F485602

General Info

Members Datasets Scaffolds Average Seq Length
915 720 411 240

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0084809|Ga0495631_0084809_273_1046
Length 257
Sequence MNRLALARELNGVAAMPGVETSVHGVAAACDPLGSLYLPDAGILVVSDLHLEKGAAFARRGMMLPPYDTLATLTVLSAVISRYNPKLVVSLGDNFHDRIGSAHLPETFRTLISDMARGREWIWINGNHDPDGTVNLPGSSVDEMCYGGLTFCHAPKSGLQTGEIAGHLHPSATVRRREKSVRRPCFATDGARMLMPAFGVMSGGLDLRHKAMKGLFDHASLIAHLLGRDRIYSVRFGNLASSRPPALKERRSDRPCD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
11 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
28 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
29 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
30 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
31 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
32 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
33 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
34 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
35 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
36 2516143018 Ensifer sp. BR816 Isolate Nodule
37 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
38 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
39 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
40 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
41 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
42 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
45 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
46 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
47 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
48 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
49 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
50 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
51 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
52 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
53 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
54 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
55 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
56 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
57 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
58 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
59 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
60 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
61 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
62 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
63 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
64 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
65 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
66 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
67 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
68 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
69 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
70 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
71 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
72 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
73 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
74 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
75 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
76 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
77 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
78 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
79 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
80 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
81 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
82 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
83 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
84 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
85 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
86 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
87 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
88 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
89 2643221557 Ensifer sp. Root558 Isolate Unclassified
90 2643221558 Rhizobium sp. Root149 Isolate Unclassified
91 2643221582 Rhizobium sp. Root651 Isolate Unclassified
92 2643221599 Rhizobium sp. Root708 Isolate Unclassified
93 2643221607 Rhizobium sp. Root73 Isolate Unclassified
94 2643221610 Ensifer sp. Root74 Isolate Unclassified
95 2643221618 Ensifer sp. Root231 Isolate Unclassified
96 2643221626 Ensifer sp. Root31 Isolate Unclassified
97 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
98 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
99 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
100 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
101 2643221655 Ensifer sp. Root1252 Isolate Unclassified
102 2643221659 Ensifer sp. Root127 Isolate Unclassified
103 2643221668 Ensifer sp. Root423 Isolate Unclassified
104 2643221675 Ensifer sp. Root1298 Isolate Unclassified
105 2643221680 Ensifer sp. Root1312 Isolate Unclassified
106 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
107 2643221688 Rhizobium sp. Root482 Isolate Unclassified
108 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
109 2643221698 Ensifer sp. Root142 Isolate Unclassified
110 2643221712 Ensifer sp. Root258 Isolate Unclassified
111 2643221718 Rhizobium sp. Root268 Isolate Unclassified
112 2643221723 Ensifer sp. Root278 Isolate Unclassified
113 2643221726 Ensifer sp. Root954 Isolate Unclassified
114 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
115 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
116 2718217882 Rhizobium sp. N741 Isolate Nodule
117 2718217927 Rhizobium sp. N324 Isolate Nodule
118 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
119 2718218009 Rhizobium sp. N561 Isolate Nodule
120 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
121 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
122 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
123 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
124 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
125 2718218363 Rhizobium sp. N113 Isolate Nodule
126 2718218365 Rhizobium sp. N731 Isolate Nodule
127 2718218366 Rhizobium sp. N621 Isolate Nodule
128 2718218423 Rhizobium sp. N941 Isolate Nodule
129 2721755514 Rhizobium sp. N6212 Isolate Nodule
130 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
131 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
132 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
133 2721755809 Rhizobium sp. N541 Isolate Nodule
134 2721755810 Rhizobium sp. N871 Isolate Nodule
135 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
136 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
137 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
138 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
139 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
140 2728369365 Rhizobium sp. N1341 Isolate Nodule
141 2728369397 Rhizobium sp. N1314 Isolate Nodule
142 2738541293 Rhizobium sp. GV031 Isolate Unclassified
143 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
144 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
145 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
146 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
147 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
148 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
149 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
150 2791355256 Rhizobium sp. M10 Isolate Nodule
151 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
152 2791355260 Rhizobium sp. L9 Isolate Nodule
153 2791355261 Rhizobium sp. J15 Isolate Nodule
154 2791355262 Rhizobium sp. M1 Isolate Nodule
155 2791355263 Rhizobium chutanense C5 Isolate Nodule
156 2791355264 Rhizobium sp. S9 Isolate Nodule
157 2791355265 Rhizobium sp. H4 Isolate Nodule
158 2791355266 Rhizobium sp. L43 Isolate Nodule
159 2791355267 Rhizobium sp. L18 Isolate Nodule
160 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
161 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
162 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
163 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
164 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
165 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
166 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
167 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
168 2802429633 Rhizobium anhuiense J3 Isolate Nodule
169 2802429634 Rhizobium anhuiense S10 Isolate Nodule
170 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
171 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
172 2802429637 Rhizobium anhuiense C15 Isolate Nodule
173 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
174 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
175 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
176 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
177 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
178 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
179 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
180 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
181 2838048938 Rhizobium pisi 27/80 Isolate Nodule
182 2838061910 Rhizobium phaseoli L15 Isolate Nodule
183 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
184 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
185 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
186 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
187 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
188 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
189 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
190 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
191 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
192 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
193 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
194 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
195 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
196 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
197 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
198 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
199 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
200 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
201 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
202 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
203 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
204 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
205 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
206 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
207 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
208 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
209 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
210 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
211 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
212 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
213 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
214 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
215 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
216 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
217 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
218 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
219 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
220 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
221 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
222 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
223 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
224 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
225 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
226 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
227 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
228 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
229 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
230 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
231 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
232 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
233 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
234 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
235 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
236 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
237 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
238 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
239 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
240 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
241 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
242 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
243 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
244 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
245 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
246 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
247 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
248 2844163670 Ensifer sp. 1H6 Isolate Unclassified
249 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
250 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
251 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
252 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
253 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
254 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
255 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
256 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
257 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
258 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
259 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
260 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
261 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
262 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
263 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
264 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
265 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
266 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
267 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
268 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
269 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
270 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
271 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
272 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
273 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
274 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
275 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
276 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
277 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
278 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
279 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
280 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
281 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
282 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
283 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
284 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
285 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
286 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
287 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
288 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
289 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
290 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
291 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
292 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
293 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
294 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
295 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
296 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
297 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
298 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
299 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
300 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
301 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
302 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
303 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
304 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
305 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
306 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
307 2933599457 Rhizobium phaseoli M3 Isolate Nodule
308 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
309 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
310 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
311 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
312 2936381700 Rhizobium chutanense C16 Isolate Unclassified
313 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
314 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
315 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
316 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
317 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
318 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
319 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
320 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
321 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
322 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
323 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
324 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
325 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
326 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
327 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
328 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
329 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
330 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
331 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
332 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
333 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
334 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
335 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
336 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
337 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
338 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
339 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
340 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
341 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
342 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
343 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
344 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
345 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
346 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
347 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
348 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
349 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
350 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
351 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
352 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
353 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
354 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
355 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
356 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
357 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
358 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
359 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
360 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
361 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
362 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
363 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
364 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
365 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
366 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
367 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
368 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
369 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
370 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
371 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
372 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
373 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
374 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
375 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
376 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
377 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
378 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
379 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
380 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
381 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
382 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
383 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
384 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
385 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
386 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
387 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
388 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
389 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
390 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
391 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
392 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
393 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
394 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
395 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
396 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
397 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
398 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
399 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
400 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
401 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
402 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
403 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
404 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
405 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
406 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
407 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
408 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
409 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
410 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
411 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
412 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
413 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
414 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
415 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
416 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
417 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
418 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
419 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
420 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
421 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
422 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
423 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
424 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
425 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
426 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
427 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
428 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
429 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
430 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
431 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
432 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
433 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
434 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
435 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
436 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
437 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
438 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
439 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
440 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
441 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
442 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
443 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
444 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
445 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
446 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
447 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
448 2996887358 Rhizobium sp. R711 Isolate Nodule
449 2996893221 Rhizobium sp. R635 Isolate Nodule
450 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
451 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
452 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
453 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
454 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
455 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
456 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
457 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
458 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
459 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
460 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
461 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
462 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
463 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
464 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
465 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
466 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
467 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
468 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
469 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
470 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
471 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
472 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
473 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
474 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
475 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
476 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
477 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
478 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
479 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
480 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
481 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
482 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
483 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
484 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
485 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
486 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
487 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
488 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
489 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
490 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
491 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
492 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
493 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
494 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
495 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
496 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
497 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
498 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
499 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
500 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
501 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
502 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
503 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
504 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
505 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
506 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
507 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
508 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
509 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
510 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
511 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
512 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
513 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
514 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
515 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
516 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
517 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
518 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
519 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
520 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
521 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
522 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
523 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
524 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
525 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
526 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
527 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
528 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
529 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
530 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
531 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
532 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
533 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
534 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
535 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
536 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
537 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
538 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
539 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
540 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
541 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
542 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
543 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
544 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
545 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
546 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
547 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
548 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
549 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
550 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
551 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
552 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
553 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
554 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
555 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
556 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
557 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
558 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
559 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
560 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
561 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
562 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
563 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
564 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
565 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
566 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
567 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
568 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
569 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
570 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
571 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
572 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
573 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
574 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
575 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
576 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
577 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
578 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
579 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
580 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
581 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
582 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
583 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
584 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
585 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
586 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
587 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
588 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
589 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
590 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
591 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
592 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
593 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
594 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
595 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
596 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
597 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
598 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
599 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
600 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
601 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
602 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
603 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
604 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
605 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
606 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
607 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
608 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
609 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
610 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
611 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
612 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
613 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
614 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
615 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
616 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
617 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
618 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
619 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
620 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
621 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
622 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
623 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
624 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
625 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
626 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
627 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
628 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
629 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
630 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
631 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
632 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
633 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
634 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
635 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
636 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
637 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
638 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
639 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
640 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
641 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
642 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
643 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
644 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
645 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
646 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
647 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
648 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
649 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
650 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
651 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
652 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
653 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
654 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
655 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
656 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
657 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
658 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
659 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
660 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
661 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
662 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
663 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
664 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
665 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
666 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
667 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
668 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
669 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
670 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
671 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
672 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
673 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
674 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
675 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
676 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
677 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
678 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
679 8005258706 Rhizobium sp. R693 Isolate Nodule
680 8005275841 Rhizobium sp. N4311 Isolate Nodule
681 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
682 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
683 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
684 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
685 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
686 8005321885 Rhizobium sp. R72 Isolate Nodule
687 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
688 8005382845 Rhizobium sp. R634 Isolate Nodule
689 8005395548 Rhizobium sp. R339 Isolate Nodule
690 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
691 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
692 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
693 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
694 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
695 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
696 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
697 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
698 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
699 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
700 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
701 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
702 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
703 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
704 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
705 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
706 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
707 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
708 8018176218 Rhizobium sp. N122 Isolate Nodule
709 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
710 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
711 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
712 8024501048 Rhizobium sp. H4 Isolate Nodule
713 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
714 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
715 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
716 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
717 8056382006 Rhizobium croatiense 13T Isolate Nodule
718 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
719 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
720 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 44.7
Metatranscriptomes 0.22
Isolates 55.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 16.94
Nodule 44.7
Rhizoplane 1.75
Rhizosphere 19.13
Stem 0
Stem Tuber 0
Unclassified 17.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000426 3300001979 Bacteria 18039
2 JGI25155J39150_1000013 3300002704 Bacteria 198215
3 JGI25156J39149_1000011 3300002705 Bacteria 198215
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1000698 3300002737 Bacteria 23303
6 JGI25154J39366_1000030 3300002738 Bacteria 191444
7 JGI25158J39367_1000090 3300002739 Bacteria 21062
8 JGI25157J39369_1000013 3300002741 Bacteria 198211
9 JGI25152J39213_1000246 3300002773 Bacteria 36282
10 JGI25152J39213_1000500 3300002773 Bacteria 22005
11 JGI25152J39213_1016171 3300002773 Bacteria 1448
12 JGI25152J39213_1016174 3300002773 Bacteria 1448
13 JGI25150J39212_1000118 3300002774 Bacteria 44311
14 JGI25150J39212_1004187 3300002774 Bacteria 3249
15 JGI25150J39212_1005928 3300002774 Bacteria 2568
16 JGI25159J45721_1000003 3300002987 Bacteria 274069
17 JGI25159J45721_1000942 3300002987 Bacteria 12699
18 JGI25151J46595_10000110 3300003187 Bacteria 111972
19 JGI25151J46595_10000681 3300003187 Bacteria 28706
20 JGI25151J46595_10003279 3300003187 Bacteria 8999
21 JGI25151J46595_10008982 3300003187 Bacteria 4765
22 JGI25165J46597_1000349 3300003214 Bacteria 52229
23 JGI25165J46597_1000355 3300003214 Bacteria 51475
24 JGI25153J46596_10000482 3300003215 Bacteria 25561
25 JGI25153J46596_10035651 3300003215 Bacteria 1608
26 JGI25153J46596_10040347 3300003215 Bacteria 1448
27 JGI25153J46596_10040373 3300003215 Bacteria 1448
28 JGI25153J46596_10047850 3300003215 Bacteria 1254
29 rootH1_10043182 3300003316 Bacteria 1402
30 rootL2_10235986 3300003322 Bacteria 1381
31 rootH1_10130347 3300003323 Bacteria 2250
32 JGI25160J50197_1000003 3300003354 Bacteria 482719
33 JGI25160J50197_1000041 3300003354 Bacteria 152843
34 JGI25160J50197_1000514 3300003354 Bacteria 22846
35 JGI25160J50197_1011969 3300003354 Bacteria 3041
36 JGI25161J50226_1000002 3300003374 Bacteria 420324
37 JGI25161J50226_1000184 3300003374 Bacteria 41591
38 JGI25161J50226_1000270 3300003374 Bacteria 30355
39 JGI25161J50226_1004678 3300003374 Bacteria 2814
40 Ga0006562J51391_1024010 3300003578 Bacteria 1107
41 Ga0055526_1000725 3300003771 Bacteria 24927
42 Ga0055526_1002842 3300003771 Bacteria 11434
43 Ga0055526_1004258 3300003771 Bacteria 8668
44 Ga0055526_1017123 3300003771 Bacteria 2791
45 Ga0055524_1002851 3300003775 Bacteria 8668
46 Ga0055524_1006954 3300003775 Bacteria 4865
47 Ga0055524_1015572 3300003775 Bacteria 2765
48 Ga0055524_1018417 3300003775 Bacteria 2426
49 Ga0055536_1019078 3300003781 Bacteria 2170
50 Ga0055528_1000095 3300003790 Bacteria 70572
51 Ga0055528_1000618 3300003790 Bacteria 26522
52 Ga0055528_1015870 3300003790 Bacteria 2694
53 Ga0055528_1021492 3300003790 Bacteria 2046
54 Ga0055528_1023363 3300003790 Bacteria 1889
55 Ga0055540_1000190 3300003792 Bacteria 59767
56 Ga0055540_1007520 3300003792 Bacteria 4091
57 Ga0055531_10005539 3300003794 Bacteria 7371
58 Ga0058692_1017409 3300003856 Bacteria 1578
59 Ga0055543_1000008 3300004625 Bacteria 202062
60 Ga0055543_1000059 3300004625 Bacteria 100942
61 Ga0055543_1000299 3300004625 Bacteria 35254
62 Ga0055543_1003650 3300004625 Bacteria 4438
63 Ga0065165_1000031 3300005262 Bacteria 216330
64 Ga0065165_1000084 3300005262 Bacteria 154822
65 Ga0065165_1012356 3300005262 Bacteria 3483
66 Ga0065165_1040779 3300005262 Bacteria 1381
67 Ga0070670_100000160 3300005331 Bacteria 61135
68 Ga0070671_100027922 3300005355 Bacteria 4646
69 Ga0070667_100181766 3300005367 Bacteria 1860
70 Ga0070665_100085654 3300005548 Bacteria 3157
71 Ga0070665_100136036 3300005548 Bacteria 2460
72 Ga0068855_100086831 3300005563 Bacteria 3617
73 Ga0068856_100094550 3300005614 Bacteria 2976
74 Ga0068851_10026861 3300005834 Bacteria 2832
75 Ga0068862_100147624 3300005844 Bacteria 2091
76 Ga0075365_10003496 3300006038 Bacteria 8115
77 Ga0075365_10007830 3300006038 Bacteria 6019
78 Ga0075368_10034448 3300006042 Bacteria 1973
79 Ga0075362_10007175 3300006177 Bacteria 4203
80 Ga0075367_10033635 3300006178 Bacteria 2956
81 Ga0075369_10008457 3300006186 Bacteria 3959
82 Ga0075366_10019959 3300006195 Bacteria 3884
83 Ga0075370_10148964 3300006353 Bacteria 1371
84 Ga0105251_10057758 3300009011 Bacteria 1833
85 Ga0105244_10157911 3300009036 Bacteria 1084
86 Ga0105240_10000460 3300009093 Bacteria 74956
87 Ga0105237_10001005 3300009545 Bacteria 37989
88 Ga0123341_1000067 3300009765 Bacteria 44232
89 Ga0123341_1068588 3300009765 Bacteria 1585
90 Ga0123342_1010893 3300009766 Bacteria 10210
91 Ga0105239_10002984 3300010375 Bacteria 21103
92 Ga0157370_10000879 3300013104 Bacteria 38163
93 Ga0171463_1001 3300013249 Bacteria 1406070
94 Ga0182008_10294383 3300014497 Bacteria 848
95 Ga0182007_10003141 3300015262 Bacteria 7939
96 Ga0182005_1001666 3300015265 Bacteria 8631
97 Ga0183363_1134 3300015690 Bacteria 18899
98 Ga0214542_1001074 3300021321 Bacteria 54628
99 Ga0214542_1025837 3300021321 Bacteria 2983
100 Ga0214543_1000027 3300021327 Bacteria 215065
101 Ga0214543_1000897 3300021327 Bacteria 54534
102 Ga0228711_1000041 3300022739 Bacteria 86591
103 Ga0228710_1000024 3300022740 Bacteria 106694
104 Ga0209435_100026 3300025206 Bacteria 198295
105 Ga0209436_100006 3300025208 Bacteria 150277
106 Ga0209436_100836 3300025208 Bacteria 12445
107 Ga0209437_100056 3300025233 Bacteria 363071
108 Ga0209437_100196 3300025233 Bacteria 121199
109 Ga0207425_1000012 3300025245 Bacteria 528324
110 Ga0207425_1002717 3300025245 Bacteria 6028
111 Ga0207425_1006821 3300025245 Bacteria 3085
112 Ga0209646_1000084 3300025246 Bacteria 198295
113 Ga0209026_1000080 3300025250 Bacteria 198295
114 Ga0209677_102042 3300025253 Bacteria 7993
115 Ga0209759_1000061 3300025256 Bacteria 198295
116 Ga0209129_1000105 3300025258 Bacteria 159104
117 Ga0209129_1000110 3300025258 Bacteria 150918
118 Ga0209129_1000429 3300025258 Bacteria 31758
119 Ga0209129_1001484 3300025258 Bacteria 13035
120 Ga0209129_1001523 3300025258 Bacteria 12805
121 Ga0209129_1001602 3300025258 Bacteria 12337
122 Ga0209129_1002388 3300025258 Bacteria 9244
123 Ga0209233_1000037 3300025261 Bacteria 554620
124 Ga0209233_1000071 3300025261 Bacteria 363290
125 Ga0209233_1000243 3300025261 Bacteria 90170
126 Ga0209455_1009107 3300025272 Bacteria 2635
127 Ga0209455_1036307 3300025272 Bacteria 785
128 Ga0209673_1000015 3300025273 Bacteria 530618
129 Ga0209673_1000063 3300025273 Bacteria 256709
130 Ga0209673_1001004 3300025273 Bacteria 34285
131 Ga0209673_1002293 3300025273 Bacteria 13648
132 Ga0209673_1003895 3300025273 Bacteria 8398
133 Ga0209673_1006202 3300025273 Bacteria 5837
134 Ga0209673_1012901 3300025273 Bacteria 3332
135 Ga0209673_1056919 3300025273 Bacteria 998
136 Ga0209130_1000002 3300025284 Bacteria 722648
137 Ga0209130_1000005 3300025284 Bacteria 599620
138 Ga0209130_1000382 3300025284 Bacteria 49448
139 Ga0209676_1033105 3300025292 Bacteria 1545
140 Ga0209025_1000024 3300025294 Bacteria 528324
141 Ga0209025_1000037 3300025294 Bacteria 383429
142 Ga0209025_1000295 3300025294 Bacteria 111489
143 Ga0209025_1000638 3300025294 Bacteria 61892
144 Ga0209025_1003060 3300025294 Bacteria 16457
145 Ga0209025_1012788 3300025294 Bacteria 5340
146 Ga0209025_1013101 3300025294 Bacteria 5241
147 Ga0209025_1042695 3300025294 Bacteria 1922
148 Ga0209564_1000093 3300025295 Bacteria 245793
149 Ga0209564_1000316 3300025295 Bacteria 94849
150 Ga0209564_1004460 3300025295 Bacteria 8554
151 Ga0209564_1008398 3300025295 Bacteria 5100
152 Ga0209564_1029360 3300025295 Bacteria 1733
153 Ga0209758_1000150 3300025297 Bacteria 163494
154 Ga0209758_1000361 3300025297 Bacteria 81006
155 Ga0209758_1000499 3300025297 Bacteria 63732
156 Ga0209758_1000876 3300025297 Bacteria 41358
157 Ga0209758_1001299 3300025297 Bacteria 30604
158 Ga0209758_1002582 3300025297 Bacteria 18177
159 Ga0209758_1007691 3300025297 Bacteria 7240
160 Ga0209758_1014373 3300025297 Bacteria 4216
161 Ga0209050_1011207 3300025298 Bacteria 4289
162 Ga0209050_1019868 3300025298 Bacteria 2530
163 Ga0209256_1000027 3300025299 Bacteria 423283
164 Ga0209256_1000880 3300025299 Bacteria 37115
165 Ga0209256_1001669 3300025299 Bacteria 21569
166 Ga0209256_1002179 3300025299 Bacteria 16813
167 Ga0209256_1005310 3300025299 Bacteria 7498
168 Ga0209256_1005901 3300025299 Bacteria 6775
169 Ga0209256_1006338 3300025299 Bacteria 6314
170 Ga0209256_1016791 3300025299 Bacteria 2471
171 Ga0209256_1044286 3300025299 Bacteria 1112
172 Ga0207426_1000012 3300025302 Bacteria 730942
173 Ga0207426_1000013 3300025302 Bacteria 721897
174 Ga0207426_1000015 3300025302 Bacteria 599316
175 Ga0207426_1000070 3300025302 Bacteria 331559
176 Ga0207426_1001614 3300025302 Bacteria 17860
177 Ga0209051_1000135 3300025303 Bacteria 138142
178 Ga0209051_1006292 3300025303 Bacteria 6727
179 Ga0209051_1055969 3300025303 Bacteria 1276
180 Ga0209051_1064569 3300025303 Bacteria 1134
181 Ga0209257_1005318 3300025304 Bacteria 9131
182 Ga0209257_1029056 3300025304 Bacteria 1807
183 Ga0207656_10027931 3300025321 Bacteria 2312
184 Ga0207647_10274920 3300025904 Bacteria 962
185 Ga0207695_10000036 3300025913 Bacteria 477897
186 Ga0207671_10000153 3300025914 Bacteria 107114
187 Ga0207650_10000776 3300025925 Bacteria 24570
188 Ga0207711_10167094 3300025941 Bacteria 1995
189 Ga0207658_10277195 3300025986 Bacteria 1436
190 Ga0207702_10119215 3300026078 Bacteria 2359
191 Ga0207698_10049414 3300026142 Bacteria 3201
192 Ga0209281_1000409 3300027111 Bacteria 65132
193 Ga0209281_1000520 3300027111 Bacteria 49942
194 Ga0209371_1000009 3300027312 Bacteria 963030
195 Ga0209371_1000424 3300027312 Bacteria 43444
196 Ga0209282_1000090 3300027666 Bacteria 65132
197 Ga0209813_10115148 3300027866 Bacteria 930
198 Ga0268266_10119922 3300028379 Bacteria 2340
199 Ga0268265_10853713 3300028380 Bacteria 891
200 Ga0307515_10000674 3300028794 Bacteria 78735
201 Ga0307515_10006511 3300028794 Bacteria 23364
202 Ga0307515_10012267 3300028794 Bacteria 16136
203 Ga0307515_10148902 3300028794 Bacteria 2460
204 Ga0268256_1000010 3300030500 Bacteria 963034
205 Ga0307513_10000180 3300031456 Bacteria 91340
206 Ga0307513_10236576 3300031456 Bacteria 1635
207 Ga0307405_10000250 3300031731 Bacteria 19640
208 Ga0307406_10002749 3300031901 Bacteria 9606
209 Ga0307412_10000491 3300031911 Bacteria 23628
210 Ga0307412_10527791 3300031911 Bacteria 987
211 Ga0315914_1000167 3300031967 Bacteria 65125
212 Ga0307416_100620524 3300032002 Bacteria 1163
213 Ga0307414_10727507 3300032004 Bacteria 900
214 Ga0315913_1000038 3300033430 Bacteria 64995
215 Ga0315915_1000019 3300033464 Bacteria 129295
216 Ga0439439_0027122 3300041406 Bacteria 1446
217 Ga0439447_022451 3300041407 Bacteria 1652
218 Ga0439465_0004487 3300041413 Bacteria 4513
219 Ga0439465_0019725 3300041413 Bacteria 2109
220 Ga0451787_252007 3300041441 Bacteria 2811
221 Ga0451791_0180341 3300041451 Bacteria 2156
222 Ga0451835_0388755 3300041492 Bacteria 1025
223 Ga0451837_0526223 3300041494 Bacteria 1068
224 Ga0451839_0199143 3300041496 Bacteria 3301
225 Ga0451841_1408368 3300041498 Bacteria 1065
226 Ga0451845_0150991 3300041501 Bacteria 1336
227 Ga0451847_0236407 3300041503 Bacteria 1377
228 Ga0451851_0308271 3300041507 Bacteria 1712
229 Ga0451843_1263341 3300041509 Bacteria 1403
230 Ga0451855_2061497 3300041511 Bacteria 1653
231 Ga0451853_3650313 3300041512 Bacteria 1721
232 Ga0439462_0011595 3300042015 Bacteria 2246
233 Ga0466966_0095761 3300044684 Bacteria 1839
234 Ga0466963_0003933 3300044694 Bacteria 8589
235 Ga0466964_0085405 3300044706 Bacteria 1363
236 Ga0466970_0002858 3300044765 Bacteria 8347
237 Ga0466957_0052900 3300044842 Bacteria 2474
238 Ga0466958_0253842 3300045836 Bacteria 1125
239 Ga0466967_0214337 3300045976 Bacteria 1827
240 Ga0495592_0186801 3300046454 Bacteria 1407
241 Ga0495590_0186407 3300046457 Bacteria 760
242 Ga0495629_0012377 3300046459 Bacteria 6178
243 Ga0495638_0020006 3300046460 Bacteria 4424
244 Ga0495605_0024123 3300046474 Bacteria 3187
245 Ga0495639_0125449 3300046475 Bacteria 1227
246 Ga0495662_0012312 3300046476 Bacteria 4175
247 Ga0495585_0009240 3300046492 Bacteria 5928
248 Ga0495607_0018739 3300046501 Bacteria 4403
249 Ga0495583_0003772 3300046506 Bacteria 11259
250 Ga0495606_0001337 3300046507 Bacteria 33546
251 Ga0495606_0164468 3300046507 Bacteria 1292
252 Ga0495606_0184566 3300046507 Bacteria 1200
253 Ga0495606_0399359 3300046507 Bacteria 716
254 Ga0495610_0000461 3300046512 Bacteria 42001
255 Ga0495610_0118502 3300046512 Bacteria 1163
256 Ga0495618_0250994 3300046514 Bacteria 1110
257 Ga0495620_0067648 3300046515 Bacteria 1469
258 Ga0495620_0115391 3300046515 Bacteria 1062
259 Ga0495620_0139721 3300046515 Bacteria 947
260 Ga0495631_0019196 3300046518 Bacteria 3208
261 Ga0495631_0084809 3300046518 Bacteria 1365
262 Ga0495632_0006289 3300046519 Bacteria 7672
263 Ga0495632_0070468 3300046519 Bacteria 1681
264 Ga0495643_0008921 3300046522 Bacteria 6302
265 Ga0495643_0050571 3300046522 Bacteria 2238
266 Ga0495648_0037751 3300046524 Bacteria 3100
267 Ga0495652_0196599 3300046529 Bacteria 1534
268 Ga0495587_0068202 3300046536 Bacteria 2072
269 Ga0495609_0047847 3300046538 Bacteria 1913
270 Ga0495633_0046861 3300046558 Bacteria 2044
271 Ga0495633_0073927 3300046558 Bacteria 1589
272 Ga0495656_0018785 3300046615 Bacteria 2661
273 Ga0495668_0097091 3300046616 Bacteria 1612
274 Ga0495668_0216647 3300046616 Bacteria 1048
275 Ga0495634_0128294 3300046642 Bacteria 1619
276 Ga0495625_0026846 3300046660 Bacteria 4343
277 Ga0495625_0250888 3300046660 Bacteria 1149
278 Ga0495635_0057071 3300046663 Bacteria 2687
279 Ga0495661_0100588 3300046665 Bacteria 1628
280 Ga0495661_0125309 3300046665 Bacteria 1414
281 Ga0495661_0201396 3300046665 Bacteria 1042
282 Ga0495661_0240021 3300046665 Bacteria 930
283 Ga0495588_0030848 3300046674 Bacteria 2696
284 Ga0495588_0031208 3300046674 Bacteria 2681
285 Ga0495623_0180036 3300046679 Bacteria 1229
286 Ga0495646_0160553 3300046680 Bacteria 1245
287 Ga0495613_0604123 3300046689 Bacteria 730
288 Ga0495624_0166998 3300046690 Bacteria 1343
289 Ga0495670_0182377 3300046691 Bacteria 1109
290 Ga0495670_0262256 3300046691 Bacteria 922
291 Ga0495649_0173544 3300046694 Bacteria 1127
292 Ga0495589_0189453 3300046794 Bacteria 974
293 Ga0495600_0016251 3300046809 Bacteria 4720
294 Ga0495660_0077835 3300046810 Bacteria 1744
295 Ga0495660_0156043 3300046810 Bacteria 1123
296 Ga0495672_0150290 3300047320 Bacteria 1208
297 Ga0495687_068328 3300047443 Bacteria 1435
298 Ga0495679_090652 3300047446 Bacteria 858
299 Ga0495681_0106643 3300047470 Bacteria 1218
300 Ga0495686_0014419 3300047472 Bacteria 5439
301 Ga0495686_0016096 3300047472 Bacteria 5083
302 Ga0495686_0040112 3300047472 Bacteria 2988
303 Ga0495686_0125744 3300047472 Bacteria 1524
304 Ga0495626_0123295 3300048091 Bacteria 1112
305 Ga0496100_0035945 3300048903 Bacteria 3120
306 Ga0496101_0576949 3300048904 Bacteria 889
307 Ga0496102_0006201 3300048905 Bacteria 10188
308 Ga0496102_0409297 3300048905 Bacteria 1274
309 Ga0496103_0015905 3300048906 Bacteria 4485
310 Ga0496104_0081774 3300048907 Bacteria 3080
311 Ga0496105_0179781 3300048908 Bacteria 1732
312 Ga0496106_0004867 3300048909 Bacteria 9942
313 Ga0496106_0409795 3300048909 Bacteria 1089
314 Ga0496111_0177519 3300048914 Bacteria 1583
315 Ga0496113_0253089 3300048916 Bacteria 1406
316 Ga0496116_0001406 3300048919 Bacteria 27038
317 Ga0496116_0002602 3300048919 Bacteria 18765
318 Ga0496116_0004126 3300048919 Bacteria 13997
319 Ga0496116_0058538 3300048919 Bacteria 2511
320 Ga0496116_0103637 3300048919 Bacteria 1692
321 Ga0496116_0194716 3300048919 Bacteria 1068
322 Ga0496116_0206798 3300048919 Bacteria 1021
323 Ga0496117_0001819 3300048920 Bacteria 28947
324 Ga0496117_0014921 3300048920 Bacteria 6660
325 Ga0496117_0018471 3300048920 Bacteria 5770
326 Ga0496117_0023539 3300048920 Bacteria 4902
327 Ga0496117_0128717 3300048920 Bacteria 1539
328 Ga0496118_0001431 3300048921 Bacteria 35926
329 Ga0496118_0008398 3300048921 Bacteria 10682
330 Ga0496118_0016889 3300048921 Bacteria 6668
331 Ga0496118_0172845 3300048921 Bacteria 1317
332 Ga0496119_0054477 3300048922 Bacteria 2434
333 Ga0496119_0130450 3300048922 Bacteria 1370
334 Ga0496120_0010487 3300048923 Bacteria 6460
335 Ga0496120_0075515 3300048923 Bacteria 1839
336 Ga0496120_0130402 3300048923 Bacteria 1288
337 Ga0496121_0002730 3300048924 Bacteria 26286
338 Ga0496121_0013386 3300048924 Bacteria 8822
339 Ga0496121_0020076 3300048924 Bacteria 6638
340 Ga0496121_0022942 3300048924 Bacteria 6030
341 Ga0496121_0082337 3300048924 Bacteria 2544
342 Ga0496121_0158392 3300048924 Bacteria 1658
343 Ga0496121_0215321 3300048924 Bacteria 1357
344 Ga0496121_0251863 3300048924 Bacteria 1224
345 Ga0496121_0252702 3300048924 Bacteria 1221
346 Ga0496121_0368336 3300048924 Bacteria 951
347 Ga0496122_0000147 3300048925 Bacteria 165589
348 Ga0496122_0008977 3300048925 Bacteria 10628
349 Ga0496122_0011942 3300048925 Bacteria 8717
350 Ga0496122_0094906 3300048925 Bacteria 2017
351 Ga0496122_0113149 3300048925 Bacteria 1774
352 Ga0496122_0113242 3300048925 Bacteria 1773
353 Ga0496122_0126887 3300048925 Bacteria 1631
354 Ga0496122_0164022 3300048925 Bacteria 1350
355 Ga0496122_0238193 3300048925 Bacteria 1028
356 Ga0496123_0000339 3300048926 Bacteria 88118
357 Ga0496123_0009204 3300048926 Bacteria 8926
358 Ga0496123_0081375 3300048926 Bacteria 1968
359 Ga0496123_0122457 3300048926 Bacteria 1459
360 Ga0496123_0265895 3300048926 Bacteria 837
361 Ga0496124_0000513 3300048927 Bacteria 66793
362 Ga0496124_0002549 3300048927 Bacteria 23643
363 Ga0496124_0025777 3300048927 Bacteria 5316
364 Ga0496124_0053734 3300048927 Bacteria 3412
365 Ga0496124_0307216 3300048927 Bacteria 1142
366 Ga0496125_0000299 3300048928 Bacteria 97532
367 Ga0496125_0001813 3300048928 Bacteria 29493
368 Ga0496125_0009396 3300048928 Bacteria 10057
369 Ga0496125_0020123 3300048928 Bacteria 6274
370 Ga0496125_0130962 3300048928 Bacteria 1766
371 Ga0496125_0239752 3300048928 Bacteria 1152
372 Ga0496125_0442100 3300048928 Bacteria 747
373 Ga0496126_0000380 3300048929 Bacteria 92061
374 Ga0496126_0018987 3300048929 Bacteria 6789
375 Ga0496126_0048725 3300048929 Bacteria 3870
376 Ga0496126_0093859 3300048929 Bacteria 2634
377 Ga0496126_0397111 3300048929 Bacteria 1119
378 Ga0496126_0434326 3300048929 Bacteria 1059
379 Ga0496126_0552677 3300048929 Bacteria 913
380 Ga0495678_048231 3300049459 Bacteria 1662
381 Ga0501032_0076997 3300049569 Bacteria 2220
382 Ga0501034_0393480 3300049571 Bacteria 1309
383 Ga0501036_0479877 3300049572 Bacteria 1035
384 Ga0501037_0017214 3300049573 Bacteria 5321
385 Ga0501037_0101909 3300049573 Bacteria 2071
386 Ga0501038_0021186 3300049574 Bacteria 5839
387 Ga0501038_0098497 3300049574 Bacteria 2438
388 Ga0501043_0025894 3300049579 Bacteria 4602
389 Ga0501047_0291556 3300049581 Bacteria 1475
390 Ga0501047_0474043 3300049581 Bacteria 1080
391 Ga0501048_0426182 3300049582 Bacteria 949
392 Ga0501083_0197816 3300049744 Bacteria 1311
393 Ga0501083_0273715 3300049744 Bacteria 1098
394 Ga0501044_0061070 3300049823 Bacteria 3857
395 nmdc:mga03683_14045_c1 3300050489 Bacteria 2957
396 nmdc:mga0sz30_153158_c1 3300050516 Bacteria 1020
397 Ga0500578_0280382 3300053086 Bacteria 994
398 Ga0500658_0001142 3300053134 Bacteria 10833
399 Ga0500568_0004265 3300053139 Bacteria 7683
400 Ga0500568_0011577 3300053139 Bacteria 4084
401 Ga0500573_0001761 3300053140 Bacteria 10530
402 Ga0500573_0028647 3300053140 Bacteria 3208
403 Ga0500590_005274 3300053148 Bacteria 6206
404 Ga0500604_0039960 3300053151 Bacteria 1412
405 Ga0500616_0014549 3300053153 Bacteria 4519
406 Ga0500616_0127806 3300053153 Bacteria 1204
407 Ga0500622_0002165 3300053156 Bacteria 14555
408 Ga0500622_0033119 3300053156 Bacteria 2709
409 Ga0500633_0030243 3300053160 Bacteria 1739
410 Ga0587068_011792 3300059641 Bacteria 1325
411 Ga0466962_0033587 3300061719 Bacteria 2455

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046507 Ga0495606_0399359 Ga0495606_0399359_63_704 213
2 3300047446 Ga0495679_090652 Ga0495679_090652_207_848 213
3 3300049569 Ga0501032_0076997 Ga0501032_0076997_492_1217 218
4 3300049573 Ga0501037_0101909 Ga0501037_0101909_451_1176 218
5 3300049574 Ga0501038_0021186 Ga0501038_0021186_4446_5171 218
6 3300049579 Ga0501043_0025894 Ga0501043_0025894_3243_3968 218
7 3300049581 Ga0501047_0474043 Ga0501047_0474043_46_771 218
8 3300048929 Ga0496126_0018987 Ga0496126_0018987_3130_3855 221
9 iso_pu_bacteria 2643221634 2644190406 222
10 iso_pu_bacteria 2718217997 2719663735 222
11 iso_pu_bacteria 2718218199 2720490154 222
12 iso_pu_bacteria 2718218232 2720611535 222
13 iso_pu_bacteria 2718218235 2720629791 222
14 iso_pu_bacteria 2718218269 2720773486 222
15 iso_pu_bacteria 2721755556 2723025159 222
16 iso_pu_bacteria 2721755684 2723558744 222
17 iso_pu_bacteria 2721755685 2723565312 222
18 iso_pu_bacteria 2721755819 2724088093 222
19 iso_pu_bacteria 2721755822 2724102577 222
20 iso_pu_bacteria 2728369352 2730106095 222
21 3300048929 Ga0496126_0000380 Ga0496126_0000380_58350_59075 225
22 3300046457 Ga0495590_0186407 Ga0495590_0186407_56_736 226
23 3300048924 Ga0496121_0252702 Ga0496121_0252702_506_1186 226
24 3300048926 Ga0496123_0265895 Ga0496123_0265895_17_697 226
25 3300013249 Ga0171463_1001 Ga0171463_1001915 230
26 3300047472 Ga0495686_0014419 Ga0495686_0014419_86_778 230
27 3300005331 Ga0070670_100000160 Ga0070670_10000016055 232
28 3300046689 Ga0495613_0604123 Ga0495613_0604123_22_720 232
29 iso_pu_bacteria 2818991448 2819608524 232
30 iso_pu_bacteria 2838029111 2838029407 232
31 iso_pu_bacteria 2842475841 2842476163 232
32 iso_pu_bacteria 2842502639 2842502935 232
33 iso_pu_bacteria 8005645114 8005649525 232
34 3300003187 JGI25151J46595_10008982 JGI25151J46595_100089823 233
35 3300025294 Ga0209025_1000037 Ga0209025_1000037241 233
36 3300048920 Ga0496117_0023539 Ga0496117_0023539_2953_3678 233
37 3300048925 Ga0496122_0000147 Ga0496122_0000147_7222_7947 233
38 3300048926 Ga0496123_0000339 Ga0496123_0000339_17494_18219 233
39 iso_pu_bacteria 2643221558 2643812771 233
40 3300003316 rootH1_10043182 rootH1_100431822 236
41 3300014497 Ga0182008_10294383 Ga0182008_102943831 236
42 3300044684 Ga0466966_0095761 Ga0466966_0095761_679_1389 236
43 3300044694 Ga0466963_0003933 Ga0466963_0003933_7606_8316 236
44 3300044706 Ga0466964_0085405 Ga0466964_0085405_415_1125 236
45 3300044765 Ga0466970_0002858 Ga0466970_0002858_7427_8137 236
46 3300044842 Ga0466957_0052900 Ga0466957_0052900_1503_2213 236
47 3300045836 Ga0466958_0253842 Ga0466958_0253842_26_736 236
48 3300045976 Ga0466967_0214337 Ga0466967_0214337_1007_1717 236
49 3300048923 Ga0496120_0075515 Ga0496120_0075515_938_1648 236
50 3300048925 Ga0496122_0094906 Ga0496122_0094906_1122_1832 236
51 3300048926 Ga0496123_0081375 Ga0496123_0081375_925_1635 236
52 3300048928 Ga0496125_0442100 Ga0496125_0442100_10_720 236
53 3300061719 Ga0466962_0033587 Ga0466962_0033587_1317_2027 236
54 iso_pu_bacteria 2511231052 2511500289 236
55 iso_pu_bacteria 2513237086 2513582299 236
56 iso_pu_bacteria 2513237091 2513616586 236
57 iso_pu_bacteria 2513237143 2513903924 236
58 iso_pu_bacteria 2516653046 2516891690 236
59 iso_pu_bacteria 2551306084 2551674468 236
60 iso_pu_bacteria 2551306086 2551693493 236
61 iso_pu_bacteria 2551306087 2551700474 236
62 iso_pu_bacteria 2551306089 2551709027 236
63 iso_pu_bacteria 2551306089 2551712769 236
64 iso_pu_bacteria 2551306090 2551716523 236
65 iso_pu_bacteria 2551306090 2551720285 236
66 iso_pu_bacteria 2551306091 2551730753 236
67 iso_pu_bacteria 2551306092 2551736162 236
68 iso_pu_bacteria 2551306093 2551746332 236
69 iso_pu_bacteria 648276728 648738454 236
70 iso_pu_bacteria 8055431914 8055433554 236
71 iso_pu_bacteria 2508501122 2509111708 237
72 iso_pu_bacteria 2509276019 2509375158 237
73 iso_pu_bacteria 2509276021 2509388620 237
74 iso_pu_bacteria 2509276033 2509444171 237
75 iso_pu_bacteria 2510065019 2510131237 237
76 iso_pu_bacteria 2510917022 2511134756 237
77 iso_pu_bacteria 2510917028 2511184630 237
78 iso_pu_bacteria 2510917030 2511197712 237
79 iso_pu_bacteria 2512875026 2512972918 237
80 iso_pu_bacteria 2513237085 2513574555 237
81 iso_pu_bacteria 2513237088 2513597261 237
82 iso_pu_bacteria 2513237089 2513602746 237
83 iso_pu_bacteria 2513237103 2513707155 237
84 iso_pu_bacteria 2513237138 2513865017 237
85 iso_pu_bacteria 2513237146 2513929370 237
86 iso_pu_bacteria 2513237156 2513985762 237
87 iso_pu_bacteria 2513237159 2513996582 237
88 iso_pu_bacteria 2513237160 2514005010 237
89 iso_pu_bacteria 2513237162 2514020436 237
90 iso_pu_bacteria 2515075009 2515110169 237
91 iso_pu_bacteria 2515154113 2515637476 237
92 iso_pu_bacteria 2515154114 2515643612 237
93 iso_pu_bacteria 2515154134 2515740754 237
94 iso_pu_bacteria 2516143018 2516204492 237
95 iso_pu_bacteria 2516653077 2517038863 237
96 iso_pu_bacteria 2516653085 2517079110 237
97 iso_pu_bacteria 2517093000 2517093050 237
98 iso_pu_bacteria 2517287029 2517409327 237
99 iso_pu_bacteria 2517487022 2517568466 237
100 iso_pu_bacteria 2558860100 2558866260 237
101 iso_pu_bacteria 2582581283 2585164746 237
102 iso_pu_bacteria 2582581294 2585205658 237
103 iso_pu_bacteria 2582581298 2585223611 237
104 iso_pu_bacteria 2582581299 2585229668 237
105 iso_pu_bacteria 2582581304 2585256056 237
106 iso_pu_bacteria 2582581306 2585265123 237
107 iso_pu_bacteria 2582581307 2585273823 237
108 iso_pu_bacteria 2582581865 2585385746 237
109 iso_pu_bacteria 2582581866 2585392087 237
110 iso_pu_bacteria 2582581867 2585398737 237
111 iso_pu_bacteria 2585427526 2585523555 237
112 iso_pu_bacteria 2585427528 2585542030 237
113 iso_pu_bacteria 2585427529 2585545793 237
114 iso_pu_bacteria 2585427531 2585559999 237
115 iso_pu_bacteria 2585427590 2585819141 237
116 iso_pu_bacteria 2585427593 2585840322 237
117 iso_pu_bacteria 2585427594 2585844050 237
118 iso_pu_bacteria 2585427609 2585905821 237
119 iso_pu_bacteria 2585428125 2587979063 237
120 iso_pu_bacteria 2599185170 2599419363 237
121 iso_pu_bacteria 2599185352 2600191237 237
122 iso_pu_bacteria 2643221557 2643806125 237
123 iso_pu_bacteria 2643221599 2644004743 237
124 iso_pu_bacteria 2643221607 2644047384 237
125 iso_pu_bacteria 2643221610 2644070321 237
126 iso_pu_bacteria 2643221618 2644103456 237
127 iso_pu_bacteria 2643221626 2644144335 237
128 iso_pu_bacteria 2643221636 2644199802 237
129 iso_pu_bacteria 2643221655 2644306386 237
130 iso_pu_bacteria 2643221659 2644330576 237
131 iso_pu_bacteria 2643221668 2644377387 237
132 iso_pu_bacteria 2643221675 2644421083 237
133 iso_pu_bacteria 2643221680 2644454606 237
134 iso_pu_bacteria 2643221686 2644480173 237
135 iso_pu_bacteria 2643221688 2644492695 237
136 iso_pu_bacteria 2643221689 2644496972 237
137 iso_pu_bacteria 2643221698 2644542620 237
138 iso_pu_bacteria 2643221712 2644611997 237
139 iso_pu_bacteria 2643221723 2644671812 237
140 iso_pu_bacteria 2643221726 2644692545 237
141 iso_pu_bacteria 2690316117 2692317449 237
142 iso_pu_bacteria 2718218233 2720618384 237
143 iso_pu_bacteria 2721755823 2724108474 237
144 iso_pu_bacteria 2724679232 2725945501 237
145 iso_pu_bacteria 2738541293 2738801393 237
146 iso_pu_bacteria 2738541333 2739036734 237
147 iso_pu_bacteria 2751185821 2753462604 237
148 iso_pu_bacteria 2765235942 2766062727 237
149 iso_pu_bacteria 2791355091 2792621255 237
150 iso_pu_bacteria 2791355092 2792625470 237
151 iso_pu_bacteria 2791355094 2792637904 237
152 iso_pu_bacteria 2791355256 2793295384 237
153 iso_pu_bacteria 2791355259 2793317981 237
154 iso_pu_bacteria 2791355262 2793334412 237
155 iso_pu_bacteria 2791355263 2793344704 237
156 iso_pu_bacteria 2791355265 2793355627 237
157 iso_pu_bacteria 2791355267 2793365702 237
158 iso_pu_bacteria 2802428858 2802718487 237
159 iso_pu_bacteria 2802428859 2802726310 237
160 iso_pu_bacteria 2802428860 2802731536 237
161 iso_pu_bacteria 2802428861 2802740834 237
162 iso_pu_bacteria 2802428862 2802742430 237
163 iso_pu_bacteria 2802428863 2802749136 237
164 iso_pu_bacteria 2802429633 2806048434 237
165 iso_pu_bacteria 2802429634 2806055915 237
166 iso_pu_bacteria 2802429635 2806062757 237
167 iso_pu_bacteria 2802429636 2806066435 237
168 iso_pu_bacteria 2802429637 2806073490 237
169 iso_pu_bacteria 2842521101 2842521511 237
170 iso_pu_bacteria 2844163670 2844165094 237
171 iso_pu_bacteria 2850079185 2850079820 237
172 iso_pu_bacteria 2891373044 2891375118 237
173 iso_pu_bacteria 2915980308 2915984016 237
174 iso_pu_bacteria 2916061851 2916064784 237
175 iso_pu_bacteria 2920760137 2920763557 237
176 iso_pu_bacteria 2920822456 2920823216 237
177 iso_pu_bacteria 2921250672 2921254456 237
178 iso_pu_bacteria 2937029754 2937034418 237
179 iso_pu_bacteria 2937036028 2937039728 237
180 iso_pu_bacteria 2937078374 2937078906 237
181 iso_pu_bacteria 2937084907 2937087641 237
182 iso_pu_bacteria 2941499720 2941500881 237
183 iso_pu_bacteria 2957375807 2957379860 237
184 iso_pu_bacteria 2957437181 2957443668 237
185 iso_pu_bacteria 2960591022 2960594601 237
186 iso_pu_bacteria 2960631154 2960634982 237
187 iso_pu_bacteria 2960680706 2960684711 237
188 iso_pu_bacteria 2960693952 2960694516 237
189 iso_pu_bacteria 2967686174 2967689604 237
190 iso_pu_bacteria 2967728569 2967730393 237
191 iso_pu_bacteria 2970026789 2970030894 237
192 iso_pu_bacteria 2970122695 2970124225 237
193 iso_pu_bacteria 2970143518 2970144283 237
194 iso_pu_bacteria 2977530762 2977532612 237
195 iso_pu_bacteria 2977544691 2977550366 237
196 iso_pu_bacteria 2989349275 2989351639 237
197 iso_pu_bacteria 3005409236 3005411003 237
198 iso_pu_bacteria 8003999396 8003999548 237
199 iso_pu_bacteria 8005382845 8005387469 237
200 iso_pu_bacteria 8005542996 8005543597 237
201 iso_pu_bacteria 8018150411 8018152965 237
202 iso_pu_bacteria 8054558443 8054563027 237
203 iso_pu_bacteria 2510065057 2510303491 238
204 iso_pu_bacteria 2510461076 2510897573 238
205 iso_pu_bacteria 2513237084 2513570442 238
206 iso_pu_bacteria 2513237093 2513635887 238
207 iso_pu_bacteria 2513237140 2513885793 238
208 iso_pu_bacteria 2513237144 2513914165 238
209 iso_pu_bacteria 2515154107 2515607564 238
210 iso_pu_bacteria 2515154116 2515657007 238
211 iso_pu_bacteria 2524023207 2524450704 238
212 iso_pu_bacteria 2529292951 2530647995 238
213 iso_pu_bacteria 2534681796 2535514924 238
214 iso_pu_bacteria 2551306085 2551686484 238
215 iso_pu_bacteria 2599185156 2599332866 238
216 iso_pu_bacteria 2643221582 2643918296 238
217 iso_pu_bacteria 2643221637 2644206930 238
218 iso_pu_bacteria 2643221643 2644237330 238
219 iso_pu_bacteria 2643221718 2644650578 238
220 iso_pu_bacteria 2791355261 2793326328 238
221 iso_pu_bacteria 2818991439 2819556598 238
222 iso_pu_bacteria 2838016132 2838020103 238
223 iso_pu_bacteria 2838035591 2838040104 238
224 iso_pu_bacteria 2838042994 2838048673 238
225 iso_pu_bacteria 2838048938 2838051683 238
226 iso_pu_bacteria 2838068647 2838070930 238
227 iso_pu_bacteria 2838661181 2838665964 238
228 iso_pu_bacteria 2841846520 2841846917 238
229 iso_pu_bacteria 2841864319 2841866994 238
230 iso_pu_bacteria 2842124991 2842127054 238
231 iso_pu_bacteria 2842205361 2842207119 238
232 iso_pu_bacteria 2842217011 2842219023 238
233 iso_pu_bacteria 2842264693 2842270471 238
234 iso_pu_bacteria 2842278818 2842280188 238
235 iso_pu_bacteria 2842285085 2842286645 238
236 iso_pu_bacteria 2842311132 2842312804 238
237 iso_pu_bacteria 2842317721 2842323891 238
238 iso_pu_bacteria 2842341865 2842343258 238
239 iso_pu_bacteria 2842363717 2842367017 238
240 iso_pu_bacteria 2842402390 2842403802 238
241 iso_pu_bacteria 2842409023 2842410496 238
242 iso_pu_bacteria 2842415677 2842417143 238
243 iso_pu_bacteria 2842422224 2842424545 238
244 iso_pu_bacteria 2842428310 2842434293 238
245 iso_pu_bacteria 2842434925 2842440600 238
246 iso_pu_bacteria 2842441272 2842447252 238
247 iso_pu_bacteria 2842447887 2842452030 238
248 iso_pu_bacteria 2842462802 2842468686 238
249 iso_pu_bacteria 2842469257 2842475231 238
250 iso_pu_bacteria 2842495871 2842500213 238
251 iso_pu_bacteria 2842922631 2842923157 238
252 iso_pu_bacteria 2855825444 2855828059 238
253 iso_pu_bacteria 2855839649 2855839830 238
254 iso_pu_bacteria 2858800743 2858803804 238
255 iso_pu_bacteria 2915986958 2915990688 238
256 iso_pu_bacteria 2915993759 2915997164 238
257 iso_pu_bacteria 2916000859 2916000930 238
258 iso_pu_bacteria 2916007675 2916011175 238
259 iso_pu_bacteria 2916014648 2916021291 238
260 iso_pu_bacteria 2916021584 2916021986 238
261 iso_pu_bacteria 2916028427 2916034079 238
262 iso_pu_bacteria 2916035215 2916036347 238
263 iso_pu_bacteria 2916041962 2916048410 238
264 iso_pu_bacteria 2916048683 2916053662 238
265 iso_pu_bacteria 2916055098 2916056938 238
266 iso_pu_bacteria 2916068649 2916071305 238
267 iso_pu_bacteria 2916076590 2916080767 238
268 iso_pu_bacteria 2919100787 2919101506 238
269 iso_pu_bacteria 2919114240 2919116419 238
270 iso_pu_bacteria 2921201388 2921205543 238
271 iso_pu_bacteria 2921208531 2921213697 238
272 iso_pu_bacteria 2921237296 2921241523 238
273 iso_pu_bacteria 2921244191 2921247102 238
274 iso_pu_bacteria 2921257292 2921262835 238
275 iso_pu_bacteria 2921263974 2921268684 238
276 iso_pu_bacteria 2921282425 2921288230 238
277 iso_pu_bacteria 2921289301 2921291757 238
278 iso_pu_bacteria 2921296804 2921297327 238
279 iso_pu_bacteria 2923556063 2923556549 238
280 iso_pu_bacteria 2924144063 2924150766 238
281 iso_pu_bacteria 2924150972 2924156669 238
282 iso_pu_bacteria 2924158325 2924160319 238
283 iso_pu_bacteria 2924165586 2924170729 238
284 iso_pu_bacteria 2924172951 2924176846 238
285 iso_pu_bacteria 2924179722 2924183643 238
286 iso_pu_bacteria 2924186466 2924187498 238
287 iso_pu_bacteria 2924193448 2924198993 238
288 iso_pu_bacteria 2924200457 2924200861 238
289 iso_pu_bacteria 2924207177 2924209215 238
290 iso_pu_bacteria 2924214083 2924216116 238
291 iso_pu_bacteria 2924221636 2924226559 238
292 iso_pu_bacteria 2924228884 2924232753 238
293 iso_pu_bacteria 2933016740 2933023545 238
294 iso_pu_bacteria 2933599457 2933601729 238
295 iso_pu_bacteria 2936381700 2936383575 238
296 iso_pu_bacteria 2936996657 2937001848 238
297 iso_pu_bacteria 2937002841 2937007702 238
298 iso_pu_bacteria 2937009748 2937014951 238
299 iso_pu_bacteria 2937016420 2937022305 238
300 iso_pu_bacteria 2937023124 2937023371 238
301 iso_pu_bacteria 2937042894 2937044861 238
302 iso_pu_bacteria 2937049772 2937053369 238
303 iso_pu_bacteria 2937056579 2937062729 238
304 iso_pu_bacteria 2937063883 2937064235 238
305 iso_pu_bacteria 2937071275 2937074887 238
306 iso_pu_bacteria 2937091812 2937092044 238
307 iso_pu_bacteria 2937098957 2937099880 238
308 iso_pu_bacteria 2937106411 2937106411 238
309 iso_pu_bacteria 2937113482 2937119477 238
310 iso_pu_bacteria 2937119839 2937126185 238
311 iso_pu_bacteria 2937126314 2937131608 238
312 iso_pu_bacteria 2957382221 2957388671 238
313 iso_pu_bacteria 2957388812 2957393385 238
314 iso_pu_bacteria 2957395598 2957400274 238
315 iso_pu_bacteria 2957402308 2957403886 238
316 iso_pu_bacteria 2957408893 2957413764 238
317 iso_pu_bacteria 2957415311 2957417670 238
318 iso_pu_bacteria 2957422303 2957423330 238
319 iso_pu_bacteria 2957430029 2957436893 238
320 iso_pu_bacteria 2957443900 2957447291 238
321 iso_pu_bacteria 2957450854 2957451214 238
322 iso_pu_bacteria 2957457609 2957460186 238
323 iso_pu_bacteria 2957464669 2957469581 238
324 iso_pu_bacteria 2957471148 2957473529 238
325 iso_pu_bacteria 2957478035 2957482011 238
326 iso_pu_bacteria 2957484790 2957484836 238
327 iso_pu_bacteria 2957491536 2957492111 238
328 iso_pu_bacteria 2957498199 2957500662 238
329 iso_pu_bacteria 2957505466 2957508130 238
330 iso_pu_bacteria 2960584000 2960586153 238
331 iso_pu_bacteria 2960597568 2960603389 238
332 iso_pu_bacteria 2960603979 2960607803 238
333 iso_pu_bacteria 2960610863 2960611730 238
334 iso_pu_bacteria 2960617483 2960621533 238
335 iso_pu_bacteria 2960624210 2960626777 238
336 iso_pu_bacteria 2960637947 2960641540 238
337 iso_pu_bacteria 2960645483 2960648080 238
338 iso_pu_bacteria 2960652885 2960658306 238
339 iso_pu_bacteria 2960660292 2960660575 238
340 iso_pu_bacteria 2960667422 2960672189 238
341 iso_pu_bacteria 2960674078 2960679599 238
342 iso_pu_bacteria 2960687367 2960687510 238
343 iso_pu_bacteria 2964607997 2964610539 238
344 iso_pu_bacteria 2964615318 2964618431 238
345 iso_pu_bacteria 2964621998 2964625434 238
346 iso_pu_bacteria 2964628898 2964633790 238
347 iso_pu_bacteria 2964636051 2964639461 238
348 iso_pu_bacteria 2964643177 2964649378 238
349 iso_pu_bacteria 2964649959 2964650168 238
350 iso_pu_bacteria 2964656573 2964663076 238
351 iso_pu_bacteria 2964663802 2964668098 238
352 iso_pu_bacteria 2964670856 2964671862 238
353 iso_pu_bacteria 2964678106 2964679839 238
354 iso_pu_bacteria 2964685014 2964691669 238
355 iso_pu_bacteria 2964691889 2964697713 238
356 iso_pu_bacteria 2964698721 2964703353 238
357 iso_pu_bacteria 2964705432 2964710200 238
358 iso_pu_bacteria 2964712639 2964717224 238
359 iso_pu_bacteria 2964719344 2964722036 238
360 iso_pu_bacteria 2967664464 2967670528 238
361 iso_pu_bacteria 2967671571 2967671860 238
362 iso_pu_bacteria 2967678726 2967680929 238
363 iso_pu_bacteria 2967693043 2967694906 238
364 iso_pu_bacteria 2967699805 2967703532 238
365 iso_pu_bacteria 2967706974 2967712297 238
366 iso_pu_bacteria 2967714385 2967714500 238
367 iso_pu_bacteria 2967721400 2967723448 238
368 iso_pu_bacteria 2967735183 2967739250 238
369 iso_pu_bacteria 2967742019 2967744837 238
370 iso_pu_bacteria 2967748971 2967754888 238
371 iso_pu_bacteria 2967755722 2967761170 238
372 iso_pu_bacteria 2967762386 2967766553 238
373 iso_pu_bacteria 2967769361 2967769942 238
374 iso_pu_bacteria 2967775926 2967778067 238
375 iso_pu_bacteria 2970019648 2970023289 238
376 iso_pu_bacteria 2970033650 2970037109 238
377 iso_pu_bacteria 2970040964 2970041117 238
378 iso_pu_bacteria 2970047711 2970050696 238
379 iso_pu_bacteria 2970054988 2970056847 238
380 iso_pu_bacteria 2970061556 2970062737 238
381 iso_pu_bacteria 2970068827 2970075392 238
382 iso_pu_bacteria 2970076120 2970081781 238
383 iso_pu_bacteria 2970082768 2970088386 238
384 iso_pu_bacteria 2970088815 2970089503 238
385 iso_pu_bacteria 2970095765 2970101912 238
386 iso_pu_bacteria 2970102677 2970105982 238
387 iso_pu_bacteria 2970109326 2970115755 238
388 iso_pu_bacteria 2970116247 2970117620 238
389 iso_pu_bacteria 2970129317 2970131404 238
390 iso_pu_bacteria 2970136068 2970138970 238
391 iso_pu_bacteria 2970149975 2970154470 238
392 iso_pu_bacteria 2970156795 2970161314 238
393 iso_pu_bacteria 2970164137 2970170115 238
394 iso_pu_bacteria 2970170962 2970175823 238
395 iso_pu_bacteria 2970177841 2970183683 238
396 iso_pu_bacteria 2970184632 2970190831 238
397 iso_pu_bacteria 2970191845 2970197451 238
398 iso_pu_bacteria 2977516862 2977521118 238
399 iso_pu_bacteria 2977523885 2977528548 238
400 iso_pu_bacteria 2977537788 2977543802 238
401 iso_pu_bacteria 2977551784 2977553459 238
402 iso_pu_bacteria 2977558990 2977563724 238
403 iso_pu_bacteria 2977565890 2977571738 238
404 iso_pu_bacteria 2977572785 2977574681 238
405 iso_pu_bacteria 2977579622 2977584441 238
406 iso_pu_bacteria 2979100975 2979105089 238
407 iso_pu_bacteria 2984509177 2984513097 238
408 iso_pu_bacteria 2984518228 2984520538 238
409 iso_pu_bacteria 2984537506 2984539832 238
410 iso_pu_bacteria 2984601300 2984602067 238
411 iso_pu_bacteria 2996887358 2996888349 238
412 iso_pu_bacteria 2996893221 2996893268 238
413 iso_pu_bacteria 3005445848 3005446029 238
414 iso_pu_bacteria 3005452660 3005452680 238
415 iso_pu_bacteria 3005452660 3005456701 238
416 iso_pu_bacteria 639633055 639646458 238
417 iso_pu_bacteria 8003992118 8003992284 238
418 iso_pu_bacteria 8005258706 8005261095 238
419 iso_pu_bacteria 8005289223 8005291261 238
420 iso_pu_bacteria 8005301065 8005301365 238
421 iso_pu_bacteria 8005321885 8005322876 238
422 iso_pu_bacteria 8005430974 8005432750 238
423 iso_pu_bacteria 8005460587 8005460806 238
424 iso_pu_bacteria 8005497431 8005498480 238
425 iso_pu_bacteria 8005570704 8005573688 238
426 iso_pu_bacteria 8005619151 8005619671 238
427 iso_pu_bacteria 8005626139 8005628244 238
428 iso_pu_bacteria 8005668836 8005669890 238
429 iso_pu_bacteria 8005688590 8005692427 238
430 iso_pu_bacteria 8056375014 8056378595 238
431 iso_pu_bacteria 8056382006 8056385779 238
432 iso_pu_bacteria 2838074704 2838075188 239
433 iso_pu_bacteria 2847417321 2847417483 239
434 iso_pu_bacteria 2848992105 2848992318 239
435 iso_pu_bacteria 2855872281 2855873543 239
436 iso_pu_bacteria 2989771324 2989772644 239
437 iso_pu_bacteria 3003930520 3003931777 239
438 iso_pu_bacteria 643692032 643824382 239
439 3300021321 Ga0214542_1001074 Ga0214542_100107441 240
440 3300021327 Ga0214543_1000897 Ga0214543_100089741 240
441 3300027111 Ga0209281_1000520 Ga0209281_100052013 240
442 iso_pu_bacteria 8005395548 8005399951 240
443 iso_pu_bacteria 8005556819 8005560418 240
444 iso_pu_bacteria 8005682033 8005685232 240
445 iso_pu_bacteria 8024479707 8024480096 240
446 3300002739 JGI25158J39367_1000090 JGI25158J39367_100009011 241
447 3300002773 JGI25152J39213_1000246 JGI25152J39213_100024625 241
448 3300002773 JGI25152J39213_1000500 JGI25152J39213_100050011 241
449 3300002773 JGI25152J39213_1016171 JGI25152J39213_10161711 241
450 3300002773 JGI25152J39213_1016174 JGI25152J39213_10161741 241
451 3300002774 JGI25150J39212_1000118 JGI25150J39212_100011822 241
452 3300002774 JGI25150J39212_1004187 JGI25150J39212_10041874 241
453 3300002774 JGI25150J39212_1005928 JGI25150J39212_10059281 241
454 3300002987 JGI25159J45721_1000003 JGI25159J45721_1000003194 241
455 3300002987 JGI25159J45721_1000942 JGI25159J45721_100094210 241
456 3300003187 JGI25151J46595_10000110 JGI25151J46595_1000011032 241
457 3300003187 JGI25151J46595_10000681 JGI25151J46595_100006814 241
458 3300003187 JGI25151J46595_10003279 JGI25151J46595_100032798 241
459 3300003215 JGI25153J46596_10000482 JGI25153J46596_100004824 241
460 3300003215 JGI25153J46596_10035651 JGI25153J46596_100356512 241
461 3300003215 JGI25153J46596_10040347 JGI25153J46596_100403471 241
462 3300003215 JGI25153J46596_10040373 JGI25153J46596_100403731 241
463 3300003215 JGI25153J46596_10047850 JGI25153J46596_100478502 241
464 3300003322 rootL2_10235986 rootL2_102359862 241
465 3300003354 JGI25160J50197_1000003 JGI25160J50197_1000003375 241
466 3300003354 JGI25160J50197_1000514 JGI25160J50197_100051416 241
467 3300003354 JGI25160J50197_1011969 JGI25160J50197_10119692 241
468 3300003374 JGI25161J50226_1000184 JGI25161J50226_100018413 241
469 3300003374 JGI25161J50226_1000270 JGI25161J50226_10002705 241
470 3300003374 JGI25161J50226_1004678 JGI25161J50226_10046783 241
471 3300003578 Ga0006562J51391_1024010 Ga0006562J51391_10240102 241
472 3300003771 Ga0055526_1000725 Ga0055526_100072517 241
473 3300003771 Ga0055526_1002842 Ga0055526_100284211 241
474 3300003771 Ga0055526_1004258 Ga0055526_10042587 241
475 3300003771 Ga0055526_1017123 Ga0055526_10171233 241
476 3300003775 Ga0055524_1002851 Ga0055524_10028512 241
477 3300003775 Ga0055524_1006954 Ga0055524_10069543 241
478 3300003775 Ga0055524_1015572 Ga0055524_10155722 241
479 3300003775 Ga0055524_1018417 Ga0055524_10184172 241
480 3300003781 Ga0055536_1019078 Ga0055536_10190782 241
481 3300003790 Ga0055528_1000095 Ga0055528_100009510 241
482 3300003790 Ga0055528_1000618 Ga0055528_10006187 241
483 3300003790 Ga0055528_1015870 Ga0055528_10158702 241
484 3300003790 Ga0055528_1021492 Ga0055528_10214922 241
485 3300003790 Ga0055528_1023363 Ga0055528_10233631 241
486 3300003792 Ga0055540_1000190 Ga0055540_100019025 241
487 3300003792 Ga0055540_1007520 Ga0055540_10075202 241
488 3300003794 Ga0055531_10005539 Ga0055531_100055392 241
489 3300003856 Ga0058692_1017409 Ga0058692_10174092 241
490 3300004625 Ga0055543_1000059 Ga0055543_100005997 241
491 3300004625 Ga0055543_1000299 Ga0055543_10002998 241
492 3300004625 Ga0055543_1003650 Ga0055543_10036504 241
493 3300005262 Ga0065165_1000084 Ga0065165_100008451 241
494 3300005262 Ga0065165_1012356 Ga0065165_10123562 241
495 3300005262 Ga0065165_1040779 Ga0065165_10407791 241
496 3300005355 Ga0070671_100027922 Ga0070671_1000279228 241
497 3300005367 Ga0070667_100181766 Ga0070667_1001817662 241
498 3300005548 Ga0070665_100136036 Ga0070665_1001360362 241
499 3300005844 Ga0068862_100147624 Ga0068862_1001476243 241
500 3300006038 Ga0075365_10003496 Ga0075365_1000349610 241
501 3300006038 Ga0075365_10007830 Ga0075365_100078303 241
502 3300006042 Ga0075368_10034448 Ga0075368_100344482 241
503 3300006177 Ga0075362_10007175 Ga0075362_100071753 241
504 3300006178 Ga0075367_10033635 Ga0075367_100336352 241
505 3300006186 Ga0075369_10008457 Ga0075369_100084572 241
506 3300006195 Ga0075366_10019959 Ga0075366_100199595 241
507 3300006353 Ga0075370_10148964 Ga0075370_101489642 241
508 3300009011 Ga0105251_10057758 Ga0105251_100577582 241
509 3300009036 Ga0105244_10157911 Ga0105244_101579111 241
510 3300009765 Ga0123341_1000067 Ga0123341_100006747 241
511 3300009765 Ga0123341_1068588 Ga0123341_10685883 241
512 3300009766 Ga0123342_1010893 Ga0123342_10108932 241
513 3300015690 Ga0183363_1134 Ga0183363_113411 241
514 3300021321 Ga0214542_1025837 Ga0214542_10258373 241
515 3300021327 Ga0214543_1000027 Ga0214543_1000027165 241
516 3300022739 Ga0228711_1000041 Ga0228711_100004156 241
517 3300022740 Ga0228710_1000024 Ga0228710_100002483 241
518 3300025208 Ga0209436_100006 Ga0209436_100006107 241
519 3300025208 Ga0209436_100836 Ga0209436_1008362 241
520 3300025245 Ga0207425_1000012 Ga0207425_1000012133 241
521 3300025245 Ga0207425_1002717 Ga0207425_10027174 241
522 3300025245 Ga0207425_1006821 Ga0207425_10068213 241
523 3300025258 Ga0209129_1000105 Ga0209129_100010588 241
524 3300025258 Ga0209129_1000110 Ga0209129_1000110133 241
525 3300025258 Ga0209129_1000429 Ga0209129_100042922 241
526 3300025258 Ga0209129_1001484 Ga0209129_10014844 241
527 3300025258 Ga0209129_1001523 Ga0209129_100152313 241
528 3300025258 Ga0209129_1001602 Ga0209129_100160213 241
529 3300025258 Ga0209129_1002388 Ga0209129_10023882 241
530 3300025273 Ga0209673_1000015 Ga0209673_1000015562 241
531 3300025273 Ga0209673_1000063 Ga0209673_1000063147 241
532 3300025273 Ga0209673_1001004 Ga0209673_100100424 241
533 3300025273 Ga0209673_1002293 Ga0209673_10022934 241
534 3300025273 Ga0209673_1003895 Ga0209673_10038952 241
535 3300025273 Ga0209673_1006202 Ga0209673_10062024 241
536 3300025273 Ga0209673_1012901 Ga0209673_10129012 241
537 3300025273 Ga0209673_1056919 Ga0209673_10569191 241
538 3300025284 Ga0209130_1000002 Ga0209130_1000002243 241
539 3300025284 Ga0209130_1000005 Ga0209130_1000005103 241
540 3300025292 Ga0209676_1033105 Ga0209676_10331052 241
541 3300025294 Ga0209025_1000024 Ga0209025_1000024133 241
542 3300025294 Ga0209025_1000295 Ga0209025_10002955 241
543 3300025294 Ga0209025_1000638 Ga0209025_100063824 241
544 3300025294 Ga0209025_1003060 Ga0209025_10030608 241
545 3300025294 Ga0209025_1012788 Ga0209025_10127881 241
546 3300025294 Ga0209025_1013101 Ga0209025_10131015 241
547 3300025294 Ga0209025_1042695 Ga0209025_10426951 241
548 3300025295 Ga0209564_1000093 Ga0209564_1000093106 241
549 3300025295 Ga0209564_1000316 Ga0209564_100031689 241
550 3300025295 Ga0209564_1004460 Ga0209564_10044607 241
551 3300025295 Ga0209564_1008398 Ga0209564_10083984 241
552 3300025295 Ga0209564_1029360 Ga0209564_10293602 241
553 3300025297 Ga0209758_1000150 Ga0209758_100015032 241
554 3300025297 Ga0209758_1000361 Ga0209758_100036142 241
555 3300025297 Ga0209758_1000499 Ga0209758_100049944 241
556 3300025297 Ga0209758_1000876 Ga0209758_100087618 241
557 3300025297 Ga0209758_1001299 Ga0209758_100129923 241
558 3300025297 Ga0209758_1002582 Ga0209758_10025826 241
559 3300025297 Ga0209758_1007691 Ga0209758_10076914 241
560 3300025297 Ga0209758_1014373 Ga0209758_10143732 241
561 3300025298 Ga0209050_1011207 Ga0209050_10112074 241
562 3300025298 Ga0209050_1019868 Ga0209050_10198682 241
563 3300025299 Ga0209256_1000027 Ga0209256_1000027306 241
564 3300025299 Ga0209256_1000880 Ga0209256_100088032 241
565 3300025299 Ga0209256_1001669 Ga0209256_100166912 241
566 3300025299 Ga0209256_1002179 Ga0209256_100217918 241
567 3300025299 Ga0209256_1005310 Ga0209256_10053104 241
568 3300025299 Ga0209256_1005901 Ga0209256_10059014 241
569 3300025299 Ga0209256_1006338 Ga0209256_10063387 241
570 3300025299 Ga0209256_1016791 Ga0209256_10167912 241
571 3300025299 Ga0209256_1044286 Ga0209256_10442861 241
572 3300025302 Ga0207426_1000013 Ga0207426_1000013243 241
573 3300025302 Ga0207426_1000015 Ga0207426_1000015496 241
574 3300025302 Ga0207426_1000070 Ga0207426_1000070201 241
575 3300025302 Ga0207426_1001614 Ga0207426_100161418 241
576 3300025303 Ga0209051_1000135 Ga0209051_100013571 241
577 3300025303 Ga0209051_1006292 Ga0209051_10062922 241
578 3300025303 Ga0209051_1055969 Ga0209051_10559692 241
579 3300025303 Ga0209051_1064569 Ga0209051_10645692 241
580 3300025304 Ga0209257_1005318 Ga0209257_10053188 241
581 3300025304 Ga0209257_1029056 Ga0209257_10290562 241
582 3300025925 Ga0207650_10000776 Ga0207650_1000077622 241
583 3300025941 Ga0207711_10167094 Ga0207711_101670943 241
584 3300025986 Ga0207658_10277195 Ga0207658_102771952 241
585 3300027111 Ga0209281_1000409 Ga0209281_100040922 241
586 3300027312 Ga0209371_1000009 Ga0209371_1000009561 241
587 3300027312 Ga0209371_1000424 Ga0209371_100042446 241
588 3300027666 Ga0209282_1000090 Ga0209282_100009022 241
589 3300027866 Ga0209813_10115148 Ga0209813_101151481 241
590 3300028379 Ga0268266_10119922 Ga0268266_101199222 241
591 3300028380 Ga0268265_10853713 Ga0268265_108537131 241
592 3300028794 Ga0307515_10000674 Ga0307515_1000067411 241
593 3300028794 Ga0307515_10006511 Ga0307515_1000651119 241
594 3300028794 Ga0307515_10012267 Ga0307515_1001226712 241
595 3300028794 Ga0307515_10148902 Ga0307515_101489022 241
596 3300030500 Ga0268256_1000010 Ga0268256_1000010560 241
597 3300031456 Ga0307513_10000180 Ga0307513_100001802 241
598 3300031456 Ga0307513_10236576 Ga0307513_102365763 241
599 3300031731 Ga0307405_10000250 Ga0307405_1000025015 241
600 3300031901 Ga0307406_10002749 Ga0307406_1000274913 241
601 3300031911 Ga0307412_10000491 Ga0307412_100004915 241
602 3300031911 Ga0307412_10527791 Ga0307412_105277912 241
603 3300031967 Ga0315914_1000167 Ga0315914_100016742 241
604 3300032002 Ga0307416_100620524 Ga0307416_1006205242 241
605 3300032004 Ga0307414_10727507 Ga0307414_107275072 241
606 3300033430 Ga0315913_1000038 Ga0315913_100003842 241
607 3300033464 Ga0315915_1000019 Ga0315915_100001922 241
608 3300041406 Ga0439439_0027122 Ga0439439_0027122_190_915 241
609 3300041407 Ga0439447_022451 Ga0439447_022451_815_1540 241
610 3300041413 Ga0439465_0004487 Ga0439465_0004487_2682_3407 241
611 3300041413 Ga0439465_0019725 Ga0439465_0019725_1267_1992 241
612 3300041441 Ga0451787_252007 Ga0451787_252007_1607_2332 241
613 3300041451 Ga0451791_0180341 Ga0451791_0180341_132_866 241
614 3300041492 Ga0451835_0388755 Ga0451835_0388755_119_856 241
615 3300041494 Ga0451837_0526223 Ga0451837_0526223_43_768 241
616 3300041496 Ga0451839_0199143 Ga0451839_0199143_960_1685 241
617 3300041498 Ga0451841_1408368 Ga0451841_1408368_119_856 241
618 3300041501 Ga0451845_0150991 Ga0451845_0150991_184_921 241
619 3300041503 Ga0451847_0236407 Ga0451847_0236407_245_970 241
620 3300041507 Ga0451851_0308271 Ga0451851_0308271_439_1164 241
621 3300041509 Ga0451843_1263341 Ga0451843_1263341_378_1103 241
622 3300041511 Ga0451855_2061497 Ga0451855_2061497_628_1353 241
623 3300041512 Ga0451853_3650313 Ga0451853_3650313_780_1505 241
624 3300042015 Ga0439462_0011595 Ga0439462_0011595_137_862 241
625 3300046454 Ga0495592_0186801 Ga0495592_0186801_511_1266 241
626 3300046459 Ga0495629_0012377 Ga0495629_0012377_2155_2880 241
627 3300046460 Ga0495638_0020006 Ga0495638_0020006_3266_4018 241
628 3300046474 Ga0495605_0024123 Ga0495605_0024123_281_1033 241
629 3300046475 Ga0495639_0125449 Ga0495639_0125449_235_960 241
630 3300046476 Ga0495662_0012312 Ga0495662_0012312_2517_3242 241
631 3300046492 Ga0495585_0009240 Ga0495585_0009240_4724_5449 241
632 3300046501 Ga0495607_0018739 Ga0495607_0018739_961_1698 241
633 3300046506 Ga0495583_0003772 Ga0495583_0003772_2083_2808 241
634 3300046507 Ga0495606_0164468 Ga0495606_0164468_220_945 241
635 3300046507 Ga0495606_0184566 Ga0495606_0184566_83_808 241
636 3300046512 Ga0495610_0000461 Ga0495610_0000461_19579_20304 241
637 3300046512 Ga0495610_0118502 Ga0495610_0118502_211_936 241
638 3300046514 Ga0495618_0250994 Ga0495618_0250994_267_992 241
639 3300046515 Ga0495620_0067648 Ga0495620_0067648_342_1067 241
640 3300046515 Ga0495620_0115391 Ga0495620_0115391_273_998 241
641 3300046515 Ga0495620_0139721 Ga0495620_0139721_141_878 241
642 3300046518 Ga0495631_0019196 Ga0495631_0019196_1273_2025 241
643 3300046518 Ga0495631_0084809 Ga0495631_0084809_273_1046 241
644 3300046519 Ga0495632_0006289 Ga0495632_0006289_417_1142 241
645 3300046519 Ga0495632_0070468 Ga0495632_0070468_696_1448 241
646 3300046522 Ga0495643_0008921 Ga0495643_0008921_5353_6090 241
647 3300046522 Ga0495643_0050571 Ga0495643_0050571_312_1037 241
648 3300046524 Ga0495648_0037751 Ga0495648_0037751_1222_1959 241
649 3300046529 Ga0495652_0196599 Ga0495652_0196599_449_1207 241
650 3300046536 Ga0495587_0068202 Ga0495587_0068202_502_1227 241
651 3300046538 Ga0495609_0047847 Ga0495609_0047847_489_1241 241
652 3300046558 Ga0495633_0046861 Ga0495633_0046861_607_1332 241
653 3300046558 Ga0495633_0073927 Ga0495633_0073927_589_1362 241
654 3300046615 Ga0495656_0018785 Ga0495656_0018785_405_1178 241
655 3300046616 Ga0495668_0097091 Ga0495668_0097091_371_1123 241
656 3300046616 Ga0495668_0216647 Ga0495668_0216647_175_900 241
657 3300046642 Ga0495634_0128294 Ga0495634_0128294_610_1335 241
658 3300046660 Ga0495625_0026846 Ga0495625_0026846_385_1137 241
659 3300046660 Ga0495625_0250888 Ga0495625_0250888_199_924 241
660 3300046663 Ga0495635_0057071 Ga0495635_0057071_925_1650 241
661 3300046665 Ga0495661_0100588 Ga0495661_0100588_736_1473 241
662 3300046665 Ga0495661_0125309 Ga0495661_0125309_532_1257 241
663 3300046665 Ga0495661_0201396 Ga0495661_0201396_241_978 241
664 3300046665 Ga0495661_0240021 Ga0495661_0240021_52_825 241
665 3300046674 Ga0495588_0030848 Ga0495588_0030848_1369_2094 241
666 3300046674 Ga0495588_0031208 Ga0495588_0031208_1687_2460 241
667 3300046679 Ga0495623_0180036 Ga0495623_0180036_449_1174 241
668 3300046680 Ga0495646_0160553 Ga0495646_0160553_127_885 241
669 3300046690 Ga0495624_0166998 Ga0495624_0166998_169_894 241
670 3300046691 Ga0495670_0182377 Ga0495670_0182377_223_975 241
671 3300046691 Ga0495670_0262256 Ga0495670_0262256_125_850 241
672 3300046694 Ga0495649_0173544 Ga0495649_0173544_339_1064 241
673 3300046794 Ga0495589_0189453 Ga0495589_0189453_69_794 241
674 3300046809 Ga0495600_0016251 Ga0495600_0016251_2807_3565 241
675 3300046810 Ga0495660_0077835 Ga0495660_0077835_735_1472 241
676 3300046810 Ga0495660_0156043 Ga0495660_0156043_257_1009 241
677 3300047320 Ga0495672_0150290 Ga0495672_0150290_168_920 241
678 3300047443 Ga0495687_068328 Ga0495687_068328_469_1206 241
679 3300047470 Ga0495681_0106643 Ga0495681_0106643_344_1117 241
680 3300047472 Ga0495686_0125744 Ga0495686_0125744_460_1185 241
681 3300048091 Ga0495626_0123295 Ga0495626_0123295_34_759 241
682 3300048904 Ga0496101_0576949 Ga0496101_0576949_110_835 241
683 3300048905 Ga0496102_0409297 Ga0496102_0409297_71_796 241
684 3300048907 Ga0496104_0081774 Ga0496104_0081774_484_1209 241
685 3300048908 Ga0496105_0179781 Ga0496105_0179781_413_1138 241
686 3300048909 Ga0496106_0004867 Ga0496106_0004867_7662_8399 241
687 3300048909 Ga0496106_0409795 Ga0496106_0409795_238_963 241
688 3300048914 Ga0496111_0177519 Ga0496111_0177519_455_1180 241
689 3300048916 Ga0496113_0253089 Ga0496113_0253089_440_1165 241
690 3300048919 Ga0496116_0001406 Ga0496116_0001406_8359_9084 241
691 3300048919 Ga0496116_0004126 Ga0496116_0004126_13124_13849 241
692 3300048919 Ga0496116_0058538 Ga0496116_0058538_1449_2174 241
693 3300048919 Ga0496116_0103637 Ga0496116_0103637_699_1424 241
694 3300048919 Ga0496116_0194716 Ga0496116_0194716_149_874 241
695 3300048919 Ga0496116_0206798 Ga0496116_0206798_70_795 241
696 3300048920 Ga0496117_0014921 Ga0496117_0014921_5522_6247 241
697 3300048920 Ga0496117_0018471 Ga0496117_0018471_4605_5330 241
698 3300048920 Ga0496117_0128717 Ga0496117_0128717_362_1087 241
699 3300048921 Ga0496118_0008398 Ga0496118_0008398_9467_10192 241
700 3300048921 Ga0496118_0016889 Ga0496118_0016889_5518_6243 241
701 3300048921 Ga0496118_0172845 Ga0496118_0172845_172_897 241
702 3300048922 Ga0496119_0130450 Ga0496119_0130450_435_1160 241
703 3300048923 Ga0496120_0130402 Ga0496120_0130402_420_1145 241
704 3300048924 Ga0496121_0020076 Ga0496121_0020076_5203_5928 241
705 3300048924 Ga0496121_0022942 Ga0496121_0022942_3185_3910 241
706 3300048924 Ga0496121_0082337 Ga0496121_0082337_1427_2152 241
707 3300048924 Ga0496121_0158392 Ga0496121_0158392_704_1429 241
708 3300048924 Ga0496121_0215321 Ga0496121_0215321_331_1056 241
709 3300048924 Ga0496121_0251863 Ga0496121_0251863_416_1141 241
710 3300048924 Ga0496121_0368336 Ga0496121_0368336_196_921 241
711 3300048925 Ga0496122_0011942 Ga0496122_0011942_2729_3454 241
712 3300048925 Ga0496122_0113149 Ga0496122_0113149_704_1429 241
713 3300048925 Ga0496122_0113242 Ga0496122_0113242_268_1038 241
714 3300048925 Ga0496122_0126887 Ga0496122_0126887_548_1273 241
715 3300048925 Ga0496122_0164022 Ga0496122_0164022_207_932 241
716 3300048925 Ga0496122_0238193 Ga0496122_0238193_269_994 241
717 3300048926 Ga0496123_0122457 Ga0496123_0122457_704_1429 241
718 3300048927 Ga0496124_0000513 Ga0496124_0000513_13805_14530 241
719 3300048927 Ga0496124_0002549 Ga0496124_0002549_5546_6271 241
720 3300048927 Ga0496124_0025777 Ga0496124_0025777_3537_4262 241
721 3300048927 Ga0496124_0307216 Ga0496124_0307216_175_900 241
722 3300048928 Ga0496125_0000299 Ga0496125_0000299_63236_63961 241
723 3300048928 Ga0496125_0001813 Ga0496125_0001813_6864_7589 241
724 3300048928 Ga0496125_0009396 Ga0496125_0009396_6483_7208 241
725 3300048928 Ga0496125_0239752 Ga0496125_0239752_33_758 241
726 3300048929 Ga0496126_0093859 Ga0496126_0093859_583_1308 241
727 3300048929 Ga0496126_0397111 Ga0496126_0397111_242_967 241
728 3300048929 Ga0496126_0434326 Ga0496126_0434326_159_884 241
729 3300048929 Ga0496126_0552677 Ga0496126_0552677_75_803 241
730 3300049459 Ga0495678_048231 Ga0495678_048231_720_1472 241
731 3300049571 Ga0501034_0393480 Ga0501034_0393480_448_1173 241
732 3300049572 Ga0501036_0479877 Ga0501036_0479877_184_909 241
733 3300049573 Ga0501037_0017214 Ga0501037_0017214_2884_3609 241
734 3300049574 Ga0501038_0098497 Ga0501038_0098497_1377_2102 241
735 3300049581 Ga0501047_0291556 Ga0501047_0291556_442_1167 241
736 3300049582 Ga0501048_0426182 Ga0501048_0426182_108_833 241
737 3300049744 Ga0501083_0197816 Ga0501083_0197816_127_852 241
738 3300049744 Ga0501083_0273715 Ga0501083_0273715_207_932 241
739 3300049823 Ga0501044_0061070 Ga0501044_0061070_2553_3278 241
740 3300050489 nmdc:mga03683_14045_c1 nmdc:mga03683_14045_c1_1630_2355 241
741 3300050516 nmdc:mga0sz30_153158_c1 nmdc:mga0sz30_153158_c1_35_763 241
742 3300053086 Ga0500578_0280382 Ga0500578_0280382_184_921 241
743 3300053134 Ga0500658_0001142 Ga0500658_0001142_6001_6726 241
744 3300053139 Ga0500568_0004265 Ga0500568_0004265_2203_2940 241
745 3300053139 Ga0500568_0011577 Ga0500568_0011577_1042_1794 241
746 3300053140 Ga0500573_0001761 Ga0500573_0001761_2311_3036 241
747 3300053140 Ga0500573_0028647 Ga0500573_0028647_1385_2110 241
748 3300053148 Ga0500590_005274 Ga0500590_005274_1375_2100 241
749 3300053151 Ga0500604_0039960 Ga0500604_0039960_611_1348 241
750 3300053153 Ga0500616_0014549 Ga0500616_0014549_503_1255 241
751 3300053153 Ga0500616_0127806 Ga0500616_0127806_178_903 241
752 3300053156 Ga0500622_0002165 Ga0500622_0002165_1655_2380 241
753 3300053156 Ga0500622_0033119 Ga0500622_0033119_558_1295 241
754 3300053160 Ga0500633_0030243 Ga0500633_0030243_22_759 241
755 3300059641 Ga0587068_011792 Ga0587068_011792_182_910 241
756 iso_pu_bacteria 2582581308 2585280125 241
757 iso_pu_bacteria 2582581315 2585326096 241
758 iso_pu_bacteria 2582581316 2585330261 241
759 iso_pu_bacteria 2585427527 2585533624 241
760 iso_pu_bacteria 2585427530 2585553215 241
761 iso_pu_bacteria 2585427608 2585900674 241
762 iso_pu_bacteria 2615840624 2616293607 241
763 iso_pu_bacteria 2615840626 2616310328 241
764 iso_pu_bacteria 2615840698 2616553293 241
765 iso_pu_bacteria 2667528174 2671113777 241
766 iso_pu_bacteria 2718217882 2719179374 241
767 iso_pu_bacteria 2718217927 2719383946 241
768 iso_pu_bacteria 2718218009 2719730044 241
769 iso_pu_bacteria 2718218363 2721145467 241
770 iso_pu_bacteria 2718218365 2721157001 241
771 iso_pu_bacteria 2718218366 2721162362 241
772 iso_pu_bacteria 2718218423 2721397716 241
773 iso_pu_bacteria 2721755514 2722838532 241
774 iso_pu_bacteria 2721755809 2724036526 241
775 iso_pu_bacteria 2721755810 2724042800 241
776 iso_pu_bacteria 2728369365 2730162611 241
777 iso_pu_bacteria 2728369397 2730296633 241
778 iso_pu_bacteria 2775507266 2778179601 241
779 iso_pu_bacteria 2791355260 2793325100 241
780 iso_pu_bacteria 2791355264 2793348325 241
781 iso_pu_bacteria 2791355266 2793363800 241
782 iso_pu_bacteria 2802429605 2805931977 241
783 iso_pu_bacteria 2802429606 2805932530 241
784 iso_pu_bacteria 2818991453 2819640632 241
785 iso_pu_bacteria 2838022645 2838027657 241
786 iso_pu_bacteria 2838061910 2838064247 241
787 iso_pu_bacteria 2838668709 2838673369 241
788 iso_pu_bacteria 2838680041 2838680411 241
789 iso_pu_bacteria 2838686498 2838691792 241
790 iso_pu_bacteria 2838694306 2838695556 241
791 iso_pu_bacteria 2838701080 2838706116 241
792 iso_pu_bacteria 2838707686 2838708933 241
793 iso_pu_bacteria 2838729681 2838733724 241
794 iso_pu_bacteria 2838742623 2838749582 241
795 iso_pu_bacteria 2841851746 2841856353 241
796 iso_pu_bacteria 2842077413 2842079832 241
797 iso_pu_bacteria 2842110456 2842112012 241
798 iso_pu_bacteria 2842118031 2842120450 241
799 iso_pu_bacteria 2842146304 2842150541 241
800 iso_pu_bacteria 2842156927 2842162142 241
801 iso_pu_bacteria 2842163707 2842165356 241
802 iso_pu_bacteria 2842180545 2842185983 241
803 iso_pu_bacteria 2842192696 2842192727 241
804 iso_pu_bacteria 2842198810 2842204214 241
805 iso_pu_bacteria 2842229732 2842236225 241
806 iso_pu_bacteria 2842237096 2842238344 241
807 iso_pu_bacteria 2842243621 2842248034 241
808 iso_pu_bacteria 2842250916 2842255580 241
809 iso_pu_bacteria 2842257432 2842262372 241
810 iso_pu_bacteria 2842271015 2842276765 241
811 iso_pu_bacteria 2842291075 2842293493 241
812 iso_pu_bacteria 2842298080 2842299570 241
813 iso_pu_bacteria 2842304105 2842311098 241
814 iso_pu_bacteria 2842357229 2842360998 241
815 iso_pu_bacteria 2842370503 2842370874 241
816 iso_pu_bacteria 2842377471 2842379890 241
817 iso_pu_bacteria 2842384541 2842386961 241
818 iso_pu_bacteria 2842395702 2842399044 241
819 iso_pu_bacteria 2842489311 2842492622 241
820 iso_pu_bacteria 2842509118 2842512786 241
821 iso_pu_bacteria 2844454524 2844456201 241
822 iso_pu_bacteria 2857516855 2857521869 241
823 iso_pu_bacteria 2933570622 2933577002 241
824 iso_pu_bacteria 2933586486 2933587341 241
825 iso_pu_bacteria 2935894831 2935896080 241
826 iso_pu_bacteria 2935901341 2935902724 241
827 iso_pu_bacteria 2936367885 2936369130 241
828 iso_pu_bacteria 2936375103 2936377527 241
829 iso_pu_bacteria 8005275841 8005278656 241
830 iso_pu_bacteria 8005282627 8005289190 241
831 iso_pu_bacteria 8005307578 8005310651 241
832 iso_pu_bacteria 8005376324 8005377622 241
833 iso_pu_bacteria 8005484373 8005484831 241
834 iso_pu_bacteria 8005563573 8005564122 241
835 iso_pu_bacteria 8005695170 8005699462 241
836 iso_pu_bacteria 8018127388 8018132913 241
837 iso_pu_bacteria 8018163183 8018165407 241
838 iso_pu_bacteria 8018176218 8018181018 241
839 iso_pu_bacteria 8023680758 8023684437 241
840 iso_pu_bacteria 8024486573 8024491528 241
841 iso_pu_bacteria 8024501048 8024501764 241
842 iso_pu_bacteria 8046767195 8046770821 241
843 iso_pu_bacteria 8057575449 8057580575 241
844 iso_pu_bacteria 8057874678 8057875842 241
845 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001330 242
846 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001130 242
847 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003030 242
848 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001330 242
849 3300025206 Ga0209435_100026 Ga0209435_10002630 242
850 3300025246 Ga0209646_1000084 Ga0209646_100008430 242
851 3300025250 Ga0209026_1000080 Ga0209026_100008030 242
852 3300025256 Ga0209759_1000061 Ga0209759_100006130 242
853 3300046507 Ga0495606_0001337 Ga0495606_0001337_21510_22238 242
854 3300047472 Ga0495686_0016096 Ga0495686_0016096_2878_3606 242
855 3300047472 Ga0495686_0040112 Ga0495686_0040112_2182_2910 242
856 3300048924 Ga0496121_0013386 Ga0496121_0013386_7299_8027 242
857 iso_pu_bacteria 2524023209 2524458244 242
858 iso_pu_bacteria 2617270742 2617380375 242
859 iso_pu_bacteria 2842482326 2842487629 242
860 iso_pu_bacteria 2852387548 2852388356 242
861 iso_pu_bacteria 2919408235 2919408684 242
862 iso_pu_bacteria 3005416602 3005422924 242
863 iso_pu_bacteria 8005314921 8005321540 242
864 iso_pu_bacteria 8056875544 8056877128 242
865 3300003323 rootH1_10130347 rootH1_101303472 244
866 3300001979 JGI24740J21852_10000426 JGI24740J21852_100004262 245
867 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016952 245
868 3300002737 JGI25162J39368_1000698 JGI25162J39368_10006986 245
869 3300003214 JGI25165J46597_1000349 JGI25165J46597_100034923 245
870 3300003214 JGI25165J46597_1000355 JGI25165J46597_10003553 245
871 3300003354 JGI25160J50197_1000041 JGI25160J50197_100004197 245
872 3300003374 JGI25161J50226_1000002 JGI25161J50226_100000297 245
873 3300004625 Ga0055543_1000008 Ga0055543_100000819 245
874 3300005262 Ga0065165_1000031 Ga0065165_1000031110 245
875 3300005548 Ga0070665_100085654 Ga0070665_1000856542 245
876 3300005563 Ga0068855_100086831 Ga0068855_1000868312 245
877 3300005614 Ga0068856_100094550 Ga0068856_1000945502 245
878 3300005834 Ga0068851_10026861 Ga0068851_100268612 245
879 3300009093 Ga0105240_10000460 Ga0105240_1000046069 245
880 3300009545 Ga0105237_10001005 Ga0105237_100010056 245
881 3300010375 Ga0105239_10002984 Ga0105239_1000298419 245
882 3300013104 Ga0157370_10000879 Ga0157370_1000087928 245
883 3300015262 Ga0182007_10003141 Ga0182007_100031415 245
884 3300015265 Ga0182005_1001666 Ga0182005_10016665 245
885 3300025233 Ga0209437_100056 Ga0209437_10005688 245
886 3300025233 Ga0209437_100196 Ga0209437_10019692 245
887 3300025253 Ga0209677_102042 Ga0209677_1020426 245
888 3300025261 Ga0209233_1000037 Ga0209233_1000037470 245
889 3300025261 Ga0209233_1000071 Ga0209233_100007188 245
890 3300025261 Ga0209233_1000243 Ga0209233_100024328 245
891 3300025272 Ga0209455_1009107 Ga0209455_10091072 245
892 3300025272 Ga0209455_1036307 Ga0209455_10363071 245
893 3300025284 Ga0209130_1000382 Ga0209130_100038229 245
894 3300025302 Ga0207426_1000012 Ga0207426_1000012231 245
895 3300025321 Ga0207656_10027931 Ga0207656_100279312 245
896 3300025904 Ga0207647_10274920 Ga0207647_102749201 245
897 3300025913 Ga0207695_10000036 Ga0207695_1000003668 245
898 3300025914 Ga0207671_10000153 Ga0207671_100001536 245
899 3300026078 Ga0207702_10119215 Ga0207702_101192152 245
900 3300026142 Ga0207698_10049414 Ga0207698_100494141 245
901 3300048903 Ga0496100_0035945 Ga0496100_0035945_702_1439 245
902 3300048905 Ga0496102_0006201 Ga0496102_0006201_8601_9338 245
903 3300048906 Ga0496103_0015905 Ga0496103_0015905_3479_4216 245
904 3300048919 Ga0496116_0002602 Ga0496116_0002602_5195_5932 245
905 3300048920 Ga0496117_0001819 Ga0496117_0001819_20329_21066 245
906 3300048921 Ga0496118_0001431 Ga0496118_0001431_24429_25166 245
907 3300048922 Ga0496119_0054477 Ga0496119_0054477_608_1345 245
908 3300048923 Ga0496120_0010487 Ga0496120_0010487_1125_1862 245
909 3300048924 Ga0496121_0002730 Ga0496121_0002730_20061_20798 245
910 3300048925 Ga0496122_0008977 Ga0496122_0008977_1286_2023 245
911 3300048926 Ga0496123_0009204 Ga0496123_0009204_906_1643 245
912 3300048927 Ga0496124_0053734 Ga0496124_0053734_1124_1861 245
913 3300048928 Ga0496125_0020123 Ga0496125_0020123_5343_6080 245
914 3300048928 Ga0496125_0130962 Ga0496125_0130962_398_1138 245
915 3300048929 Ga0496126_0048725 Ga0496126_0048725_1901_2638 245

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

41

178

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dfm-assembly1.cif.gz_A the crystal structure of the zinc inhibited form of teicoplanin deacetylase orf2 0.7381 69 97
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7069 21 238
6nvo-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.7039 21 238
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.6953 21 238
6nvp-assembly1.cif.gz_A crystal structure of pseudomonas putida nuclease mpe 0.6928 21 238
ID Description Score Start End Superfamily
3dfmA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.7381 69 97 3.40.50.10320
af_Q7XA67_1_254_3.40.50.1580 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain 0.7061 72 96 3.40.50.1580
af_Q60344_23_147_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6646 49 160 3.60.21.10
af_Q2G290_1_180_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.664 74 131 3.40.50.2000
af_A0A0R0JB13_452_710_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.6576 71 128 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A258KG66-F1-model_v4 Phosphoesterase 0.9341 32 101
AF-A0A3S1QVR4-F1-model_v4 Metallophosphatase 0.8956 17 160 GO:0016787
AF-A0A4Q3SJX5-F1-model_v4 Ligase-associated DNA damage response endonuclease PdeM (EC 3.1.-.-) 0.8901 21 174 GO:0004519
GO:0016874
AF-A0A259M2T5-F1-model_v4 Metallophosphoesterase 0.8901 21 160 GO:0016787
AF-A0A4Q5TWE3-F1-model_v4 Metallophosphoesterase 0.8901 21 101

Feature Viewer

pLDDT pTM Quality
75.85 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map