F485602
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 915 | 720 | 411 | 240 |
Family's Representative Sequence
| Representative Sequence | 3300046518|Ga0495631_0084809|Ga0495631_0084809_273_1046 |
| Length | 257 |
| Sequence | MNRLALARELNGVAAMPGVETSVHGVAAACDPLGSLYLPDAGILVVSDLHLEKGAAFARRGMMLPPYDTLATLTVLSAVISRYNPKLVVSLGDNFHDRIGSAHLPETFRTLISDMARGREWIWINGNHDPDGTVNLPGSSVDEMCYGGLTFCHAPKSGLQTGEIAGHLHPSATVRRREKSVRRPCFATDGARMLMPAFGVMSGGLDLRHKAMKGLFDHASLIAHLLGRDRIYSVRFGNLASSRPPALKERRSDRPCD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 8 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 9 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 10 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 11 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 12 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 15 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 16 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 17 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 18 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 19 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 20 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 21 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 22 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 23 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 24 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 25 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 26 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 27 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 28 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 29 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 30 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 31 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 32 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 33 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 34 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 35 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 36 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 37 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 38 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 39 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 40 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 41 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 42 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 43 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 44 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 45 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 46 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 47 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 48 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 49 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 50 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 51 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 52 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 53 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 54 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 55 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 56 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 57 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 58 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 59 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 60 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 61 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 62 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 63 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 64 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 65 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 66 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 67 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 68 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 69 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 70 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 71 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 72 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 73 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 74 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 75 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 76 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 77 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 78 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 79 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 80 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 81 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 82 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 83 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 84 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 85 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 86 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 87 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 88 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 89 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 90 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 91 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 92 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 93 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 94 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 95 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 96 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 97 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 98 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 99 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 100 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 101 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 102 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 103 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 104 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 105 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 106 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 107 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 108 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 109 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 110 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 111 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 112 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 113 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 114 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 115 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 116 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 117 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 118 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 119 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 120 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 121 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 122 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 123 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 124 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 125 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 126 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 127 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 128 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 129 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 130 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 131 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 132 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 133 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 134 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 135 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 136 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 137 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 138 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 139 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 140 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 141 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 142 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 143 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 144 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 145 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 146 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 147 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 148 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 149 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 150 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 151 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 152 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 153 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 154 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 155 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 156 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 157 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 158 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 159 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 160 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 161 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 162 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 163 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 164 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 165 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 166 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 167 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 168 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 169 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 170 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 171 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 172 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 173 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 174 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 175 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 176 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 177 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 178 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 179 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 180 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 181 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 182 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 183 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 184 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 185 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 186 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 187 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 188 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 189 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 190 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 191 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 192 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 193 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 194 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 195 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 196 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 197 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 198 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 199 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 200 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 201 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 202 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 203 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 204 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 205 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 206 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 207 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 208 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 209 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 210 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 211 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 212 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 213 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 214 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 215 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 216 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 217 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 218 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 219 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 220 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 221 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 222 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 223 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 224 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 225 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 226 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 227 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 228 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 229 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 230 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 231 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 232 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 233 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 234 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 235 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 236 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 237 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 238 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 239 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 240 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 241 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 242 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 243 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 244 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 245 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 246 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 247 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 248 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 249 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 250 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 251 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 252 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 253 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 254 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 255 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 256 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 257 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 258 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 259 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 260 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 261 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 262 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 263 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 264 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 265 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 266 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 267 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 268 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 269 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 270 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 271 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 272 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 273 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 274 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 275 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 276 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 277 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 278 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 279 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 280 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 281 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 282 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 283 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 284 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 285 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 286 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 287 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 288 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 289 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 290 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 291 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 292 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 293 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 294 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 295 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 296 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 297 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 298 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 299 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 300 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 301 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 302 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 303 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 304 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 305 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 306 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 307 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 308 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 309 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 310 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 311 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 312 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 313 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 314 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 315 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 316 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 317 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 318 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 319 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 320 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 321 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 322 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 323 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 324 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 325 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 326 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 327 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 328 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 329 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 330 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 331 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 332 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 333 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 334 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 335 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 336 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 337 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 338 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 339 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 340 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 341 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 342 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 343 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 344 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 345 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 346 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 347 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 348 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 349 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 350 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 351 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 352 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 353 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 354 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 355 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 356 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 357 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 358 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 359 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 360 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 361 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 362 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 363 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 364 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 365 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 366 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 367 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 368 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 369 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 370 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 371 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 372 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 373 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 374 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 375 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 376 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 377 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 378 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 379 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 380 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 381 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 382 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 383 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 384 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 385 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 386 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 387 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 388 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 389 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 390 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 391 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 392 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 393 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 394 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 395 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 396 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 397 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 398 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 399 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 400 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 401 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 402 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 403 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 404 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 405 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 406 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 407 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 408 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 409 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 410 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 411 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 412 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 413 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 414 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 415 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 416 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 417 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 418 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 419 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 420 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 421 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 422 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 423 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 424 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 425 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 426 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 427 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 428 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 429 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 430 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 431 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 432 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 433 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 434 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 435 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 436 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 437 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 438 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 439 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 440 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 441 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 442 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 443 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 444 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 445 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 446 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 447 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 448 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 449 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 450 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 451 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 452 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 453 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 454 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 455 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 456 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 457 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 458 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 459 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 460 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 461 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 462 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 463 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 464 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 465 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 466 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 467 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 468 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 469 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 470 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 471 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 472 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 473 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 474 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 475 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 476 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 477 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 478 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 479 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 480 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 481 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 482 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 483 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 484 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 485 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 486 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 487 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 488 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 489 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 490 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 491 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 492 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 493 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 494 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 495 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 496 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 497 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 498 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 499 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 500 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 501 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 502 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 503 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 504 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 505 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 506 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 507 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 508 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 509 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 510 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 511 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 512 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 513 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 514 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 515 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 516 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 517 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 518 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 519 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 520 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 521 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 522 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 523 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 524 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 525 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 526 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 527 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 528 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 529 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 530 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 531 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 532 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 533 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 534 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 535 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 536 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 537 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 538 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 539 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 540 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 541 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 542 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 543 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 544 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 545 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 546 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 547 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 548 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 549 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 550 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 551 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 552 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 553 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 554 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 555 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 556 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 557 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 558 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 559 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 560 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 561 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 562 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 563 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 564 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 565 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 566 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 567 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 568 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 569 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 570 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 571 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 572 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 573 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 574 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 575 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 576 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 577 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 578 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 579 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 580 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 581 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 582 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 583 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 584 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 585 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 586 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 631 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 632 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 633 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 634 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 635 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 636 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 637 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 638 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 639 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 640 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 641 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 642 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 643 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 644 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 645 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 646 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 647 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 648 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 649 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 650 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 652 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 654 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 655 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 656 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 657 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 658 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 659 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 661 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 662 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 663 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 664 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 665 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 666 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 667 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 668 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 669 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 670 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 671 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 672 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 673 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 674 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 675 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 676 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 677 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 678 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 679 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 680 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 681 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 682 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 683 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 684 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 685 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 686 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 687 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 688 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 689 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 690 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 691 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 692 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 693 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 694 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 695 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 696 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 697 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 698 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 699 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 700 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 701 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 702 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 703 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 704 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 705 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 706 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 707 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 708 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 709 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 710 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 711 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 712 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 713 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 714 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 715 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 716 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 717 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 718 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 719 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 720 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 44.7 |
| Metatranscriptomes | 0.22 |
| Isolates | 55.08 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 16.94 |
| Nodule | 44.7 |
| Rhizoplane | 1.75 |
| Rhizosphere | 19.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 17.05 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000426 | 3300001979 | Bacteria | 18039 |
| 2 | JGI25155J39150_1000013 | 3300002704 | Bacteria | 198215 |
| 3 | JGI25156J39149_1000011 | 3300002705 | Bacteria | 198215 |
| 4 | JGI25162J39368_1000169 | 3300002737 | Bacteria | 72114 |
| 5 | JGI25162J39368_1000698 | 3300002737 | Bacteria | 23303 |
| 6 | JGI25154J39366_1000030 | 3300002738 | Bacteria | 191444 |
| 7 | JGI25158J39367_1000090 | 3300002739 | Bacteria | 21062 |
| 8 | JGI25157J39369_1000013 | 3300002741 | Bacteria | 198211 |
| 9 | JGI25152J39213_1000246 | 3300002773 | Bacteria | 36282 |
| 10 | JGI25152J39213_1000500 | 3300002773 | Bacteria | 22005 |
| 11 | JGI25152J39213_1016171 | 3300002773 | Bacteria | 1448 |
| 12 | JGI25152J39213_1016174 | 3300002773 | Bacteria | 1448 |
| 13 | JGI25150J39212_1000118 | 3300002774 | Bacteria | 44311 |
| 14 | JGI25150J39212_1004187 | 3300002774 | Bacteria | 3249 |
| 15 | JGI25150J39212_1005928 | 3300002774 | Bacteria | 2568 |
| 16 | JGI25159J45721_1000003 | 3300002987 | Bacteria | 274069 |
| 17 | JGI25159J45721_1000942 | 3300002987 | Bacteria | 12699 |
| 18 | JGI25151J46595_10000110 | 3300003187 | Bacteria | 111972 |
| 19 | JGI25151J46595_10000681 | 3300003187 | Bacteria | 28706 |
| 20 | JGI25151J46595_10003279 | 3300003187 | Bacteria | 8999 |
| 21 | JGI25151J46595_10008982 | 3300003187 | Bacteria | 4765 |
| 22 | JGI25165J46597_1000349 | 3300003214 | Bacteria | 52229 |
| 23 | JGI25165J46597_1000355 | 3300003214 | Bacteria | 51475 |
| 24 | JGI25153J46596_10000482 | 3300003215 | Bacteria | 25561 |
| 25 | JGI25153J46596_10035651 | 3300003215 | Bacteria | 1608 |
| 26 | JGI25153J46596_10040347 | 3300003215 | Bacteria | 1448 |
| 27 | JGI25153J46596_10040373 | 3300003215 | Bacteria | 1448 |
| 28 | JGI25153J46596_10047850 | 3300003215 | Bacteria | 1254 |
| 29 | rootH1_10043182 | 3300003316 | Bacteria | 1402 |
| 30 | rootL2_10235986 | 3300003322 | Bacteria | 1381 |
| 31 | rootH1_10130347 | 3300003323 | Bacteria | 2250 |
| 32 | JGI25160J50197_1000003 | 3300003354 | Bacteria | 482719 |
| 33 | JGI25160J50197_1000041 | 3300003354 | Bacteria | 152843 |
| 34 | JGI25160J50197_1000514 | 3300003354 | Bacteria | 22846 |
| 35 | JGI25160J50197_1011969 | 3300003354 | Bacteria | 3041 |
| 36 | JGI25161J50226_1000002 | 3300003374 | Bacteria | 420324 |
| 37 | JGI25161J50226_1000184 | 3300003374 | Bacteria | 41591 |
| 38 | JGI25161J50226_1000270 | 3300003374 | Bacteria | 30355 |
| 39 | JGI25161J50226_1004678 | 3300003374 | Bacteria | 2814 |
| 40 | Ga0006562J51391_1024010 | 3300003578 | Bacteria | 1107 |
| 41 | Ga0055526_1000725 | 3300003771 | Bacteria | 24927 |
| 42 | Ga0055526_1002842 | 3300003771 | Bacteria | 11434 |
| 43 | Ga0055526_1004258 | 3300003771 | Bacteria | 8668 |
| 44 | Ga0055526_1017123 | 3300003771 | Bacteria | 2791 |
| 45 | Ga0055524_1002851 | 3300003775 | Bacteria | 8668 |
| 46 | Ga0055524_1006954 | 3300003775 | Bacteria | 4865 |
| 47 | Ga0055524_1015572 | 3300003775 | Bacteria | 2765 |
| 48 | Ga0055524_1018417 | 3300003775 | Bacteria | 2426 |
| 49 | Ga0055536_1019078 | 3300003781 | Bacteria | 2170 |
| 50 | Ga0055528_1000095 | 3300003790 | Bacteria | 70572 |
| 51 | Ga0055528_1000618 | 3300003790 | Bacteria | 26522 |
| 52 | Ga0055528_1015870 | 3300003790 | Bacteria | 2694 |
| 53 | Ga0055528_1021492 | 3300003790 | Bacteria | 2046 |
| 54 | Ga0055528_1023363 | 3300003790 | Bacteria | 1889 |
| 55 | Ga0055540_1000190 | 3300003792 | Bacteria | 59767 |
| 56 | Ga0055540_1007520 | 3300003792 | Bacteria | 4091 |
| 57 | Ga0055531_10005539 | 3300003794 | Bacteria | 7371 |
| 58 | Ga0058692_1017409 | 3300003856 | Bacteria | 1578 |
| 59 | Ga0055543_1000008 | 3300004625 | Bacteria | 202062 |
| 60 | Ga0055543_1000059 | 3300004625 | Bacteria | 100942 |
| 61 | Ga0055543_1000299 | 3300004625 | Bacteria | 35254 |
| 62 | Ga0055543_1003650 | 3300004625 | Bacteria | 4438 |
| 63 | Ga0065165_1000031 | 3300005262 | Bacteria | 216330 |
| 64 | Ga0065165_1000084 | 3300005262 | Bacteria | 154822 |
| 65 | Ga0065165_1012356 | 3300005262 | Bacteria | 3483 |
| 66 | Ga0065165_1040779 | 3300005262 | Bacteria | 1381 |
| 67 | Ga0070670_100000160 | 3300005331 | Bacteria | 61135 |
| 68 | Ga0070671_100027922 | 3300005355 | Bacteria | 4646 |
| 69 | Ga0070667_100181766 | 3300005367 | Bacteria | 1860 |
| 70 | Ga0070665_100085654 | 3300005548 | Bacteria | 3157 |
| 71 | Ga0070665_100136036 | 3300005548 | Bacteria | 2460 |
| 72 | Ga0068855_100086831 | 3300005563 | Bacteria | 3617 |
| 73 | Ga0068856_100094550 | 3300005614 | Bacteria | 2976 |
| 74 | Ga0068851_10026861 | 3300005834 | Bacteria | 2832 |
| 75 | Ga0068862_100147624 | 3300005844 | Bacteria | 2091 |
| 76 | Ga0075365_10003496 | 3300006038 | Bacteria | 8115 |
| 77 | Ga0075365_10007830 | 3300006038 | Bacteria | 6019 |
| 78 | Ga0075368_10034448 | 3300006042 | Bacteria | 1973 |
| 79 | Ga0075362_10007175 | 3300006177 | Bacteria | 4203 |
| 80 | Ga0075367_10033635 | 3300006178 | Bacteria | 2956 |
| 81 | Ga0075369_10008457 | 3300006186 | Bacteria | 3959 |
| 82 | Ga0075366_10019959 | 3300006195 | Bacteria | 3884 |
| 83 | Ga0075370_10148964 | 3300006353 | Bacteria | 1371 |
| 84 | Ga0105251_10057758 | 3300009011 | Bacteria | 1833 |
| 85 | Ga0105244_10157911 | 3300009036 | Bacteria | 1084 |
| 86 | Ga0105240_10000460 | 3300009093 | Bacteria | 74956 |
| 87 | Ga0105237_10001005 | 3300009545 | Bacteria | 37989 |
| 88 | Ga0123341_1000067 | 3300009765 | Bacteria | 44232 |
| 89 | Ga0123341_1068588 | 3300009765 | Bacteria | 1585 |
| 90 | Ga0123342_1010893 | 3300009766 | Bacteria | 10210 |
| 91 | Ga0105239_10002984 | 3300010375 | Bacteria | 21103 |
| 92 | Ga0157370_10000879 | 3300013104 | Bacteria | 38163 |
| 93 | Ga0171463_1001 | 3300013249 | Bacteria | 1406070 |
| 94 | Ga0182008_10294383 | 3300014497 | Bacteria | 848 |
| 95 | Ga0182007_10003141 | 3300015262 | Bacteria | 7939 |
| 96 | Ga0182005_1001666 | 3300015265 | Bacteria | 8631 |
| 97 | Ga0183363_1134 | 3300015690 | Bacteria | 18899 |
| 98 | Ga0214542_1001074 | 3300021321 | Bacteria | 54628 |
| 99 | Ga0214542_1025837 | 3300021321 | Bacteria | 2983 |
| 100 | Ga0214543_1000027 | 3300021327 | Bacteria | 215065 |
| 101 | Ga0214543_1000897 | 3300021327 | Bacteria | 54534 |
| 102 | Ga0228711_1000041 | 3300022739 | Bacteria | 86591 |
| 103 | Ga0228710_1000024 | 3300022740 | Bacteria | 106694 |
| 104 | Ga0209435_100026 | 3300025206 | Bacteria | 198295 |
| 105 | Ga0209436_100006 | 3300025208 | Bacteria | 150277 |
| 106 | Ga0209436_100836 | 3300025208 | Bacteria | 12445 |
| 107 | Ga0209437_100056 | 3300025233 | Bacteria | 363071 |
| 108 | Ga0209437_100196 | 3300025233 | Bacteria | 121199 |
| 109 | Ga0207425_1000012 | 3300025245 | Bacteria | 528324 |
| 110 | Ga0207425_1002717 | 3300025245 | Bacteria | 6028 |
| 111 | Ga0207425_1006821 | 3300025245 | Bacteria | 3085 |
| 112 | Ga0209646_1000084 | 3300025246 | Bacteria | 198295 |
| 113 | Ga0209026_1000080 | 3300025250 | Bacteria | 198295 |
| 114 | Ga0209677_102042 | 3300025253 | Bacteria | 7993 |
| 115 | Ga0209759_1000061 | 3300025256 | Bacteria | 198295 |
| 116 | Ga0209129_1000105 | 3300025258 | Bacteria | 159104 |
| 117 | Ga0209129_1000110 | 3300025258 | Bacteria | 150918 |
| 118 | Ga0209129_1000429 | 3300025258 | Bacteria | 31758 |
| 119 | Ga0209129_1001484 | 3300025258 | Bacteria | 13035 |
| 120 | Ga0209129_1001523 | 3300025258 | Bacteria | 12805 |
| 121 | Ga0209129_1001602 | 3300025258 | Bacteria | 12337 |
| 122 | Ga0209129_1002388 | 3300025258 | Bacteria | 9244 |
| 123 | Ga0209233_1000037 | 3300025261 | Bacteria | 554620 |
| 124 | Ga0209233_1000071 | 3300025261 | Bacteria | 363290 |
| 125 | Ga0209233_1000243 | 3300025261 | Bacteria | 90170 |
| 126 | Ga0209455_1009107 | 3300025272 | Bacteria | 2635 |
| 127 | Ga0209455_1036307 | 3300025272 | Bacteria | 785 |
| 128 | Ga0209673_1000015 | 3300025273 | Bacteria | 530618 |
| 129 | Ga0209673_1000063 | 3300025273 | Bacteria | 256709 |
| 130 | Ga0209673_1001004 | 3300025273 | Bacteria | 34285 |
| 131 | Ga0209673_1002293 | 3300025273 | Bacteria | 13648 |
| 132 | Ga0209673_1003895 | 3300025273 | Bacteria | 8398 |
| 133 | Ga0209673_1006202 | 3300025273 | Bacteria | 5837 |
| 134 | Ga0209673_1012901 | 3300025273 | Bacteria | 3332 |
| 135 | Ga0209673_1056919 | 3300025273 | Bacteria | 998 |
| 136 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 137 | Ga0209130_1000005 | 3300025284 | Bacteria | 599620 |
| 138 | Ga0209130_1000382 | 3300025284 | Bacteria | 49448 |
| 139 | Ga0209676_1033105 | 3300025292 | Bacteria | 1545 |
| 140 | Ga0209025_1000024 | 3300025294 | Bacteria | 528324 |
| 141 | Ga0209025_1000037 | 3300025294 | Bacteria | 383429 |
| 142 | Ga0209025_1000295 | 3300025294 | Bacteria | 111489 |
| 143 | Ga0209025_1000638 | 3300025294 | Bacteria | 61892 |
| 144 | Ga0209025_1003060 | 3300025294 | Bacteria | 16457 |
| 145 | Ga0209025_1012788 | 3300025294 | Bacteria | 5340 |
| 146 | Ga0209025_1013101 | 3300025294 | Bacteria | 5241 |
| 147 | Ga0209025_1042695 | 3300025294 | Bacteria | 1922 |
| 148 | Ga0209564_1000093 | 3300025295 | Bacteria | 245793 |
| 149 | Ga0209564_1000316 | 3300025295 | Bacteria | 94849 |
| 150 | Ga0209564_1004460 | 3300025295 | Bacteria | 8554 |
| 151 | Ga0209564_1008398 | 3300025295 | Bacteria | 5100 |
| 152 | Ga0209564_1029360 | 3300025295 | Bacteria | 1733 |
| 153 | Ga0209758_1000150 | 3300025297 | Bacteria | 163494 |
| 154 | Ga0209758_1000361 | 3300025297 | Bacteria | 81006 |
| 155 | Ga0209758_1000499 | 3300025297 | Bacteria | 63732 |
| 156 | Ga0209758_1000876 | 3300025297 | Bacteria | 41358 |
| 157 | Ga0209758_1001299 | 3300025297 | Bacteria | 30604 |
| 158 | Ga0209758_1002582 | 3300025297 | Bacteria | 18177 |
| 159 | Ga0209758_1007691 | 3300025297 | Bacteria | 7240 |
| 160 | Ga0209758_1014373 | 3300025297 | Bacteria | 4216 |
| 161 | Ga0209050_1011207 | 3300025298 | Bacteria | 4289 |
| 162 | Ga0209050_1019868 | 3300025298 | Bacteria | 2530 |
| 163 | Ga0209256_1000027 | 3300025299 | Bacteria | 423283 |
| 164 | Ga0209256_1000880 | 3300025299 | Bacteria | 37115 |
| 165 | Ga0209256_1001669 | 3300025299 | Bacteria | 21569 |
| 166 | Ga0209256_1002179 | 3300025299 | Bacteria | 16813 |
| 167 | Ga0209256_1005310 | 3300025299 | Bacteria | 7498 |
| 168 | Ga0209256_1005901 | 3300025299 | Bacteria | 6775 |
| 169 | Ga0209256_1006338 | 3300025299 | Bacteria | 6314 |
| 170 | Ga0209256_1016791 | 3300025299 | Bacteria | 2471 |
| 171 | Ga0209256_1044286 | 3300025299 | Bacteria | 1112 |
| 172 | Ga0207426_1000012 | 3300025302 | Bacteria | 730942 |
| 173 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 174 | Ga0207426_1000015 | 3300025302 | Bacteria | 599316 |
| 175 | Ga0207426_1000070 | 3300025302 | Bacteria | 331559 |
| 176 | Ga0207426_1001614 | 3300025302 | Bacteria | 17860 |
| 177 | Ga0209051_1000135 | 3300025303 | Bacteria | 138142 |
| 178 | Ga0209051_1006292 | 3300025303 | Bacteria | 6727 |
| 179 | Ga0209051_1055969 | 3300025303 | Bacteria | 1276 |
| 180 | Ga0209051_1064569 | 3300025303 | Bacteria | 1134 |
| 181 | Ga0209257_1005318 | 3300025304 | Bacteria | 9131 |
| 182 | Ga0209257_1029056 | 3300025304 | Bacteria | 1807 |
| 183 | Ga0207656_10027931 | 3300025321 | Bacteria | 2312 |
| 184 | Ga0207647_10274920 | 3300025904 | Bacteria | 962 |
| 185 | Ga0207695_10000036 | 3300025913 | Bacteria | 477897 |
| 186 | Ga0207671_10000153 | 3300025914 | Bacteria | 107114 |
| 187 | Ga0207650_10000776 | 3300025925 | Bacteria | 24570 |
| 188 | Ga0207711_10167094 | 3300025941 | Bacteria | 1995 |
| 189 | Ga0207658_10277195 | 3300025986 | Bacteria | 1436 |
| 190 | Ga0207702_10119215 | 3300026078 | Bacteria | 2359 |
| 191 | Ga0207698_10049414 | 3300026142 | Bacteria | 3201 |
| 192 | Ga0209281_1000409 | 3300027111 | Bacteria | 65132 |
| 193 | Ga0209281_1000520 | 3300027111 | Bacteria | 49942 |
| 194 | Ga0209371_1000009 | 3300027312 | Bacteria | 963030 |
| 195 | Ga0209371_1000424 | 3300027312 | Bacteria | 43444 |
| 196 | Ga0209282_1000090 | 3300027666 | Bacteria | 65132 |
| 197 | Ga0209813_10115148 | 3300027866 | Bacteria | 930 |
| 198 | Ga0268266_10119922 | 3300028379 | Bacteria | 2340 |
| 199 | Ga0268265_10853713 | 3300028380 | Bacteria | 891 |
| 200 | Ga0307515_10000674 | 3300028794 | Bacteria | 78735 |
| 201 | Ga0307515_10006511 | 3300028794 | Bacteria | 23364 |
| 202 | Ga0307515_10012267 | 3300028794 | Bacteria | 16136 |
| 203 | Ga0307515_10148902 | 3300028794 | Bacteria | 2460 |
| 204 | Ga0268256_1000010 | 3300030500 | Bacteria | 963034 |
| 205 | Ga0307513_10000180 | 3300031456 | Bacteria | 91340 |
| 206 | Ga0307513_10236576 | 3300031456 | Bacteria | 1635 |
| 207 | Ga0307405_10000250 | 3300031731 | Bacteria | 19640 |
| 208 | Ga0307406_10002749 | 3300031901 | Bacteria | 9606 |
| 209 | Ga0307412_10000491 | 3300031911 | Bacteria | 23628 |
| 210 | Ga0307412_10527791 | 3300031911 | Bacteria | 987 |
| 211 | Ga0315914_1000167 | 3300031967 | Bacteria | 65125 |
| 212 | Ga0307416_100620524 | 3300032002 | Bacteria | 1163 |
| 213 | Ga0307414_10727507 | 3300032004 | Bacteria | 900 |
| 214 | Ga0315913_1000038 | 3300033430 | Bacteria | 64995 |
| 215 | Ga0315915_1000019 | 3300033464 | Bacteria | 129295 |
| 216 | Ga0439439_0027122 | 3300041406 | Bacteria | 1446 |
| 217 | Ga0439447_022451 | 3300041407 | Bacteria | 1652 |
| 218 | Ga0439465_0004487 | 3300041413 | Bacteria | 4513 |
| 219 | Ga0439465_0019725 | 3300041413 | Bacteria | 2109 |
| 220 | Ga0451787_252007 | 3300041441 | Bacteria | 2811 |
| 221 | Ga0451791_0180341 | 3300041451 | Bacteria | 2156 |
| 222 | Ga0451835_0388755 | 3300041492 | Bacteria | 1025 |
| 223 | Ga0451837_0526223 | 3300041494 | Bacteria | 1068 |
| 224 | Ga0451839_0199143 | 3300041496 | Bacteria | 3301 |
| 225 | Ga0451841_1408368 | 3300041498 | Bacteria | 1065 |
| 226 | Ga0451845_0150991 | 3300041501 | Bacteria | 1336 |
| 227 | Ga0451847_0236407 | 3300041503 | Bacteria | 1377 |
| 228 | Ga0451851_0308271 | 3300041507 | Bacteria | 1712 |
| 229 | Ga0451843_1263341 | 3300041509 | Bacteria | 1403 |
| 230 | Ga0451855_2061497 | 3300041511 | Bacteria | 1653 |
| 231 | Ga0451853_3650313 | 3300041512 | Bacteria | 1721 |
| 232 | Ga0439462_0011595 | 3300042015 | Bacteria | 2246 |
| 233 | Ga0466966_0095761 | 3300044684 | Bacteria | 1839 |
| 234 | Ga0466963_0003933 | 3300044694 | Bacteria | 8589 |
| 235 | Ga0466964_0085405 | 3300044706 | Bacteria | 1363 |
| 236 | Ga0466970_0002858 | 3300044765 | Bacteria | 8347 |
| 237 | Ga0466957_0052900 | 3300044842 | Bacteria | 2474 |
| 238 | Ga0466958_0253842 | 3300045836 | Bacteria | 1125 |
| 239 | Ga0466967_0214337 | 3300045976 | Bacteria | 1827 |
| 240 | Ga0495592_0186801 | 3300046454 | Bacteria | 1407 |
| 241 | Ga0495590_0186407 | 3300046457 | Bacteria | 760 |
| 242 | Ga0495629_0012377 | 3300046459 | Bacteria | 6178 |
| 243 | Ga0495638_0020006 | 3300046460 | Bacteria | 4424 |
| 244 | Ga0495605_0024123 | 3300046474 | Bacteria | 3187 |
| 245 | Ga0495639_0125449 | 3300046475 | Bacteria | 1227 |
| 246 | Ga0495662_0012312 | 3300046476 | Bacteria | 4175 |
| 247 | Ga0495585_0009240 | 3300046492 | Bacteria | 5928 |
| 248 | Ga0495607_0018739 | 3300046501 | Bacteria | 4403 |
| 249 | Ga0495583_0003772 | 3300046506 | Bacteria | 11259 |
| 250 | Ga0495606_0001337 | 3300046507 | Bacteria | 33546 |
| 251 | Ga0495606_0164468 | 3300046507 | Bacteria | 1292 |
| 252 | Ga0495606_0184566 | 3300046507 | Bacteria | 1200 |
| 253 | Ga0495606_0399359 | 3300046507 | Bacteria | 716 |
| 254 | Ga0495610_0000461 | 3300046512 | Bacteria | 42001 |
| 255 | Ga0495610_0118502 | 3300046512 | Bacteria | 1163 |
| 256 | Ga0495618_0250994 | 3300046514 | Bacteria | 1110 |
| 257 | Ga0495620_0067648 | 3300046515 | Bacteria | 1469 |
| 258 | Ga0495620_0115391 | 3300046515 | Bacteria | 1062 |
| 259 | Ga0495620_0139721 | 3300046515 | Bacteria | 947 |
| 260 | Ga0495631_0019196 | 3300046518 | Bacteria | 3208 |
| 261 | Ga0495631_0084809 | 3300046518 | Bacteria | 1365 |
| 262 | Ga0495632_0006289 | 3300046519 | Bacteria | 7672 |
| 263 | Ga0495632_0070468 | 3300046519 | Bacteria | 1681 |
| 264 | Ga0495643_0008921 | 3300046522 | Bacteria | 6302 |
| 265 | Ga0495643_0050571 | 3300046522 | Bacteria | 2238 |
| 266 | Ga0495648_0037751 | 3300046524 | Bacteria | 3100 |
| 267 | Ga0495652_0196599 | 3300046529 | Bacteria | 1534 |
| 268 | Ga0495587_0068202 | 3300046536 | Bacteria | 2072 |
| 269 | Ga0495609_0047847 | 3300046538 | Bacteria | 1913 |
| 270 | Ga0495633_0046861 | 3300046558 | Bacteria | 2044 |
| 271 | Ga0495633_0073927 | 3300046558 | Bacteria | 1589 |
| 272 | Ga0495656_0018785 | 3300046615 | Bacteria | 2661 |
| 273 | Ga0495668_0097091 | 3300046616 | Bacteria | 1612 |
| 274 | Ga0495668_0216647 | 3300046616 | Bacteria | 1048 |
| 275 | Ga0495634_0128294 | 3300046642 | Bacteria | 1619 |
| 276 | Ga0495625_0026846 | 3300046660 | Bacteria | 4343 |
| 277 | Ga0495625_0250888 | 3300046660 | Bacteria | 1149 |
| 278 | Ga0495635_0057071 | 3300046663 | Bacteria | 2687 |
| 279 | Ga0495661_0100588 | 3300046665 | Bacteria | 1628 |
| 280 | Ga0495661_0125309 | 3300046665 | Bacteria | 1414 |
| 281 | Ga0495661_0201396 | 3300046665 | Bacteria | 1042 |
| 282 | Ga0495661_0240021 | 3300046665 | Bacteria | 930 |
| 283 | Ga0495588_0030848 | 3300046674 | Bacteria | 2696 |
| 284 | Ga0495588_0031208 | 3300046674 | Bacteria | 2681 |
| 285 | Ga0495623_0180036 | 3300046679 | Bacteria | 1229 |
| 286 | Ga0495646_0160553 | 3300046680 | Bacteria | 1245 |
| 287 | Ga0495613_0604123 | 3300046689 | Bacteria | 730 |
| 288 | Ga0495624_0166998 | 3300046690 | Bacteria | 1343 |
| 289 | Ga0495670_0182377 | 3300046691 | Bacteria | 1109 |
| 290 | Ga0495670_0262256 | 3300046691 | Bacteria | 922 |
| 291 | Ga0495649_0173544 | 3300046694 | Bacteria | 1127 |
| 292 | Ga0495589_0189453 | 3300046794 | Bacteria | 974 |
| 293 | Ga0495600_0016251 | 3300046809 | Bacteria | 4720 |
| 294 | Ga0495660_0077835 | 3300046810 | Bacteria | 1744 |
| 295 | Ga0495660_0156043 | 3300046810 | Bacteria | 1123 |
| 296 | Ga0495672_0150290 | 3300047320 | Bacteria | 1208 |
| 297 | Ga0495687_068328 | 3300047443 | Bacteria | 1435 |
| 298 | Ga0495679_090652 | 3300047446 | Bacteria | 858 |
| 299 | Ga0495681_0106643 | 3300047470 | Bacteria | 1218 |
| 300 | Ga0495686_0014419 | 3300047472 | Bacteria | 5439 |
| 301 | Ga0495686_0016096 | 3300047472 | Bacteria | 5083 |
| 302 | Ga0495686_0040112 | 3300047472 | Bacteria | 2988 |
| 303 | Ga0495686_0125744 | 3300047472 | Bacteria | 1524 |
| 304 | Ga0495626_0123295 | 3300048091 | Bacteria | 1112 |
| 305 | Ga0496100_0035945 | 3300048903 | Bacteria | 3120 |
| 306 | Ga0496101_0576949 | 3300048904 | Bacteria | 889 |
| 307 | Ga0496102_0006201 | 3300048905 | Bacteria | 10188 |
| 308 | Ga0496102_0409297 | 3300048905 | Bacteria | 1274 |
| 309 | Ga0496103_0015905 | 3300048906 | Bacteria | 4485 |
| 310 | Ga0496104_0081774 | 3300048907 | Bacteria | 3080 |
| 311 | Ga0496105_0179781 | 3300048908 | Bacteria | 1732 |
| 312 | Ga0496106_0004867 | 3300048909 | Bacteria | 9942 |
| 313 | Ga0496106_0409795 | 3300048909 | Bacteria | 1089 |
| 314 | Ga0496111_0177519 | 3300048914 | Bacteria | 1583 |
| 315 | Ga0496113_0253089 | 3300048916 | Bacteria | 1406 |
| 316 | Ga0496116_0001406 | 3300048919 | Bacteria | 27038 |
| 317 | Ga0496116_0002602 | 3300048919 | Bacteria | 18765 |
| 318 | Ga0496116_0004126 | 3300048919 | Bacteria | 13997 |
| 319 | Ga0496116_0058538 | 3300048919 | Bacteria | 2511 |
| 320 | Ga0496116_0103637 | 3300048919 | Bacteria | 1692 |
| 321 | Ga0496116_0194716 | 3300048919 | Bacteria | 1068 |
| 322 | Ga0496116_0206798 | 3300048919 | Bacteria | 1021 |
| 323 | Ga0496117_0001819 | 3300048920 | Bacteria | 28947 |
| 324 | Ga0496117_0014921 | 3300048920 | Bacteria | 6660 |
| 325 | Ga0496117_0018471 | 3300048920 | Bacteria | 5770 |
| 326 | Ga0496117_0023539 | 3300048920 | Bacteria | 4902 |
| 327 | Ga0496117_0128717 | 3300048920 | Bacteria | 1539 |
| 328 | Ga0496118_0001431 | 3300048921 | Bacteria | 35926 |
| 329 | Ga0496118_0008398 | 3300048921 | Bacteria | 10682 |
| 330 | Ga0496118_0016889 | 3300048921 | Bacteria | 6668 |
| 331 | Ga0496118_0172845 | 3300048921 | Bacteria | 1317 |
| 332 | Ga0496119_0054477 | 3300048922 | Bacteria | 2434 |
| 333 | Ga0496119_0130450 | 3300048922 | Bacteria | 1370 |
| 334 | Ga0496120_0010487 | 3300048923 | Bacteria | 6460 |
| 335 | Ga0496120_0075515 | 3300048923 | Bacteria | 1839 |
| 336 | Ga0496120_0130402 | 3300048923 | Bacteria | 1288 |
| 337 | Ga0496121_0002730 | 3300048924 | Bacteria | 26286 |
| 338 | Ga0496121_0013386 | 3300048924 | Bacteria | 8822 |
| 339 | Ga0496121_0020076 | 3300048924 | Bacteria | 6638 |
| 340 | Ga0496121_0022942 | 3300048924 | Bacteria | 6030 |
| 341 | Ga0496121_0082337 | 3300048924 | Bacteria | 2544 |
| 342 | Ga0496121_0158392 | 3300048924 | Bacteria | 1658 |
| 343 | Ga0496121_0215321 | 3300048924 | Bacteria | 1357 |
| 344 | Ga0496121_0251863 | 3300048924 | Bacteria | 1224 |
| 345 | Ga0496121_0252702 | 3300048924 | Bacteria | 1221 |
| 346 | Ga0496121_0368336 | 3300048924 | Bacteria | 951 |
| 347 | Ga0496122_0000147 | 3300048925 | Bacteria | 165589 |
| 348 | Ga0496122_0008977 | 3300048925 | Bacteria | 10628 |
| 349 | Ga0496122_0011942 | 3300048925 | Bacteria | 8717 |
| 350 | Ga0496122_0094906 | 3300048925 | Bacteria | 2017 |
| 351 | Ga0496122_0113149 | 3300048925 | Bacteria | 1774 |
| 352 | Ga0496122_0113242 | 3300048925 | Bacteria | 1773 |
| 353 | Ga0496122_0126887 | 3300048925 | Bacteria | 1631 |
| 354 | Ga0496122_0164022 | 3300048925 | Bacteria | 1350 |
| 355 | Ga0496122_0238193 | 3300048925 | Bacteria | 1028 |
| 356 | Ga0496123_0000339 | 3300048926 | Bacteria | 88118 |
| 357 | Ga0496123_0009204 | 3300048926 | Bacteria | 8926 |
| 358 | Ga0496123_0081375 | 3300048926 | Bacteria | 1968 |
| 359 | Ga0496123_0122457 | 3300048926 | Bacteria | 1459 |
| 360 | Ga0496123_0265895 | 3300048926 | Bacteria | 837 |
| 361 | Ga0496124_0000513 | 3300048927 | Bacteria | 66793 |
| 362 | Ga0496124_0002549 | 3300048927 | Bacteria | 23643 |
| 363 | Ga0496124_0025777 | 3300048927 | Bacteria | 5316 |
| 364 | Ga0496124_0053734 | 3300048927 | Bacteria | 3412 |
| 365 | Ga0496124_0307216 | 3300048927 | Bacteria | 1142 |
| 366 | Ga0496125_0000299 | 3300048928 | Bacteria | 97532 |
| 367 | Ga0496125_0001813 | 3300048928 | Bacteria | 29493 |
| 368 | Ga0496125_0009396 | 3300048928 | Bacteria | 10057 |
| 369 | Ga0496125_0020123 | 3300048928 | Bacteria | 6274 |
| 370 | Ga0496125_0130962 | 3300048928 | Bacteria | 1766 |
| 371 | Ga0496125_0239752 | 3300048928 | Bacteria | 1152 |
| 372 | Ga0496125_0442100 | 3300048928 | Bacteria | 747 |
| 373 | Ga0496126_0000380 | 3300048929 | Bacteria | 92061 |
| 374 | Ga0496126_0018987 | 3300048929 | Bacteria | 6789 |
| 375 | Ga0496126_0048725 | 3300048929 | Bacteria | 3870 |
| 376 | Ga0496126_0093859 | 3300048929 | Bacteria | 2634 |
| 377 | Ga0496126_0397111 | 3300048929 | Bacteria | 1119 |
| 378 | Ga0496126_0434326 | 3300048929 | Bacteria | 1059 |
| 379 | Ga0496126_0552677 | 3300048929 | Bacteria | 913 |
| 380 | Ga0495678_048231 | 3300049459 | Bacteria | 1662 |
| 381 | Ga0501032_0076997 | 3300049569 | Bacteria | 2220 |
| 382 | Ga0501034_0393480 | 3300049571 | Bacteria | 1309 |
| 383 | Ga0501036_0479877 | 3300049572 | Bacteria | 1035 |
| 384 | Ga0501037_0017214 | 3300049573 | Bacteria | 5321 |
| 385 | Ga0501037_0101909 | 3300049573 | Bacteria | 2071 |
| 386 | Ga0501038_0021186 | 3300049574 | Bacteria | 5839 |
| 387 | Ga0501038_0098497 | 3300049574 | Bacteria | 2438 |
| 388 | Ga0501043_0025894 | 3300049579 | Bacteria | 4602 |
| 389 | Ga0501047_0291556 | 3300049581 | Bacteria | 1475 |
| 390 | Ga0501047_0474043 | 3300049581 | Bacteria | 1080 |
| 391 | Ga0501048_0426182 | 3300049582 | Bacteria | 949 |
| 392 | Ga0501083_0197816 | 3300049744 | Bacteria | 1311 |
| 393 | Ga0501083_0273715 | 3300049744 | Bacteria | 1098 |
| 394 | Ga0501044_0061070 | 3300049823 | Bacteria | 3857 |
| 395 | nmdc:mga03683_14045_c1 | 3300050489 | Bacteria | 2957 |
| 396 | nmdc:mga0sz30_153158_c1 | 3300050516 | Bacteria | 1020 |
| 397 | Ga0500578_0280382 | 3300053086 | Bacteria | 994 |
| 398 | Ga0500658_0001142 | 3300053134 | Bacteria | 10833 |
| 399 | Ga0500568_0004265 | 3300053139 | Bacteria | 7683 |
| 400 | Ga0500568_0011577 | 3300053139 | Bacteria | 4084 |
| 401 | Ga0500573_0001761 | 3300053140 | Bacteria | 10530 |
| 402 | Ga0500573_0028647 | 3300053140 | Bacteria | 3208 |
| 403 | Ga0500590_005274 | 3300053148 | Bacteria | 6206 |
| 404 | Ga0500604_0039960 | 3300053151 | Bacteria | 1412 |
| 405 | Ga0500616_0014549 | 3300053153 | Bacteria | 4519 |
| 406 | Ga0500616_0127806 | 3300053153 | Bacteria | 1204 |
| 407 | Ga0500622_0002165 | 3300053156 | Bacteria | 14555 |
| 408 | Ga0500622_0033119 | 3300053156 | Bacteria | 2709 |
| 409 | Ga0500633_0030243 | 3300053160 | Bacteria | 1739 |
| 410 | Ga0587068_011792 | 3300059641 | Bacteria | 1325 |
| 411 | Ga0466962_0033587 | 3300061719 | Bacteria | 2455 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046507 | Ga0495606_0399359 | Ga0495606_0399359_63_704 | 213 |
| 2 | 3300047446 | Ga0495679_090652 | Ga0495679_090652_207_848 | 213 |
| 3 | 3300049569 | Ga0501032_0076997 | Ga0501032_0076997_492_1217 | 218 |
| 4 | 3300049573 | Ga0501037_0101909 | Ga0501037_0101909_451_1176 | 218 |
| 5 | 3300049574 | Ga0501038_0021186 | Ga0501038_0021186_4446_5171 | 218 |
| 6 | 3300049579 | Ga0501043_0025894 | Ga0501043_0025894_3243_3968 | 218 |
| 7 | 3300049581 | Ga0501047_0474043 | Ga0501047_0474043_46_771 | 218 |
| 8 | 3300048929 | Ga0496126_0018987 | Ga0496126_0018987_3130_3855 | 221 |
| 9 | iso_pu_bacteria | 2643221634 | 2644190406 | 222 |
| 10 | iso_pu_bacteria | 2718217997 | 2719663735 | 222 |
| 11 | iso_pu_bacteria | 2718218199 | 2720490154 | 222 |
| 12 | iso_pu_bacteria | 2718218232 | 2720611535 | 222 |
| 13 | iso_pu_bacteria | 2718218235 | 2720629791 | 222 |
| 14 | iso_pu_bacteria | 2718218269 | 2720773486 | 222 |
| 15 | iso_pu_bacteria | 2721755556 | 2723025159 | 222 |
| 16 | iso_pu_bacteria | 2721755684 | 2723558744 | 222 |
| 17 | iso_pu_bacteria | 2721755685 | 2723565312 | 222 |
| 18 | iso_pu_bacteria | 2721755819 | 2724088093 | 222 |
| 19 | iso_pu_bacteria | 2721755822 | 2724102577 | 222 |
| 20 | iso_pu_bacteria | 2728369352 | 2730106095 | 222 |
| 21 | 3300048929 | Ga0496126_0000380 | Ga0496126_0000380_58350_59075 | 225 |
| 22 | 3300046457 | Ga0495590_0186407 | Ga0495590_0186407_56_736 | 226 |
| 23 | 3300048924 | Ga0496121_0252702 | Ga0496121_0252702_506_1186 | 226 |
| 24 | 3300048926 | Ga0496123_0265895 | Ga0496123_0265895_17_697 | 226 |
| 25 | 3300013249 | Ga0171463_1001 | Ga0171463_1001915 | 230 |
| 26 | 3300047472 | Ga0495686_0014419 | Ga0495686_0014419_86_778 | 230 |
| 27 | 3300005331 | Ga0070670_100000160 | Ga0070670_10000016055 | 232 |
| 28 | 3300046689 | Ga0495613_0604123 | Ga0495613_0604123_22_720 | 232 |
| 29 | iso_pu_bacteria | 2818991448 | 2819608524 | 232 |
| 30 | iso_pu_bacteria | 2838029111 | 2838029407 | 232 |
| 31 | iso_pu_bacteria | 2842475841 | 2842476163 | 232 |
| 32 | iso_pu_bacteria | 2842502639 | 2842502935 | 232 |
| 33 | iso_pu_bacteria | 8005645114 | 8005649525 | 232 |
| 34 | 3300003187 | JGI25151J46595_10008982 | JGI25151J46595_100089823 | 233 |
| 35 | 3300025294 | Ga0209025_1000037 | Ga0209025_1000037241 | 233 |
| 36 | 3300048920 | Ga0496117_0023539 | Ga0496117_0023539_2953_3678 | 233 |
| 37 | 3300048925 | Ga0496122_0000147 | Ga0496122_0000147_7222_7947 | 233 |
| 38 | 3300048926 | Ga0496123_0000339 | Ga0496123_0000339_17494_18219 | 233 |
| 39 | iso_pu_bacteria | 2643221558 | 2643812771 | 233 |
| 40 | 3300003316 | rootH1_10043182 | rootH1_100431822 | 236 |
| 41 | 3300014497 | Ga0182008_10294383 | Ga0182008_102943831 | 236 |
| 42 | 3300044684 | Ga0466966_0095761 | Ga0466966_0095761_679_1389 | 236 |
| 43 | 3300044694 | Ga0466963_0003933 | Ga0466963_0003933_7606_8316 | 236 |
| 44 | 3300044706 | Ga0466964_0085405 | Ga0466964_0085405_415_1125 | 236 |
| 45 | 3300044765 | Ga0466970_0002858 | Ga0466970_0002858_7427_8137 | 236 |
| 46 | 3300044842 | Ga0466957_0052900 | Ga0466957_0052900_1503_2213 | 236 |
| 47 | 3300045836 | Ga0466958_0253842 | Ga0466958_0253842_26_736 | 236 |
| 48 | 3300045976 | Ga0466967_0214337 | Ga0466967_0214337_1007_1717 | 236 |
| 49 | 3300048923 | Ga0496120_0075515 | Ga0496120_0075515_938_1648 | 236 |
| 50 | 3300048925 | Ga0496122_0094906 | Ga0496122_0094906_1122_1832 | 236 |
| 51 | 3300048926 | Ga0496123_0081375 | Ga0496123_0081375_925_1635 | 236 |
| 52 | 3300048928 | Ga0496125_0442100 | Ga0496125_0442100_10_720 | 236 |
| 53 | 3300061719 | Ga0466962_0033587 | Ga0466962_0033587_1317_2027 | 236 |
| 54 | iso_pu_bacteria | 2511231052 | 2511500289 | 236 |
| 55 | iso_pu_bacteria | 2513237086 | 2513582299 | 236 |
| 56 | iso_pu_bacteria | 2513237091 | 2513616586 | 236 |
| 57 | iso_pu_bacteria | 2513237143 | 2513903924 | 236 |
| 58 | iso_pu_bacteria | 2516653046 | 2516891690 | 236 |
| 59 | iso_pu_bacteria | 2551306084 | 2551674468 | 236 |
| 60 | iso_pu_bacteria | 2551306086 | 2551693493 | 236 |
| 61 | iso_pu_bacteria | 2551306087 | 2551700474 | 236 |
| 62 | iso_pu_bacteria | 2551306089 | 2551709027 | 236 |
| 63 | iso_pu_bacteria | 2551306089 | 2551712769 | 236 |
| 64 | iso_pu_bacteria | 2551306090 | 2551716523 | 236 |
| 65 | iso_pu_bacteria | 2551306090 | 2551720285 | 236 |
| 66 | iso_pu_bacteria | 2551306091 | 2551730753 | 236 |
| 67 | iso_pu_bacteria | 2551306092 | 2551736162 | 236 |
| 68 | iso_pu_bacteria | 2551306093 | 2551746332 | 236 |
| 69 | iso_pu_bacteria | 648276728 | 648738454 | 236 |
| 70 | iso_pu_bacteria | 8055431914 | 8055433554 | 236 |
| 71 | iso_pu_bacteria | 2508501122 | 2509111708 | 237 |
| 72 | iso_pu_bacteria | 2509276019 | 2509375158 | 237 |
| 73 | iso_pu_bacteria | 2509276021 | 2509388620 | 237 |
| 74 | iso_pu_bacteria | 2509276033 | 2509444171 | 237 |
| 75 | iso_pu_bacteria | 2510065019 | 2510131237 | 237 |
| 76 | iso_pu_bacteria | 2510917022 | 2511134756 | 237 |
| 77 | iso_pu_bacteria | 2510917028 | 2511184630 | 237 |
| 78 | iso_pu_bacteria | 2510917030 | 2511197712 | 237 |
| 79 | iso_pu_bacteria | 2512875026 | 2512972918 | 237 |
| 80 | iso_pu_bacteria | 2513237085 | 2513574555 | 237 |
| 81 | iso_pu_bacteria | 2513237088 | 2513597261 | 237 |
| 82 | iso_pu_bacteria | 2513237089 | 2513602746 | 237 |
| 83 | iso_pu_bacteria | 2513237103 | 2513707155 | 237 |
| 84 | iso_pu_bacteria | 2513237138 | 2513865017 | 237 |
| 85 | iso_pu_bacteria | 2513237146 | 2513929370 | 237 |
| 86 | iso_pu_bacteria | 2513237156 | 2513985762 | 237 |
| 87 | iso_pu_bacteria | 2513237159 | 2513996582 | 237 |
| 88 | iso_pu_bacteria | 2513237160 | 2514005010 | 237 |
| 89 | iso_pu_bacteria | 2513237162 | 2514020436 | 237 |
| 90 | iso_pu_bacteria | 2515075009 | 2515110169 | 237 |
| 91 | iso_pu_bacteria | 2515154113 | 2515637476 | 237 |
| 92 | iso_pu_bacteria | 2515154114 | 2515643612 | 237 |
| 93 | iso_pu_bacteria | 2515154134 | 2515740754 | 237 |
| 94 | iso_pu_bacteria | 2516143018 | 2516204492 | 237 |
| 95 | iso_pu_bacteria | 2516653077 | 2517038863 | 237 |
| 96 | iso_pu_bacteria | 2516653085 | 2517079110 | 237 |
| 97 | iso_pu_bacteria | 2517093000 | 2517093050 | 237 |
| 98 | iso_pu_bacteria | 2517287029 | 2517409327 | 237 |
| 99 | iso_pu_bacteria | 2517487022 | 2517568466 | 237 |
| 100 | iso_pu_bacteria | 2558860100 | 2558866260 | 237 |
| 101 | iso_pu_bacteria | 2582581283 | 2585164746 | 237 |
| 102 | iso_pu_bacteria | 2582581294 | 2585205658 | 237 |
| 103 | iso_pu_bacteria | 2582581298 | 2585223611 | 237 |
| 104 | iso_pu_bacteria | 2582581299 | 2585229668 | 237 |
| 105 | iso_pu_bacteria | 2582581304 | 2585256056 | 237 |
| 106 | iso_pu_bacteria | 2582581306 | 2585265123 | 237 |
| 107 | iso_pu_bacteria | 2582581307 | 2585273823 | 237 |
| 108 | iso_pu_bacteria | 2582581865 | 2585385746 | 237 |
| 109 | iso_pu_bacteria | 2582581866 | 2585392087 | 237 |
| 110 | iso_pu_bacteria | 2582581867 | 2585398737 | 237 |
| 111 | iso_pu_bacteria | 2585427526 | 2585523555 | 237 |
| 112 | iso_pu_bacteria | 2585427528 | 2585542030 | 237 |
| 113 | iso_pu_bacteria | 2585427529 | 2585545793 | 237 |
| 114 | iso_pu_bacteria | 2585427531 | 2585559999 | 237 |
| 115 | iso_pu_bacteria | 2585427590 | 2585819141 | 237 |
| 116 | iso_pu_bacteria | 2585427593 | 2585840322 | 237 |
| 117 | iso_pu_bacteria | 2585427594 | 2585844050 | 237 |
| 118 | iso_pu_bacteria | 2585427609 | 2585905821 | 237 |
| 119 | iso_pu_bacteria | 2585428125 | 2587979063 | 237 |
| 120 | iso_pu_bacteria | 2599185170 | 2599419363 | 237 |
| 121 | iso_pu_bacteria | 2599185352 | 2600191237 | 237 |
| 122 | iso_pu_bacteria | 2643221557 | 2643806125 | 237 |
| 123 | iso_pu_bacteria | 2643221599 | 2644004743 | 237 |
| 124 | iso_pu_bacteria | 2643221607 | 2644047384 | 237 |
| 125 | iso_pu_bacteria | 2643221610 | 2644070321 | 237 |
| 126 | iso_pu_bacteria | 2643221618 | 2644103456 | 237 |
| 127 | iso_pu_bacteria | 2643221626 | 2644144335 | 237 |
| 128 | iso_pu_bacteria | 2643221636 | 2644199802 | 237 |
| 129 | iso_pu_bacteria | 2643221655 | 2644306386 | 237 |
| 130 | iso_pu_bacteria | 2643221659 | 2644330576 | 237 |
| 131 | iso_pu_bacteria | 2643221668 | 2644377387 | 237 |
| 132 | iso_pu_bacteria | 2643221675 | 2644421083 | 237 |
| 133 | iso_pu_bacteria | 2643221680 | 2644454606 | 237 |
| 134 | iso_pu_bacteria | 2643221686 | 2644480173 | 237 |
| 135 | iso_pu_bacteria | 2643221688 | 2644492695 | 237 |
| 136 | iso_pu_bacteria | 2643221689 | 2644496972 | 237 |
| 137 | iso_pu_bacteria | 2643221698 | 2644542620 | 237 |
| 138 | iso_pu_bacteria | 2643221712 | 2644611997 | 237 |
| 139 | iso_pu_bacteria | 2643221723 | 2644671812 | 237 |
| 140 | iso_pu_bacteria | 2643221726 | 2644692545 | 237 |
| 141 | iso_pu_bacteria | 2690316117 | 2692317449 | 237 |
| 142 | iso_pu_bacteria | 2718218233 | 2720618384 | 237 |
| 143 | iso_pu_bacteria | 2721755823 | 2724108474 | 237 |
| 144 | iso_pu_bacteria | 2724679232 | 2725945501 | 237 |
| 145 | iso_pu_bacteria | 2738541293 | 2738801393 | 237 |
| 146 | iso_pu_bacteria | 2738541333 | 2739036734 | 237 |
| 147 | iso_pu_bacteria | 2751185821 | 2753462604 | 237 |
| 148 | iso_pu_bacteria | 2765235942 | 2766062727 | 237 |
| 149 | iso_pu_bacteria | 2791355091 | 2792621255 | 237 |
| 150 | iso_pu_bacteria | 2791355092 | 2792625470 | 237 |
| 151 | iso_pu_bacteria | 2791355094 | 2792637904 | 237 |
| 152 | iso_pu_bacteria | 2791355256 | 2793295384 | 237 |
| 153 | iso_pu_bacteria | 2791355259 | 2793317981 | 237 |
| 154 | iso_pu_bacteria | 2791355262 | 2793334412 | 237 |
| 155 | iso_pu_bacteria | 2791355263 | 2793344704 | 237 |
| 156 | iso_pu_bacteria | 2791355265 | 2793355627 | 237 |
| 157 | iso_pu_bacteria | 2791355267 | 2793365702 | 237 |
| 158 | iso_pu_bacteria | 2802428858 | 2802718487 | 237 |
| 159 | iso_pu_bacteria | 2802428859 | 2802726310 | 237 |
| 160 | iso_pu_bacteria | 2802428860 | 2802731536 | 237 |
| 161 | iso_pu_bacteria | 2802428861 | 2802740834 | 237 |
| 162 | iso_pu_bacteria | 2802428862 | 2802742430 | 237 |
| 163 | iso_pu_bacteria | 2802428863 | 2802749136 | 237 |
| 164 | iso_pu_bacteria | 2802429633 | 2806048434 | 237 |
| 165 | iso_pu_bacteria | 2802429634 | 2806055915 | 237 |
| 166 | iso_pu_bacteria | 2802429635 | 2806062757 | 237 |
| 167 | iso_pu_bacteria | 2802429636 | 2806066435 | 237 |
| 168 | iso_pu_bacteria | 2802429637 | 2806073490 | 237 |
| 169 | iso_pu_bacteria | 2842521101 | 2842521511 | 237 |
| 170 | iso_pu_bacteria | 2844163670 | 2844165094 | 237 |
| 171 | iso_pu_bacteria | 2850079185 | 2850079820 | 237 |
| 172 | iso_pu_bacteria | 2891373044 | 2891375118 | 237 |
| 173 | iso_pu_bacteria | 2915980308 | 2915984016 | 237 |
| 174 | iso_pu_bacteria | 2916061851 | 2916064784 | 237 |
| 175 | iso_pu_bacteria | 2920760137 | 2920763557 | 237 |
| 176 | iso_pu_bacteria | 2920822456 | 2920823216 | 237 |
| 177 | iso_pu_bacteria | 2921250672 | 2921254456 | 237 |
| 178 | iso_pu_bacteria | 2937029754 | 2937034418 | 237 |
| 179 | iso_pu_bacteria | 2937036028 | 2937039728 | 237 |
| 180 | iso_pu_bacteria | 2937078374 | 2937078906 | 237 |
| 181 | iso_pu_bacteria | 2937084907 | 2937087641 | 237 |
| 182 | iso_pu_bacteria | 2941499720 | 2941500881 | 237 |
| 183 | iso_pu_bacteria | 2957375807 | 2957379860 | 237 |
| 184 | iso_pu_bacteria | 2957437181 | 2957443668 | 237 |
| 185 | iso_pu_bacteria | 2960591022 | 2960594601 | 237 |
| 186 | iso_pu_bacteria | 2960631154 | 2960634982 | 237 |
| 187 | iso_pu_bacteria | 2960680706 | 2960684711 | 237 |
| 188 | iso_pu_bacteria | 2960693952 | 2960694516 | 237 |
| 189 | iso_pu_bacteria | 2967686174 | 2967689604 | 237 |
| 190 | iso_pu_bacteria | 2967728569 | 2967730393 | 237 |
| 191 | iso_pu_bacteria | 2970026789 | 2970030894 | 237 |
| 192 | iso_pu_bacteria | 2970122695 | 2970124225 | 237 |
| 193 | iso_pu_bacteria | 2970143518 | 2970144283 | 237 |
| 194 | iso_pu_bacteria | 2977530762 | 2977532612 | 237 |
| 195 | iso_pu_bacteria | 2977544691 | 2977550366 | 237 |
| 196 | iso_pu_bacteria | 2989349275 | 2989351639 | 237 |
| 197 | iso_pu_bacteria | 3005409236 | 3005411003 | 237 |
| 198 | iso_pu_bacteria | 8003999396 | 8003999548 | 237 |
| 199 | iso_pu_bacteria | 8005382845 | 8005387469 | 237 |
| 200 | iso_pu_bacteria | 8005542996 | 8005543597 | 237 |
| 201 | iso_pu_bacteria | 8018150411 | 8018152965 | 237 |
| 202 | iso_pu_bacteria | 8054558443 | 8054563027 | 237 |
| 203 | iso_pu_bacteria | 2510065057 | 2510303491 | 238 |
| 204 | iso_pu_bacteria | 2510461076 | 2510897573 | 238 |
| 205 | iso_pu_bacteria | 2513237084 | 2513570442 | 238 |
| 206 | iso_pu_bacteria | 2513237093 | 2513635887 | 238 |
| 207 | iso_pu_bacteria | 2513237140 | 2513885793 | 238 |
| 208 | iso_pu_bacteria | 2513237144 | 2513914165 | 238 |
| 209 | iso_pu_bacteria | 2515154107 | 2515607564 | 238 |
| 210 | iso_pu_bacteria | 2515154116 | 2515657007 | 238 |
| 211 | iso_pu_bacteria | 2524023207 | 2524450704 | 238 |
| 212 | iso_pu_bacteria | 2529292951 | 2530647995 | 238 |
| 213 | iso_pu_bacteria | 2534681796 | 2535514924 | 238 |
| 214 | iso_pu_bacteria | 2551306085 | 2551686484 | 238 |
| 215 | iso_pu_bacteria | 2599185156 | 2599332866 | 238 |
| 216 | iso_pu_bacteria | 2643221582 | 2643918296 | 238 |
| 217 | iso_pu_bacteria | 2643221637 | 2644206930 | 238 |
| 218 | iso_pu_bacteria | 2643221643 | 2644237330 | 238 |
| 219 | iso_pu_bacteria | 2643221718 | 2644650578 | 238 |
| 220 | iso_pu_bacteria | 2791355261 | 2793326328 | 238 |
| 221 | iso_pu_bacteria | 2818991439 | 2819556598 | 238 |
| 222 | iso_pu_bacteria | 2838016132 | 2838020103 | 238 |
| 223 | iso_pu_bacteria | 2838035591 | 2838040104 | 238 |
| 224 | iso_pu_bacteria | 2838042994 | 2838048673 | 238 |
| 225 | iso_pu_bacteria | 2838048938 | 2838051683 | 238 |
| 226 | iso_pu_bacteria | 2838068647 | 2838070930 | 238 |
| 227 | iso_pu_bacteria | 2838661181 | 2838665964 | 238 |
| 228 | iso_pu_bacteria | 2841846520 | 2841846917 | 238 |
| 229 | iso_pu_bacteria | 2841864319 | 2841866994 | 238 |
| 230 | iso_pu_bacteria | 2842124991 | 2842127054 | 238 |
| 231 | iso_pu_bacteria | 2842205361 | 2842207119 | 238 |
| 232 | iso_pu_bacteria | 2842217011 | 2842219023 | 238 |
| 233 | iso_pu_bacteria | 2842264693 | 2842270471 | 238 |
| 234 | iso_pu_bacteria | 2842278818 | 2842280188 | 238 |
| 235 | iso_pu_bacteria | 2842285085 | 2842286645 | 238 |
| 236 | iso_pu_bacteria | 2842311132 | 2842312804 | 238 |
| 237 | iso_pu_bacteria | 2842317721 | 2842323891 | 238 |
| 238 | iso_pu_bacteria | 2842341865 | 2842343258 | 238 |
| 239 | iso_pu_bacteria | 2842363717 | 2842367017 | 238 |
| 240 | iso_pu_bacteria | 2842402390 | 2842403802 | 238 |
| 241 | iso_pu_bacteria | 2842409023 | 2842410496 | 238 |
| 242 | iso_pu_bacteria | 2842415677 | 2842417143 | 238 |
| 243 | iso_pu_bacteria | 2842422224 | 2842424545 | 238 |
| 244 | iso_pu_bacteria | 2842428310 | 2842434293 | 238 |
| 245 | iso_pu_bacteria | 2842434925 | 2842440600 | 238 |
| 246 | iso_pu_bacteria | 2842441272 | 2842447252 | 238 |
| 247 | iso_pu_bacteria | 2842447887 | 2842452030 | 238 |
| 248 | iso_pu_bacteria | 2842462802 | 2842468686 | 238 |
| 249 | iso_pu_bacteria | 2842469257 | 2842475231 | 238 |
| 250 | iso_pu_bacteria | 2842495871 | 2842500213 | 238 |
| 251 | iso_pu_bacteria | 2842922631 | 2842923157 | 238 |
| 252 | iso_pu_bacteria | 2855825444 | 2855828059 | 238 |
| 253 | iso_pu_bacteria | 2855839649 | 2855839830 | 238 |
| 254 | iso_pu_bacteria | 2858800743 | 2858803804 | 238 |
| 255 | iso_pu_bacteria | 2915986958 | 2915990688 | 238 |
| 256 | iso_pu_bacteria | 2915993759 | 2915997164 | 238 |
| 257 | iso_pu_bacteria | 2916000859 | 2916000930 | 238 |
| 258 | iso_pu_bacteria | 2916007675 | 2916011175 | 238 |
| 259 | iso_pu_bacteria | 2916014648 | 2916021291 | 238 |
| 260 | iso_pu_bacteria | 2916021584 | 2916021986 | 238 |
| 261 | iso_pu_bacteria | 2916028427 | 2916034079 | 238 |
| 262 | iso_pu_bacteria | 2916035215 | 2916036347 | 238 |
| 263 | iso_pu_bacteria | 2916041962 | 2916048410 | 238 |
| 264 | iso_pu_bacteria | 2916048683 | 2916053662 | 238 |
| 265 | iso_pu_bacteria | 2916055098 | 2916056938 | 238 |
| 266 | iso_pu_bacteria | 2916068649 | 2916071305 | 238 |
| 267 | iso_pu_bacteria | 2916076590 | 2916080767 | 238 |
| 268 | iso_pu_bacteria | 2919100787 | 2919101506 | 238 |
| 269 | iso_pu_bacteria | 2919114240 | 2919116419 | 238 |
| 270 | iso_pu_bacteria | 2921201388 | 2921205543 | 238 |
| 271 | iso_pu_bacteria | 2921208531 | 2921213697 | 238 |
| 272 | iso_pu_bacteria | 2921237296 | 2921241523 | 238 |
| 273 | iso_pu_bacteria | 2921244191 | 2921247102 | 238 |
| 274 | iso_pu_bacteria | 2921257292 | 2921262835 | 238 |
| 275 | iso_pu_bacteria | 2921263974 | 2921268684 | 238 |
| 276 | iso_pu_bacteria | 2921282425 | 2921288230 | 238 |
| 277 | iso_pu_bacteria | 2921289301 | 2921291757 | 238 |
| 278 | iso_pu_bacteria | 2921296804 | 2921297327 | 238 |
| 279 | iso_pu_bacteria | 2923556063 | 2923556549 | 238 |
| 280 | iso_pu_bacteria | 2924144063 | 2924150766 | 238 |
| 281 | iso_pu_bacteria | 2924150972 | 2924156669 | 238 |
| 282 | iso_pu_bacteria | 2924158325 | 2924160319 | 238 |
| 283 | iso_pu_bacteria | 2924165586 | 2924170729 | 238 |
| 284 | iso_pu_bacteria | 2924172951 | 2924176846 | 238 |
| 285 | iso_pu_bacteria | 2924179722 | 2924183643 | 238 |
| 286 | iso_pu_bacteria | 2924186466 | 2924187498 | 238 |
| 287 | iso_pu_bacteria | 2924193448 | 2924198993 | 238 |
| 288 | iso_pu_bacteria | 2924200457 | 2924200861 | 238 |
| 289 | iso_pu_bacteria | 2924207177 | 2924209215 | 238 |
| 290 | iso_pu_bacteria | 2924214083 | 2924216116 | 238 |
| 291 | iso_pu_bacteria | 2924221636 | 2924226559 | 238 |
| 292 | iso_pu_bacteria | 2924228884 | 2924232753 | 238 |
| 293 | iso_pu_bacteria | 2933016740 | 2933023545 | 238 |
| 294 | iso_pu_bacteria | 2933599457 | 2933601729 | 238 |
| 295 | iso_pu_bacteria | 2936381700 | 2936383575 | 238 |
| 296 | iso_pu_bacteria | 2936996657 | 2937001848 | 238 |
| 297 | iso_pu_bacteria | 2937002841 | 2937007702 | 238 |
| 298 | iso_pu_bacteria | 2937009748 | 2937014951 | 238 |
| 299 | iso_pu_bacteria | 2937016420 | 2937022305 | 238 |
| 300 | iso_pu_bacteria | 2937023124 | 2937023371 | 238 |
| 301 | iso_pu_bacteria | 2937042894 | 2937044861 | 238 |
| 302 | iso_pu_bacteria | 2937049772 | 2937053369 | 238 |
| 303 | iso_pu_bacteria | 2937056579 | 2937062729 | 238 |
| 304 | iso_pu_bacteria | 2937063883 | 2937064235 | 238 |
| 305 | iso_pu_bacteria | 2937071275 | 2937074887 | 238 |
| 306 | iso_pu_bacteria | 2937091812 | 2937092044 | 238 |
| 307 | iso_pu_bacteria | 2937098957 | 2937099880 | 238 |
| 308 | iso_pu_bacteria | 2937106411 | 2937106411 | 238 |
| 309 | iso_pu_bacteria | 2937113482 | 2937119477 | 238 |
| 310 | iso_pu_bacteria | 2937119839 | 2937126185 | 238 |
| 311 | iso_pu_bacteria | 2937126314 | 2937131608 | 238 |
| 312 | iso_pu_bacteria | 2957382221 | 2957388671 | 238 |
| 313 | iso_pu_bacteria | 2957388812 | 2957393385 | 238 |
| 314 | iso_pu_bacteria | 2957395598 | 2957400274 | 238 |
| 315 | iso_pu_bacteria | 2957402308 | 2957403886 | 238 |
| 316 | iso_pu_bacteria | 2957408893 | 2957413764 | 238 |
| 317 | iso_pu_bacteria | 2957415311 | 2957417670 | 238 |
| 318 | iso_pu_bacteria | 2957422303 | 2957423330 | 238 |
| 319 | iso_pu_bacteria | 2957430029 | 2957436893 | 238 |
| 320 | iso_pu_bacteria | 2957443900 | 2957447291 | 238 |
| 321 | iso_pu_bacteria | 2957450854 | 2957451214 | 238 |
| 322 | iso_pu_bacteria | 2957457609 | 2957460186 | 238 |
| 323 | iso_pu_bacteria | 2957464669 | 2957469581 | 238 |
| 324 | iso_pu_bacteria | 2957471148 | 2957473529 | 238 |
| 325 | iso_pu_bacteria | 2957478035 | 2957482011 | 238 |
| 326 | iso_pu_bacteria | 2957484790 | 2957484836 | 238 |
| 327 | iso_pu_bacteria | 2957491536 | 2957492111 | 238 |
| 328 | iso_pu_bacteria | 2957498199 | 2957500662 | 238 |
| 329 | iso_pu_bacteria | 2957505466 | 2957508130 | 238 |
| 330 | iso_pu_bacteria | 2960584000 | 2960586153 | 238 |
| 331 | iso_pu_bacteria | 2960597568 | 2960603389 | 238 |
| 332 | iso_pu_bacteria | 2960603979 | 2960607803 | 238 |
| 333 | iso_pu_bacteria | 2960610863 | 2960611730 | 238 |
| 334 | iso_pu_bacteria | 2960617483 | 2960621533 | 238 |
| 335 | iso_pu_bacteria | 2960624210 | 2960626777 | 238 |
| 336 | iso_pu_bacteria | 2960637947 | 2960641540 | 238 |
| 337 | iso_pu_bacteria | 2960645483 | 2960648080 | 238 |
| 338 | iso_pu_bacteria | 2960652885 | 2960658306 | 238 |
| 339 | iso_pu_bacteria | 2960660292 | 2960660575 | 238 |
| 340 | iso_pu_bacteria | 2960667422 | 2960672189 | 238 |
| 341 | iso_pu_bacteria | 2960674078 | 2960679599 | 238 |
| 342 | iso_pu_bacteria | 2960687367 | 2960687510 | 238 |
| 343 | iso_pu_bacteria | 2964607997 | 2964610539 | 238 |
| 344 | iso_pu_bacteria | 2964615318 | 2964618431 | 238 |
| 345 | iso_pu_bacteria | 2964621998 | 2964625434 | 238 |
| 346 | iso_pu_bacteria | 2964628898 | 2964633790 | 238 |
| 347 | iso_pu_bacteria | 2964636051 | 2964639461 | 238 |
| 348 | iso_pu_bacteria | 2964643177 | 2964649378 | 238 |
| 349 | iso_pu_bacteria | 2964649959 | 2964650168 | 238 |
| 350 | iso_pu_bacteria | 2964656573 | 2964663076 | 238 |
| 351 | iso_pu_bacteria | 2964663802 | 2964668098 | 238 |
| 352 | iso_pu_bacteria | 2964670856 | 2964671862 | 238 |
| 353 | iso_pu_bacteria | 2964678106 | 2964679839 | 238 |
| 354 | iso_pu_bacteria | 2964685014 | 2964691669 | 238 |
| 355 | iso_pu_bacteria | 2964691889 | 2964697713 | 238 |
| 356 | iso_pu_bacteria | 2964698721 | 2964703353 | 238 |
| 357 | iso_pu_bacteria | 2964705432 | 2964710200 | 238 |
| 358 | iso_pu_bacteria | 2964712639 | 2964717224 | 238 |
| 359 | iso_pu_bacteria | 2964719344 | 2964722036 | 238 |
| 360 | iso_pu_bacteria | 2967664464 | 2967670528 | 238 |
| 361 | iso_pu_bacteria | 2967671571 | 2967671860 | 238 |
| 362 | iso_pu_bacteria | 2967678726 | 2967680929 | 238 |
| 363 | iso_pu_bacteria | 2967693043 | 2967694906 | 238 |
| 364 | iso_pu_bacteria | 2967699805 | 2967703532 | 238 |
| 365 | iso_pu_bacteria | 2967706974 | 2967712297 | 238 |
| 366 | iso_pu_bacteria | 2967714385 | 2967714500 | 238 |
| 367 | iso_pu_bacteria | 2967721400 | 2967723448 | 238 |
| 368 | iso_pu_bacteria | 2967735183 | 2967739250 | 238 |
| 369 | iso_pu_bacteria | 2967742019 | 2967744837 | 238 |
| 370 | iso_pu_bacteria | 2967748971 | 2967754888 | 238 |
| 371 | iso_pu_bacteria | 2967755722 | 2967761170 | 238 |
| 372 | iso_pu_bacteria | 2967762386 | 2967766553 | 238 |
| 373 | iso_pu_bacteria | 2967769361 | 2967769942 | 238 |
| 374 | iso_pu_bacteria | 2967775926 | 2967778067 | 238 |
| 375 | iso_pu_bacteria | 2970019648 | 2970023289 | 238 |
| 376 | iso_pu_bacteria | 2970033650 | 2970037109 | 238 |
| 377 | iso_pu_bacteria | 2970040964 | 2970041117 | 238 |
| 378 | iso_pu_bacteria | 2970047711 | 2970050696 | 238 |
| 379 | iso_pu_bacteria | 2970054988 | 2970056847 | 238 |
| 380 | iso_pu_bacteria | 2970061556 | 2970062737 | 238 |
| 381 | iso_pu_bacteria | 2970068827 | 2970075392 | 238 |
| 382 | iso_pu_bacteria | 2970076120 | 2970081781 | 238 |
| 383 | iso_pu_bacteria | 2970082768 | 2970088386 | 238 |
| 384 | iso_pu_bacteria | 2970088815 | 2970089503 | 238 |
| 385 | iso_pu_bacteria | 2970095765 | 2970101912 | 238 |
| 386 | iso_pu_bacteria | 2970102677 | 2970105982 | 238 |
| 387 | iso_pu_bacteria | 2970109326 | 2970115755 | 238 |
| 388 | iso_pu_bacteria | 2970116247 | 2970117620 | 238 |
| 389 | iso_pu_bacteria | 2970129317 | 2970131404 | 238 |
| 390 | iso_pu_bacteria | 2970136068 | 2970138970 | 238 |
| 391 | iso_pu_bacteria | 2970149975 | 2970154470 | 238 |
| 392 | iso_pu_bacteria | 2970156795 | 2970161314 | 238 |
| 393 | iso_pu_bacteria | 2970164137 | 2970170115 | 238 |
| 394 | iso_pu_bacteria | 2970170962 | 2970175823 | 238 |
| 395 | iso_pu_bacteria | 2970177841 | 2970183683 | 238 |
| 396 | iso_pu_bacteria | 2970184632 | 2970190831 | 238 |
| 397 | iso_pu_bacteria | 2970191845 | 2970197451 | 238 |
| 398 | iso_pu_bacteria | 2977516862 | 2977521118 | 238 |
| 399 | iso_pu_bacteria | 2977523885 | 2977528548 | 238 |
| 400 | iso_pu_bacteria | 2977537788 | 2977543802 | 238 |
| 401 | iso_pu_bacteria | 2977551784 | 2977553459 | 238 |
| 402 | iso_pu_bacteria | 2977558990 | 2977563724 | 238 |
| 403 | iso_pu_bacteria | 2977565890 | 2977571738 | 238 |
| 404 | iso_pu_bacteria | 2977572785 | 2977574681 | 238 |
| 405 | iso_pu_bacteria | 2977579622 | 2977584441 | 238 |
| 406 | iso_pu_bacteria | 2979100975 | 2979105089 | 238 |
| 407 | iso_pu_bacteria | 2984509177 | 2984513097 | 238 |
| 408 | iso_pu_bacteria | 2984518228 | 2984520538 | 238 |
| 409 | iso_pu_bacteria | 2984537506 | 2984539832 | 238 |
| 410 | iso_pu_bacteria | 2984601300 | 2984602067 | 238 |
| 411 | iso_pu_bacteria | 2996887358 | 2996888349 | 238 |
| 412 | iso_pu_bacteria | 2996893221 | 2996893268 | 238 |
| 413 | iso_pu_bacteria | 3005445848 | 3005446029 | 238 |
| 414 | iso_pu_bacteria | 3005452660 | 3005452680 | 238 |
| 415 | iso_pu_bacteria | 3005452660 | 3005456701 | 238 |
| 416 | iso_pu_bacteria | 639633055 | 639646458 | 238 |
| 417 | iso_pu_bacteria | 8003992118 | 8003992284 | 238 |
| 418 | iso_pu_bacteria | 8005258706 | 8005261095 | 238 |
| 419 | iso_pu_bacteria | 8005289223 | 8005291261 | 238 |
| 420 | iso_pu_bacteria | 8005301065 | 8005301365 | 238 |
| 421 | iso_pu_bacteria | 8005321885 | 8005322876 | 238 |
| 422 | iso_pu_bacteria | 8005430974 | 8005432750 | 238 |
| 423 | iso_pu_bacteria | 8005460587 | 8005460806 | 238 |
| 424 | iso_pu_bacteria | 8005497431 | 8005498480 | 238 |
| 425 | iso_pu_bacteria | 8005570704 | 8005573688 | 238 |
| 426 | iso_pu_bacteria | 8005619151 | 8005619671 | 238 |
| 427 | iso_pu_bacteria | 8005626139 | 8005628244 | 238 |
| 428 | iso_pu_bacteria | 8005668836 | 8005669890 | 238 |
| 429 | iso_pu_bacteria | 8005688590 | 8005692427 | 238 |
| 430 | iso_pu_bacteria | 8056375014 | 8056378595 | 238 |
| 431 | iso_pu_bacteria | 8056382006 | 8056385779 | 238 |
| 432 | iso_pu_bacteria | 2838074704 | 2838075188 | 239 |
| 433 | iso_pu_bacteria | 2847417321 | 2847417483 | 239 |
| 434 | iso_pu_bacteria | 2848992105 | 2848992318 | 239 |
| 435 | iso_pu_bacteria | 2855872281 | 2855873543 | 239 |
| 436 | iso_pu_bacteria | 2989771324 | 2989772644 | 239 |
| 437 | iso_pu_bacteria | 3003930520 | 3003931777 | 239 |
| 438 | iso_pu_bacteria | 643692032 | 643824382 | 239 |
| 439 | 3300021321 | Ga0214542_1001074 | Ga0214542_100107441 | 240 |
| 440 | 3300021327 | Ga0214543_1000897 | Ga0214543_100089741 | 240 |
| 441 | 3300027111 | Ga0209281_1000520 | Ga0209281_100052013 | 240 |
| 442 | iso_pu_bacteria | 8005395548 | 8005399951 | 240 |
| 443 | iso_pu_bacteria | 8005556819 | 8005560418 | 240 |
| 444 | iso_pu_bacteria | 8005682033 | 8005685232 | 240 |
| 445 | iso_pu_bacteria | 8024479707 | 8024480096 | 240 |
| 446 | 3300002739 | JGI25158J39367_1000090 | JGI25158J39367_100009011 | 241 |
| 447 | 3300002773 | JGI25152J39213_1000246 | JGI25152J39213_100024625 | 241 |
| 448 | 3300002773 | JGI25152J39213_1000500 | JGI25152J39213_100050011 | 241 |
| 449 | 3300002773 | JGI25152J39213_1016171 | JGI25152J39213_10161711 | 241 |
| 450 | 3300002773 | JGI25152J39213_1016174 | JGI25152J39213_10161741 | 241 |
| 451 | 3300002774 | JGI25150J39212_1000118 | JGI25150J39212_100011822 | 241 |
| 452 | 3300002774 | JGI25150J39212_1004187 | JGI25150J39212_10041874 | 241 |
| 453 | 3300002774 | JGI25150J39212_1005928 | JGI25150J39212_10059281 | 241 |
| 454 | 3300002987 | JGI25159J45721_1000003 | JGI25159J45721_1000003194 | 241 |
| 455 | 3300002987 | JGI25159J45721_1000942 | JGI25159J45721_100094210 | 241 |
| 456 | 3300003187 | JGI25151J46595_10000110 | JGI25151J46595_1000011032 | 241 |
| 457 | 3300003187 | JGI25151J46595_10000681 | JGI25151J46595_100006814 | 241 |
| 458 | 3300003187 | JGI25151J46595_10003279 | JGI25151J46595_100032798 | 241 |
| 459 | 3300003215 | JGI25153J46596_10000482 | JGI25153J46596_100004824 | 241 |
| 460 | 3300003215 | JGI25153J46596_10035651 | JGI25153J46596_100356512 | 241 |
| 461 | 3300003215 | JGI25153J46596_10040347 | JGI25153J46596_100403471 | 241 |
| 462 | 3300003215 | JGI25153J46596_10040373 | JGI25153J46596_100403731 | 241 |
| 463 | 3300003215 | JGI25153J46596_10047850 | JGI25153J46596_100478502 | 241 |
| 464 | 3300003322 | rootL2_10235986 | rootL2_102359862 | 241 |
| 465 | 3300003354 | JGI25160J50197_1000003 | JGI25160J50197_1000003375 | 241 |
| 466 | 3300003354 | JGI25160J50197_1000514 | JGI25160J50197_100051416 | 241 |
| 467 | 3300003354 | JGI25160J50197_1011969 | JGI25160J50197_10119692 | 241 |
| 468 | 3300003374 | JGI25161J50226_1000184 | JGI25161J50226_100018413 | 241 |
| 469 | 3300003374 | JGI25161J50226_1000270 | JGI25161J50226_10002705 | 241 |
| 470 | 3300003374 | JGI25161J50226_1004678 | JGI25161J50226_10046783 | 241 |
| 471 | 3300003578 | Ga0006562J51391_1024010 | Ga0006562J51391_10240102 | 241 |
| 472 | 3300003771 | Ga0055526_1000725 | Ga0055526_100072517 | 241 |
| 473 | 3300003771 | Ga0055526_1002842 | Ga0055526_100284211 | 241 |
| 474 | 3300003771 | Ga0055526_1004258 | Ga0055526_10042587 | 241 |
| 475 | 3300003771 | Ga0055526_1017123 | Ga0055526_10171233 | 241 |
| 476 | 3300003775 | Ga0055524_1002851 | Ga0055524_10028512 | 241 |
| 477 | 3300003775 | Ga0055524_1006954 | Ga0055524_10069543 | 241 |
| 478 | 3300003775 | Ga0055524_1015572 | Ga0055524_10155722 | 241 |
| 479 | 3300003775 | Ga0055524_1018417 | Ga0055524_10184172 | 241 |
| 480 | 3300003781 | Ga0055536_1019078 | Ga0055536_10190782 | 241 |
| 481 | 3300003790 | Ga0055528_1000095 | Ga0055528_100009510 | 241 |
| 482 | 3300003790 | Ga0055528_1000618 | Ga0055528_10006187 | 241 |
| 483 | 3300003790 | Ga0055528_1015870 | Ga0055528_10158702 | 241 |
| 484 | 3300003790 | Ga0055528_1021492 | Ga0055528_10214922 | 241 |
| 485 | 3300003790 | Ga0055528_1023363 | Ga0055528_10233631 | 241 |
| 486 | 3300003792 | Ga0055540_1000190 | Ga0055540_100019025 | 241 |
| 487 | 3300003792 | Ga0055540_1007520 | Ga0055540_10075202 | 241 |
| 488 | 3300003794 | Ga0055531_10005539 | Ga0055531_100055392 | 241 |
| 489 | 3300003856 | Ga0058692_1017409 | Ga0058692_10174092 | 241 |
| 490 | 3300004625 | Ga0055543_1000059 | Ga0055543_100005997 | 241 |
| 491 | 3300004625 | Ga0055543_1000299 | Ga0055543_10002998 | 241 |
| 492 | 3300004625 | Ga0055543_1003650 | Ga0055543_10036504 | 241 |
| 493 | 3300005262 | Ga0065165_1000084 | Ga0065165_100008451 | 241 |
| 494 | 3300005262 | Ga0065165_1012356 | Ga0065165_10123562 | 241 |
| 495 | 3300005262 | Ga0065165_1040779 | Ga0065165_10407791 | 241 |
| 496 | 3300005355 | Ga0070671_100027922 | Ga0070671_1000279228 | 241 |
| 497 | 3300005367 | Ga0070667_100181766 | Ga0070667_1001817662 | 241 |
| 498 | 3300005548 | Ga0070665_100136036 | Ga0070665_1001360362 | 241 |
| 499 | 3300005844 | Ga0068862_100147624 | Ga0068862_1001476243 | 241 |
| 500 | 3300006038 | Ga0075365_10003496 | Ga0075365_1000349610 | 241 |
| 501 | 3300006038 | Ga0075365_10007830 | Ga0075365_100078303 | 241 |
| 502 | 3300006042 | Ga0075368_10034448 | Ga0075368_100344482 | 241 |
| 503 | 3300006177 | Ga0075362_10007175 | Ga0075362_100071753 | 241 |
| 504 | 3300006178 | Ga0075367_10033635 | Ga0075367_100336352 | 241 |
| 505 | 3300006186 | Ga0075369_10008457 | Ga0075369_100084572 | 241 |
| 506 | 3300006195 | Ga0075366_10019959 | Ga0075366_100199595 | 241 |
| 507 | 3300006353 | Ga0075370_10148964 | Ga0075370_101489642 | 241 |
| 508 | 3300009011 | Ga0105251_10057758 | Ga0105251_100577582 | 241 |
| 509 | 3300009036 | Ga0105244_10157911 | Ga0105244_101579111 | 241 |
| 510 | 3300009765 | Ga0123341_1000067 | Ga0123341_100006747 | 241 |
| 511 | 3300009765 | Ga0123341_1068588 | Ga0123341_10685883 | 241 |
| 512 | 3300009766 | Ga0123342_1010893 | Ga0123342_10108932 | 241 |
| 513 | 3300015690 | Ga0183363_1134 | Ga0183363_113411 | 241 |
| 514 | 3300021321 | Ga0214542_1025837 | Ga0214542_10258373 | 241 |
| 515 | 3300021327 | Ga0214543_1000027 | Ga0214543_1000027165 | 241 |
| 516 | 3300022739 | Ga0228711_1000041 | Ga0228711_100004156 | 241 |
| 517 | 3300022740 | Ga0228710_1000024 | Ga0228710_100002483 | 241 |
| 518 | 3300025208 | Ga0209436_100006 | Ga0209436_100006107 | 241 |
| 519 | 3300025208 | Ga0209436_100836 | Ga0209436_1008362 | 241 |
| 520 | 3300025245 | Ga0207425_1000012 | Ga0207425_1000012133 | 241 |
| 521 | 3300025245 | Ga0207425_1002717 | Ga0207425_10027174 | 241 |
| 522 | 3300025245 | Ga0207425_1006821 | Ga0207425_10068213 | 241 |
| 523 | 3300025258 | Ga0209129_1000105 | Ga0209129_100010588 | 241 |
| 524 | 3300025258 | Ga0209129_1000110 | Ga0209129_1000110133 | 241 |
| 525 | 3300025258 | Ga0209129_1000429 | Ga0209129_100042922 | 241 |
| 526 | 3300025258 | Ga0209129_1001484 | Ga0209129_10014844 | 241 |
| 527 | 3300025258 | Ga0209129_1001523 | Ga0209129_100152313 | 241 |
| 528 | 3300025258 | Ga0209129_1001602 | Ga0209129_100160213 | 241 |
| 529 | 3300025258 | Ga0209129_1002388 | Ga0209129_10023882 | 241 |
| 530 | 3300025273 | Ga0209673_1000015 | Ga0209673_1000015562 | 241 |
| 531 | 3300025273 | Ga0209673_1000063 | Ga0209673_1000063147 | 241 |
| 532 | 3300025273 | Ga0209673_1001004 | Ga0209673_100100424 | 241 |
| 533 | 3300025273 | Ga0209673_1002293 | Ga0209673_10022934 | 241 |
| 534 | 3300025273 | Ga0209673_1003895 | Ga0209673_10038952 | 241 |
| 535 | 3300025273 | Ga0209673_1006202 | Ga0209673_10062024 | 241 |
| 536 | 3300025273 | Ga0209673_1012901 | Ga0209673_10129012 | 241 |
| 537 | 3300025273 | Ga0209673_1056919 | Ga0209673_10569191 | 241 |
| 538 | 3300025284 | Ga0209130_1000002 | Ga0209130_1000002243 | 241 |
| 539 | 3300025284 | Ga0209130_1000005 | Ga0209130_1000005103 | 241 |
| 540 | 3300025292 | Ga0209676_1033105 | Ga0209676_10331052 | 241 |
| 541 | 3300025294 | Ga0209025_1000024 | Ga0209025_1000024133 | 241 |
| 542 | 3300025294 | Ga0209025_1000295 | Ga0209025_10002955 | 241 |
| 543 | 3300025294 | Ga0209025_1000638 | Ga0209025_100063824 | 241 |
| 544 | 3300025294 | Ga0209025_1003060 | Ga0209025_10030608 | 241 |
| 545 | 3300025294 | Ga0209025_1012788 | Ga0209025_10127881 | 241 |
| 546 | 3300025294 | Ga0209025_1013101 | Ga0209025_10131015 | 241 |
| 547 | 3300025294 | Ga0209025_1042695 | Ga0209025_10426951 | 241 |
| 548 | 3300025295 | Ga0209564_1000093 | Ga0209564_1000093106 | 241 |
| 549 | 3300025295 | Ga0209564_1000316 | Ga0209564_100031689 | 241 |
| 550 | 3300025295 | Ga0209564_1004460 | Ga0209564_10044607 | 241 |
| 551 | 3300025295 | Ga0209564_1008398 | Ga0209564_10083984 | 241 |
| 552 | 3300025295 | Ga0209564_1029360 | Ga0209564_10293602 | 241 |
| 553 | 3300025297 | Ga0209758_1000150 | Ga0209758_100015032 | 241 |
| 554 | 3300025297 | Ga0209758_1000361 | Ga0209758_100036142 | 241 |
| 555 | 3300025297 | Ga0209758_1000499 | Ga0209758_100049944 | 241 |
| 556 | 3300025297 | Ga0209758_1000876 | Ga0209758_100087618 | 241 |
| 557 | 3300025297 | Ga0209758_1001299 | Ga0209758_100129923 | 241 |
| 558 | 3300025297 | Ga0209758_1002582 | Ga0209758_10025826 | 241 |
| 559 | 3300025297 | Ga0209758_1007691 | Ga0209758_10076914 | 241 |
| 560 | 3300025297 | Ga0209758_1014373 | Ga0209758_10143732 | 241 |
| 561 | 3300025298 | Ga0209050_1011207 | Ga0209050_10112074 | 241 |
| 562 | 3300025298 | Ga0209050_1019868 | Ga0209050_10198682 | 241 |
| 563 | 3300025299 | Ga0209256_1000027 | Ga0209256_1000027306 | 241 |
| 564 | 3300025299 | Ga0209256_1000880 | Ga0209256_100088032 | 241 |
| 565 | 3300025299 | Ga0209256_1001669 | Ga0209256_100166912 | 241 |
| 566 | 3300025299 | Ga0209256_1002179 | Ga0209256_100217918 | 241 |
| 567 | 3300025299 | Ga0209256_1005310 | Ga0209256_10053104 | 241 |
| 568 | 3300025299 | Ga0209256_1005901 | Ga0209256_10059014 | 241 |
| 569 | 3300025299 | Ga0209256_1006338 | Ga0209256_10063387 | 241 |
| 570 | 3300025299 | Ga0209256_1016791 | Ga0209256_10167912 | 241 |
| 571 | 3300025299 | Ga0209256_1044286 | Ga0209256_10442861 | 241 |
| 572 | 3300025302 | Ga0207426_1000013 | Ga0207426_1000013243 | 241 |
| 573 | 3300025302 | Ga0207426_1000015 | Ga0207426_1000015496 | 241 |
| 574 | 3300025302 | Ga0207426_1000070 | Ga0207426_1000070201 | 241 |
| 575 | 3300025302 | Ga0207426_1001614 | Ga0207426_100161418 | 241 |
| 576 | 3300025303 | Ga0209051_1000135 | Ga0209051_100013571 | 241 |
| 577 | 3300025303 | Ga0209051_1006292 | Ga0209051_10062922 | 241 |
| 578 | 3300025303 | Ga0209051_1055969 | Ga0209051_10559692 | 241 |
| 579 | 3300025303 | Ga0209051_1064569 | Ga0209051_10645692 | 241 |
| 580 | 3300025304 | Ga0209257_1005318 | Ga0209257_10053188 | 241 |
| 581 | 3300025304 | Ga0209257_1029056 | Ga0209257_10290562 | 241 |
| 582 | 3300025925 | Ga0207650_10000776 | Ga0207650_1000077622 | 241 |
| 583 | 3300025941 | Ga0207711_10167094 | Ga0207711_101670943 | 241 |
| 584 | 3300025986 | Ga0207658_10277195 | Ga0207658_102771952 | 241 |
| 585 | 3300027111 | Ga0209281_1000409 | Ga0209281_100040922 | 241 |
| 586 | 3300027312 | Ga0209371_1000009 | Ga0209371_1000009561 | 241 |
| 587 | 3300027312 | Ga0209371_1000424 | Ga0209371_100042446 | 241 |
| 588 | 3300027666 | Ga0209282_1000090 | Ga0209282_100009022 | 241 |
| 589 | 3300027866 | Ga0209813_10115148 | Ga0209813_101151481 | 241 |
| 590 | 3300028379 | Ga0268266_10119922 | Ga0268266_101199222 | 241 |
| 591 | 3300028380 | Ga0268265_10853713 | Ga0268265_108537131 | 241 |
| 592 | 3300028794 | Ga0307515_10000674 | Ga0307515_1000067411 | 241 |
| 593 | 3300028794 | Ga0307515_10006511 | Ga0307515_1000651119 | 241 |
| 594 | 3300028794 | Ga0307515_10012267 | Ga0307515_1001226712 | 241 |
| 595 | 3300028794 | Ga0307515_10148902 | Ga0307515_101489022 | 241 |
| 596 | 3300030500 | Ga0268256_1000010 | Ga0268256_1000010560 | 241 |
| 597 | 3300031456 | Ga0307513_10000180 | Ga0307513_100001802 | 241 |
| 598 | 3300031456 | Ga0307513_10236576 | Ga0307513_102365763 | 241 |
| 599 | 3300031731 | Ga0307405_10000250 | Ga0307405_1000025015 | 241 |
| 600 | 3300031901 | Ga0307406_10002749 | Ga0307406_1000274913 | 241 |
| 601 | 3300031911 | Ga0307412_10000491 | Ga0307412_100004915 | 241 |
| 602 | 3300031911 | Ga0307412_10527791 | Ga0307412_105277912 | 241 |
| 603 | 3300031967 | Ga0315914_1000167 | Ga0315914_100016742 | 241 |
| 604 | 3300032002 | Ga0307416_100620524 | Ga0307416_1006205242 | 241 |
| 605 | 3300032004 | Ga0307414_10727507 | Ga0307414_107275072 | 241 |
| 606 | 3300033430 | Ga0315913_1000038 | Ga0315913_100003842 | 241 |
| 607 | 3300033464 | Ga0315915_1000019 | Ga0315915_100001922 | 241 |
| 608 | 3300041406 | Ga0439439_0027122 | Ga0439439_0027122_190_915 | 241 |
| 609 | 3300041407 | Ga0439447_022451 | Ga0439447_022451_815_1540 | 241 |
| 610 | 3300041413 | Ga0439465_0004487 | Ga0439465_0004487_2682_3407 | 241 |
| 611 | 3300041413 | Ga0439465_0019725 | Ga0439465_0019725_1267_1992 | 241 |
| 612 | 3300041441 | Ga0451787_252007 | Ga0451787_252007_1607_2332 | 241 |
| 613 | 3300041451 | Ga0451791_0180341 | Ga0451791_0180341_132_866 | 241 |
| 614 | 3300041492 | Ga0451835_0388755 | Ga0451835_0388755_119_856 | 241 |
| 615 | 3300041494 | Ga0451837_0526223 | Ga0451837_0526223_43_768 | 241 |
| 616 | 3300041496 | Ga0451839_0199143 | Ga0451839_0199143_960_1685 | 241 |
| 617 | 3300041498 | Ga0451841_1408368 | Ga0451841_1408368_119_856 | 241 |
| 618 | 3300041501 | Ga0451845_0150991 | Ga0451845_0150991_184_921 | 241 |
| 619 | 3300041503 | Ga0451847_0236407 | Ga0451847_0236407_245_970 | 241 |
| 620 | 3300041507 | Ga0451851_0308271 | Ga0451851_0308271_439_1164 | 241 |
| 621 | 3300041509 | Ga0451843_1263341 | Ga0451843_1263341_378_1103 | 241 |
| 622 | 3300041511 | Ga0451855_2061497 | Ga0451855_2061497_628_1353 | 241 |
| 623 | 3300041512 | Ga0451853_3650313 | Ga0451853_3650313_780_1505 | 241 |
| 624 | 3300042015 | Ga0439462_0011595 | Ga0439462_0011595_137_862 | 241 |
| 625 | 3300046454 | Ga0495592_0186801 | Ga0495592_0186801_511_1266 | 241 |
| 626 | 3300046459 | Ga0495629_0012377 | Ga0495629_0012377_2155_2880 | 241 |
| 627 | 3300046460 | Ga0495638_0020006 | Ga0495638_0020006_3266_4018 | 241 |
| 628 | 3300046474 | Ga0495605_0024123 | Ga0495605_0024123_281_1033 | 241 |
| 629 | 3300046475 | Ga0495639_0125449 | Ga0495639_0125449_235_960 | 241 |
| 630 | 3300046476 | Ga0495662_0012312 | Ga0495662_0012312_2517_3242 | 241 |
| 631 | 3300046492 | Ga0495585_0009240 | Ga0495585_0009240_4724_5449 | 241 |
| 632 | 3300046501 | Ga0495607_0018739 | Ga0495607_0018739_961_1698 | 241 |
| 633 | 3300046506 | Ga0495583_0003772 | Ga0495583_0003772_2083_2808 | 241 |
| 634 | 3300046507 | Ga0495606_0164468 | Ga0495606_0164468_220_945 | 241 |
| 635 | 3300046507 | Ga0495606_0184566 | Ga0495606_0184566_83_808 | 241 |
| 636 | 3300046512 | Ga0495610_0000461 | Ga0495610_0000461_19579_20304 | 241 |
| 637 | 3300046512 | Ga0495610_0118502 | Ga0495610_0118502_211_936 | 241 |
| 638 | 3300046514 | Ga0495618_0250994 | Ga0495618_0250994_267_992 | 241 |
| 639 | 3300046515 | Ga0495620_0067648 | Ga0495620_0067648_342_1067 | 241 |
| 640 | 3300046515 | Ga0495620_0115391 | Ga0495620_0115391_273_998 | 241 |
| 641 | 3300046515 | Ga0495620_0139721 | Ga0495620_0139721_141_878 | 241 |
| 642 | 3300046518 | Ga0495631_0019196 | Ga0495631_0019196_1273_2025 | 241 |
| 643 | 3300046518 | Ga0495631_0084809 | Ga0495631_0084809_273_1046 | 241 |
| 644 | 3300046519 | Ga0495632_0006289 | Ga0495632_0006289_417_1142 | 241 |
| 645 | 3300046519 | Ga0495632_0070468 | Ga0495632_0070468_696_1448 | 241 |
| 646 | 3300046522 | Ga0495643_0008921 | Ga0495643_0008921_5353_6090 | 241 |
| 647 | 3300046522 | Ga0495643_0050571 | Ga0495643_0050571_312_1037 | 241 |
| 648 | 3300046524 | Ga0495648_0037751 | Ga0495648_0037751_1222_1959 | 241 |
| 649 | 3300046529 | Ga0495652_0196599 | Ga0495652_0196599_449_1207 | 241 |
| 650 | 3300046536 | Ga0495587_0068202 | Ga0495587_0068202_502_1227 | 241 |
| 651 | 3300046538 | Ga0495609_0047847 | Ga0495609_0047847_489_1241 | 241 |
| 652 | 3300046558 | Ga0495633_0046861 | Ga0495633_0046861_607_1332 | 241 |
| 653 | 3300046558 | Ga0495633_0073927 | Ga0495633_0073927_589_1362 | 241 |
| 654 | 3300046615 | Ga0495656_0018785 | Ga0495656_0018785_405_1178 | 241 |
| 655 | 3300046616 | Ga0495668_0097091 | Ga0495668_0097091_371_1123 | 241 |
| 656 | 3300046616 | Ga0495668_0216647 | Ga0495668_0216647_175_900 | 241 |
| 657 | 3300046642 | Ga0495634_0128294 | Ga0495634_0128294_610_1335 | 241 |
| 658 | 3300046660 | Ga0495625_0026846 | Ga0495625_0026846_385_1137 | 241 |
| 659 | 3300046660 | Ga0495625_0250888 | Ga0495625_0250888_199_924 | 241 |
| 660 | 3300046663 | Ga0495635_0057071 | Ga0495635_0057071_925_1650 | 241 |
| 661 | 3300046665 | Ga0495661_0100588 | Ga0495661_0100588_736_1473 | 241 |
| 662 | 3300046665 | Ga0495661_0125309 | Ga0495661_0125309_532_1257 | 241 |
| 663 | 3300046665 | Ga0495661_0201396 | Ga0495661_0201396_241_978 | 241 |
| 664 | 3300046665 | Ga0495661_0240021 | Ga0495661_0240021_52_825 | 241 |
| 665 | 3300046674 | Ga0495588_0030848 | Ga0495588_0030848_1369_2094 | 241 |
| 666 | 3300046674 | Ga0495588_0031208 | Ga0495588_0031208_1687_2460 | 241 |
| 667 | 3300046679 | Ga0495623_0180036 | Ga0495623_0180036_449_1174 | 241 |
| 668 | 3300046680 | Ga0495646_0160553 | Ga0495646_0160553_127_885 | 241 |
| 669 | 3300046690 | Ga0495624_0166998 | Ga0495624_0166998_169_894 | 241 |
| 670 | 3300046691 | Ga0495670_0182377 | Ga0495670_0182377_223_975 | 241 |
| 671 | 3300046691 | Ga0495670_0262256 | Ga0495670_0262256_125_850 | 241 |
| 672 | 3300046694 | Ga0495649_0173544 | Ga0495649_0173544_339_1064 | 241 |
| 673 | 3300046794 | Ga0495589_0189453 | Ga0495589_0189453_69_794 | 241 |
| 674 | 3300046809 | Ga0495600_0016251 | Ga0495600_0016251_2807_3565 | 241 |
| 675 | 3300046810 | Ga0495660_0077835 | Ga0495660_0077835_735_1472 | 241 |
| 676 | 3300046810 | Ga0495660_0156043 | Ga0495660_0156043_257_1009 | 241 |
| 677 | 3300047320 | Ga0495672_0150290 | Ga0495672_0150290_168_920 | 241 |
| 678 | 3300047443 | Ga0495687_068328 | Ga0495687_068328_469_1206 | 241 |
| 679 | 3300047470 | Ga0495681_0106643 | Ga0495681_0106643_344_1117 | 241 |
| 680 | 3300047472 | Ga0495686_0125744 | Ga0495686_0125744_460_1185 | 241 |
| 681 | 3300048091 | Ga0495626_0123295 | Ga0495626_0123295_34_759 | 241 |
| 682 | 3300048904 | Ga0496101_0576949 | Ga0496101_0576949_110_835 | 241 |
| 683 | 3300048905 | Ga0496102_0409297 | Ga0496102_0409297_71_796 | 241 |
| 684 | 3300048907 | Ga0496104_0081774 | Ga0496104_0081774_484_1209 | 241 |
| 685 | 3300048908 | Ga0496105_0179781 | Ga0496105_0179781_413_1138 | 241 |
| 686 | 3300048909 | Ga0496106_0004867 | Ga0496106_0004867_7662_8399 | 241 |
| 687 | 3300048909 | Ga0496106_0409795 | Ga0496106_0409795_238_963 | 241 |
| 688 | 3300048914 | Ga0496111_0177519 | Ga0496111_0177519_455_1180 | 241 |
| 689 | 3300048916 | Ga0496113_0253089 | Ga0496113_0253089_440_1165 | 241 |
| 690 | 3300048919 | Ga0496116_0001406 | Ga0496116_0001406_8359_9084 | 241 |
| 691 | 3300048919 | Ga0496116_0004126 | Ga0496116_0004126_13124_13849 | 241 |
| 692 | 3300048919 | Ga0496116_0058538 | Ga0496116_0058538_1449_2174 | 241 |
| 693 | 3300048919 | Ga0496116_0103637 | Ga0496116_0103637_699_1424 | 241 |
| 694 | 3300048919 | Ga0496116_0194716 | Ga0496116_0194716_149_874 | 241 |
| 695 | 3300048919 | Ga0496116_0206798 | Ga0496116_0206798_70_795 | 241 |
| 696 | 3300048920 | Ga0496117_0014921 | Ga0496117_0014921_5522_6247 | 241 |
| 697 | 3300048920 | Ga0496117_0018471 | Ga0496117_0018471_4605_5330 | 241 |
| 698 | 3300048920 | Ga0496117_0128717 | Ga0496117_0128717_362_1087 | 241 |
| 699 | 3300048921 | Ga0496118_0008398 | Ga0496118_0008398_9467_10192 | 241 |
| 700 | 3300048921 | Ga0496118_0016889 | Ga0496118_0016889_5518_6243 | 241 |
| 701 | 3300048921 | Ga0496118_0172845 | Ga0496118_0172845_172_897 | 241 |
| 702 | 3300048922 | Ga0496119_0130450 | Ga0496119_0130450_435_1160 | 241 |
| 703 | 3300048923 | Ga0496120_0130402 | Ga0496120_0130402_420_1145 | 241 |
| 704 | 3300048924 | Ga0496121_0020076 | Ga0496121_0020076_5203_5928 | 241 |
| 705 | 3300048924 | Ga0496121_0022942 | Ga0496121_0022942_3185_3910 | 241 |
| 706 | 3300048924 | Ga0496121_0082337 | Ga0496121_0082337_1427_2152 | 241 |
| 707 | 3300048924 | Ga0496121_0158392 | Ga0496121_0158392_704_1429 | 241 |
| 708 | 3300048924 | Ga0496121_0215321 | Ga0496121_0215321_331_1056 | 241 |
| 709 | 3300048924 | Ga0496121_0251863 | Ga0496121_0251863_416_1141 | 241 |
| 710 | 3300048924 | Ga0496121_0368336 | Ga0496121_0368336_196_921 | 241 |
| 711 | 3300048925 | Ga0496122_0011942 | Ga0496122_0011942_2729_3454 | 241 |
| 712 | 3300048925 | Ga0496122_0113149 | Ga0496122_0113149_704_1429 | 241 |
| 713 | 3300048925 | Ga0496122_0113242 | Ga0496122_0113242_268_1038 | 241 |
| 714 | 3300048925 | Ga0496122_0126887 | Ga0496122_0126887_548_1273 | 241 |
| 715 | 3300048925 | Ga0496122_0164022 | Ga0496122_0164022_207_932 | 241 |
| 716 | 3300048925 | Ga0496122_0238193 | Ga0496122_0238193_269_994 | 241 |
| 717 | 3300048926 | Ga0496123_0122457 | Ga0496123_0122457_704_1429 | 241 |
| 718 | 3300048927 | Ga0496124_0000513 | Ga0496124_0000513_13805_14530 | 241 |
| 719 | 3300048927 | Ga0496124_0002549 | Ga0496124_0002549_5546_6271 | 241 |
| 720 | 3300048927 | Ga0496124_0025777 | Ga0496124_0025777_3537_4262 | 241 |
| 721 | 3300048927 | Ga0496124_0307216 | Ga0496124_0307216_175_900 | 241 |
| 722 | 3300048928 | Ga0496125_0000299 | Ga0496125_0000299_63236_63961 | 241 |
| 723 | 3300048928 | Ga0496125_0001813 | Ga0496125_0001813_6864_7589 | 241 |
| 724 | 3300048928 | Ga0496125_0009396 | Ga0496125_0009396_6483_7208 | 241 |
| 725 | 3300048928 | Ga0496125_0239752 | Ga0496125_0239752_33_758 | 241 |
| 726 | 3300048929 | Ga0496126_0093859 | Ga0496126_0093859_583_1308 | 241 |
| 727 | 3300048929 | Ga0496126_0397111 | Ga0496126_0397111_242_967 | 241 |
| 728 | 3300048929 | Ga0496126_0434326 | Ga0496126_0434326_159_884 | 241 |
| 729 | 3300048929 | Ga0496126_0552677 | Ga0496126_0552677_75_803 | 241 |
| 730 | 3300049459 | Ga0495678_048231 | Ga0495678_048231_720_1472 | 241 |
| 731 | 3300049571 | Ga0501034_0393480 | Ga0501034_0393480_448_1173 | 241 |
| 732 | 3300049572 | Ga0501036_0479877 | Ga0501036_0479877_184_909 | 241 |
| 733 | 3300049573 | Ga0501037_0017214 | Ga0501037_0017214_2884_3609 | 241 |
| 734 | 3300049574 | Ga0501038_0098497 | Ga0501038_0098497_1377_2102 | 241 |
| 735 | 3300049581 | Ga0501047_0291556 | Ga0501047_0291556_442_1167 | 241 |
| 736 | 3300049582 | Ga0501048_0426182 | Ga0501048_0426182_108_833 | 241 |
| 737 | 3300049744 | Ga0501083_0197816 | Ga0501083_0197816_127_852 | 241 |
| 738 | 3300049744 | Ga0501083_0273715 | Ga0501083_0273715_207_932 | 241 |
| 739 | 3300049823 | Ga0501044_0061070 | Ga0501044_0061070_2553_3278 | 241 |
| 740 | 3300050489 | nmdc:mga03683_14045_c1 | nmdc:mga03683_14045_c1_1630_2355 | 241 |
| 741 | 3300050516 | nmdc:mga0sz30_153158_c1 | nmdc:mga0sz30_153158_c1_35_763 | 241 |
| 742 | 3300053086 | Ga0500578_0280382 | Ga0500578_0280382_184_921 | 241 |
| 743 | 3300053134 | Ga0500658_0001142 | Ga0500658_0001142_6001_6726 | 241 |
| 744 | 3300053139 | Ga0500568_0004265 | Ga0500568_0004265_2203_2940 | 241 |
| 745 | 3300053139 | Ga0500568_0011577 | Ga0500568_0011577_1042_1794 | 241 |
| 746 | 3300053140 | Ga0500573_0001761 | Ga0500573_0001761_2311_3036 | 241 |
| 747 | 3300053140 | Ga0500573_0028647 | Ga0500573_0028647_1385_2110 | 241 |
| 748 | 3300053148 | Ga0500590_005274 | Ga0500590_005274_1375_2100 | 241 |
| 749 | 3300053151 | Ga0500604_0039960 | Ga0500604_0039960_611_1348 | 241 |
| 750 | 3300053153 | Ga0500616_0014549 | Ga0500616_0014549_503_1255 | 241 |
| 751 | 3300053153 | Ga0500616_0127806 | Ga0500616_0127806_178_903 | 241 |
| 752 | 3300053156 | Ga0500622_0002165 | Ga0500622_0002165_1655_2380 | 241 |
| 753 | 3300053156 | Ga0500622_0033119 | Ga0500622_0033119_558_1295 | 241 |
| 754 | 3300053160 | Ga0500633_0030243 | Ga0500633_0030243_22_759 | 241 |
| 755 | 3300059641 | Ga0587068_011792 | Ga0587068_011792_182_910 | 241 |
| 756 | iso_pu_bacteria | 2582581308 | 2585280125 | 241 |
| 757 | iso_pu_bacteria | 2582581315 | 2585326096 | 241 |
| 758 | iso_pu_bacteria | 2582581316 | 2585330261 | 241 |
| 759 | iso_pu_bacteria | 2585427527 | 2585533624 | 241 |
| 760 | iso_pu_bacteria | 2585427530 | 2585553215 | 241 |
| 761 | iso_pu_bacteria | 2585427608 | 2585900674 | 241 |
| 762 | iso_pu_bacteria | 2615840624 | 2616293607 | 241 |
| 763 | iso_pu_bacteria | 2615840626 | 2616310328 | 241 |
| 764 | iso_pu_bacteria | 2615840698 | 2616553293 | 241 |
| 765 | iso_pu_bacteria | 2667528174 | 2671113777 | 241 |
| 766 | iso_pu_bacteria | 2718217882 | 2719179374 | 241 |
| 767 | iso_pu_bacteria | 2718217927 | 2719383946 | 241 |
| 768 | iso_pu_bacteria | 2718218009 | 2719730044 | 241 |
| 769 | iso_pu_bacteria | 2718218363 | 2721145467 | 241 |
| 770 | iso_pu_bacteria | 2718218365 | 2721157001 | 241 |
| 771 | iso_pu_bacteria | 2718218366 | 2721162362 | 241 |
| 772 | iso_pu_bacteria | 2718218423 | 2721397716 | 241 |
| 773 | iso_pu_bacteria | 2721755514 | 2722838532 | 241 |
| 774 | iso_pu_bacteria | 2721755809 | 2724036526 | 241 |
| 775 | iso_pu_bacteria | 2721755810 | 2724042800 | 241 |
| 776 | iso_pu_bacteria | 2728369365 | 2730162611 | 241 |
| 777 | iso_pu_bacteria | 2728369397 | 2730296633 | 241 |
| 778 | iso_pu_bacteria | 2775507266 | 2778179601 | 241 |
| 779 | iso_pu_bacteria | 2791355260 | 2793325100 | 241 |
| 780 | iso_pu_bacteria | 2791355264 | 2793348325 | 241 |
| 781 | iso_pu_bacteria | 2791355266 | 2793363800 | 241 |
| 782 | iso_pu_bacteria | 2802429605 | 2805931977 | 241 |
| 783 | iso_pu_bacteria | 2802429606 | 2805932530 | 241 |
| 784 | iso_pu_bacteria | 2818991453 | 2819640632 | 241 |
| 785 | iso_pu_bacteria | 2838022645 | 2838027657 | 241 |
| 786 | iso_pu_bacteria | 2838061910 | 2838064247 | 241 |
| 787 | iso_pu_bacteria | 2838668709 | 2838673369 | 241 |
| 788 | iso_pu_bacteria | 2838680041 | 2838680411 | 241 |
| 789 | iso_pu_bacteria | 2838686498 | 2838691792 | 241 |
| 790 | iso_pu_bacteria | 2838694306 | 2838695556 | 241 |
| 791 | iso_pu_bacteria | 2838701080 | 2838706116 | 241 |
| 792 | iso_pu_bacteria | 2838707686 | 2838708933 | 241 |
| 793 | iso_pu_bacteria | 2838729681 | 2838733724 | 241 |
| 794 | iso_pu_bacteria | 2838742623 | 2838749582 | 241 |
| 795 | iso_pu_bacteria | 2841851746 | 2841856353 | 241 |
| 796 | iso_pu_bacteria | 2842077413 | 2842079832 | 241 |
| 797 | iso_pu_bacteria | 2842110456 | 2842112012 | 241 |
| 798 | iso_pu_bacteria | 2842118031 | 2842120450 | 241 |
| 799 | iso_pu_bacteria | 2842146304 | 2842150541 | 241 |
| 800 | iso_pu_bacteria | 2842156927 | 2842162142 | 241 |
| 801 | iso_pu_bacteria | 2842163707 | 2842165356 | 241 |
| 802 | iso_pu_bacteria | 2842180545 | 2842185983 | 241 |
| 803 | iso_pu_bacteria | 2842192696 | 2842192727 | 241 |
| 804 | iso_pu_bacteria | 2842198810 | 2842204214 | 241 |
| 805 | iso_pu_bacteria | 2842229732 | 2842236225 | 241 |
| 806 | iso_pu_bacteria | 2842237096 | 2842238344 | 241 |
| 807 | iso_pu_bacteria | 2842243621 | 2842248034 | 241 |
| 808 | iso_pu_bacteria | 2842250916 | 2842255580 | 241 |
| 809 | iso_pu_bacteria | 2842257432 | 2842262372 | 241 |
| 810 | iso_pu_bacteria | 2842271015 | 2842276765 | 241 |
| 811 | iso_pu_bacteria | 2842291075 | 2842293493 | 241 |
| 812 | iso_pu_bacteria | 2842298080 | 2842299570 | 241 |
| 813 | iso_pu_bacteria | 2842304105 | 2842311098 | 241 |
| 814 | iso_pu_bacteria | 2842357229 | 2842360998 | 241 |
| 815 | iso_pu_bacteria | 2842370503 | 2842370874 | 241 |
| 816 | iso_pu_bacteria | 2842377471 | 2842379890 | 241 |
| 817 | iso_pu_bacteria | 2842384541 | 2842386961 | 241 |
| 818 | iso_pu_bacteria | 2842395702 | 2842399044 | 241 |
| 819 | iso_pu_bacteria | 2842489311 | 2842492622 | 241 |
| 820 | iso_pu_bacteria | 2842509118 | 2842512786 | 241 |
| 821 | iso_pu_bacteria | 2844454524 | 2844456201 | 241 |
| 822 | iso_pu_bacteria | 2857516855 | 2857521869 | 241 |
| 823 | iso_pu_bacteria | 2933570622 | 2933577002 | 241 |
| 824 | iso_pu_bacteria | 2933586486 | 2933587341 | 241 |
| 825 | iso_pu_bacteria | 2935894831 | 2935896080 | 241 |
| 826 | iso_pu_bacteria | 2935901341 | 2935902724 | 241 |
| 827 | iso_pu_bacteria | 2936367885 | 2936369130 | 241 |
| 828 | iso_pu_bacteria | 2936375103 | 2936377527 | 241 |
| 829 | iso_pu_bacteria | 8005275841 | 8005278656 | 241 |
| 830 | iso_pu_bacteria | 8005282627 | 8005289190 | 241 |
| 831 | iso_pu_bacteria | 8005307578 | 8005310651 | 241 |
| 832 | iso_pu_bacteria | 8005376324 | 8005377622 | 241 |
| 833 | iso_pu_bacteria | 8005484373 | 8005484831 | 241 |
| 834 | iso_pu_bacteria | 8005563573 | 8005564122 | 241 |
| 835 | iso_pu_bacteria | 8005695170 | 8005699462 | 241 |
| 836 | iso_pu_bacteria | 8018127388 | 8018132913 | 241 |
| 837 | iso_pu_bacteria | 8018163183 | 8018165407 | 241 |
| 838 | iso_pu_bacteria | 8018176218 | 8018181018 | 241 |
| 839 | iso_pu_bacteria | 8023680758 | 8023684437 | 241 |
| 840 | iso_pu_bacteria | 8024486573 | 8024491528 | 241 |
| 841 | iso_pu_bacteria | 8024501048 | 8024501764 | 241 |
| 842 | iso_pu_bacteria | 8046767195 | 8046770821 | 241 |
| 843 | iso_pu_bacteria | 8057575449 | 8057580575 | 241 |
| 844 | iso_pu_bacteria | 8057874678 | 8057875842 | 241 |
| 845 | 3300002704 | JGI25155J39150_1000013 | JGI25155J39150_100001330 | 242 |
| 846 | 3300002705 | JGI25156J39149_1000011 | JGI25156J39149_100001130 | 242 |
| 847 | 3300002738 | JGI25154J39366_1000030 | JGI25154J39366_100003030 | 242 |
| 848 | 3300002741 | JGI25157J39369_1000013 | JGI25157J39369_100001330 | 242 |
| 849 | 3300025206 | Ga0209435_100026 | Ga0209435_10002630 | 242 |
| 850 | 3300025246 | Ga0209646_1000084 | Ga0209646_100008430 | 242 |
| 851 | 3300025250 | Ga0209026_1000080 | Ga0209026_100008030 | 242 |
| 852 | 3300025256 | Ga0209759_1000061 | Ga0209759_100006130 | 242 |
| 853 | 3300046507 | Ga0495606_0001337 | Ga0495606_0001337_21510_22238 | 242 |
| 854 | 3300047472 | Ga0495686_0016096 | Ga0495686_0016096_2878_3606 | 242 |
| 855 | 3300047472 | Ga0495686_0040112 | Ga0495686_0040112_2182_2910 | 242 |
| 856 | 3300048924 | Ga0496121_0013386 | Ga0496121_0013386_7299_8027 | 242 |
| 857 | iso_pu_bacteria | 2524023209 | 2524458244 | 242 |
| 858 | iso_pu_bacteria | 2617270742 | 2617380375 | 242 |
| 859 | iso_pu_bacteria | 2842482326 | 2842487629 | 242 |
| 860 | iso_pu_bacteria | 2852387548 | 2852388356 | 242 |
| 861 | iso_pu_bacteria | 2919408235 | 2919408684 | 242 |
| 862 | iso_pu_bacteria | 3005416602 | 3005422924 | 242 |
| 863 | iso_pu_bacteria | 8005314921 | 8005321540 | 242 |
| 864 | iso_pu_bacteria | 8056875544 | 8056877128 | 242 |
| 865 | 3300003323 | rootH1_10130347 | rootH1_101303472 | 244 |
| 866 | 3300001979 | JGI24740J21852_10000426 | JGI24740J21852_100004262 | 245 |
| 867 | 3300002737 | JGI25162J39368_1000169 | JGI25162J39368_100016952 | 245 |
| 868 | 3300002737 | JGI25162J39368_1000698 | JGI25162J39368_10006986 | 245 |
| 869 | 3300003214 | JGI25165J46597_1000349 | JGI25165J46597_100034923 | 245 |
| 870 | 3300003214 | JGI25165J46597_1000355 | JGI25165J46597_10003553 | 245 |
| 871 | 3300003354 | JGI25160J50197_1000041 | JGI25160J50197_100004197 | 245 |
| 872 | 3300003374 | JGI25161J50226_1000002 | JGI25161J50226_100000297 | 245 |
| 873 | 3300004625 | Ga0055543_1000008 | Ga0055543_100000819 | 245 |
| 874 | 3300005262 | Ga0065165_1000031 | Ga0065165_1000031110 | 245 |
| 875 | 3300005548 | Ga0070665_100085654 | Ga0070665_1000856542 | 245 |
| 876 | 3300005563 | Ga0068855_100086831 | Ga0068855_1000868312 | 245 |
| 877 | 3300005614 | Ga0068856_100094550 | Ga0068856_1000945502 | 245 |
| 878 | 3300005834 | Ga0068851_10026861 | Ga0068851_100268612 | 245 |
| 879 | 3300009093 | Ga0105240_10000460 | Ga0105240_1000046069 | 245 |
| 880 | 3300009545 | Ga0105237_10001005 | Ga0105237_100010056 | 245 |
| 881 | 3300010375 | Ga0105239_10002984 | Ga0105239_1000298419 | 245 |
| 882 | 3300013104 | Ga0157370_10000879 | Ga0157370_1000087928 | 245 |
| 883 | 3300015262 | Ga0182007_10003141 | Ga0182007_100031415 | 245 |
| 884 | 3300015265 | Ga0182005_1001666 | Ga0182005_10016665 | 245 |
| 885 | 3300025233 | Ga0209437_100056 | Ga0209437_10005688 | 245 |
| 886 | 3300025233 | Ga0209437_100196 | Ga0209437_10019692 | 245 |
| 887 | 3300025253 | Ga0209677_102042 | Ga0209677_1020426 | 245 |
| 888 | 3300025261 | Ga0209233_1000037 | Ga0209233_1000037470 | 245 |
| 889 | 3300025261 | Ga0209233_1000071 | Ga0209233_100007188 | 245 |
| 890 | 3300025261 | Ga0209233_1000243 | Ga0209233_100024328 | 245 |
| 891 | 3300025272 | Ga0209455_1009107 | Ga0209455_10091072 | 245 |
| 892 | 3300025272 | Ga0209455_1036307 | Ga0209455_10363071 | 245 |
| 893 | 3300025284 | Ga0209130_1000382 | Ga0209130_100038229 | 245 |
| 894 | 3300025302 | Ga0207426_1000012 | Ga0207426_1000012231 | 245 |
| 895 | 3300025321 | Ga0207656_10027931 | Ga0207656_100279312 | 245 |
| 896 | 3300025904 | Ga0207647_10274920 | Ga0207647_102749201 | 245 |
| 897 | 3300025913 | Ga0207695_10000036 | Ga0207695_1000003668 | 245 |
| 898 | 3300025914 | Ga0207671_10000153 | Ga0207671_100001536 | 245 |
| 899 | 3300026078 | Ga0207702_10119215 | Ga0207702_101192152 | 245 |
| 900 | 3300026142 | Ga0207698_10049414 | Ga0207698_100494141 | 245 |
| 901 | 3300048903 | Ga0496100_0035945 | Ga0496100_0035945_702_1439 | 245 |
| 902 | 3300048905 | Ga0496102_0006201 | Ga0496102_0006201_8601_9338 | 245 |
| 903 | 3300048906 | Ga0496103_0015905 | Ga0496103_0015905_3479_4216 | 245 |
| 904 | 3300048919 | Ga0496116_0002602 | Ga0496116_0002602_5195_5932 | 245 |
| 905 | 3300048920 | Ga0496117_0001819 | Ga0496117_0001819_20329_21066 | 245 |
| 906 | 3300048921 | Ga0496118_0001431 | Ga0496118_0001431_24429_25166 | 245 |
| 907 | 3300048922 | Ga0496119_0054477 | Ga0496119_0054477_608_1345 | 245 |
| 908 | 3300048923 | Ga0496120_0010487 | Ga0496120_0010487_1125_1862 | 245 |
| 909 | 3300048924 | Ga0496121_0002730 | Ga0496121_0002730_20061_20798 | 245 |
| 910 | 3300048925 | Ga0496122_0008977 | Ga0496122_0008977_1286_2023 | 245 |
| 911 | 3300048926 | Ga0496123_0009204 | Ga0496123_0009204_906_1643 | 245 |
| 912 | 3300048927 | Ga0496124_0053734 | Ga0496124_0053734_1124_1861 | 245 |
| 913 | 3300048928 | Ga0496125_0020123 | Ga0496125_0020123_5343_6080 | 245 |
| 914 | 3300048928 | Ga0496125_0130962 | Ga0496125_0130962_398_1138 | 245 |
| 915 | 3300048929 | Ga0496126_0048725 | Ga0496126_0048725_1901_2638 | 245 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dfm-assembly1.cif.gz_A | the crystal structure of the zinc inhibited form of teicoplanin deacetylase orf2 | 0.7381 | 69 | 97 |
| 6nvo-assembly1.cif.gz_A | crystal structure of pseudomonas putida nuclease mpe | 0.7069 | 21 | 238 |
| 6nvo-assembly1.cif.gz_A | crystal structure of pseudomonas putida nuclease mpe | 0.7039 | 21 | 238 |
| 6nvp-assembly1.cif.gz_A | crystal structure of pseudomonas putida nuclease mpe | 0.6953 | 21 | 238 |
| 6nvp-assembly1.cif.gz_A | crystal structure of pseudomonas putida nuclease mpe | 0.6928 | 21 | 238 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dfmA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like | 0.7381 | 69 | 97 | 3.40.50.10320 |
| af_Q7XA67_1_254_3.40.50.1580 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nucleoside phosphorylase domain | 0.7061 | 72 | 96 | 3.40.50.1580 |
| af_Q60344_23_147_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.6646 | 49 | 160 | 3.60.21.10 |
| af_Q2G290_1_180_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.664 | 74 | 131 | 3.40.50.2000 |
| af_A0A0R0JB13_452_710_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.6576 | 71 | 128 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258KG66-F1-model_v4 | Phosphoesterase | 0.9341 | 32 | 101 |
|
| AF-A0A3S1QVR4-F1-model_v4 | Metallophosphatase | 0.8956 | 17 | 160 |
GO:0016787
|
| AF-A0A4Q3SJX5-F1-model_v4 | Ligase-associated DNA damage response endonuclease PdeM (EC 3.1.-.-) | 0.8901 | 21 | 174 |
GO:0004519
GO:0016874 |
| AF-A0A259M2T5-F1-model_v4 | Metallophosphoesterase | 0.8901 | 21 | 160 |
GO:0016787
|
| AF-A0A4Q5TWE3-F1-model_v4 | Metallophosphoesterase | 0.8901 | 21 | 101 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar