F485580
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 914 | 300 | 1828 | 177 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0218663|Ga0495628_0218663_661_1305 |
| Length | 197 |
| Sequence | LDFGLPHSFAFKRGLVFVAGHSSFLIIPMIFIPPLDWMFNAHVYIVPVIVFYGAMALPFPLMLALAFFAGFLWDALTVQVLDVAHVEISFGWSILLYAVLAAIMHGLKPLFNRGRWEVHCILSGICTSVILLTQYLMISFRRGSIIFDREVWWQIGGPGLLAMLMAPLVFWSLHWLSRLTNNPYQPQEEPFPDYASR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 6 | 3300005276 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 | Metagenome | Rhizosphere |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 79 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 82 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 196 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 203 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 204 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 209 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 210 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 211 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 212 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 213 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 214 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 217 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 218 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 219 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 220 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 223 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 277 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 278 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 279 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 280 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 281 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 282 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 283 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 284 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 286 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 287 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 288 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 289 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 290 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 7.77 |
| Rhizosphere | 91.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 35.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495628_0218663 | 3300046516 | Bacteria | 1431 |
| 2 | CNXas_1000015 | 3300000545 | Bacteria | 35772 |
| 3 | JGI24035J26624_1002185 | 3300002126 | Bacteria | 1822 |
| 4 | JGI25406J46586_10028297 | 3300003203 | Bacteria | 2137 |
| 5 | JGI25406J46586_10033383 | 3300003203 | Unclassified | 1900 |
| 6 | JGI25405J52794_10000124 | 3300003911 | Bacteria | 9159 |
| 7 | Ga0065717_1001519 | 3300005276 | Bacteria | 827 |
| 8 | Ga0065714_10090773 | 3300005288 | Bacteria | 1933 |
| 9 | Ga0065714_10228608 | 3300005288 | Bacteria | 821 |
| 10 | Ga0065704_10082945 | 3300005289 | Bacteria | 3529 |
| 11 | Ga0065704_10083157 | 3300005289 | Bacteria | 3502 |
| 12 | Ga0065704_10148674 | 3300005289 | Bacteria | 1442 |
| 13 | Ga0065704_10238857 | 3300005289 | Unclassified | 1021 |
| 14 | Ga0065712_10002542 | 3300005290 | Bacteria | 6920 |
| 15 | Ga0065712_10008036 | 3300005290 | Bacteria | 2716 |
| 16 | Ga0065712_10008417 | 3300005290 | Bacteria | 5432 |
| 17 | Ga0065712_10084262 | 3300005290 | Unclassified | 2769 |
| 18 | Ga0065712_10125226 | 3300005290 | Unclassified | 1616 |
| 19 | Ga0065712_10138258 | 3300005290 | Bacteria | 1475 |
| 20 | Ga0065712_10240150 | 3300005290 | Bacteria | 959 |
| 21 | Ga0065715_10002238 | 3300005293 | Bacteria | 10693 |
| 22 | Ga0065715_10007980 | 3300005293 | Bacteria | 5404 |
| 23 | Ga0065715_10013048 | 3300005293 | Bacteria | 1927 |
| 24 | Ga0065715_10089584 | 3300005293 | Bacteria | 9364 |
| 25 | Ga0065715_10103092 | 3300005293 | Unclassified | 3060 |
| 26 | Ga0065715_10106469 | 3300005293 | Bacteria | 2828 |
| 27 | Ga0065715_10120331 | 3300005293 | Bacteria | 2261 |
| 28 | Ga0065715_10303022 | 3300005293 | Bacteria | 980 |
| 29 | Ga0065707_10003529 | 3300005295 | Bacteria | 4250 |
| 30 | Ga0065707_10014870 | 3300005295 | Bacteria | 1630 |
| 31 | Ga0070676_10002299 | 3300005328 | Bacteria | 9771 |
| 32 | Ga0070676_10039949 | 3300005328 | Unclassified | 2715 |
| 33 | Ga0070676_10067171 | 3300005328 | Bacteria | 2143 |
| 34 | Ga0070676_10168250 | 3300005328 | Unclassified | 1416 |
| 35 | Ga0070683_100007716 | 3300005329 | Bacteria | 9109 |
| 36 | Ga0070683_100031446 | 3300005329 | Bacteria | 4826 |
| 37 | Ga0070683_100067473 | 3300005329 | Bacteria | 3332 |
| 38 | Ga0070683_100130551 | 3300005329 | Bacteria | 2378 |
| 39 | Ga0070683_100161638 | 3300005329 | Unclassified | 2125 |
| 40 | Ga0070690_100077316 | 3300005330 | Unclassified | 2172 |
| 41 | Ga0070690_100085791 | 3300005330 | Bacteria | 2066 |
| 42 | Ga0070690_100101108 | 3300005330 | Bacteria | 1912 |
| 43 | Ga0070690_100107914 | 3300005330 | Unclassified | 1854 |
| 44 | Ga0070690_100232936 | 3300005330 | Unclassified | 1296 |
| 45 | Ga0070670_100014391 | 3300005331 | Bacteria | 6788 |
| 46 | Ga0070670_100037989 | 3300005331 | Bacteria | 4140 |
| 47 | Ga0070670_100069191 | 3300005331 | Bacteria | 3030 |
| 48 | Ga0070670_100113364 | 3300005331 | Unclassified | 2337 |
| 49 | Ga0070670_100117022 | 3300005331 | Bacteria | 2298 |
| 50 | Ga0070670_100552400 | 3300005331 | Bacteria | 1027 |
| 51 | Ga0070670_100681117 | 3300005331 | Unclassified | 924 |
| 52 | Ga0070670_101124735 | 3300005331 | Unclassified | 717 |
| 53 | Ga0070677_10069138 | 3300005333 | Bacteria | 1480 |
| 54 | Ga0070677_10217156 | 3300005333 | Bacteria | 932 |
| 55 | Ga0068869_100120624 | 3300005334 | Unclassified | 2005 |
| 56 | Ga0068869_100122116 | 3300005334 | Unclassified | 1993 |
| 57 | Ga0070666_10015825 | 3300005335 | Bacteria | 4818 |
| 58 | Ga0070666_10026780 | 3300005335 | Unclassified | 3771 |
| 59 | Ga0070666_10086327 | 3300005335 | Bacteria | 2150 |
| 60 | Ga0070666_10200626 | 3300005335 | Bacteria | 1403 |
| 61 | Ga0070666_10896415 | 3300005335 | Unclassified | 655 |
| 62 | Ga0070680_100155543 | 3300005336 | Bacteria | 1920 |
| 63 | Ga0070680_100589926 | 3300005336 | Unclassified | 954 |
| 64 | Ga0070682_100053816 | 3300005337 | Bacteria | 2523 |
| 65 | Ga0068868_100012887 | 3300005338 | Bacteria | 6117 |
| 66 | Ga0068868_100048425 | 3300005338 | Bacteria | 3333 |
| 67 | Ga0068868_100053005 | 3300005338 | Bacteria | 3195 |
| 68 | Ga0068868_100126576 | 3300005338 | Bacteria | 2088 |
| 69 | Ga0070660_100062452 | 3300005339 | Unclassified | 2894 |
| 70 | Ga0070660_100351029 | 3300005339 | Unclassified | 1215 |
| 71 | Ga0070660_100384965 | 3300005339 | Bacteria | 1158 |
| 72 | Ga0070660_100749358 | 3300005339 | Bacteria | 820 |
| 73 | Ga0070689_100001267 | 3300005340 | Bacteria | 16057 |
| 74 | Ga0070689_100009006 | 3300005340 | Bacteria | 7068 |
| 75 | Ga0070689_100075953 | 3300005340 | Bacteria | 2631 |
| 76 | Ga0070689_100218494 | 3300005340 | Bacteria | 1562 |
| 77 | Ga0070687_100694925 | 3300005343 | Unclassified | 710 |
| 78 | Ga0070687_100807312 | 3300005343 | Unclassified | 665 |
| 79 | Ga0070661_100096470 | 3300005344 | Bacteria | 2194 |
| 80 | Ga0070692_10192214 | 3300005345 | Bacteria | 1190 |
| 81 | Ga0070668_100001566 | 3300005347 | Bacteria | 16516 |
| 82 | Ga0070668_100022038 | 3300005347 | Bacteria | 4815 |
| 83 | Ga0070668_100047915 | 3300005347 | Bacteria | 3286 |
| 84 | Ga0070668_100093795 | 3300005347 | Bacteria | 2369 |
| 85 | Ga0070668_100171859 | 3300005347 | Bacteria | 1765 |
| 86 | Ga0070669_100005146 | 3300005353 | Bacteria | 9456 |
| 87 | Ga0070669_100014651 | 3300005353 | Bacteria | 5581 |
| 88 | Ga0070669_100035637 | 3300005353 | Unclassified | 3605 |
| 89 | Ga0070669_100070580 | 3300005353 | Bacteria | 2583 |
| 90 | Ga0070669_100473234 | 3300005353 | Unclassified | 1035 |
| 91 | Ga0070669_100493727 | 3300005353 | Unclassified | 1015 |
| 92 | Ga0070675_100000800 | 3300005354 | Bacteria | 22104 |
| 93 | Ga0070675_100001110 | 3300005354 | Bacteria | 19396 |
| 94 | Ga0070675_100032879 | 3300005354 | Bacteria | 4200 |
| 95 | Ga0070675_100042730 | 3300005354 | Unclassified | 3704 |
| 96 | Ga0070675_100084777 | 3300005354 | Unclassified | 2646 |
| 97 | Ga0070675_100126077 | 3300005354 | Bacteria | 2178 |
| 98 | Ga0070675_100183334 | 3300005354 | Bacteria | 1811 |
| 99 | Ga0070675_100444653 | 3300005354 | Unclassified | 1162 |
| 100 | Ga0070675_100515654 | 3300005354 | Bacteria | 1078 |
| 101 | Ga0070675_101159773 | 3300005354 | Bacteria | 711 |
| 102 | Ga0070671_100006985 | 3300005355 | Bacteria | 9043 |
| 103 | Ga0070671_100009200 | 3300005355 | Bacteria | 7933 |
| 104 | Ga0070671_100010632 | 3300005355 | Bacteria | 7386 |
| 105 | Ga0070671_100117596 | 3300005355 | Bacteria | 2235 |
| 106 | Ga0070671_100213265 | 3300005355 | Bacteria | 1638 |
| 107 | Ga0070671_100251248 | 3300005355 | Bacteria | 1502 |
| 108 | Ga0070671_100455729 | 3300005355 | Unclassified | 1097 |
| 109 | Ga0070671_100459439 | 3300005355 | Bacteria | 1093 |
| 110 | Ga0070671_100520260 | 3300005355 | Bacteria | 1024 |
| 111 | Ga0070671_100727451 | 3300005355 | Bacteria | 862 |
| 112 | Ga0070674_100004295 | 3300005356 | Bacteria | 8108 |
| 113 | Ga0070674_100017349 | 3300005356 | Bacteria | 4526 |
| 114 | Ga0070674_100061487 | 3300005356 | Bacteria | 2621 |
| 115 | Ga0070674_100136976 | 3300005356 | Bacteria | 1833 |
| 116 | Ga0070673_100008309 | 3300005364 | Bacteria | 6895 |
| 117 | Ga0070673_100012043 | 3300005364 | Bacteria | 5925 |
| 118 | Ga0070673_100012359 | 3300005364 | Bacteria | 5860 |
| 119 | Ga0070673_100069064 | 3300005364 | Bacteria | 2831 |
| 120 | Ga0070673_100359117 | 3300005364 | Unclassified | 1295 |
| 121 | Ga0070688_100024252 | 3300005365 | Bacteria | 3576 |
| 122 | Ga0070688_100088841 | 3300005365 | Unclassified | 2015 |
| 123 | Ga0070688_100166542 | 3300005365 | Unclassified | 1518 |
| 124 | Ga0070659_100035409 | 3300005366 | Unclassified | 3887 |
| 125 | Ga0070659_100281801 | 3300005366 | Unclassified | 1383 |
| 126 | Ga0070659_100319339 | 3300005366 | Unclassified | 1298 |
| 127 | Ga0070659_100928889 | 3300005366 | Bacteria | 761 |
| 128 | Ga0070667_100018525 | 3300005367 | Bacteria | 5775 |
| 129 | Ga0070667_100051358 | 3300005367 | Bacteria | 3476 |
| 130 | Ga0070667_100056208 | 3300005367 | Bacteria | 3324 |
| 131 | Ga0070667_100215810 | 3300005367 | Unclassified | 1706 |
| 132 | Ga0070667_100241944 | 3300005367 | Unclassified | 1611 |
| 133 | Ga0070667_100520265 | 3300005367 | Bacteria | 1092 |
| 134 | Ga0070667_100768811 | 3300005367 | Unclassified | 893 |
| 135 | Ga0070709_10061646 | 3300005434 | Unclassified | 2388 |
| 136 | Ga0070709_10101160 | 3300005434 | Bacteria | 1920 |
| 137 | Ga0070709_10157553 | 3300005434 | Unclassified | 1576 |
| 138 | Ga0070709_10389873 | 3300005434 | Bacteria | 1038 |
| 139 | Ga0070714_100066234 | 3300005435 | Bacteria | 3113 |
| 140 | Ga0070713_100065319 | 3300005436 | Bacteria | 3056 |
| 141 | Ga0070713_100210626 | 3300005436 | Bacteria | 1759 |
| 142 | Ga0070713_100311592 | 3300005436 | Bacteria | 1451 |
| 143 | Ga0070710_10045206 | 3300005437 | Bacteria | 2447 |
| 144 | Ga0070710_10158900 | 3300005437 | Bacteria | 1400 |
| 145 | Ga0070710_10225392 | 3300005437 | Bacteria | 1194 |
| 146 | Ga0070710_10436124 | 3300005437 | Bacteria | 885 |
| 147 | Ga0070711_100003037 | 3300005439 | Bacteria | 9706 |
| 148 | Ga0070711_100020337 | 3300005439 | Bacteria | 4276 |
| 149 | Ga0070711_100041603 | 3300005439 | Bacteria | 3105 |
| 150 | Ga0070711_100111760 | 3300005439 | Bacteria | 2006 |
| 151 | Ga0070711_100115136 | 3300005439 | Bacteria | 1979 |
| 152 | Ga0070705_100017828 | 3300005440 | Bacteria | 3711 |
| 153 | Ga0070705_100021045 | 3300005440 | Bacteria | 3463 |
| 154 | Ga0070705_100039662 | 3300005440 | Bacteria | 2673 |
| 155 | Ga0070705_100378764 | 3300005440 | Bacteria | 1041 |
| 156 | Ga0070700_100084729 | 3300005441 | Unclassified | 2055 |
| 157 | Ga0070694_100086048 | 3300005444 | Bacteria | 2196 |
| 158 | Ga0070694_100245858 | 3300005444 | Unclassified | 1351 |
| 159 | Ga0070708_100014955 | 3300005445 | Bacteria | 6398 |
| 160 | Ga0070708_100027669 | 3300005445 | Bacteria | 4867 |
| 161 | Ga0070708_100045127 | 3300005445 | Unclassified | 3881 |
| 162 | Ga0070708_100074413 | 3300005445 | Unclassified | 3063 |
| 163 | Ga0070708_100141047 | 3300005445 | Bacteria | 2235 |
| 164 | Ga0070708_100298506 | 3300005445 | Unclassified | 1517 |
| 165 | Ga0070708_100339865 | 3300005445 | Unclassified | 1415 |
| 166 | Ga0070708_100424659 | 3300005445 | Bacteria | 1254 |
| 167 | Ga0070708_100922290 | 3300005445 | Unclassified | 820 |
| 168 | Ga0070663_100020545 | 3300005455 | Bacteria | 4373 |
| 169 | Ga0070663_100516075 | 3300005455 | Bacteria | 994 |
| 170 | Ga0070663_101117233 | 3300005455 | Unclassified | 690 |
| 171 | Ga0070678_100053145 | 3300005456 | Bacteria | 2944 |
| 172 | Ga0070678_100142165 | 3300005456 | Bacteria | 1922 |
| 173 | Ga0070662_100011457 | 3300005457 | Bacteria | 5851 |
| 174 | Ga0070662_100144755 | 3300005457 | Bacteria | 1845 |
| 175 | Ga0070662_100178898 | 3300005457 | Unclassified | 1671 |
| 176 | Ga0070662_100827424 | 3300005457 | Unclassified | 788 |
| 177 | Ga0070681_10052380 | 3300005458 | Bacteria | 4070 |
| 178 | Ga0068867_100014657 | 3300005459 | Bacteria | 5556 |
| 179 | Ga0070685_10050959 | 3300005466 | Bacteria | 2393 |
| 180 | Ga0070685_10530275 | 3300005466 | Unclassified | 837 |
| 181 | Ga0070706_100000011 | 3300005467 | Bacteria | 198585 |
| 182 | Ga0070706_100012402 | 3300005467 | Bacteria | 7897 |
| 183 | Ga0070706_100015234 | 3300005467 | Bacteria | 7097 |
| 184 | Ga0070706_100021085 | 3300005467 | Bacteria | 5999 |
| 185 | Ga0070706_100040495 | 3300005467 | Bacteria | 4301 |
| 186 | Ga0070706_100068869 | 3300005467 | Bacteria | 3273 |
| 187 | Ga0070706_100430206 | 3300005467 | Bacteria | 1228 |
| 188 | Ga0070706_100665738 | 3300005467 | Unclassified | 966 |
| 189 | Ga0070706_101044686 | 3300005467 | Unclassified | 753 |
| 190 | Ga0070707_100003264 | 3300005468 | Bacteria | 15375 |
| 191 | Ga0070707_100023994 | 3300005468 | Bacteria | 5771 |
| 192 | Ga0070707_100024310 | 3300005468 | Bacteria | 5737 |
| 193 | Ga0070707_100041589 | 3300005468 | Bacteria | 4399 |
| 194 | Ga0070707_100052756 | 3300005468 | Unclassified | 3899 |
| 195 | Ga0070707_100126399 | 3300005468 | Bacteria | 2484 |
| 196 | Ga0070707_100244903 | 3300005468 | Bacteria | 1745 |
| 197 | Ga0070707_100598422 | 3300005468 | Unclassified | 1065 |
| 198 | Ga0070707_100672675 | 3300005468 | Unclassified | 998 |
| 199 | Ga0070698_100000288 | 3300005471 | Bacteria | 51295 |
| 200 | Ga0070698_100012794 | 3300005471 | Bacteria | 8887 |
| 201 | Ga0070698_100029828 | 3300005471 | Bacteria | 5660 |
| 202 | Ga0070698_100255024 | 3300005471 | Unclassified | 1686 |
| 203 | Ga0070698_100294938 | 3300005471 | Bacteria | 1552 |
| 204 | Ga0070698_101173497 | 3300005471 | Bacteria | 717 |
| 205 | Ga0070699_100134495 | 3300005518 | Bacteria | 2181 |
| 206 | Ga0070699_100206100 | 3300005518 | Bacteria | 1749 |
| 207 | Ga0070699_100333238 | 3300005518 | Bacteria | 1365 |
| 208 | Ga0070699_100595076 | 3300005518 | Unclassified | 1008 |
| 209 | Ga0070699_100665034 | 3300005518 | Bacteria | 951 |
| 210 | Ga0070699_101054423 | 3300005518 | Unclassified | 746 |
| 211 | Ga0070684_100000254 | 3300005535 | Bacteria | 36890 |
| 212 | Ga0070684_100260485 | 3300005535 | Unclassified | 1586 |
| 213 | Ga0070684_100383706 | 3300005535 | Unclassified | 1294 |
| 214 | Ga0070684_100470170 | 3300005535 | Unclassified | 1163 |
| 215 | Ga0070684_100830345 | 3300005535 | Unclassified | 865 |
| 216 | Ga0070684_100966149 | 3300005535 | Unclassified | 799 |
| 217 | Ga0070697_100001132 | 3300005536 | Bacteria | 20163 |
| 218 | Ga0070697_100017935 | 3300005536 | Bacteria | 5576 |
| 219 | Ga0070697_100020084 | 3300005536 | Bacteria | 5280 |
| 220 | Ga0070697_100024745 | 3300005536 | Unclassified | 4782 |
| 221 | Ga0070697_100034437 | 3300005536 | Bacteria | 4083 |
| 222 | Ga0070697_100038577 | 3300005536 | Bacteria | 3860 |
| 223 | Ga0070697_100039499 | 3300005536 | Unclassified | 3815 |
| 224 | Ga0070697_100039941 | 3300005536 | Bacteria | 3795 |
| 225 | Ga0070697_100042413 | 3300005536 | Bacteria | 3682 |
| 226 | Ga0070697_100087093 | 3300005536 | Bacteria | 2578 |
| 227 | Ga0070697_100162632 | 3300005536 | Bacteria | 1886 |
| 228 | Ga0070697_100518172 | 3300005536 | Unclassified | 1044 |
| 229 | Ga0070697_100533086 | 3300005536 | Bacteria | 1029 |
| 230 | Ga0070697_100637862 | 3300005536 | Unclassified | 938 |
| 231 | Ga0070672_100008850 | 3300005543 | Bacteria | 6914 |
| 232 | Ga0070672_100060915 | 3300005543 | Bacteria | 2973 |
| 233 | Ga0070672_100071036 | 3300005543 | Bacteria | 2768 |
| 234 | Ga0070672_100085054 | 3300005543 | Bacteria | 2541 |
| 235 | Ga0070686_100008987 | 3300005544 | Bacteria | 5599 |
| 236 | Ga0070686_100633978 | 3300005544 | Unclassified | 846 |
| 237 | Ga0070695_100073372 | 3300005545 | Bacteria | 2246 |
| 238 | Ga0070695_100798851 | 3300005545 | Unclassified | 756 |
| 239 | Ga0070696_100033547 | 3300005546 | Bacteria | 3527 |
| 240 | Ga0070696_100285926 | 3300005546 | Bacteria | 1258 |
| 241 | Ga0070665_100146836 | 3300005548 | Bacteria | 2361 |
| 242 | Ga0070665_100147354 | 3300005548 | Bacteria | 2356 |
| 243 | Ga0070665_100160449 | 3300005548 | Bacteria | 2250 |
| 244 | Ga0070665_100184912 | 3300005548 | Bacteria | 2084 |
| 245 | Ga0070665_100190733 | 3300005548 | Bacteria | 2050 |
| 246 | Ga0070665_100307052 | 3300005548 | Bacteria | 1590 |
| 247 | Ga0070665_100787728 | 3300005548 | Unclassified | 964 |
| 248 | Ga0070665_101125515 | 3300005548 | Unclassified | 796 |
| 249 | Ga0070704_100007524 | 3300005549 | Bacteria | 6484 |
| 250 | Ga0070704_100453595 | 3300005549 | Bacteria | 1104 |
| 251 | Ga0068855_100460849 | 3300005563 | Unclassified | 1386 |
| 252 | Ga0068855_100461974 | 3300005563 | Bacteria | 1384 |
| 253 | Ga0068855_101232633 | 3300005563 | Unclassified | 777 |
| 254 | Ga0070664_100025116 | 3300005564 | Bacteria | 4936 |
| 255 | Ga0070664_100030703 | 3300005564 | Bacteria | 4484 |
| 256 | Ga0070664_100127830 | 3300005564 | Unclassified | 2231 |
| 257 | Ga0070664_100138533 | 3300005564 | Bacteria | 2141 |
| 258 | Ga0070664_100252035 | 3300005564 | Bacteria | 1587 |
| 259 | Ga0070664_100353061 | 3300005564 | Bacteria | 1338 |
| 260 | Ga0070664_100745758 | 3300005564 | Bacteria | 914 |
| 261 | Ga0068854_100313522 | 3300005578 | Bacteria | 1273 |
| 262 | Ga0068856_100024841 | 3300005614 | Bacteria | 5837 |
| 263 | Ga0070702_100192728 | 3300005615 | Bacteria | 1342 |
| 264 | Ga0070702_100455904 | 3300005615 | Unclassified | 929 |
| 265 | Ga0068852_100637867 | 3300005616 | Unclassified | 1072 |
| 266 | Ga0068852_100641552 | 3300005616 | Unclassified | 1069 |
| 267 | Ga0068859_100124988 | 3300005617 | Bacteria | 2641 |
| 268 | Ga0068864_100263763 | 3300005618 | Bacteria | 1603 |
| 269 | Ga0068864_100446769 | 3300005618 | Bacteria | 1236 |
| 270 | Ga0068866_10017827 | 3300005718 | Bacteria | 3200 |
| 271 | Ga0068861_100234604 | 3300005719 | Bacteria | 1557 |
| 272 | Ga0068863_100085861 | 3300005841 | Bacteria | 2982 |
| 273 | Ga0068863_100166687 | 3300005841 | Unclassified | 2112 |
| 274 | Ga0068863_100172349 | 3300005841 | Bacteria | 2076 |
| 275 | Ga0068863_100789166 | 3300005841 | Unclassified | 947 |
| 276 | Ga0068858_100010162 | 3300005842 | Bacteria | 8933 |
| 277 | Ga0068858_100212940 | 3300005842 | Bacteria | 1829 |
| 278 | Ga0068858_100354330 | 3300005842 | Unclassified | 1406 |
| 279 | Ga0068860_100007266 | 3300005843 | Bacteria | 11078 |
| 280 | Ga0068860_101124737 | 3300005843 | Bacteria | 805 |
| 281 | Ga0068860_101314894 | 3300005843 | Unclassified | 744 |
| 282 | Ga0068862_100083952 | 3300005844 | Bacteria | 2766 |
| 283 | Ga0068862_100316582 | 3300005844 | Unclassified | 1439 |
| 284 | Ga0068862_101023174 | 3300005844 | Unclassified | 818 |
| 285 | Ga0081455_10000486 | 3300005937 | Bacteria | 51545 |
| 286 | Ga0081455_10003585 | 3300005937 | Bacteria | 17813 |
| 287 | Ga0081455_10114154 | 3300005937 | Unclassified | 2141 |
| 288 | Ga0081455_10114852 | 3300005937 | Bacteria | 2132 |
| 289 | Ga0081455_10149311 | 3300005937 | Unclassified | 1804 |
| 290 | Ga0081540_1000532 | 3300005983 | Bacteria | 37070 |
| 291 | Ga0081540_1007016 | 3300005983 | Bacteria | 8105 |
| 292 | Ga0081540_1020553 | 3300005983 | Bacteria | 3965 |
| 293 | Ga0081539_10003960 | 3300005985 | Bacteria | 17145 |
| 294 | Ga0081539_10005046 | 3300005985 | Bacteria | 13877 |
| 295 | Ga0081539_10016932 | 3300005985 | Bacteria | 5164 |
| 296 | Ga0081539_10040760 | 3300005985 | Unclassified | 2723 |
| 297 | Ga0070717_10005159 | 3300006028 | Bacteria | 9525 |
| 298 | Ga0070717_10005613 | 3300006028 | Bacteria | 9165 |
| 299 | Ga0070717_10016084 | 3300006028 | Bacteria | 5793 |
| 300 | Ga0070717_10067690 | 3300006028 | Bacteria | 2971 |
| 301 | Ga0070717_10072623 | 3300006028 | Bacteria | 2873 |
| 302 | Ga0070717_10461502 | 3300006028 | Unclassified | 1145 |
| 303 | Ga0070717_10579642 | 3300006028 | Bacteria | 1017 |
| 304 | Ga0070717_10682660 | 3300006028 | Unclassified | 933 |
| 305 | Ga0070717_11226327 | 3300006028 | Unclassified | 682 |
| 306 | Ga0070715_10012884 | 3300006163 | Bacteria | 3057 |
| 307 | Ga0070715_10016504 | 3300006163 | Bacteria | 2775 |
| 308 | Ga0070715_10291114 | 3300006163 | Unclassified | 870 |
| 309 | Ga0070716_100034718 | 3300006173 | Bacteria | 2767 |
| 310 | Ga0070716_100050005 | 3300006173 | Bacteria | 2371 |
| 311 | Ga0070716_100052507 | 3300006173 | Bacteria | 2321 |
| 312 | Ga0070716_100062450 | 3300006173 | Bacteria | 2160 |
| 313 | Ga0070716_100257965 | 3300006173 | Bacteria | 1191 |
| 314 | Ga0070716_100448324 | 3300006173 | Bacteria | 940 |
| 315 | Ga0070712_100005405 | 3300006175 | Bacteria | 7907 |
| 316 | Ga0070712_100006223 | 3300006175 | Bacteria | 7388 |
| 317 | Ga0070712_100142042 | 3300006175 | Unclassified | 1833 |
| 318 | Ga0070712_100160451 | 3300006175 | Bacteria | 1736 |
| 319 | Ga0070712_100213429 | 3300006175 | Unclassified | 1523 |
| 320 | Ga0070712_100368745 | 3300006175 | Bacteria | 1179 |
| 321 | Ga0070712_100670156 | 3300006175 | Bacteria | 882 |
| 322 | Ga0070712_100822959 | 3300006175 | Unclassified | 798 |
| 323 | Ga0070712_100990787 | 3300006175 | Unclassified | 727 |
| 324 | Ga0070712_100995804 | 3300006175 | Unclassified | 725 |
| 325 | Ga0075366_10572089 | 3300006195 | Unclassified | 700 |
| 326 | Ga0097621_100005808 | 3300006237 | Bacteria | 8716 |
| 327 | Ga0097621_100015849 | 3300006237 | Bacteria | 5683 |
| 328 | Ga0097621_100074971 | 3300006237 | Bacteria | 2803 |
| 329 | Ga0097621_100129350 | 3300006237 | Bacteria | 2148 |
| 330 | Ga0097621_100286979 | 3300006237 | Unclassified | 1450 |
| 331 | Ga0068871_100004431 | 3300006358 | Bacteria | 9766 |
| 332 | Ga0068871_100026904 | 3300006358 | Bacteria | 4493 |
| 333 | Ga0068871_100199469 | 3300006358 | Bacteria | 1727 |
| 334 | Ga0068871_100200713 | 3300006358 | Unclassified | 1722 |
| 335 | Ga0075428_100262136 | 3300006844 | Bacteria | 1861 |
| 336 | Ga0075428_100836432 | 3300006844 | Unclassified | 978 |
| 337 | Ga0075431_100515654 | 3300006847 | Unclassified | 1185 |
| 338 | Ga0075433_10602200 | 3300006852 | Unclassified | 965 |
| 339 | Ga0075434_100052913 | 3300006871 | Bacteria | 4035 |
| 340 | Ga0075434_100492373 | 3300006871 | Unclassified | 1247 |
| 341 | Ga0075434_100553872 | 3300006871 | Unclassified | 1169 |
| 342 | Ga0068865_100013990 | 3300006881 | Bacteria | 5091 |
| 343 | Ga0068865_100162120 | 3300006881 | Unclassified | 1707 |
| 344 | Ga0075436_100023561 | 3300006914 | Bacteria | 4227 |
| 345 | Ga0075436_100273132 | 3300006914 | Unclassified | 1207 |
| 346 | Ga0097620_100124987 | 3300006931 | Bacteria | 2641 |
| 347 | Ga0075435_100440009 | 3300007076 | Unclassified | 1124 |
| 348 | Ga0099795_10043076 | 3300007788 | Bacteria | 1614 |
| 349 | Ga0105240_10684839 | 3300009093 | Bacteria | 1120 |
| 350 | Ga0105240_11272952 | 3300009093 | Unclassified | 776 |
| 351 | Ga0111539_10106439 | 3300009094 | Bacteria | 3290 |
| 352 | Ga0111539_10114935 | 3300009094 | Bacteria | 3156 |
| 353 | Ga0111539_10495389 | 3300009094 | Unclassified | 1423 |
| 354 | Ga0105245_10074086 | 3300009098 | Bacteria | 3097 |
| 355 | Ga0105245_10077081 | 3300009098 | Unclassified | 3038 |
| 356 | Ga0105245_10188026 | 3300009098 | Unclassified | 1977 |
| 357 | Ga0105245_10328943 | 3300009098 | Bacteria | 1508 |
| 358 | Ga0105245_10571395 | 3300009098 | Unclassified | 1154 |
| 359 | Ga0105245_11005435 | 3300009098 | Bacteria | 878 |
| 360 | Ga0105247_10043319 | 3300009101 | Bacteria | 2757 |
| 361 | Ga0105247_10130781 | 3300009101 | Bacteria | 1636 |
| 362 | Ga0114129_10416208 | 3300009147 | Bacteria | 1769 |
| 363 | Ga0114129_10844177 | 3300009147 | Bacteria | 1165 |
| 364 | Ga0105243_10129668 | 3300009148 | Unclassified | 2138 |
| 365 | Ga0105243_10132216 | 3300009148 | Unclassified | 2118 |
| 366 | Ga0105243_11262403 | 3300009148 | Bacteria | 754 |
| 367 | Ga0105241_10224294 | 3300009174 | Unclassified | 1581 |
| 368 | Ga0105241_10739050 | 3300009174 | Unclassified | 901 |
| 369 | Ga0105242_10029989 | 3300009176 | Bacteria | 4341 |
| 370 | Ga0105242_10175215 | 3300009176 | Bacteria | 1888 |
| 371 | Ga0105242_10325009 | 3300009176 | Bacteria | 1412 |
| 372 | Ga0105237_10167421 | 3300009545 | Bacteria | 2197 |
| 373 | Ga0105249_10006222 | 3300009553 | Bacteria | 10364 |
| 374 | Ga0105249_10045544 | 3300009553 | Bacteria | 3990 |
| 375 | Ga0105249_10727539 | 3300009553 | Bacteria | 1054 |
| 376 | Ga0099796_10059088 | 3300010159 | Unclassified | 1353 |
| 377 | Ga0105239_10018051 | 3300010375 | Bacteria | 7804 |
| 378 | Ga0105239_10226533 | 3300010375 | Bacteria | 2097 |
| 379 | Ga0105239_10669524 | 3300010375 | Unclassified | 1186 |
| 380 | Ga0105246_10034754 | 3300011119 | Bacteria | 3362 |
| 381 | Ga0105246_10163593 | 3300011119 | Bacteria | 1697 |
| 382 | Ga0105246_10846491 | 3300011119 | Unclassified | 815 |
| 383 | Ga0157373_10601331 | 3300013100 | Unclassified | 801 |
| 384 | Ga0157369_10179278 | 3300013105 | Bacteria | 2229 |
| 385 | Ga0157374_10004504 | 3300013296 | Bacteria | 11708 |
| 386 | Ga0157374_10030925 | 3300013296 | Unclassified | 4863 |
| 387 | Ga0157374_10062854 | 3300013296 | Bacteria | 3481 |
| 388 | Ga0157374_10124171 | 3300013296 | Bacteria | 2494 |
| 389 | Ga0157374_10154984 | 3300013296 | Bacteria | 2229 |
| 390 | Ga0157374_10179307 | 3300013296 | Bacteria | 2069 |
| 391 | Ga0157374_10186378 | 3300013296 | Unclassified | 2029 |
| 392 | Ga0157374_10214222 | 3300013296 | Unclassified | 1889 |
| 393 | Ga0157374_10248798 | 3300013296 | Bacteria | 1749 |
| 394 | Ga0157374_10511776 | 3300013296 | Bacteria | 1206 |
| 395 | Ga0157374_10537347 | 3300013296 | Unclassified | 1176 |
| 396 | Ga0157374_10735867 | 3300013296 | Unclassified | 1000 |
| 397 | Ga0157378_10004663 | 3300013297 | Bacteria | 12024 |
| 398 | Ga0157378_10029641 | 3300013297 | Bacteria | 4833 |
| 399 | Ga0157378_10061028 | 3300013297 | Unclassified | 3364 |
| 400 | Ga0157378_10061937 | 3300013297 | Bacteria | 3340 |
| 401 | Ga0157378_10067784 | 3300013297 | Bacteria | 3199 |
| 402 | Ga0157378_10085694 | 3300013297 | Bacteria | 2854 |
| 403 | Ga0157378_10253080 | 3300013297 | Bacteria | 1687 |
| 404 | Ga0157378_10349824 | 3300013297 | Bacteria | 1443 |
| 405 | Ga0157378_10496685 | 3300013297 | Unclassified | 1218 |
| 406 | Ga0157378_10526729 | 3300013297 | Bacteria | 1184 |
| 407 | Ga0157378_10554211 | 3300013297 | Bacteria | 1155 |
| 408 | Ga0157378_10916296 | 3300013297 | Unclassified | 908 |
| 409 | Ga0163162_10004005 | 3300013306 | Bacteria | 14138 |
| 410 | Ga0163162_10011144 | 3300013306 | Bacteria | 8758 |
| 411 | Ga0163162_10036699 | 3300013306 | Bacteria | 4887 |
| 412 | Ga0163162_10039816 | 3300013306 | Bacteria | 4696 |
| 413 | Ga0163162_10040041 | 3300013306 | Bacteria | 4685 |
| 414 | Ga0163162_10300252 | 3300013306 | Bacteria | 1738 |
| 415 | Ga0163162_10416610 | 3300013306 | Unclassified | 1475 |
| 416 | Ga0163162_10519708 | 3300013306 | Unclassified | 1320 |
| 417 | Ga0157372_10061403 | 3300013307 | Bacteria | 4208 |
| 418 | Ga0157372_10068753 | 3300013307 | Bacteria | 3982 |
| 419 | Ga0157372_10136701 | 3300013307 | Bacteria | 2823 |
| 420 | Ga0157372_11388444 | 3300013307 | Bacteria | 810 |
| 421 | Ga0157375_10003613 | 3300013308 | Bacteria | 13421 |
| 422 | Ga0157375_10037043 | 3300013308 | Bacteria | 4670 |
| 423 | Ga0157375_10135970 | 3300013308 | Bacteria | 2582 |
| 424 | Ga0157375_10235267 | 3300013308 | Bacteria | 1991 |
| 425 | Ga0157375_10332876 | 3300013308 | Bacteria | 1683 |
| 426 | Ga0157375_10378858 | 3300013308 | Unclassified | 1581 |
| 427 | Ga0157375_10398083 | 3300013308 | Unclassified | 1544 |
| 428 | Ga0157375_10971227 | 3300013308 | Bacteria | 990 |
| 429 | Ga0163163_10222506 | 3300014325 | Bacteria | 1936 |
| 430 | Ga0163163_11519704 | 3300014325 | Unclassified | 731 |
| 431 | Ga0182008_10438391 | 3300014497 | Unclassified | 708 |
| 432 | Ga0157377_10082291 | 3300014745 | Bacteria | 1885 |
| 433 | Ga0157377_10235911 | 3300014745 | Unclassified | 1178 |
| 434 | Ga0157379_10030011 | 3300014968 | Bacteria | 4836 |
| 435 | Ga0157376_10032856 | 3300014969 | Unclassified | 4171 |
| 436 | Ga0157376_10062547 | 3300014969 | Bacteria | 3132 |
| 437 | Ga0157376_10081011 | 3300014969 | Unclassified | 2786 |
| 438 | Ga0157376_10088716 | 3300014969 | Bacteria | 2672 |
| 439 | Ga0157376_10111049 | 3300014969 | Bacteria | 2413 |
| 440 | Ga0157376_10142869 | 3300014969 | Bacteria | 2149 |
| 441 | Ga0157376_10304067 | 3300014969 | Unclassified | 1511 |
| 442 | Ga0157376_10468600 | 3300014969 | Unclassified | 1232 |
| 443 | Ga0157376_10670955 | 3300014969 | Unclassified | 1039 |
| 444 | Ga0157376_11175893 | 3300014969 | Unclassified | 795 |
| 445 | Ga0157376_11691128 | 3300014969 | Bacteria | 668 |
| 446 | Ga0182007_10076327 | 3300015262 | Unclassified | 1099 |
| 447 | Ga0163161_10039588 | 3300017792 | Bacteria | 3384 |
| 448 | Ga0163161_10159728 | 3300017792 | Bacteria | 1718 |
| 449 | Ga0163161_10302651 | 3300017792 | Bacteria | 1259 |
| 450 | Ga0207666_1001684 | 3300025271 | Bacteria | 2629 |
| 451 | Ga0207673_1000646 | 3300025290 | Bacteria | 3719 |
| 452 | Ga0207673_1002887 | 3300025290 | Bacteria | 1986 |
| 453 | Ga0207673_1009636 | 3300025290 | Unclassified | 1236 |
| 454 | Ga0207673_1031750 | 3300025290 | Unclassified | 733 |
| 455 | Ga0207697_10000281 | 3300025315 | Bacteria | 28268 |
| 456 | Ga0207697_10001510 | 3300025315 | Bacteria | 12642 |
| 457 | Ga0207697_10002546 | 3300025315 | Bacteria | 9382 |
| 458 | Ga0207697_10003172 | 3300025315 | Bacteria | 8184 |
| 459 | Ga0207697_10009904 | 3300025315 | Bacteria | 4096 |
| 460 | Ga0207697_10011141 | 3300025315 | Bacteria | 3812 |
| 461 | Ga0207697_10012398 | 3300025315 | Bacteria | 3574 |
| 462 | Ga0207697_10013296 | 3300025315 | Unclassified | 3435 |
| 463 | Ga0207697_10038913 | 3300025315 | Unclassified | 1951 |
| 464 | Ga0207697_10080359 | 3300025315 | Unclassified | 1373 |
| 465 | Ga0207653_10006171 | 3300025885 | Unclassified | 3735 |
| 466 | Ga0207682_10004815 | 3300025893 | Bacteria | 5594 |
| 467 | Ga0207692_10127636 | 3300025898 | Unclassified | 1432 |
| 468 | Ga0207642_10050773 | 3300025899 | Bacteria | 1872 |
| 469 | Ga0207710_10038073 | 3300025900 | Bacteria | 2126 |
| 470 | Ga0207710_10192462 | 3300025900 | Bacteria | 1005 |
| 471 | Ga0207688_10001545 | 3300025901 | Bacteria | 12092 |
| 472 | Ga0207688_10005469 | 3300025901 | Bacteria | 6907 |
| 473 | Ga0207688_10043420 | 3300025901 | Bacteria | 2503 |
| 474 | Ga0207688_10159234 | 3300025901 | Unclassified | 1337 |
| 475 | Ga0207688_10189402 | 3300025901 | Bacteria | 1230 |
| 476 | Ga0207680_10012292 | 3300025903 | Bacteria | 4356 |
| 477 | Ga0207680_10028269 | 3300025903 | Bacteria | 3135 |
| 478 | Ga0207680_10222950 | 3300025903 | Unclassified | 1293 |
| 479 | Ga0207647_10009086 | 3300025904 | Bacteria | 7077 |
| 480 | Ga0207647_10236704 | 3300025904 | Bacteria | 1049 |
| 481 | Ga0207647_10243707 | 3300025904 | Unclassified | 1032 |
| 482 | Ga0207685_10148187 | 3300025905 | Bacteria | 1059 |
| 483 | Ga0207685_10200573 | 3300025905 | Unclassified | 937 |
| 484 | Ga0207699_10009262 | 3300025906 | Bacteria | 4894 |
| 485 | Ga0207699_10085515 | 3300025906 | Unclassified | 1967 |
| 486 | Ga0207645_10001030 | 3300025907 | Bacteria | 23008 |
| 487 | Ga0207645_10003151 | 3300025907 | Bacteria | 12633 |
| 488 | Ga0207645_10008561 | 3300025907 | Bacteria | 7131 |
| 489 | Ga0207645_10010303 | 3300025907 | Bacteria | 6420 |
| 490 | Ga0207645_10043642 | 3300025907 | Bacteria | 2870 |
| 491 | Ga0207645_10187341 | 3300025907 | Unclassified | 1359 |
| 492 | Ga0207645_10621605 | 3300025907 | Unclassified | 734 |
| 493 | Ga0207684_10000052 | 3300025910 | Bacteria | 228510 |
| 494 | Ga0207684_10011740 | 3300025910 | Bacteria | 7641 |
| 495 | Ga0207684_10015843 | 3300025910 | Bacteria | 6481 |
| 496 | Ga0207684_10028320 | 3300025910 | Bacteria | 4773 |
| 497 | Ga0207684_10028682 | 3300025910 | Bacteria | 4741 |
| 498 | Ga0207684_10048819 | 3300025910 | Bacteria | 3590 |
| 499 | Ga0207684_10190765 | 3300025910 | Bacteria | 1768 |
| 500 | Ga0207684_10257943 | 3300025910 | Unclassified | 1504 |
| 501 | Ga0207684_10395575 | 3300025910 | Bacteria | 1188 |
| 502 | Ga0207684_10629919 | 3300025910 | Bacteria | 915 |
| 503 | Ga0207684_10700144 | 3300025910 | Bacteria | 861 |
| 504 | Ga0207684_10925131 | 3300025910 | Unclassified | 732 |
| 505 | Ga0207654_10164387 | 3300025911 | Unclassified | 1436 |
| 506 | Ga0207707_10024631 | 3300025912 | Bacteria | 5267 |
| 507 | Ga0207671_10266760 | 3300025914 | Unclassified | 1348 |
| 508 | Ga0207693_10009848 | 3300025915 | Bacteria | 7774 |
| 509 | Ga0207693_10016372 | 3300025915 | Bacteria | 5926 |
| 510 | Ga0207693_10029080 | 3300025915 | Unclassified | 4368 |
| 511 | Ga0207693_10032992 | 3300025915 | Bacteria | 4086 |
| 512 | Ga0207693_10047385 | 3300025915 | Bacteria | 3378 |
| 513 | Ga0207693_10089441 | 3300025915 | Bacteria | 2413 |
| 514 | Ga0207693_10102841 | 3300025915 | Bacteria | 2240 |
| 515 | Ga0207693_10134442 | 3300025915 | Bacteria | 1944 |
| 516 | Ga0207693_10294460 | 3300025915 | Unclassified | 1272 |
| 517 | Ga0207693_10294461 | 3300025915 | Unclassified | 1272 |
| 518 | Ga0207693_10395716 | 3300025915 | Bacteria | 1080 |
| 519 | Ga0207663_10002317 | 3300025916 | Bacteria | 9127 |
| 520 | Ga0207663_10034619 | 3300025916 | Bacteria | 3023 |
| 521 | Ga0207663_10076307 | 3300025916 | Unclassified | 2177 |
| 522 | Ga0207663_10161217 | 3300025916 | Bacteria | 1583 |
| 523 | Ga0207663_10322425 | 3300025916 | Bacteria | 1161 |
| 524 | Ga0207662_10000532 | 3300025918 | Bacteria | 16909 |
| 525 | Ga0207657_10061423 | 3300025919 | Unclassified | 3222 |
| 526 | Ga0207657_10077181 | 3300025919 | Unclassified | 2808 |
| 527 | Ga0207657_10319976 | 3300025919 | Bacteria | 1227 |
| 528 | Ga0207657_10355796 | 3300025919 | Unclassified | 1154 |
| 529 | Ga0207657_10665842 | 3300025919 | Bacteria | 810 |
| 530 | Ga0207657_10822114 | 3300025919 | Bacteria | 718 |
| 531 | Ga0207649_10177784 | 3300025920 | Unclassified | 1487 |
| 532 | Ga0207652_10240703 | 3300025921 | Unclassified | 1631 |
| 533 | Ga0207646_10001640 | 3300025922 | Bacteria | 27348 |
| 534 | Ga0207646_10003759 | 3300025922 | Bacteria | 16922 |
| 535 | Ga0207646_10003836 | 3300025922 | Bacteria | 16700 |
| 536 | Ga0207646_10037631 | 3300025922 | Bacteria | 4361 |
| 537 | Ga0207646_10091803 | 3300025922 | Bacteria | 2717 |
| 538 | Ga0207646_10164799 | 3300025922 | Bacteria | 2001 |
| 539 | Ga0207646_10179804 | 3300025922 | Bacteria | 1910 |
| 540 | Ga0207646_10197179 | 3300025922 | Bacteria | 1818 |
| 541 | Ga0207646_10290940 | 3300025922 | Unclassified | 1476 |
| 542 | Ga0207646_10571677 | 3300025922 | Unclassified | 1015 |
| 543 | Ga0207646_10943958 | 3300025922 | Unclassified | 764 |
| 544 | Ga0207681_10013338 | 3300025923 | Bacteria | 5084 |
| 545 | Ga0207681_10017078 | 3300025923 | Bacteria | 4553 |
| 546 | Ga0207681_10024960 | 3300025923 | Unclassified | 3841 |
| 547 | Ga0207681_10032609 | 3300025923 | Bacteria | 3412 |
| 548 | Ga0207681_10057495 | 3300025923 | Bacteria | 2658 |
| 549 | Ga0207681_10101402 | 3300025923 | Bacteria | 2076 |
| 550 | Ga0207681_10203742 | 3300025923 | Unclassified | 1521 |
| 551 | Ga0207681_10247898 | 3300025923 | Bacteria | 1389 |
| 552 | Ga0207681_10632468 | 3300025923 | Bacteria | 886 |
| 553 | Ga0207650_10069982 | 3300025925 | Unclassified | 2637 |
| 554 | Ga0207650_10129955 | 3300025925 | Bacteria | 1970 |
| 555 | Ga0207650_10154601 | 3300025925 | Bacteria | 1813 |
| 556 | Ga0207650_10418715 | 3300025925 | Unclassified | 1111 |
| 557 | Ga0207650_10615040 | 3300025925 | Unclassified | 914 |
| 558 | Ga0207659_10018518 | 3300025926 | Bacteria | 4566 |
| 559 | Ga0207659_10021701 | 3300025926 | Bacteria | 4268 |
| 560 | Ga0207659_10044610 | 3300025926 | Bacteria | 3120 |
| 561 | Ga0207659_10071319 | 3300025926 | Unclassified | 2536 |
| 562 | Ga0207659_10135106 | 3300025926 | Unclassified | 1908 |
| 563 | Ga0207659_10222390 | 3300025926 | Unclassified | 1519 |
| 564 | Ga0207659_10257277 | 3300025926 | Bacteria | 1419 |
| 565 | Ga0207659_10430627 | 3300025926 | Bacteria | 1108 |
| 566 | Ga0207659_10612718 | 3300025926 | Unclassified | 929 |
| 567 | Ga0207687_10132076 | 3300025927 | Unclassified | 1883 |
| 568 | Ga0207700_10066986 | 3300025928 | Bacteria | 2746 |
| 569 | Ga0207700_10092426 | 3300025928 | Bacteria | 2392 |
| 570 | Ga0207700_10240938 | 3300025928 | Unclassified | 1541 |
| 571 | Ga0207700_10244906 | 3300025928 | Unclassified | 1529 |
| 572 | Ga0207664_10321010 | 3300025929 | Unclassified | 1366 |
| 573 | Ga0207664_10796190 | 3300025929 | Unclassified | 850 |
| 574 | Ga0207664_10913629 | 3300025929 | Unclassified | 788 |
| 575 | Ga0207644_10015592 | 3300025931 | Bacteria | 5103 |
| 576 | Ga0207644_10017748 | 3300025931 | Bacteria | 4811 |
| 577 | Ga0207644_10080828 | 3300025931 | Unclassified | 2401 |
| 578 | Ga0207644_10161054 | 3300025931 | Bacteria | 1744 |
| 579 | Ga0207644_10246227 | 3300025931 | Bacteria | 1425 |
| 580 | Ga0207644_10282670 | 3300025931 | Bacteria | 1332 |
| 581 | Ga0207644_10542331 | 3300025931 | Unclassified | 962 |
| 582 | Ga0207644_10580991 | 3300025931 | Bacteria | 929 |
| 583 | Ga0207690_10008181 | 3300025932 | Bacteria | 6204 |
| 584 | Ga0207690_10183309 | 3300025932 | Unclassified | 1578 |
| 585 | Ga0207690_10648289 | 3300025932 | Unclassified | 865 |
| 586 | Ga0207706_10003378 | 3300025933 | Bacteria | 15270 |
| 587 | Ga0207706_10007545 | 3300025933 | Bacteria | 10066 |
| 588 | Ga0207706_10051444 | 3300025933 | Bacteria | 3637 |
| 589 | Ga0207706_10212378 | 3300025933 | Bacteria | 1696 |
| 590 | Ga0207706_10231715 | 3300025933 | Unclassified | 1616 |
| 591 | Ga0207706_10723978 | 3300025933 | Unclassified | 849 |
| 592 | Ga0207686_10013154 | 3300025934 | Bacteria | 4572 |
| 593 | Ga0207686_10015885 | 3300025934 | Bacteria | 4218 |
| 594 | Ga0207686_10293090 | 3300025934 | Unclassified | 1206 |
| 595 | Ga0207709_10073851 | 3300025935 | Unclassified | 2174 |
| 596 | Ga0207709_10458291 | 3300025935 | Unclassified | 987 |
| 597 | Ga0207670_10019286 | 3300025936 | Bacteria | 4163 |
| 598 | Ga0207670_10039737 | 3300025936 | Bacteria | 3083 |
| 599 | Ga0207670_10080069 | 3300025936 | Bacteria | 2282 |
| 600 | Ga0207669_10007580 | 3300025937 | Bacteria | 5033 |
| 601 | Ga0207669_10066988 | 3300025937 | Bacteria | 2235 |
| 602 | Ga0207669_10255803 | 3300025937 | Unclassified | 1307 |
| 603 | Ga0207669_10659299 | 3300025937 | Unclassified | 856 |
| 604 | Ga0207704_10011653 | 3300025938 | Bacteria | 4338 |
| 605 | Ga0207665_10007750 | 3300025939 | Bacteria | 7088 |
| 606 | Ga0207665_10029506 | 3300025939 | Bacteria | 3626 |
| 607 | Ga0207665_10036891 | 3300025939 | Bacteria | 3252 |
| 608 | Ga0207665_10073958 | 3300025939 | Bacteria | 2332 |
| 609 | Ga0207665_10170169 | 3300025939 | Bacteria | 1573 |
| 610 | Ga0207665_10204697 | 3300025939 | Unclassified | 1439 |
| 611 | Ga0207665_10270734 | 3300025939 | Bacteria | 1261 |
| 612 | Ga0207665_10430026 | 3300025939 | Unclassified | 1010 |
| 613 | Ga0207665_10477862 | 3300025939 | Bacteria | 960 |
| 614 | Ga0207665_10519987 | 3300025939 | Unclassified | 921 |
| 615 | Ga0207665_10573797 | 3300025939 | Bacteria | 879 |
| 616 | Ga0207691_10000701 | 3300025940 | Bacteria | 33170 |
| 617 | Ga0207691_10001070 | 3300025940 | Bacteria | 27238 |
| 618 | Ga0207691_10030053 | 3300025940 | Bacteria | 5080 |
| 619 | Ga0207691_11155590 | 3300025940 | Bacteria | 643 |
| 620 | Ga0207711_10192093 | 3300025941 | Unclassified | 1861 |
| 621 | Ga0207689_10139734 | 3300025942 | Unclassified | 1995 |
| 622 | Ga0207689_10525967 | 3300025942 | Bacteria | 992 |
| 623 | Ga0207661_10009439 | 3300025944 | Bacteria | 6999 |
| 624 | Ga0207661_10310509 | 3300025944 | Unclassified | 1415 |
| 625 | Ga0207679_10022332 | 3300025945 | Bacteria | 4307 |
| 626 | Ga0207679_10059913 | 3300025945 | Bacteria | 2826 |
| 627 | Ga0207679_10106199 | 3300025945 | Unclassified | 2207 |
| 628 | Ga0207679_10374511 | 3300025945 | Bacteria | 1247 |
| 629 | Ga0207679_10420978 | 3300025945 | Bacteria | 1179 |
| 630 | Ga0207667_10109661 | 3300025949 | Unclassified | 2847 |
| 631 | Ga0207667_10544901 | 3300025949 | Unclassified | 1174 |
| 632 | Ga0207651_10029637 | 3300025960 | Unclassified | 3470 |
| 633 | Ga0207651_10105668 | 3300025960 | Unclassified | 2101 |
| 634 | Ga0207651_10144653 | 3300025960 | Unclassified | 1841 |
| 635 | Ga0207651_10170621 | 3300025960 | Bacteria | 1715 |
| 636 | Ga0207651_10235979 | 3300025960 | Unclassified | 1488 |
| 637 | Ga0207651_10335148 | 3300025960 | Unclassified | 1269 |
| 638 | Ga0207712_10007453 | 3300025961 | Bacteria | 6909 |
| 639 | Ga0207712_10014529 | 3300025961 | Bacteria | 5068 |
| 640 | Ga0207712_10549905 | 3300025961 | Unclassified | 993 |
| 641 | Ga0207668_10017951 | 3300025972 | Unclassified | 4442 |
| 642 | Ga0207668_10022499 | 3300025972 | Bacteria | 4037 |
| 643 | Ga0207668_10028647 | 3300025972 | Bacteria | 3644 |
| 644 | Ga0207668_10042462 | 3300025972 | Bacteria | 3079 |
| 645 | Ga0207668_10052123 | 3300025972 | Bacteria | 2829 |
| 646 | Ga0207668_10206629 | 3300025972 | Unclassified | 1568 |
| 647 | Ga0207640_10300847 | 3300025981 | Bacteria | 1269 |
| 648 | Ga0207640_10886159 | 3300025981 | Bacteria | 778 |
| 649 | Ga0207658_10004924 | 3300025986 | Bacteria | 9211 |
| 650 | Ga0207658_10052195 | 3300025986 | Bacteria | 3016 |
| 651 | Ga0207658_10146665 | 3300025986 | Bacteria | 1917 |
| 652 | Ga0207658_10281767 | 3300025986 | Unclassified | 1425 |
| 653 | Ga0207658_10384598 | 3300025986 | Unclassified | 1230 |
| 654 | Ga0207677_10062789 | 3300026023 | Bacteria | 2579 |
| 655 | Ga0207677_10370325 | 3300026023 | Bacteria | 1206 |
| 656 | Ga0207703_10327616 | 3300026035 | Bacteria | 1404 |
| 657 | Ga0207703_10540403 | 3300026035 | Bacteria | 1098 |
| 658 | Ga0207678_10004824 | 3300026067 | Bacteria | 12114 |
| 659 | Ga0207678_10174162 | 3300026067 | Unclassified | 1837 |
| 660 | Ga0207678_10277388 | 3300026067 | Bacteria | 1438 |
| 661 | Ga0207708_10816242 | 3300026075 | Unclassified | 804 |
| 662 | Ga0207702_10081420 | 3300026078 | Bacteria | 2811 |
| 663 | Ga0207702_11162545 | 3300026078 | Unclassified | 766 |
| 664 | Ga0207641_10008530 | 3300026088 | Bacteria | 8465 |
| 665 | Ga0207648_10015532 | 3300026089 | Bacteria | 6998 |
| 666 | Ga0207648_10084443 | 3300026089 | Bacteria | 2770 |
| 667 | Ga0207676_10072439 | 3300026095 | Unclassified | 2770 |
| 668 | Ga0207676_10443807 | 3300026095 | Unclassified | 1222 |
| 669 | Ga0207675_100101175 | 3300026118 | Bacteria | 2715 |
| 670 | Ga0207675_100139331 | 3300026118 | Bacteria | 2304 |
| 671 | Ga0207675_100484530 | 3300026118 | Bacteria | 1230 |
| 672 | Ga0207683_10020045 | 3300026121 | Bacteria | 5714 |
| 673 | Ga0207683_10025017 | 3300026121 | Bacteria | 5148 |
| 674 | Ga0207683_10028676 | 3300026121 | Bacteria | 4815 |
| 675 | Ga0207683_10030603 | 3300026121 | Bacteria | 4664 |
| 676 | Ga0207683_10069897 | 3300026121 | Unclassified | 3101 |
| 677 | Ga0207698_10149223 | 3300026142 | Unclassified | 2026 |
| 678 | Ga0207698_10866642 | 3300026142 | Unclassified | 909 |
| 679 | Ga0207698_11193818 | 3300026142 | Unclassified | 775 |
| 680 | Ga0209179_1013682 | 3300027512 | Unclassified | 1478 |
| 681 | Ga0209971_1063954 | 3300027682 | Bacteria | 891 |
| 682 | Ga0209974_10034676 | 3300027876 | Bacteria | 1675 |
| 683 | Ga0209974_10065148 | 3300027876 | Unclassified | 1237 |
| 684 | Ga0268266_10078512 | 3300028379 | Bacteria | 2872 |
| 685 | Ga0268266_10121829 | 3300028379 | Bacteria | 2321 |
| 686 | Ga0268266_10145117 | 3300028379 | Bacteria | 2133 |
| 687 | Ga0268266_10454840 | 3300028379 | Unclassified | 1217 |
| 688 | Ga0268266_10583876 | 3300028379 | Unclassified | 1072 |
| 689 | Ga0268266_11393809 | 3300028379 | Unclassified | 676 |
| 690 | Ga0268266_11552443 | 3300028379 | Unclassified | 637 |
| 691 | Ga0268265_10174506 | 3300028380 | Unclassified | 1841 |
| 692 | Ga0268265_10523006 | 3300028380 | Unclassified | 1122 |
| 693 | Ga0268265_10865720 | 3300028380 | Unclassified | 885 |
| 694 | Ga0268264_10004596 | 3300028381 | Bacteria | 11730 |
| 695 | Ga0268264_11087801 | 3300028381 | Bacteria | 808 |
| 696 | Ga0268264_11151210 | 3300028381 | Unclassified | 785 |
| 697 | Ga0373938_0020479 | 3300034957 | Unclassified | 1333 |
| 698 | Ga0373926_0314976 | 3300035083 | Unclassified | 612 |
| 699 | Ga0373944_0072364 | 3300035089 | Unclassified | 1125 |
| 700 | Ga0373949_0056079 | 3300035090 | Unclassified | 1004 |
| 701 | Ga0373923_0364414 | 3300035111 | Unclassified | 692 |
| 702 | Ga0373936_0115947 | 3300035113 | Unclassified | 1141 |
| 703 | Ga0373945_0231219 | 3300035116 | Unclassified | 776 |
| 704 | Ga0373943_0019490 | 3300035170 | Bacteria | 3121 |
| 705 | Ga0373943_0021431 | 3300035170 | Bacteria | 2985 |
| 706 | Ga0373943_0175516 | 3300035170 | Unclassified | 1175 |
| 707 | Ga0373943_0246014 | 3300035170 | Bacteria | 1003 |
| 708 | Ga0373946_0027047 | 3300035171 | Unclassified | 2267 |
| 709 | Ga0373946_0105125 | 3300035171 | Unclassified | 1271 |
| 710 | Ga0373942_0013505 | 3300035207 | Bacteria | 1965 |
| 711 | Ga0373931_0031944 | 3300035691 | Bacteria | 2721 |
| 712 | Ga0373931_0501330 | 3300035691 | Unclassified | 783 |
| 713 | Ga0373935_0133698 | 3300035692 | Unclassified | 1669 |
| 714 | Ga0373935_0241878 | 3300035692 | Bacteria | 1260 |
| 715 | Ga0373927_0065252 | 3300035695 | Bacteria | 2355 |
| 716 | Ga0373927_0124512 | 3300035695 | Unclassified | 1683 |
| 717 | Ga0373927_0637479 | 3300035695 | Bacteria | 704 |
| 718 | Ga0373933_0077828 | 3300035724 | Bacteria | 2028 |
| 719 | Ga0373947_0007130 | 3300035725 | Bacteria | 6481 |
| 720 | Ga0373947_0076953 | 3300035725 | Bacteria | 2057 |
| 721 | Ga0373947_0167959 | 3300035725 | Bacteria | 1422 |
| 722 | Ga0373947_0190974 | 3300035725 | Bacteria | 1336 |
| 723 | Ga0373947_0225339 | 3300035725 | Bacteria | 1233 |
| 724 | Ga0373947_0299569 | 3300035725 | Unclassified | 1072 |
| 725 | Ga0373937_0287910 | 3300036401 | Unclassified | 1552 |
| 726 | Ga0373937_0414485 | 3300036401 | Bacteria | 1278 |
| 727 | Ga0373937_0589619 | 3300036401 | Unclassified | 1055 |
| 728 | Ga0373925_0024806 | 3300037068 | Unclassified | 4380 |
| 729 | Ga0373925_0059108 | 3300037068 | Bacteria | 2875 |
| 730 | Ga0373925_0120341 | 3300037068 | Bacteria | 2038 |
| 731 | Ga0373925_0143788 | 3300037068 | Unclassified | 1868 |
| 732 | Ga0373925_0260186 | 3300037068 | Bacteria | 1394 |
| 733 | Ga0373925_0361466 | 3300037068 | Unclassified | 1180 |
| 734 | Ga0395900_0035484 | 3300037418 | Bacteria | 5136 |
| 735 | Ga0395900_0158848 | 3300037418 | Bacteria | 2307 |
| 736 | Ga0395900_0225339 | 3300037418 | Unclassified | 1888 |
| 737 | Ga0395900_0288535 | 3300037418 | Bacteria | 1630 |
| 738 | Ga0395900_0906285 | 3300037418 | Unclassified | 805 |
| 739 | Ga0395900_1525012 | 3300037418 | Bacteria | 580 |
| 740 | Ga0395898_0015422 | 3300037466 | Bacteria | 7836 |
| 741 | Ga0395898_0059347 | 3300037466 | Bacteria | 3722 |
| 742 | Ga0395898_0601008 | 3300037466 | Unclassified | 1043 |
| 743 | Ga0395898_1301856 | 3300037466 | Unclassified | 656 |
| 744 | Ga0395905_0586725 | 3300037471 | Unclassified | 1016 |
| 745 | Ga0395905_1165189 | 3300037471 | Bacteria | 674 |
| 746 | Ga0436364_1013391 | 3300037853 | Bacteria | 1046 |
| 747 | Ga0395901_0001294 | 3300038443 | Bacteria | 26427 |
| 748 | Ga0395901_0125281 | 3300038443 | Bacteria | 2700 |
| 749 | Ga0395901_0338284 | 3300038443 | Bacteria | 1555 |
| 750 | Ga0395901_0615709 | 3300038443 | Bacteria | 1093 |
| 751 | Ga0395901_0810671 | 3300038443 | Bacteria | 924 |
| 752 | Ga0436362_0544766 | 3300039453 | Unclassified | 519 |
| 753 | Ga0451798_0255311 | 3300041458 | Unclassified | 516 |
| 754 | Ga0451853_0364943 | 3300041512 | Unclassified | 757 |
| 755 | Ga0451853_3265935 | 3300041512 | Bacteria | 1092 |
| 756 | Ga0439455_0014472 | 3300042012 | Unclassified | 1802 |
| 757 | Ga0439458_0011354 | 3300042157 | Unclassified | 1991 |
| 758 | Ga0439458_0060117 | 3300042157 | Bacteria | 948 |
| 759 | Ga0439460_0051433 | 3300042461 | Unclassified | 1236 |
| 760 | Ga0439440_0016520 | 3300042993 | Unclassified | 1617 |
| 761 | Ga0439440_0129557 | 3300042993 | Unclassified | 709 |
| 762 | Ga0466964_0010200 | 3300044706 | Bacteria | 3543 |
| 763 | Ga0451576_0437515 | 3300045051 | Unclassified | 1372 |
| 764 | Ga0466967_0810295 | 3300045976 | Bacteria | 930 |
| 765 | Ga0495592_0003666 | 3300046454 | Bacteria | 11062 |
| 766 | Ga0495592_0071957 | 3300046454 | Bacteria | 2516 |
| 767 | Ga0495603_0136944 | 3300046455 | Bacteria | 1425 |
| 768 | Ga0495629_0069394 | 3300046459 | Bacteria | 2459 |
| 769 | Ga0495629_0292997 | 3300046459 | Unclassified | 1115 |
| 770 | Ga0495651_0002481 | 3300046462 | Bacteria | 14260 |
| 771 | Ga0495651_0165100 | 3300046462 | Unclassified | 1582 |
| 772 | Ga0495653_0188674 | 3300046463 | Unclassified | 1408 |
| 773 | Ga0495580_0085689 | 3300046472 | Bacteria | 2194 |
| 774 | Ga0495605_0077750 | 3300046474 | Unclassified | 1556 |
| 775 | Ga0495639_0051774 | 3300046475 | Unclassified | 1868 |
| 776 | Ga0495662_0109566 | 3300046476 | Unclassified | 1353 |
| 777 | Ga0495664_0023225 | 3300046477 | Bacteria | 3598 |
| 778 | Ga0495584_0167766 | 3300046491 | Unclassified | 1116 |
| 779 | Ga0495584_0232173 | 3300046491 | Archaea | 938 |
| 780 | Ga0495618_0152914 | 3300046514 | Unclassified | 1473 |
| 781 | Ga0495620_0157899 | 3300046515 | Bacteria | 882 |
| 782 | Ga0495630_0379348 | 3300046517 | Bacteria | 1083 |
| 783 | Ga0495632_0330158 | 3300046519 | Unclassified | 673 |
| 784 | Ga0495637_0136817 | 3300046520 | Archaea | 932 |
| 785 | Ga0495644_0105876 | 3300046523 | Bacteria | 1066 |
| 786 | Ga0495663_0017731 | 3300046525 | Unclassified | 2023 |
| 787 | Ga0495663_0141507 | 3300046525 | Bacteria | 817 |
| 788 | Ga0495666_0054427 | 3300046526 | Bacteria | 1919 |
| 789 | Ga0495642_0032571 | 3300046528 | Unclassified | 2092 |
| 790 | Ga0495652_0062611 | 3300046529 | Bacteria | 3136 |
| 791 | Ga0495652_0185848 | 3300046529 | Bacteria | 1590 |
| 792 | Ga0495654_0126738 | 3300046530 | Unclassified | 1150 |
| 793 | Ga0495665_0158596 | 3300046531 | Unclassified | 1180 |
| 794 | Ga0495640_0079005 | 3300046533 | Bacteria | 2191 |
| 795 | Ga0495586_0041598 | 3300046535 | Bacteria | 2475 |
| 796 | Ga0495587_0031563 | 3300046536 | Bacteria | 3206 |
| 797 | Ga0495598_0002133 | 3300046537 | Unclassified | 4039 |
| 798 | Ga0495609_0249334 | 3300046538 | Archaea | 731 |
| 799 | Ga0495621_0098493 | 3300046539 | Unclassified | 1110 |
| 800 | Ga0495622_0163821 | 3300046557 | Bacteria | 1002 |
| 801 | Ga0495633_0108727 | 3300046558 | Unclassified | 1286 |
| 802 | Ga0495656_0236029 | 3300046615 | Archaea | 919 |
| 803 | Ga0495634_0099295 | 3300046642 | Unclassified | 1882 |
| 804 | Ga0495635_0343956 | 3300046663 | Unclassified | 996 |
| 805 | Ga0495635_0372444 | 3300046663 | Unclassified | 951 |
| 806 | Ga0495659_0007430 | 3300046664 | Bacteria | 3476 |
| 807 | Ga0495588_0246193 | 3300046674 | Unclassified | 943 |
| 808 | Ga0495657_0622887 | 3300046675 | Unclassified | 623 |
| 809 | Ga0495599_0002602 | 3300046678 | Bacteria | 10523 |
| 810 | Ga0495623_0008117 | 3300046679 | Bacteria | 6823 |
| 811 | Ga0495646_0156660 | 3300046680 | Unclassified | 1263 |
| 812 | Ga0495658_0093823 | 3300046683 | Bacteria | 1781 |
| 813 | Ga0495669_0012538 | 3300046684 | Bacteria | 3609 |
| 814 | Ga0495669_0022893 | 3300046684 | Unclassified | 2716 |
| 815 | Ga0495669_0082058 | 3300046684 | Unclassified | 1481 |
| 816 | Ga0495613_0086089 | 3300046689 | Unclassified | 2279 |
| 817 | Ga0495649_0307248 | 3300046694 | Unclassified | 807 |
| 818 | Ga0495600_0217469 | 3300046809 | Unclassified | 1223 |
| 819 | Ga0495581_0143850 | 3300047315 | Bacteria | 1391 |
| 820 | Ga0495674_0036636 | 3300047319 | Bacteria | 4414 |
| 821 | Ga0495676_0101757 | 3300047321 | Bacteria | 2124 |
| 822 | Ga0495675_0072265 | 3300047444 | Bacteria | 2176 |
| 823 | Ga0495684_0024374 | 3300047471 | Bacteria | 4658 |
| 824 | Ga0495602_0085166 | 3300048088 | Bacteria | 2642 |
| 825 | Ga0495614_0007991 | 3300048089 | Bacteria | 4702 |
| 826 | Ga0496100_0014612 | 3300048903 | Bacteria | 4562 |
| 827 | Ga0496100_0311080 | 3300048903 | Bacteria | 1181 |
| 828 | Ga0496101_0020470 | 3300048904 | Bacteria | 4530 |
| 829 | Ga0496101_0073871 | 3300048904 | Bacteria | 2506 |
| 830 | Ga0496101_0285318 | 3300048904 | Bacteria | 1291 |
| 831 | Ga0496101_0321082 | 3300048904 | Unclassified | 1215 |
| 832 | Ga0496101_0701515 | 3300048904 | Bacteria | 799 |
| 833 | Ga0496102_0057850 | 3300048905 | Bacteria | 3541 |
| 834 | Ga0496102_0078808 | 3300048905 | Bacteria | 3033 |
| 835 | Ga0496102_0153527 | 3300048905 | Bacteria | 2164 |
| 836 | Ga0496102_0279302 | 3300048905 | Bacteria | 1574 |
| 837 | Ga0496102_0434581 | 3300048905 | Bacteria | 1232 |
| 838 | Ga0496103_0016279 | 3300048906 | Bacteria | 4438 |
| 839 | Ga0496103_0046493 | 3300048906 | Bacteria | 2680 |
| 840 | Ga0496103_0312960 | 3300048906 | Bacteria | 1010 |
| 841 | Ga0496104_0040248 | 3300048907 | Bacteria | 4380 |
| 842 | Ga0496104_0051870 | 3300048907 | Bacteria | 3873 |
| 843 | Ga0496104_0063642 | 3300048907 | Bacteria | 3499 |
| 844 | Ga0496104_0094169 | 3300048907 | Bacteria | 2865 |
| 845 | Ga0496104_0171742 | 3300048907 | Unclassified | 2079 |
| 846 | Ga0496104_0525184 | 3300048907 | Unclassified | 1095 |
| 847 | Ga0496105_0038887 | 3300048908 | Bacteria | 3920 |
| 848 | Ga0496105_0322645 | 3300048908 | Bacteria | 1237 |
| 849 | Ga0496105_0336194 | 3300048908 | Bacteria | 1208 |
| 850 | Ga0496105_0438172 | 3300048908 | Bacteria | 1033 |
| 851 | Ga0496106_0025001 | 3300048909 | Bacteria | 4442 |
| 852 | Ga0496106_0077084 | 3300048909 | Bacteria | 2556 |
| 853 | Ga0496106_0248457 | 3300048909 | Bacteria | 1422 |
| 854 | Ga0496106_0342812 | 3300048909 | Bacteria | 1200 |
| 855 | Ga0496107_0026842 | 3300048910 | Bacteria | 4086 |
| 856 | Ga0496107_0067383 | 3300048910 | Bacteria | 2597 |
| 857 | Ga0496107_0119523 | 3300048910 | Bacteria | 1941 |
| 858 | Ga0496107_0409308 | 3300048910 | Bacteria | 1009 |
| 859 | Ga0496108_0052612 | 3300048911 | Bacteria | 3413 |
| 860 | Ga0496108_0063381 | 3300048911 | Unclassified | 3113 |
| 861 | Ga0496108_0130017 | 3300048911 | Bacteria | 2164 |
| 862 | Ga0496108_0432648 | 3300048911 | Bacteria | 1149 |
| 863 | Ga0496108_0760276 | 3300048911 | Bacteria | 838 |
| 864 | Ga0496108_0931755 | 3300048911 | Bacteria | 744 |
| 865 | Ga0496109_0027830 | 3300048912 | Bacteria | 5052 |
| 866 | Ga0496109_0042205 | 3300048912 | Bacteria | 4131 |
| 867 | Ga0496109_0093658 | 3300048912 | Bacteria | 2780 |
| 868 | Ga0496109_0164122 | 3300048912 | Bacteria | 2082 |
| 869 | Ga0496109_0222184 | 3300048912 | Bacteria | 1776 |
| 870 | Ga0496109_0446505 | 3300048912 | Bacteria | 1222 |
| 871 | Ga0496109_0491271 | 3300048912 | Unclassified | 1159 |
| 872 | Ga0496110_0065445 | 3300048913 | Unclassified | 3214 |
| 873 | Ga0496110_0393781 | 3300048913 | Unclassified | 1263 |
| 874 | Ga0496110_0555896 | 3300048913 | Bacteria | 1043 |
| 875 | Ga0496110_0911827 | 3300048913 | Unclassified | 785 |
| 876 | Ga0496111_0086614 | 3300048914 | Bacteria | 2292 |
| 877 | Ga0496112_0001874 | 3300048915 | Bacteria | 16581 |
| 878 | Ga0496112_0040797 | 3300048915 | Unclassified | 4539 |
| 879 | Ga0496112_0094453 | 3300048915 | Bacteria | 2961 |
| 880 | Ga0496112_0163709 | 3300048915 | Bacteria | 2190 |
| 881 | Ga0496112_0236983 | 3300048915 | Unclassified | 1778 |
| 882 | Ga0496112_0483833 | 3300048915 | Bacteria | 1174 |
| 883 | Ga0496112_0950785 | 3300048915 | Unclassified | 780 |
| 884 | Ga0496113_0055035 | 3300048916 | Bacteria | 2981 |
| 885 | Ga0496113_0085381 | 3300048916 | Unclassified | 2425 |
| 886 | Ga0496113_0300205 | 3300048916 | Unclassified | 1286 |
| 887 | Ga0496113_0554671 | 3300048916 | Bacteria | 921 |
| 888 | Ga0496114_0005274 | 3300048917 | Bacteria | 10099 |
| 889 | Ga0496114_0107274 | 3300048917 | Bacteria | 2390 |
| 890 | Ga0496114_0278962 | 3300048917 | Bacteria | 1473 |
| 891 | Ga0496115_0004373 | 3300048918 | Bacteria | 10232 |
| 892 | Ga0496115_0004459 | 3300048918 | Bacteria | 10146 |
| 893 | Ga0496115_0007639 | 3300048918 | Bacteria | 7965 |
| 894 | Ga0496115_0017107 | 3300048918 | Bacteria | 5532 |
| 895 | Ga0496115_0103021 | 3300048918 | Unclassified | 2341 |
| 896 | nmdc:mga05p37_190551_c1 | 3300050507 | Bacteria | 2490 |
| 897 | nmdc:mga05p37_27192_c1 | 3300050507 | Bacteria | 6964 |
| 898 | nmdc:mga05p37_679881_c1 | 3300050507 | Bacteria | 1147 |
| 899 | nmdc:mga08y16_26106_c3 | 3300050511 | Bacteria | 1655 |
| 900 | nmdc:mga08y16_312471_c1 | 3300050511 | Unclassified | 1618 |
| 901 | nmdc:mga08y16_330091_c1 | 3300050511 | Unclassified | 1569 |
| 902 | nmdc:mga0n895_169751_c1 | 3300050512 | Unclassified | 2213 |
| 903 | nmdc:mga0n895_198730_c1 | 3300050512 | Unclassified | 2036 |
| 904 | nmdc:mga0n895_223870_c1 | 3300050512 | Unclassified | 1909 |
| 905 | nmdc:mga0n895_504204_c1 | 3300050512 | Unclassified | 1219 |
| 906 | nmdc:mga0rr50_884094_c1 | 3300050513 | Unclassified | 762 |
| 907 | nmdc:mga08x19_335824_c1 | 3300050514 | Unclassified | 1053 |
| 908 | nmdc:mga08x19_341484_c1 | 3300050514 | Unclassified | 1044 |
| 909 | nmdc:mga08x19_50281_c1 | 3300050514 | Unclassified | 2675 |
| 910 | nmdc:mga0a205_234102_c1 | 3300050515 | Bacteria | 1719 |
| 911 | Ga0495601_0036340 | 3300053077 | Bacteria | 3075 |
| 912 | Ga0495655_0056658 | 3300053083 | Archaea | 1055 |
| 913 | Ga0495595_0146473 | 3300053084 | Bacteria | 1160 |
| 914 | Ga0495619_0386021 | 3300053085 | Bacteria | 968 |
| 915 | Ga0495628_0218663 | |||
| 916 | CNXas_1000015 | |||
| 917 | JGI24035J26624_1002185 | |||
| 918 | JGI25406J46586_10028297 | |||
| 919 | JGI25406J46586_10033383 | |||
| 920 | JGI25405J52794_10000124 | |||
| 921 | Ga0065717_1001519 | |||
| 922 | Ga0065714_10090773 | |||
| 923 | Ga0065714_10228608 | |||
| 924 | Ga0065704_10082945 | |||
| 925 | Ga0065704_10083157 | |||
| 926 | Ga0065704_10148674 | |||
| 927 | Ga0065704_10238857 | |||
| 928 | Ga0065712_10002542 | |||
| 929 | Ga0065712_10008036 | |||
| 930 | Ga0065712_10008417 | |||
| 931 | Ga0065712_10084262 | |||
| 932 | Ga0065712_10125226 | |||
| 933 | Ga0065712_10138258 | |||
| 934 | Ga0065712_10240150 | |||
| 935 | Ga0065715_10002238 | |||
| 936 | Ga0065715_10007980 | |||
| 937 | Ga0065715_10013048 | |||
| 938 | Ga0065715_10089584 | |||
| 939 | Ga0065715_10103092 | |||
| 940 | Ga0065715_10106469 | |||
| 941 | Ga0065715_10120331 | |||
| 942 | Ga0065715_10303022 | |||
| 943 | Ga0065707_10003529 | |||
| 944 | Ga0065707_10014870 | |||
| 945 | Ga0070676_10002299 | |||
| 946 | Ga0070676_10039949 | |||
| 947 | Ga0070676_10067171 | |||
| 948 | Ga0070676_10168250 | |||
| 949 | Ga0070683_100007716 | |||
| 950 | Ga0070683_100031446 | |||
| 951 | Ga0070683_100067473 | |||
| 952 | Ga0070683_100130551 | |||
| 953 | Ga0070683_100161638 | |||
| 954 | Ga0070690_100077316 | |||
| 955 | Ga0070690_100085791 | |||
| 956 | Ga0070690_100101108 | |||
| 957 | Ga0070690_100107914 | |||
| 958 | Ga0070690_100232936 | |||
| 959 | Ga0070670_100014391 | |||
| 960 | Ga0070670_100037989 | |||
| 961 | Ga0070670_100069191 | |||
| 962 | Ga0070670_100113364 | |||
| 963 | Ga0070670_100117022 | |||
| 964 | Ga0070670_100552400 | |||
| 965 | Ga0070670_100681117 | |||
| 966 | Ga0070670_101124735 | |||
| 967 | Ga0070677_10069138 | |||
| 968 | Ga0070677_10217156 | |||
| 969 | Ga0068869_100120624 | |||
| 970 | Ga0068869_100122116 | |||
| 971 | Ga0070666_10015825 | |||
| 972 | Ga0070666_10026780 | |||
| 973 | Ga0070666_10086327 | |||
| 974 | Ga0070666_10200626 | |||
| 975 | Ga0070666_10896415 | |||
| 976 | Ga0070680_100155543 | |||
| 977 | Ga0070680_100589926 | |||
| 978 | Ga0070682_100053816 | |||
| 979 | Ga0068868_100012887 | |||
| 980 | Ga0068868_100048425 | |||
| 981 | Ga0068868_100053005 | |||
| 982 | Ga0068868_100126576 | |||
| 983 | Ga0070660_100062452 | |||
| 984 | Ga0070660_100351029 | |||
| 985 | Ga0070660_100384965 | |||
| 986 | Ga0070660_100749358 | |||
| 987 | Ga0070689_100001267 | |||
| 988 | Ga0070689_100009006 | |||
| 989 | Ga0070689_100075953 | |||
| 990 | Ga0070689_100218494 | |||
| 991 | Ga0070687_100694925 | |||
| 992 | Ga0070687_100807312 | |||
| 993 | Ga0070661_100096470 | |||
| 994 | Ga0070692_10192214 | |||
| 995 | Ga0070668_100001566 | |||
| 996 | Ga0070668_100022038 | |||
| 997 | Ga0070668_100047915 | |||
| 998 | Ga0070668_100093795 | |||
| 999 | Ga0070668_100171859 | |||
| 1000 | Ga0070669_100005146 | |||
| 1001 | Ga0070669_100014651 | |||
| 1002 | Ga0070669_100035637 | |||
| 1003 | Ga0070669_100070580 | |||
| 1004 | Ga0070669_100473234 | |||
| 1005 | Ga0070669_100493727 | |||
| 1006 | Ga0070675_100000800 | |||
| 1007 | Ga0070675_100001110 | |||
| 1008 | Ga0070675_100032879 | |||
| 1009 | Ga0070675_100042730 | |||
| 1010 | Ga0070675_100084777 | |||
| 1011 | Ga0070675_100126077 | |||
| 1012 | Ga0070675_100183334 | |||
| 1013 | Ga0070675_100444653 | |||
| 1014 | Ga0070675_100515654 | |||
| 1015 | Ga0070675_101159773 | |||
| 1016 | Ga0070671_100006985 | |||
| 1017 | Ga0070671_100009200 | |||
| 1018 | Ga0070671_100010632 | |||
| 1019 | Ga0070671_100117596 | |||
| 1020 | Ga0070671_100213265 | |||
| 1021 | Ga0070671_100251248 | |||
| 1022 | Ga0070671_100455729 | |||
| 1023 | Ga0070671_100459439 | |||
| 1024 | Ga0070671_100520260 | |||
| 1025 | Ga0070671_100727451 | |||
| 1026 | Ga0070674_100004295 | |||
| 1027 | Ga0070674_100017349 | |||
| 1028 | Ga0070674_100061487 | |||
| 1029 | Ga0070674_100136976 | |||
| 1030 | Ga0070673_100008309 | |||
| 1031 | Ga0070673_100012043 | |||
| 1032 | Ga0070673_100012359 | |||
| 1033 | Ga0070673_100069064 | |||
| 1034 | Ga0070673_100359117 | |||
| 1035 | Ga0070688_100024252 | |||
| 1036 | Ga0070688_100088841 | |||
| 1037 | Ga0070688_100166542 | |||
| 1038 | Ga0070659_100035409 | |||
| 1039 | Ga0070659_100281801 | |||
| 1040 | Ga0070659_100319339 | |||
| 1041 | Ga0070659_100928889 | |||
| 1042 | Ga0070667_100018525 | |||
| 1043 | Ga0070667_100051358 | |||
| 1044 | Ga0070667_100056208 | |||
| 1045 | Ga0070667_100215810 | |||
| 1046 | Ga0070667_100241944 | |||
| 1047 | Ga0070667_100520265 | |||
| 1048 | Ga0070667_100768811 | |||
| 1049 | Ga0070709_10061646 | |||
| 1050 | Ga0070709_10101160 | |||
| 1051 | Ga0070709_10157553 | |||
| 1052 | Ga0070709_10389873 | |||
| 1053 | Ga0070714_100066234 | |||
| 1054 | Ga0070713_100065319 | |||
| 1055 | Ga0070713_100210626 | |||
| 1056 | Ga0070713_100311592 | |||
| 1057 | Ga0070710_10045206 | |||
| 1058 | Ga0070710_10158900 | |||
| 1059 | Ga0070710_10225392 | |||
| 1060 | Ga0070710_10436124 | |||
| 1061 | Ga0070711_100003037 | |||
| 1062 | Ga0070711_100020337 | |||
| 1063 | Ga0070711_100041603 | |||
| 1064 | Ga0070711_100111760 | |||
| 1065 | Ga0070711_100115136 | |||
| 1066 | Ga0070705_100017828 | |||
| 1067 | Ga0070705_100021045 | |||
| 1068 | Ga0070705_100039662 | |||
| 1069 | Ga0070705_100378764 | |||
| 1070 | Ga0070700_100084729 | |||
| 1071 | Ga0070694_100086048 | |||
| 1072 | Ga0070694_100245858 | |||
| 1073 | Ga0070708_100014955 | |||
| 1074 | Ga0070708_100027669 | |||
| 1075 | Ga0070708_100045127 | |||
| 1076 | Ga0070708_100074413 | |||
| 1077 | Ga0070708_100141047 | |||
| 1078 | Ga0070708_100298506 | |||
| 1079 | Ga0070708_100339865 | |||
| 1080 | Ga0070708_100424659 | |||
| 1081 | Ga0070708_100922290 | |||
| 1082 | Ga0070663_100020545 | |||
| 1083 | Ga0070663_100516075 | |||
| 1084 | Ga0070663_101117233 | |||
| 1085 | Ga0070678_100053145 | |||
| 1086 | Ga0070678_100142165 | |||
| 1087 | Ga0070662_100011457 | |||
| 1088 | Ga0070662_100144755 | |||
| 1089 | Ga0070662_100178898 | |||
| 1090 | Ga0070662_100827424 | |||
| 1091 | Ga0070681_10052380 | |||
| 1092 | Ga0068867_100014657 | |||
| 1093 | Ga0070685_10050959 | |||
| 1094 | Ga0070685_10530275 | |||
| 1095 | Ga0070706_100000011 | |||
| 1096 | Ga0070706_100012402 | |||
| 1097 | Ga0070706_100015234 | |||
| 1098 | Ga0070706_100021085 | |||
| 1099 | Ga0070706_100040495 | |||
| 1100 | Ga0070706_100068869 | |||
| 1101 | Ga0070706_100430206 | |||
| 1102 | Ga0070706_100665738 | |||
| 1103 | Ga0070706_101044686 | |||
| 1104 | Ga0070707_100003264 | |||
| 1105 | Ga0070707_100023994 | |||
| 1106 | Ga0070707_100024310 | |||
| 1107 | Ga0070707_100041589 | |||
| 1108 | Ga0070707_100052756 | |||
| 1109 | Ga0070707_100126399 | |||
| 1110 | Ga0070707_100244903 | |||
| 1111 | Ga0070707_100598422 | |||
| 1112 | Ga0070707_100672675 | |||
| 1113 | Ga0070698_100000288 | |||
| 1114 | Ga0070698_100012794 | |||
| 1115 | Ga0070698_100029828 | |||
| 1116 | Ga0070698_100255024 | |||
| 1117 | Ga0070698_100294938 | |||
| 1118 | Ga0070698_101173497 | |||
| 1119 | Ga0070699_100134495 | |||
| 1120 | Ga0070699_100206100 | |||
| 1121 | Ga0070699_100333238 | |||
| 1122 | Ga0070699_100595076 | |||
| 1123 | Ga0070699_100665034 | |||
| 1124 | Ga0070699_101054423 | |||
| 1125 | Ga0070684_100000254 | |||
| 1126 | Ga0070684_100260485 | |||
| 1127 | Ga0070684_100383706 | |||
| 1128 | Ga0070684_100470170 | |||
| 1129 | Ga0070684_100830345 | |||
| 1130 | Ga0070684_100966149 | |||
| 1131 | Ga0070697_100001132 | |||
| 1132 | Ga0070697_100017935 | |||
| 1133 | Ga0070697_100020084 | |||
| 1134 | Ga0070697_100024745 | |||
| 1135 | Ga0070697_100034437 | |||
| 1136 | Ga0070697_100038577 | |||
| 1137 | Ga0070697_100039499 | |||
| 1138 | Ga0070697_100039941 | |||
| 1139 | Ga0070697_100042413 | |||
| 1140 | Ga0070697_100087093 | |||
| 1141 | Ga0070697_100162632 | |||
| 1142 | Ga0070697_100518172 | |||
| 1143 | Ga0070697_100533086 | |||
| 1144 | Ga0070697_100637862 | |||
| 1145 | Ga0070672_100008850 | |||
| 1146 | Ga0070672_100060915 | |||
| 1147 | Ga0070672_100071036 | |||
| 1148 | Ga0070672_100085054 | |||
| 1149 | Ga0070686_100008987 | |||
| 1150 | Ga0070686_100633978 | |||
| 1151 | Ga0070695_100073372 | |||
| 1152 | Ga0070695_100798851 | |||
| 1153 | Ga0070696_100033547 | |||
| 1154 | Ga0070696_100285926 | |||
| 1155 | Ga0070665_100146836 | |||
| 1156 | Ga0070665_100147354 | |||
| 1157 | Ga0070665_100160449 | |||
| 1158 | Ga0070665_100184912 | |||
| 1159 | Ga0070665_100190733 | |||
| 1160 | Ga0070665_100307052 | |||
| 1161 | Ga0070665_100787728 | |||
| 1162 | Ga0070665_101125515 | |||
| 1163 | Ga0070704_100007524 | |||
| 1164 | Ga0070704_100453595 | |||
| 1165 | Ga0068855_100460849 | |||
| 1166 | Ga0068855_100461974 | |||
| 1167 | Ga0068855_101232633 | |||
| 1168 | Ga0070664_100025116 | |||
| 1169 | Ga0070664_100030703 | |||
| 1170 | Ga0070664_100127830 | |||
| 1171 | Ga0070664_100138533 | |||
| 1172 | Ga0070664_100252035 | |||
| 1173 | Ga0070664_100353061 | |||
| 1174 | Ga0070664_100745758 | |||
| 1175 | Ga0068854_100313522 | |||
| 1176 | Ga0068856_100024841 | |||
| 1177 | Ga0070702_100192728 | |||
| 1178 | Ga0070702_100455904 | |||
| 1179 | Ga0068852_100637867 | |||
| 1180 | Ga0068852_100641552 | |||
| 1181 | Ga0068859_100124988 | |||
| 1182 | Ga0068864_100263763 | |||
| 1183 | Ga0068864_100446769 | |||
| 1184 | Ga0068866_10017827 | |||
| 1185 | Ga0068861_100234604 | |||
| 1186 | Ga0068863_100085861 | |||
| 1187 | Ga0068863_100166687 | |||
| 1188 | Ga0068863_100172349 | |||
| 1189 | Ga0068863_100789166 | |||
| 1190 | Ga0068858_100010162 | |||
| 1191 | Ga0068858_100212940 | |||
| 1192 | Ga0068858_100354330 | |||
| 1193 | Ga0068860_100007266 | |||
| 1194 | Ga0068860_101124737 | |||
| 1195 | Ga0068860_101314894 | |||
| 1196 | Ga0068862_100083952 | |||
| 1197 | Ga0068862_100316582 | |||
| 1198 | Ga0068862_101023174 | |||
| 1199 | Ga0081455_10000486 | |||
| 1200 | Ga0081455_10003585 | |||
| 1201 | Ga0081455_10114154 | |||
| 1202 | Ga0081455_10114852 | |||
| 1203 | Ga0081455_10149311 | |||
| 1204 | Ga0081540_1000532 | |||
| 1205 | Ga0081540_1007016 | |||
| 1206 | Ga0081540_1020553 | |||
| 1207 | Ga0081539_10003960 | |||
| 1208 | Ga0081539_10005046 | |||
| 1209 | Ga0081539_10016932 | |||
| 1210 | Ga0081539_10040760 | |||
| 1211 | Ga0070717_10005159 | |||
| 1212 | Ga0070717_10005613 | |||
| 1213 | Ga0070717_10016084 | |||
| 1214 | Ga0070717_10067690 | |||
| 1215 | Ga0070717_10072623 | |||
| 1216 | Ga0070717_10461502 | |||
| 1217 | Ga0070717_10579642 | |||
| 1218 | Ga0070717_10682660 | |||
| 1219 | Ga0070717_11226327 | |||
| 1220 | Ga0070715_10012884 | |||
| 1221 | Ga0070715_10016504 | |||
| 1222 | Ga0070715_10291114 | |||
| 1223 | Ga0070716_100034718 | |||
| 1224 | Ga0070716_100050005 | |||
| 1225 | Ga0070716_100052507 | |||
| 1226 | Ga0070716_100062450 | |||
| 1227 | Ga0070716_100257965 | |||
| 1228 | Ga0070716_100448324 | |||
| 1229 | Ga0070712_100005405 | |||
| 1230 | Ga0070712_100006223 | |||
| 1231 | Ga0070712_100142042 | |||
| 1232 | Ga0070712_100160451 | |||
| 1233 | Ga0070712_100213429 | |||
| 1234 | Ga0070712_100368745 | |||
| 1235 | Ga0070712_100670156 | |||
| 1236 | Ga0070712_100822959 | |||
| 1237 | Ga0070712_100990787 | |||
| 1238 | Ga0070712_100995804 | |||
| 1239 | Ga0075366_10572089 | |||
| 1240 | Ga0097621_100005808 | |||
| 1241 | Ga0097621_100015849 | |||
| 1242 | Ga0097621_100074971 | |||
| 1243 | Ga0097621_100129350 | |||
| 1244 | Ga0097621_100286979 | |||
| 1245 | Ga0068871_100004431 | |||
| 1246 | Ga0068871_100026904 | |||
| 1247 | Ga0068871_100199469 | |||
| 1248 | Ga0068871_100200713 | |||
| 1249 | Ga0075428_100262136 | |||
| 1250 | Ga0075428_100836432 | |||
| 1251 | Ga0075431_100515654 | |||
| 1252 | Ga0075433_10602200 | |||
| 1253 | Ga0075434_100052913 | |||
| 1254 | Ga0075434_100492373 | |||
| 1255 | Ga0075434_100553872 | |||
| 1256 | Ga0068865_100013990 | |||
| 1257 | Ga0068865_100162120 | |||
| 1258 | Ga0075436_100023561 | |||
| 1259 | Ga0075436_100273132 | |||
| 1260 | Ga0097620_100124987 | |||
| 1261 | Ga0075435_100440009 | |||
| 1262 | Ga0099795_10043076 | |||
| 1263 | Ga0105240_10684839 | |||
| 1264 | Ga0105240_11272952 | |||
| 1265 | Ga0111539_10106439 | |||
| 1266 | Ga0111539_10114935 | |||
| 1267 | Ga0111539_10495389 | |||
| 1268 | Ga0105245_10074086 | |||
| 1269 | Ga0105245_10077081 | |||
| 1270 | Ga0105245_10188026 | |||
| 1271 | Ga0105245_10328943 | |||
| 1272 | Ga0105245_10571395 | |||
| 1273 | Ga0105245_11005435 | |||
| 1274 | Ga0105247_10043319 | |||
| 1275 | Ga0105247_10130781 | |||
| 1276 | Ga0114129_10416208 | |||
| 1277 | Ga0114129_10844177 | |||
| 1278 | Ga0105243_10129668 | |||
| 1279 | Ga0105243_10132216 | |||
| 1280 | Ga0105243_11262403 | |||
| 1281 | Ga0105241_10224294 | |||
| 1282 | Ga0105241_10739050 | |||
| 1283 | Ga0105242_10029989 | |||
| 1284 | Ga0105242_10175215 | |||
| 1285 | Ga0105242_10325009 | |||
| 1286 | Ga0105237_10167421 | |||
| 1287 | Ga0105249_10006222 | |||
| 1288 | Ga0105249_10045544 | |||
| 1289 | Ga0105249_10727539 | |||
| 1290 | Ga0099796_10059088 | |||
| 1291 | Ga0105239_10018051 | |||
| 1292 | Ga0105239_10226533 | |||
| 1293 | Ga0105239_10669524 | |||
| 1294 | Ga0105246_10034754 | |||
| 1295 | Ga0105246_10163593 | |||
| 1296 | Ga0105246_10846491 | |||
| 1297 | Ga0157373_10601331 | |||
| 1298 | Ga0157369_10179278 | |||
| 1299 | Ga0157374_10004504 | |||
| 1300 | Ga0157374_10030925 | |||
| 1301 | Ga0157374_10062854 | |||
| 1302 | Ga0157374_10124171 | |||
| 1303 | Ga0157374_10154984 | |||
| 1304 | Ga0157374_10179307 | |||
| 1305 | Ga0157374_10186378 | |||
| 1306 | Ga0157374_10214222 | |||
| 1307 | Ga0157374_10248798 | |||
| 1308 | Ga0157374_10511776 | |||
| 1309 | Ga0157374_10537347 | |||
| 1310 | Ga0157374_10735867 | |||
| 1311 | Ga0157378_10004663 | |||
| 1312 | Ga0157378_10029641 | |||
| 1313 | Ga0157378_10061028 | |||
| 1314 | Ga0157378_10061937 | |||
| 1315 | Ga0157378_10067784 | |||
| 1316 | Ga0157378_10085694 | |||
| 1317 | Ga0157378_10253080 | |||
| 1318 | Ga0157378_10349824 | |||
| 1319 | Ga0157378_10496685 | |||
| 1320 | Ga0157378_10526729 | |||
| 1321 | Ga0157378_10554211 | |||
| 1322 | Ga0157378_10916296 | |||
| 1323 | Ga0163162_10004005 | |||
| 1324 | Ga0163162_10011144 | |||
| 1325 | Ga0163162_10036699 | |||
| 1326 | Ga0163162_10039816 | |||
| 1327 | Ga0163162_10040041 | |||
| 1328 | Ga0163162_10300252 | |||
| 1329 | Ga0163162_10416610 | |||
| 1330 | Ga0163162_10519708 | |||
| 1331 | Ga0157372_10061403 | |||
| 1332 | Ga0157372_10068753 | |||
| 1333 | Ga0157372_10136701 | |||
| 1334 | Ga0157372_11388444 | |||
| 1335 | Ga0157375_10003613 | |||
| 1336 | Ga0157375_10037043 | |||
| 1337 | Ga0157375_10135970 | |||
| 1338 | Ga0157375_10235267 | |||
| 1339 | Ga0157375_10332876 | |||
| 1340 | Ga0157375_10378858 | |||
| 1341 | Ga0157375_10398083 | |||
| 1342 | Ga0157375_10971227 | |||
| 1343 | Ga0163163_10222506 | |||
| 1344 | Ga0163163_11519704 | |||
| 1345 | Ga0182008_10438391 | |||
| 1346 | Ga0157377_10082291 | |||
| 1347 | Ga0157377_10235911 | |||
| 1348 | Ga0157379_10030011 | |||
| 1349 | Ga0157376_10032856 | |||
| 1350 | Ga0157376_10062547 | |||
| 1351 | Ga0157376_10081011 | |||
| 1352 | Ga0157376_10088716 | |||
| 1353 | Ga0157376_10111049 | |||
| 1354 | Ga0157376_10142869 | |||
| 1355 | Ga0157376_10304067 | |||
| 1356 | Ga0157376_10468600 | |||
| 1357 | Ga0157376_10670955 | |||
| 1358 | Ga0157376_11175893 | |||
| 1359 | Ga0157376_11691128 | |||
| 1360 | Ga0182007_10076327 | |||
| 1361 | Ga0163161_10039588 | |||
| 1362 | Ga0163161_10159728 | |||
| 1363 | Ga0163161_10302651 | |||
| 1364 | Ga0207666_1001684 | |||
| 1365 | Ga0207673_1000646 | |||
| 1366 | Ga0207673_1002887 | |||
| 1367 | Ga0207673_1009636 | |||
| 1368 | Ga0207673_1031750 | |||
| 1369 | Ga0207697_10000281 | |||
| 1370 | Ga0207697_10001510 | |||
| 1371 | Ga0207697_10002546 | |||
| 1372 | Ga0207697_10003172 | |||
| 1373 | Ga0207697_10009904 | |||
| 1374 | Ga0207697_10011141 | |||
| 1375 | Ga0207697_10012398 | |||
| 1376 | Ga0207697_10013296 | |||
| 1377 | Ga0207697_10038913 | |||
| 1378 | Ga0207697_10080359 | |||
| 1379 | Ga0207653_10006171 | |||
| 1380 | Ga0207682_10004815 | |||
| 1381 | Ga0207692_10127636 | |||
| 1382 | Ga0207642_10050773 | |||
| 1383 | Ga0207710_10038073 | |||
| 1384 | Ga0207710_10192462 | |||
| 1385 | Ga0207688_10001545 | |||
| 1386 | Ga0207688_10005469 | |||
| 1387 | Ga0207688_10043420 | |||
| 1388 | Ga0207688_10159234 | |||
| 1389 | Ga0207688_10189402 | |||
| 1390 | Ga0207680_10012292 | |||
| 1391 | Ga0207680_10028269 | |||
| 1392 | Ga0207680_10222950 | |||
| 1393 | Ga0207647_10009086 | |||
| 1394 | Ga0207647_10236704 | |||
| 1395 | Ga0207647_10243707 | |||
| 1396 | Ga0207685_10148187 | |||
| 1397 | Ga0207685_10200573 | |||
| 1398 | Ga0207699_10009262 | |||
| 1399 | Ga0207699_10085515 | |||
| 1400 | Ga0207645_10001030 | |||
| 1401 | Ga0207645_10003151 | |||
| 1402 | Ga0207645_10008561 | |||
| 1403 | Ga0207645_10010303 | |||
| 1404 | Ga0207645_10043642 | |||
| 1405 | Ga0207645_10187341 | |||
| 1406 | Ga0207645_10621605 | |||
| 1407 | Ga0207684_10000052 | |||
| 1408 | Ga0207684_10011740 | |||
| 1409 | Ga0207684_10015843 | |||
| 1410 | Ga0207684_10028320 | |||
| 1411 | Ga0207684_10028682 | |||
| 1412 | Ga0207684_10048819 | |||
| 1413 | Ga0207684_10190765 | |||
| 1414 | Ga0207684_10257943 | |||
| 1415 | Ga0207684_10395575 | |||
| 1416 | Ga0207684_10629919 | |||
| 1417 | Ga0207684_10700144 | |||
| 1418 | Ga0207684_10925131 | |||
| 1419 | Ga0207654_10164387 | |||
| 1420 | Ga0207707_10024631 | |||
| 1421 | Ga0207671_10266760 | |||
| 1422 | Ga0207693_10009848 | |||
| 1423 | Ga0207693_10016372 | |||
| 1424 | Ga0207693_10029080 | |||
| 1425 | Ga0207693_10032992 | |||
| 1426 | Ga0207693_10047385 | |||
| 1427 | Ga0207693_10089441 | |||
| 1428 | Ga0207693_10102841 | |||
| 1429 | Ga0207693_10134442 | |||
| 1430 | Ga0207693_10294460 | |||
| 1431 | Ga0207693_10294461 | |||
| 1432 | Ga0207693_10395716 | |||
| 1433 | Ga0207663_10002317 | |||
| 1434 | Ga0207663_10034619 | |||
| 1435 | Ga0207663_10076307 | |||
| 1436 | Ga0207663_10161217 | |||
| 1437 | Ga0207663_10322425 | |||
| 1438 | Ga0207662_10000532 | |||
| 1439 | Ga0207657_10061423 | |||
| 1440 | Ga0207657_10077181 | |||
| 1441 | Ga0207657_10319976 | |||
| 1442 | Ga0207657_10355796 | |||
| 1443 | Ga0207657_10665842 | |||
| 1444 | Ga0207657_10822114 | |||
| 1445 | Ga0207649_10177784 | |||
| 1446 | Ga0207652_10240703 | |||
| 1447 | Ga0207646_10001640 | |||
| 1448 | Ga0207646_10003759 | |||
| 1449 | Ga0207646_10003836 | |||
| 1450 | Ga0207646_10037631 | |||
| 1451 | Ga0207646_10091803 | |||
| 1452 | Ga0207646_10164799 | |||
| 1453 | Ga0207646_10179804 | |||
| 1454 | Ga0207646_10197179 | |||
| 1455 | Ga0207646_10290940 | |||
| 1456 | Ga0207646_10571677 | |||
| 1457 | Ga0207646_10943958 | |||
| 1458 | Ga0207681_10013338 | |||
| 1459 | Ga0207681_10017078 | |||
| 1460 | Ga0207681_10024960 | |||
| 1461 | Ga0207681_10032609 | |||
| 1462 | Ga0207681_10057495 | |||
| 1463 | Ga0207681_10101402 | |||
| 1464 | Ga0207681_10203742 | |||
| 1465 | Ga0207681_10247898 | |||
| 1466 | Ga0207681_10632468 | |||
| 1467 | Ga0207650_10069982 | |||
| 1468 | Ga0207650_10129955 | |||
| 1469 | Ga0207650_10154601 | |||
| 1470 | Ga0207650_10418715 | |||
| 1471 | Ga0207650_10615040 | |||
| 1472 | Ga0207659_10018518 | |||
| 1473 | Ga0207659_10021701 | |||
| 1474 | Ga0207659_10044610 | |||
| 1475 | Ga0207659_10071319 | |||
| 1476 | Ga0207659_10135106 | |||
| 1477 | Ga0207659_10222390 | |||
| 1478 | Ga0207659_10257277 | |||
| 1479 | Ga0207659_10430627 | |||
| 1480 | Ga0207659_10612718 | |||
| 1481 | Ga0207687_10132076 | |||
| 1482 | Ga0207700_10066986 | |||
| 1483 | Ga0207700_10092426 | |||
| 1484 | Ga0207700_10240938 | |||
| 1485 | Ga0207700_10244906 | |||
| 1486 | Ga0207664_10321010 | |||
| 1487 | Ga0207664_10796190 | |||
| 1488 | Ga0207664_10913629 | |||
| 1489 | Ga0207644_10015592 | |||
| 1490 | Ga0207644_10017748 | |||
| 1491 | Ga0207644_10080828 | |||
| 1492 | Ga0207644_10161054 | |||
| 1493 | Ga0207644_10246227 | |||
| 1494 | Ga0207644_10282670 | |||
| 1495 | Ga0207644_10542331 | |||
| 1496 | Ga0207644_10580991 | |||
| 1497 | Ga0207690_10008181 | |||
| 1498 | Ga0207690_10183309 | |||
| 1499 | Ga0207690_10648289 | |||
| 1500 | Ga0207706_10003378 | |||
| 1501 | Ga0207706_10007545 | |||
| 1502 | Ga0207706_10051444 | |||
| 1503 | Ga0207706_10212378 | |||
| 1504 | Ga0207706_10231715 | |||
| 1505 | Ga0207706_10723978 | |||
| 1506 | Ga0207686_10013154 | |||
| 1507 | Ga0207686_10015885 | |||
| 1508 | Ga0207686_10293090 | |||
| 1509 | Ga0207709_10073851 | |||
| 1510 | Ga0207709_10458291 | |||
| 1511 | Ga0207670_10019286 | |||
| 1512 | Ga0207670_10039737 | |||
| 1513 | Ga0207670_10080069 | |||
| 1514 | Ga0207669_10007580 | |||
| 1515 | Ga0207669_10066988 | |||
| 1516 | Ga0207669_10255803 | |||
| 1517 | Ga0207669_10659299 | |||
| 1518 | Ga0207704_10011653 | |||
| 1519 | Ga0207665_10007750 | |||
| 1520 | Ga0207665_10029506 | |||
| 1521 | Ga0207665_10036891 | |||
| 1522 | Ga0207665_10073958 | |||
| 1523 | Ga0207665_10170169 | |||
| 1524 | Ga0207665_10204697 | |||
| 1525 | Ga0207665_10270734 | |||
| 1526 | Ga0207665_10430026 | |||
| 1527 | Ga0207665_10477862 | |||
| 1528 | Ga0207665_10519987 | |||
| 1529 | Ga0207665_10573797 | |||
| 1530 | Ga0207691_10000701 | |||
| 1531 | Ga0207691_10001070 | |||
| 1532 | Ga0207691_10030053 | |||
| 1533 | Ga0207691_11155590 | |||
| 1534 | Ga0207711_10192093 | |||
| 1535 | Ga0207689_10139734 | |||
| 1536 | Ga0207689_10525967 | |||
| 1537 | Ga0207661_10009439 | |||
| 1538 | Ga0207661_10310509 | |||
| 1539 | Ga0207679_10022332 | |||
| 1540 | Ga0207679_10059913 | |||
| 1541 | Ga0207679_10106199 | |||
| 1542 | Ga0207679_10374511 | |||
| 1543 | Ga0207679_10420978 | |||
| 1544 | Ga0207667_10109661 | |||
| 1545 | Ga0207667_10544901 | |||
| 1546 | Ga0207651_10029637 | |||
| 1547 | Ga0207651_10105668 | |||
| 1548 | Ga0207651_10144653 | |||
| 1549 | Ga0207651_10170621 | |||
| 1550 | Ga0207651_10235979 | |||
| 1551 | Ga0207651_10335148 | |||
| 1552 | Ga0207712_10007453 | |||
| 1553 | Ga0207712_10014529 | |||
| 1554 | Ga0207712_10549905 | |||
| 1555 | Ga0207668_10017951 | |||
| 1556 | Ga0207668_10022499 | |||
| 1557 | Ga0207668_10028647 | |||
| 1558 | Ga0207668_10042462 | |||
| 1559 | Ga0207668_10052123 | |||
| 1560 | Ga0207668_10206629 | |||
| 1561 | Ga0207640_10300847 | |||
| 1562 | Ga0207640_10886159 | |||
| 1563 | Ga0207658_10004924 | |||
| 1564 | Ga0207658_10052195 | |||
| 1565 | Ga0207658_10146665 | |||
| 1566 | Ga0207658_10281767 | |||
| 1567 | Ga0207658_10384598 | |||
| 1568 | Ga0207677_10062789 | |||
| 1569 | Ga0207677_10370325 | |||
| 1570 | Ga0207703_10327616 | |||
| 1571 | Ga0207703_10540403 | |||
| 1572 | Ga0207678_10004824 | |||
| 1573 | Ga0207678_10174162 | |||
| 1574 | Ga0207678_10277388 | |||
| 1575 | Ga0207708_10816242 | |||
| 1576 | Ga0207702_10081420 | |||
| 1577 | Ga0207702_11162545 | |||
| 1578 | Ga0207641_10008530 | |||
| 1579 | Ga0207648_10015532 | |||
| 1580 | Ga0207648_10084443 | |||
| 1581 | Ga0207676_10072439 | |||
| 1582 | Ga0207676_10443807 | |||
| 1583 | Ga0207675_100101175 | |||
| 1584 | Ga0207675_100139331 | |||
| 1585 | Ga0207675_100484530 | |||
| 1586 | Ga0207683_10020045 | |||
| 1587 | Ga0207683_10025017 | |||
| 1588 | Ga0207683_10028676 | |||
| 1589 | Ga0207683_10030603 | |||
| 1590 | Ga0207683_10069897 | |||
| 1591 | Ga0207698_10149223 | |||
| 1592 | Ga0207698_10866642 | |||
| 1593 | Ga0207698_11193818 | |||
| 1594 | Ga0209179_1013682 | |||
| 1595 | Ga0209971_1063954 | |||
| 1596 | Ga0209974_10034676 | |||
| 1597 | Ga0209974_10065148 | |||
| 1598 | Ga0268266_10078512 | |||
| 1599 | Ga0268266_10121829 | |||
| 1600 | Ga0268266_10145117 | |||
| 1601 | Ga0268266_10454840 | |||
| 1602 | Ga0268266_10583876 | |||
| 1603 | Ga0268266_11393809 | |||
| 1604 | Ga0268266_11552443 | |||
| 1605 | Ga0268265_10174506 | |||
| 1606 | Ga0268265_10523006 | |||
| 1607 | Ga0268265_10865720 | |||
| 1608 | Ga0268264_10004596 | |||
| 1609 | Ga0268264_11087801 | |||
| 1610 | Ga0268264_11151210 | |||
| 1611 | Ga0373938_0020479 | |||
| 1612 | Ga0373926_0314976 | |||
| 1613 | Ga0373944_0072364 | |||
| 1614 | Ga0373949_0056079 | |||
| 1615 | Ga0373923_0364414 | |||
| 1616 | Ga0373936_0115947 | |||
| 1617 | Ga0373945_0231219 | |||
| 1618 | Ga0373943_0019490 | |||
| 1619 | Ga0373943_0021431 | |||
| 1620 | Ga0373943_0175516 | |||
| 1621 | Ga0373943_0246014 | |||
| 1622 | Ga0373946_0027047 | |||
| 1623 | Ga0373946_0105125 | |||
| 1624 | Ga0373942_0013505 | |||
| 1625 | Ga0373931_0031944 | |||
| 1626 | Ga0373931_0501330 | |||
| 1627 | Ga0373935_0133698 | |||
| 1628 | Ga0373935_0241878 | |||
| 1629 | Ga0373927_0065252 | |||
| 1630 | Ga0373927_0124512 | |||
| 1631 | Ga0373927_0637479 | |||
| 1632 | Ga0373933_0077828 | |||
| 1633 | Ga0373947_0007130 | |||
| 1634 | Ga0373947_0076953 | |||
| 1635 | Ga0373947_0167959 | |||
| 1636 | Ga0373947_0190974 | |||
| 1637 | Ga0373947_0225339 | |||
| 1638 | Ga0373947_0299569 | |||
| 1639 | Ga0373937_0287910 | |||
| 1640 | Ga0373937_0414485 | |||
| 1641 | Ga0373937_0589619 | |||
| 1642 | Ga0373925_0024806 | |||
| 1643 | Ga0373925_0059108 | |||
| 1644 | Ga0373925_0120341 | |||
| 1645 | Ga0373925_0143788 | |||
| 1646 | Ga0373925_0260186 | |||
| 1647 | Ga0373925_0361466 | |||
| 1648 | Ga0395900_0035484 | |||
| 1649 | Ga0395900_0158848 | |||
| 1650 | Ga0395900_0225339 | |||
| 1651 | Ga0395900_0288535 | |||
| 1652 | Ga0395900_0906285 | |||
| 1653 | Ga0395900_1525012 | |||
| 1654 | Ga0395898_0015422 | |||
| 1655 | Ga0395898_0059347 | |||
| 1656 | Ga0395898_0601008 | |||
| 1657 | Ga0395898_1301856 | |||
| 1658 | Ga0395905_0586725 | |||
| 1659 | Ga0395905_1165189 | |||
| 1660 | Ga0436364_1013391 | |||
| 1661 | Ga0395901_0001294 | |||
| 1662 | Ga0395901_0125281 | |||
| 1663 | Ga0395901_0338284 | |||
| 1664 | Ga0395901_0615709 | |||
| 1665 | Ga0395901_0810671 | |||
| 1666 | Ga0436362_0544766 | |||
| 1667 | Ga0451798_0255311 | |||
| 1668 | Ga0451853_0364943 | |||
| 1669 | Ga0451853_3265935 | |||
| 1670 | Ga0439455_0014472 | |||
| 1671 | Ga0439458_0011354 | |||
| 1672 | Ga0439458_0060117 | |||
| 1673 | Ga0439460_0051433 | |||
| 1674 | Ga0439440_0016520 | |||
| 1675 | Ga0439440_0129557 | |||
| 1676 | Ga0466964_0010200 | |||
| 1677 | Ga0451576_0437515 | |||
| 1678 | Ga0466967_0810295 | |||
| 1679 | Ga0495592_0003666 | |||
| 1680 | Ga0495592_0071957 | |||
| 1681 | Ga0495603_0136944 | |||
| 1682 | Ga0495629_0069394 | |||
| 1683 | Ga0495629_0292997 | |||
| 1684 | Ga0495651_0002481 | |||
| 1685 | Ga0495651_0165100 | |||
| 1686 | Ga0495653_0188674 | |||
| 1687 | Ga0495580_0085689 | |||
| 1688 | Ga0495605_0077750 | |||
| 1689 | Ga0495639_0051774 | |||
| 1690 | Ga0495662_0109566 | |||
| 1691 | Ga0495664_0023225 | |||
| 1692 | Ga0495584_0167766 | |||
| 1693 | Ga0495584_0232173 | |||
| 1694 | Ga0495618_0152914 | |||
| 1695 | Ga0495620_0157899 | |||
| 1696 | Ga0495630_0379348 | |||
| 1697 | Ga0495632_0330158 | |||
| 1698 | Ga0495637_0136817 | |||
| 1699 | Ga0495644_0105876 | |||
| 1700 | Ga0495663_0017731 | |||
| 1701 | Ga0495663_0141507 | |||
| 1702 | Ga0495666_0054427 | |||
| 1703 | Ga0495642_0032571 | |||
| 1704 | Ga0495652_0062611 | |||
| 1705 | Ga0495652_0185848 | |||
| 1706 | Ga0495654_0126738 | |||
| 1707 | Ga0495665_0158596 | |||
| 1708 | Ga0495640_0079005 | |||
| 1709 | Ga0495586_0041598 | |||
| 1710 | Ga0495587_0031563 | |||
| 1711 | Ga0495598_0002133 | |||
| 1712 | Ga0495609_0249334 | |||
| 1713 | Ga0495621_0098493 | |||
| 1714 | Ga0495622_0163821 | |||
| 1715 | Ga0495633_0108727 | |||
| 1716 | Ga0495656_0236029 | |||
| 1717 | Ga0495634_0099295 | |||
| 1718 | Ga0495635_0343956 | |||
| 1719 | Ga0495635_0372444 | |||
| 1720 | Ga0495659_0007430 | |||
| 1721 | Ga0495588_0246193 | |||
| 1722 | Ga0495657_0622887 | |||
| 1723 | Ga0495599_0002602 | |||
| 1724 | Ga0495623_0008117 | |||
| 1725 | Ga0495646_0156660 | |||
| 1726 | Ga0495658_0093823 | |||
| 1727 | Ga0495669_0012538 | |||
| 1728 | Ga0495669_0022893 | |||
| 1729 | Ga0495669_0082058 | |||
| 1730 | Ga0495613_0086089 | |||
| 1731 | Ga0495649_0307248 | |||
| 1732 | Ga0495600_0217469 | |||
| 1733 | Ga0495581_0143850 | |||
| 1734 | Ga0495674_0036636 | |||
| 1735 | Ga0495676_0101757 | |||
| 1736 | Ga0495675_0072265 | |||
| 1737 | Ga0495684_0024374 | |||
| 1738 | Ga0495602_0085166 | |||
| 1739 | Ga0495614_0007991 | |||
| 1740 | Ga0496100_0014612 | |||
| 1741 | Ga0496100_0311080 | |||
| 1742 | Ga0496101_0020470 | |||
| 1743 | Ga0496101_0073871 | |||
| 1744 | Ga0496101_0285318 | |||
| 1745 | Ga0496101_0321082 | |||
| 1746 | Ga0496101_0701515 | |||
| 1747 | Ga0496102_0057850 | |||
| 1748 | Ga0496102_0078808 | |||
| 1749 | Ga0496102_0153527 | |||
| 1750 | Ga0496102_0279302 | |||
| 1751 | Ga0496102_0434581 | |||
| 1752 | Ga0496103_0016279 | |||
| 1753 | Ga0496103_0046493 | |||
| 1754 | Ga0496103_0312960 | |||
| 1755 | Ga0496104_0040248 | |||
| 1756 | Ga0496104_0051870 | |||
| 1757 | Ga0496104_0063642 | |||
| 1758 | Ga0496104_0094169 | |||
| 1759 | Ga0496104_0171742 | |||
| 1760 | Ga0496104_0525184 | |||
| 1761 | Ga0496105_0038887 | |||
| 1762 | Ga0496105_0322645 | |||
| 1763 | Ga0496105_0336194 | |||
| 1764 | Ga0496105_0438172 | |||
| 1765 | Ga0496106_0025001 | |||
| 1766 | Ga0496106_0077084 | |||
| 1767 | Ga0496106_0248457 | |||
| 1768 | Ga0496106_0342812 | |||
| 1769 | Ga0496107_0026842 | |||
| 1770 | Ga0496107_0067383 | |||
| 1771 | Ga0496107_0119523 | |||
| 1772 | Ga0496107_0409308 | |||
| 1773 | Ga0496108_0052612 | |||
| 1774 | Ga0496108_0063381 | |||
| 1775 | Ga0496108_0130017 | |||
| 1776 | Ga0496108_0432648 | |||
| 1777 | Ga0496108_0760276 | |||
| 1778 | Ga0496108_0931755 | |||
| 1779 | Ga0496109_0027830 | |||
| 1780 | Ga0496109_0042205 | |||
| 1781 | Ga0496109_0093658 | |||
| 1782 | Ga0496109_0164122 | |||
| 1783 | Ga0496109_0222184 | |||
| 1784 | Ga0496109_0446505 | |||
| 1785 | Ga0496109_0491271 | |||
| 1786 | Ga0496110_0065445 | |||
| 1787 | Ga0496110_0393781 | |||
| 1788 | Ga0496110_0555896 | |||
| 1789 | Ga0496110_0911827 | |||
| 1790 | Ga0496111_0086614 | |||
| 1791 | Ga0496112_0001874 | |||
| 1792 | Ga0496112_0040797 | |||
| 1793 | Ga0496112_0094453 | |||
| 1794 | Ga0496112_0163709 | |||
| 1795 | Ga0496112_0236983 | |||
| 1796 | Ga0496112_0483833 | |||
| 1797 | Ga0496112_0950785 | |||
| 1798 | Ga0496113_0055035 | |||
| 1799 | Ga0496113_0085381 | |||
| 1800 | Ga0496113_0300205 | |||
| 1801 | Ga0496113_0554671 | |||
| 1802 | Ga0496114_0005274 | |||
| 1803 | Ga0496114_0107274 | |||
| 1804 | Ga0496114_0278962 | |||
| 1805 | Ga0496115_0004373 | |||
| 1806 | Ga0496115_0004459 | |||
| 1807 | Ga0496115_0007639 | |||
| 1808 | Ga0496115_0017107 | |||
| 1809 | Ga0496115_0103021 | |||
| 1810 | nmdc:mga05p37_190551_c1 | |||
| 1811 | nmdc:mga05p37_27192_c1 | |||
| 1812 | nmdc:mga05p37_679881_c1 | |||
| 1813 | nmdc:mga08y16_26106_c3 | |||
| 1814 | nmdc:mga08y16_312471_c1 | |||
| 1815 | nmdc:mga08y16_330091_c1 | |||
| 1816 | nmdc:mga0n895_169751_c1 | |||
| 1817 | nmdc:mga0n895_198730_c1 | |||
| 1818 | nmdc:mga0n895_223870_c1 | |||
| 1819 | nmdc:mga0n895_504204_c1 | |||
| 1820 | nmdc:mga0rr50_884094_c1 | |||
| 1821 | nmdc:mga08x19_335824_c1 | |||
| 1822 | nmdc:mga08x19_341484_c1 | |||
| 1823 | nmdc:mga08x19_50281_c1 | |||
| 1824 | nmdc:mga0a205_234102_c1 | |||
| 1825 | Ga0495601_0036340 | |||
| 1826 | Ga0495655_0056658 | |||
| 1827 | Ga0495595_0146473 | |||
| 1828 | Ga0495619_0386021 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4rfs-assembly1.cif.gz_S | structure of a pantothenate energy coupling factor transporter | 0.7037 | 4 | 169 |
| 4rfs-assembly1.cif.gz_S | structure of a pantothenate energy coupling factor transporter | 0.6553 | 4 | 169 |
| 3p5n-assembly1.cif.gz_B | structure and mechanism of the s component of a bacterial ecf transporter | 0.5858 | 2 | 169 |
| 6zg3-assembly2.cif.gz_C | the structure of ecf pant transporter in a complex with a nanobody | 0.566 | 2 | 166 |
| 5kc4-assembly1.cif.gz_A | structure of tmribu, orthorhombic crystal form | 0.56 | 6 | 164 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4rfsS00 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.7037 | 4 | 169 | 1.10.1760.20 |
| af_P0AA93_45_200_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6943 | 3 | 169 | 1.10.1760.20 |
| af_P0ABH4_4_155_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6818 | 8 | 163 | 1.10.1760.20 |
| af_Q2FZ00_2_162_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6683 | 1 | 170 | 1.10.1760.20 |
| af_P0AA93_45_200_1.10.1760.20 | Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; | 0.6652 | 3 | 169 | 1.10.1760.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V9V419-F1-model_v4 | Rod shape-determining protein MreD | 0.9587 | 1 | 179 |
GO:0016020
|
| AF-A0A7V9V419-F1-model_v4 | Rod shape-determining protein MreD | 0.9535 | 1 | 179 |
GO:0016020
|
| AF-A0A2W5ZLD3-F1-model_v4 | Rod shape-determining protein MreD | 0.9516 | 1 | 180 |
GO:0016020
|
| AF-A0A2W5ZLD3-F1-model_v4 | Rod shape-determining protein MreD | 0.9464 | 1 | 180 |
GO:0016020
|
| AF-A0A2V6FSM6-F1-model_v4 | Rod shape-determining protein MreD | 0.9408 | 1 | 129 |
GO:0016020
|