000012 Ga0495590_0000012_166024_166959 303
673 3300046501 Ga0495607_0000447 Ga0495607_0000447_12703_13638 303
674 3300046507 Ga0495606_0000814 Ga0495606_0000814_14593_15528 303
675 3300046558 Ga0495633_0028627 Ga0495633_0028627_1322_2263 303
676 3300046616 Ga0495668_0000712 Ga0495668_0000712_36944_37885 303
677 3300046616 Ga0495668_0006539 Ga0495668_0006539_1410_2345 303
678 3300047445 Ga0495677_0128884 Ga0495677_0128884_11_946 303
679 3300048918 Ga0496115_0023301 Ga0496115_0023301_2539_3486 303
680 3300049162 Ga0501307_003330 Ga0501307_003330_390_1325 303
681 3300049459 Ga0495678_002896 Ga0495678_002896_930_1865 303
682 3300002738 JGI25154J39366_1001206 JGI25154J39366_10012066 304
683 3300003771 Ga0055526_1000007 Ga0055526_1000007222 304
684 3300009036 Ga0105244_10001568 Ga0105244_100015687 304
685 3300025233 Ga0209437_101483 Ga0209437_1014836 304
686 3300025246 Ga0209646_1000042 Ga0209646_1000042276 304
687 3300025295 Ga0209564_1000010 Ga0209564_1000010453 304
688 3300025728 Ga0207655_1002256 Ga0207655_10022569 304
689 3300037471 Ga0395905_0000955 Ga0395905_0000955_12612_13541 304
690 3300037471 Ga0395905_0041777 Ga0395905_0041777_1570_2499 304
691 3300038443 Ga0395901_0314493 Ga0395901_0314493_209_1138 304
692 3300046452 Ga0495617_008224 Ga0495617_008224_1217_2152 304
693 3300046452 Ga0495617_015288 Ga0495617_015288_1559_2488 304
694 3300046457 Ga0495590_0011927 Ga0495590_0011927_1246_2181 304
695 3300046460 Ga0495638_0009661 Ga0495638_0009661_1402_2337 304
696 3300046474 Ga0495605_0005369 Ga0495605_0005369_1522_2457 304
697 3300046491 Ga0495584_0000570 Ga0495584_0000570_9058_9993 304
698 3300046491 Ga0495584_0022479 Ga0495584_0022479_199_1134 304
699 3300046491 Ga0495584_0022925 Ga0495584_0022925_1238_2173 304
700 3300046492 Ga0495585_0013680 Ga0495585_0013680_1790_2725 304
701 3300046492 Ga0495585_0071327 Ga0495585_0071327_515_1450 304
702 3300046501 Ga0495607_0015793 Ga0495607_0015793_3147_4082 304
703 3300046501 Ga0495607_0050499 Ga0495607_0050499_867_1802 304
704 3300046501 Ga0495607_0068780 Ga0495607_0068780_886_1815 304
705 3300046506 Ga0495583_0000316 Ga0495583_0000316_31127_32062 304
706 3300046507 Ga0495606_0000830 Ga0495606_0000830_40035_40982 304
707 3300046513 Ga0495616_0001323 Ga0495616_0001323_8779_9708 304
708 3300046513 Ga0495616_0023004 Ga0495616_0023004_930_1865 304
709 3300046523 Ga0495644_0000379 Ga0495644_0000379_5250_6185 304
710 3300046523 Ga0495644_0002875 Ga0495644_0002875_3688_4623 304
711 3300046524 Ga0495648_0000207 Ga0495648_0000207_2459_3394 304
712 3300046538 Ga0495609_0000421 Ga0495609_0000421_3270_4205 304
713 3300046538 Ga0495609_0016190 Ga0495609_0016190_899_1834 304
714 3300046558 Ga0495633_0002917 Ga0495633_0002917_2594_3529 304
715 3300046558 Ga0495633_0003169 Ga0495633_0003169_1418_2353 304
716 3300046615 Ga0495656_0003025 Ga0495656_0003025_1165_2100 304
717 3300046615 Ga0495656_0045968 Ga0495656_0045968_181_1116 304
718 3300046648 Ga0495611_0005095 Ga0495611_0005095_1520_2455 304
719 3300046648 Ga0495611_0010718 Ga0495611_0010718_2313_3248 304
720 3300046648 Ga0495611_0021800 Ga0495611_0021800_1381_2310 304
721 3300046660 Ga0495625_0024019 Ga0495625_0024019_1960_2895 304
722 3300046664 Ga0495659_0009976 Ga0495659_0009976_1268_2203 304
723 3300046665 Ga0495661_0018067 Ga0495661_0018067_783_1712 304
724 3300046665 Ga0495661_0113437 Ga0495661_0113437_100_1035 304
725 3300046691 Ga0495670_0003637 Ga0495670_0003637_5378_6313 304
726 3300046692 Ga0495671_0022530 Ga0495671_0022530_1301_2236 304
727 3300046692 Ga0495671_0056155 Ga0495671_0056155_153_1082 304
728 3300046694 Ga0495649_0017973 Ga0495649_0017973_1458_2390 304
729 3300046810 Ga0495660_0180040 Ga0495660_0180040_35_970 304
730 3300047318 Ga0495636_0001424 Ga0495636_0001424_4956_5891 304
731 3300047320 Ga0495672_0005477 Ga0495672_0005477_144_1079 304
732 3300047320 Ga0495672_0023423 Ga0495672_0023423_893_1828 304
733 3300047323 Ga0495683_0011411 Ga0495683_0011411_2765_3700 304
734 3300047443 Ga0495687_000213 Ga0495687_000213_21604_22539 304
735 3300047445 Ga0495677_0007617 Ga0495677_0007617_2069_3004 304
736 3300047445 Ga0495677_0094802 Ga0495677_0094802_16_951 304
737 3300047447 Ga0495685_000263 Ga0495685_000263_2539_3474 304
738 3300047469 Ga0495673_0007222 Ga0495673_0007222_1168_2103 304
739 3300047469 Ga0495673_0067398 Ga0495673_0067398_435_1370 304
740 3300049459 Ga0495678_000782 Ga0495678_000782_2598_3533 304
741 3300049460 Ga0495682_0001032 Ga0495682_0001032_1515_2450 304
742 3300049460 Ga0495682_0005703 Ga0495682_0005703_553_1488 304
743 3300049571 Ga0501034_0284748 Ga0501034_0284748_493_1422 304
744 iso_pu_bacteria 2904424332 2904428247 304
745 iso_pu_bacteria 2919476304 2919476530 304
746 3300015261 Ga0182006_1000023 Ga0182006_1000023183 305
747 3300015265 Ga0182005_1000006 Ga0182005_1000006141 305
748 3300025925 Ga0207650_10214918 Ga0207650_102149181 305
749 3300027111 Ga0209281_1004072 Ga0209281_10040723 305
750 3300030744 Ga0316181_1174308 Ga0316181_11743082 305
751 3300031548 Ga0307408_100002837 Ga0307408_10000283712 305
752 3300038443 Ga0395901_0010151 Ga0395901_0010151_1658_2587 305
753 3300038443 Ga0395901_0159990 Ga0395901_0159990_536_1471 305
754 3300046507 Ga0495606_0061775 Ga0495606_0061775_1298_2248 305
755 3300046512 Ga0495610_0005660 Ga0495610_0005660_2088_3038 305
756 3300046539 Ga0495621_0000839 Ga0495621_0000839_5015_5950 305
757 3300046558 Ga0495633_0033608 Ga0495633_0033608_612_1580 305
758 3300046660 Ga0495625_0014160 Ga0495625_0014160_237_1220 305
759 3300048903 Ga0496100_0034984 Ga0496100_0034984_1031_1966 305
760 3300048904 Ga0496101_0249842 Ga0496101_0249842_358_1293 305
761 3300048905 Ga0496102_0031176 Ga0496102_0031176_2432_3367 305
762 3300048911 Ga0496108_0070387 Ga0496108_0070387_358_1293 305
763 3300048913 Ga0496110_0126770 Ga0496110_0126770_562_1497 305
764 3300048914 Ga0496111_0038096 Ga0496111_0038096_2151_3086 305
765 3300048917 Ga0496114_0144584 Ga0496114_0144584_526_1461 305
766 3300049679 Ga0501249_001082 Ga0501249_001082_3529_4521 305
767 3300049766 Ga0501269_000461 Ga0501269_000461_3203_4195 305
768 iso_pu_bacteria 2643221645 2644250649 305
769 iso_pu_bacteria 2643221664 2644358961 305
770 iso_pu_bacteria 2738541280 2738738592 305
771 iso_pu_bacteria 2738541297 2738826325 305
772 iso_pu_bacteria 2738541300 2738842599 305
773 iso_pu_bacteria 2738541357 2739150122 305
774 iso_pu_bacteria 2738543003 2739192041 305
775 iso_pu_bacteria 2738543018 2739273346 305
776 iso_pu_bacteria 2738543026 2739318518 305
777 iso_pu_bacteria 2738543029 2739336759 305
778 iso_pu_bacteria 2738543030 2739342390 305
779 iso_pu_bacteria 2821131069 2821134866 305
780 iso_pu_bacteria 2842711865 2842715716 305
781 iso_pu_bacteria 2857553236 2857558440 305
782 iso_pu_bacteria 2857558681 2857558880 305
783 3300025250 Ga0209026_1006544 Ga0209026_10065443 306
784 3300031711 Ga0265314_10016398 Ga0265314_100163984 306
785 3300046463 Ga0495653_0000082 Ga0495653_0000082_78040_78978 306
786 3300046471 Ga0495650_0000226 Ga0495650_0000226_112840_113799 306
787 3300046507 Ga0495606_0000066 Ga0495606_0000066_122976_123935 306
788 3300046507 Ga0495606_0000101 Ga0495606_0000101_59313_60245 306
789 3300046507 Ga0495606_0000161 Ga0495606_0000161_78370_79308 306
790 3300046528 Ga0495642_0032189 Ga0495642_0032189_1114_2073 306
791 3300046616 Ga0495668_0000066 Ga0495668_0000066_102875_103819 306
792 3300047472 Ga0495686_0002226 Ga0495686_0002226_3505_4449 306
793 3300049459 Ga0495678_025648 Ga0495678_025648_1045_1989 306
794 3300003763 Ga0055529_1000015 Ga0055529_1000015187 307
795 3300021361 Ga0213872_10000157 Ga0213872_1000015737 307
796 3300021361 Ga0213872_10016017 Ga0213872_100160173 307
797 3300021361 Ga0213872_10027347 Ga0213872_100273472 307
798 3300031548 Ga0307408_100000144 Ga0307408_10000014472 307
799 3300039447 Ga0436361_0006435 Ga0436361_0006435_38_1009 307
800 3300039447 Ga0436361_0428998 Ga0436361_0428998_38_1009 307
801 3300039447 Ga0436361_0998063 Ga0436361_0998063_4991_5962 307
802 3300039447 Ga0436361_1217285 Ga0436361_1217285_237_1205 307
803 3300025233 Ga0209437_109253 Ga0209437_1092532 308
804 3300025272 Ga0209455_1000031 Ga0209455_1000031188 308
805 3300046474 Ga0495605_0000018 Ga0495605_0000018_198286_199242 308
806 3300046512 Ga0495610_0005574 Ga0495610_0005574_6239_7213 308
807 3300047470 Ga0495681_0011676 Ga0495681_0011676_2832_3794 308
808 3300047470 Ga0495681_0060524 Ga0495681_0060524_651_1625 308
809 3300048906 Ga0496103_0006209 Ga0496103_0006209_1672_2634 308
810 3300048927 Ga0496124_0157902 Ga0496124_0157902_172_1134 308
811 3300050489 nmdc:mga03683_37356_c1 nmdc:mga03683_37356_c1_151_1125 308
812 3300053118 Ga0500594_0036941 Ga0500594_0036941_204_1187 308
813 3300053125 Ga0500618_000088 Ga0500618_000088_54100_55083 308
814 iso_pu_bacteria 2548876994 2550692772 308
815 iso_pu_bacteria 2818991445 2819593680 308
816 iso_pu_bacteria 2884811622 2884815856 308
817 iso_pu_bacteria 2884836552 2884837881 308
818 iso_pu_bacteria 2884852848 2884854173 308
819 iso_pu_bacteria 2896154374 2896154710 308
820 3300002774 JGI25150J39212_1002242 JGI25150J39212_10022426 309
821 3300003771 Ga0055526_1000054 Ga0055526_100005465 309
822 3300009036 Ga0105244_10030858 Ga0105244_100308582 309
823 3300025245 Ga0207425_1001550 Ga0207425_10015508 309
824 3300025294 Ga0209025_1004319 Ga0209025_10043194 309
825 3300025295 Ga0209564_1000042 Ga0209564_100004260 309
826 3300025297 Ga0209758_1000379 Ga0209758_100037959 309
827 3300025728 Ga0207655_1002948 Ga0207655_100294812 309
828 3300046452 Ga0495617_000809 Ga0495617_000809_13014_13964 309
829 3300046453 Ga0495627_000004 Ga0495627_000004_280966_281940 309
830 3300046460 Ga0495638_0011357 Ga0495638_0011357_4357_5304 309
831 3300046460 Ga0495638_0082126 Ga0495638_0082126_473_1420 309
832 3300046471 Ga0495650_0000437 Ga0495650_0000437_39270_40211 309
833 3300046471 Ga0495650_0000462 Ga0495650_0000462_13693_14661 309
834 3300046471 Ga0495650_0001511 Ga0495650_0001511_17979_18935 309
835 3300046471 Ga0495650_0052773 Ga0495650_0052773_87_1055 309
836 3300046492 Ga0495585_0009264 Ga0495585_0009264_1334_2302 309
837 3300046507 Ga0495606_0000409 Ga0495606_0000409_1388_2338 309
838 3300046507 Ga0495606_0025163 Ga0495606_0025163_2212_3180 309
839 3300046512 Ga0495610_0000014 Ga0495610_0000014_69376_70329 309
840 3300046512 Ga0495610_0009501 Ga0495610_0009501_958_1908 309
841 3300046512 Ga0495610_0012253 Ga0495610_0012253_3756_4697 309
842 3300046520 Ga0495637_0001526 Ga0495637_0001526_11454_12404 309
843 3300046522 Ga0495643_0000234 Ga0495643_0000234_62124_63065 309
844 3300046523 Ga0495644_0009357 Ga0495644_0009357_1951_2925 309
845 3300046524 Ga0495648_0005556 Ga0495648_0005556_7131_8099 309
846 3300046524 Ga0495648_0007648 Ga0495648_0007648_1264_2232 309
847 3300046524 Ga0495648_0015834 Ga0495648_0015834_68_1027 309
848 3300046524 Ga0495648_0037659 Ga0495648_0037659_1302_2243 309
849 3300046528 Ga0495642_0070602 Ga0495642_0070602_436_1407 309
850 3300046529 Ga0495652_0046650 Ga0495652_0046650_1152_2135 309
851 3300046530 Ga0495654_0000014 Ga0495654_0000014_18067_19044 309
852 3300046530 Ga0495654_0021587 Ga0495654_0021587_482_1450 309
853 3300046530 Ga0495654_0027638 Ga0495654_0027638_1039_2007 309
854 3300046538 Ga0495609_0000377 Ga0495609_0000377_14903_15877 309
855 3300046542 Ga0495597_0000378 Ga0495597_0000378_36263_37213 309
856 3300046558 Ga0495633_0000297 Ga0495633_0000297_33641_34615 309
857 3300046558 Ga0495633_0005227 Ga0495633_0005227_1217_2167 309
858 3300046616 Ga0495668_0000579 Ga0495668_0000579_1219_2187 309
859 3300046616 Ga0495668_0007925 Ga0495668_0007925_3656_4597 309
860 3300046660 Ga0495625_0000931 Ga0495625_0000931_25262_26209 309
861 3300046660 Ga0495625_0001069 Ga0495625_0001069_1204_2172 309
862 3300046660 Ga0495625_0007654 Ga0495625_0007654_7453_8403 309
863 3300046660 Ga0495625_0039018 Ga0495625_0039018_1837_2805 309
864 3300046660 Ga0495625_0146559 Ga0495625_0146559_465_1406 309
865 3300046664 Ga0495659_0000074 Ga0495659_0000074_7737_8705 309
866 3300046665 Ga0495661_0067259 Ga0495661_0067259_575_1543 309
867 3300046680 Ga0495646_0003302 Ga0495646_0003302_4538_5521 309
868 3300046692 Ga0495671_0000493 Ga0495671_0000493_1550_2518 309
869 3300046692 Ga0495671_0089866 Ga0495671_0089866_166_1134 309
870 3300046694 Ga0495649_0002914 Ga0495649_0002914_9366_10307 309
871 3300046694 Ga0495649_0033827 Ga0495649_0033827_1202_2161 309
872 3300046810 Ga0495660_0002961 Ga0495660_0002961_7548_8516 309
873 3300046810 Ga0495660_0007004 Ga0495660_0007004_2211_3185 309
874 3300046810 Ga0495660_0020217 Ga0495660_0020217_195_1169 309
875 3300047320 Ga0495672_0000026 Ga0495672_0000026_157313_158281 309
876 3300047320 Ga0495672_0000226 Ga0495672_0000226_24712_25653 309
877 3300047323 Ga0495683_0042743 Ga0495683_0042743_235_1203 309
878 3300047445 Ga0495677_0052114 Ga0495677_0052114_57_998 309
879 3300047446 Ga0495679_014141 Ga0495679_014141_1281_2249 309
880 3300047469 Ga0495673_0000009 Ga0495673_0000009_414226_415194 309
881 3300047469 Ga0495673_0000012 Ga0495673_0000012_294483_295439 309
882 3300048919 Ga0496116_0067960 Ga0496116_0067960_632_1606 309
883 3300048927 Ga0496124_0067409 Ga0496124_0067409_1986_2927 309
884 3300048927 Ga0496124_0210580 Ga0496124_0210580_282_1223 309
885 3300048928 Ga0496125_0000995 Ga0496125_0000995_40147_41091 309
886 3300048929 Ga0496126_0006238 Ga0496126_0006238_11843_12799 309
887 3300049459 Ga0495678_000012 Ga0495678_000012_289862_290836 309
888 3300049459 Ga0495678_000130 Ga0495678_000130_1526_2467 309
889 3300053145 Ga0500586_001756 Ga0500586_001756_463_1413 309
890 3300039447 Ga0436361_0835704 Ga0436361_0835704_105_1073 310
891 3300046538 Ga0495609_0025283 Ga0495609_0025283_520_1506 311
892 3300046810 Ga0495660_0000419 Ga0495660_0000419_2848_3834 311
893 3300002704 JGI25155J39150_1000045 JGI25155J39150_100004547 312
894 3300002704 JGI25155J39150_1000256 JGI25155J39150_10002568 312
895 3300002705 JGI25156J39149_1000054 JGI25156J39149_100005435 312
896 3300002705 JGI25156J39149_1002432 JGI25156J39149_10024322 312
897 3300002737 JGI25162J39368_1003970 JGI25162J39368_10039702 312
898 3300002738 JGI25154J39366_1000083 JGI25154J39366_100008335 312
899 3300002738 JGI25154J39366_1000474 JGI25154J39366_10004749 312
900 3300002741 JGI25157J39369_1000208 JGI25157J39369_100020820 312
901 3300003758 Ga0055532_1000099 Ga0055532_100009942 312
902 3300009093 Ga0105240_10038896 Ga0105240_100388968 312
903 3300014497 Ga0182008_10065918 Ga0182008_100659183 312
904 3300025206 Ga0209435_100034 Ga0209435_100034105 312
905 3300025206 Ga0209435_100074 Ga0209435_10007446 312
906 3300025229 Ga0209147_100004 Ga0209147_100004146 312
907 3300025233 Ga0209437_100072 Ga0209437_100072198 312
908 3300025242 Ga0209258_100417 Ga0209258_10041747 312
909 3300025246 Ga0209646_1000057 Ga0209646_1000057165 312
910 3300025246 Ga0209646_1000118 Ga0209646_1000118105 312
911 3300025250 Ga0209026_1000106 Ga0209026_1000106105 312
912 3300025250 Ga0209026_1002894 Ga0209026_10028942 312
913 3300025256 Ga0209759_1000112 Ga0209759_100011276 312
914 3300025256 Ga0209759_1000190 Ga0209759_100019036 312
915 3300025272 Ga0209455_1010197 Ga0209455_10101973 312
916 3300025913 Ga0207695_10019098 Ga0207695_100190988 312
917 3300048924 Ga0496121_0006051 Ga0496121_0006051_11744_12682 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14715

FixP_N

N-terminal domain of cytochrome oxidase-cbb3, FixP

50

97

0.96

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

139

215

0.89

PF00034

Cytochrom_C

Cytochrome c

141

219

0.8

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

221

302

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wq8-assembly1.cif.gz_A thiosulfate dehydrogenase (tsda) from allochromatium vinosum - tetrathionate soak 0.9075 138 166
2c8s-assembly1.cif.gz_A cytochrome cl from methylobacterium extorquens 0.8828 133 184
6onq-assembly1.cif.gz_A crystal structure of c-type cytochrome xoxg from methylobacterium extorquens am1 0.8135 137 303
2zoo-assembly1.cif.gz_A crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125 0.7935 137 193
3zbm-assembly1.cif.gz_A structure of m92a variant of three-domain heme-cu nitrite reductase from ralstonia pickettii 0.7919 141 192
ID Description Score Start End Superfamily
3mk7C02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9203 101 303 1.10.760.10
3mk7C02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.9054 101 303 1.10.760.10
3mk7M03 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8894 192 276 1.10.760.10
2c8sA00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8828 133 184 1.10.760.10
1yiqA02 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8357 133 167 1.10.760.10
ID Description Score Start End GO Terms
AF-C9YAH0-F1-model_v4 Cytochrome c domain-containing protein 0.9969 167 304 GO:0005506
GO:0009055
GO:0016491
GO:0020037
AF-A0A3C0YM75-F1-model_v4 Cytochrome-c oxidase, cbb3-type subunit III 0.9935 131 304 GO:0005506
GO:0009055
GO:0020037
AF-A0A2W5PT04-F1-model_v4 Cytochrome-c oxidase, cbb3-type subunit III 0.9898 152 308 GO:0005506
GO:0009055
GO:0020037
AF-A0A2P7P329-F1-model_v4 deleted 0.9822 206 304
AF-A0A0B8Q7J7-F1-model_v4 Cytochrome c oxidase subunit ccoP (EC 1.9.3.1) 0.9817 145 305 GO:0005506
GO:0009055
GO:0016491
GO:0020037

Feature Viewer

pLDDT pTM Quality
84.96 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map