F485580

General Info

Members Datasets Scaffolds Average Seq Length
914 300 1828 177

Family's Representative Sequence

Representative Sequence 3300046516|Ga0495628_0218663|Ga0495628_0218663_661_1305
Length 197
Sequence LDFGLPHSFAFKRGLVFVAGHSSFLIIPMIFIPPLDWMFNAHVYIVPVIVFYGAMALPFPLMLALAFFAGFLWDALTVQVLDVAHVEISFGWSILLYAVLAAIMHGLKPLFNRGRWEVHCILSGICTSVILLTQYLMISFRRGSIIFDREVWWQIGGPGLLAMLMAPLVFWSLHWLSRLTNNPYQPQEEPFPDYASR

Samples

Sample ID Description Type Environment
1 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
193 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
212 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
217 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
220 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
229 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
230 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
231 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
232 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
233 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
234 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
258 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
259 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
260 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
261 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
262 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
263 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
264 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
265 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
266 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
267 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
268 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
269 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
270 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
271 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
272 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
273 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
274 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
275 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
276 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
277 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
278 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
279 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
280 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
281 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
282 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
283 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
284 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
285 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
286 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
287 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
288 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
289 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
290 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
293 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
294 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
295 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
296 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
297 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
298 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
299 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
300 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 7.77
Rhizosphere 91.79
Stem 0
Stem Tuber 0
Unclassified 35.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495628_0218663 3300046516 Bacteria 1431
2 CNXas_1000015 3300000545 Bacteria 35772
3 JGI24035J26624_1002185 3300002126 Bacteria 1822
4 JGI25406J46586_10028297 3300003203 Bacteria 2137
5 JGI25406J46586_10033383 3300003203 Unclassified 1900
6 JGI25405J52794_10000124 3300003911 Bacteria 9159
7 Ga0065717_1001519 3300005276 Bacteria 827
8 Ga0065714_10090773 3300005288 Bacteria 1933
9 Ga0065714_10228608 3300005288 Bacteria 821
10 Ga0065704_10082945 3300005289 Bacteria 3529
11 Ga0065704_10083157 3300005289 Bacteria 3502
12 Ga0065704_10148674 3300005289 Bacteria 1442
13 Ga0065704_10238857 3300005289 Unclassified 1021
14 Ga0065712_10002542 3300005290 Bacteria 6920
15 Ga0065712_10008036 3300005290 Bacteria 2716
16 Ga0065712_10008417 3300005290 Bacteria 5432
17 Ga0065712_10084262 3300005290 Unclassified 2769
18 Ga0065712_10125226 3300005290 Unclassified 1616
19 Ga0065712_10138258 3300005290 Bacteria 1475
20 Ga0065712_10240150 3300005290 Bacteria 959
21 Ga0065715_10002238 3300005293 Bacteria 10693
22 Ga0065715_10007980 3300005293 Bacteria 5404
23 Ga0065715_10013048 3300005293 Bacteria 1927
24 Ga0065715_10089584 3300005293 Bacteria 9364
25 Ga0065715_10103092 3300005293 Unclassified 3060
26 Ga0065715_10106469 3300005293 Bacteria 2828
27 Ga0065715_10120331 3300005293 Bacteria 2261
28 Ga0065715_10303022 3300005293 Bacteria 980
29 Ga0065707_10003529 3300005295 Bacteria 4250
30 Ga0065707_10014870 3300005295 Bacteria 1630
31 Ga0070676_10002299 3300005328 Bacteria 9771
32 Ga0070676_10039949 3300005328 Unclassified 2715
33 Ga0070676_10067171 3300005328 Bacteria 2143
34 Ga0070676_10168250 3300005328 Unclassified 1416
35 Ga0070683_100007716 3300005329 Bacteria 9109
36 Ga0070683_100031446 3300005329 Bacteria 4826
37 Ga0070683_100067473 3300005329 Bacteria 3332
38 Ga0070683_100130551 3300005329 Bacteria 2378
39 Ga0070683_100161638 3300005329 Unclassified 2125
40 Ga0070690_100077316 3300005330 Unclassified 2172
41 Ga0070690_100085791 3300005330 Bacteria 2066
42 Ga0070690_100101108 3300005330 Bacteria 1912
43 Ga0070690_100107914 3300005330 Unclassified 1854
44 Ga0070690_100232936 3300005330 Unclassified 1296
45 Ga0070670_100014391 3300005331 Bacteria 6788
46 Ga0070670_100037989 3300005331 Bacteria 4140
47 Ga0070670_100069191 3300005331 Bacteria 3030
48 Ga0070670_100113364 3300005331 Unclassified 2337
49 Ga0070670_100117022 3300005331 Bacteria 2298
50 Ga0070670_100552400 3300005331 Bacteria 1027
51 Ga0070670_100681117 3300005331 Unclassified 924
52 Ga0070670_101124735 3300005331 Unclassified 717
53 Ga0070677_10069138 3300005333 Bacteria 1480
54 Ga0070677_10217156 3300005333 Bacteria 932
55 Ga0068869_100120624 3300005334 Unclassified 2005
56 Ga0068869_100122116 3300005334 Unclassified 1993
57 Ga0070666_10015825 3300005335 Bacteria 4818
58 Ga0070666_10026780 3300005335 Unclassified 3771
59 Ga0070666_10086327 3300005335 Bacteria 2150
60 Ga0070666_10200626 3300005335 Bacteria 1403
61 Ga0070666_10896415 3300005335 Unclassified 655
62 Ga0070680_100155543 3300005336 Bacteria 1920
63 Ga0070680_100589926 3300005336 Unclassified 954
64 Ga0070682_100053816 3300005337 Bacteria 2523
65 Ga0068868_100012887 3300005338 Bacteria 6117
66 Ga0068868_100048425 3300005338 Bacteria 3333
67 Ga0068868_100053005 3300005338 Bacteria 3195
68 Ga0068868_100126576 3300005338 Bacteria 2088
69 Ga0070660_100062452 3300005339 Unclassified 2894
70 Ga0070660_100351029 3300005339 Unclassified 1215
71 Ga0070660_100384965 3300005339 Bacteria 1158
72 Ga0070660_100749358 3300005339 Bacteria 820
73 Ga0070689_100001267 3300005340 Bacteria 16057
74 Ga0070689_100009006 3300005340 Bacteria 7068
75 Ga0070689_100075953 3300005340 Bacteria 2631
76 Ga0070689_100218494 3300005340 Bacteria 1562
77 Ga0070687_100694925 3300005343 Unclassified 710
78 Ga0070687_100807312 3300005343 Unclassified 665
79 Ga0070661_100096470 3300005344 Bacteria 2194
80 Ga0070692_10192214 3300005345 Bacteria 1190
81 Ga0070668_100001566 3300005347 Bacteria 16516
82 Ga0070668_100022038 3300005347 Bacteria 4815
83 Ga0070668_100047915 3300005347 Bacteria 3286
84 Ga0070668_100093795 3300005347 Bacteria 2369
85 Ga0070668_100171859 3300005347 Bacteria 1765
86 Ga0070669_100005146 3300005353 Bacteria 9456
87 Ga0070669_100014651 3300005353 Bacteria 5581
88 Ga0070669_100035637 3300005353 Unclassified 3605
89 Ga0070669_100070580 3300005353 Bacteria 2583
90 Ga0070669_100473234 3300005353 Unclassified 1035
91 Ga0070669_100493727 3300005353 Unclassified 1015
92 Ga0070675_100000800 3300005354 Bacteria 22104
93 Ga0070675_100001110 3300005354 Bacteria 19396
94 Ga0070675_100032879 3300005354 Bacteria 4200
95 Ga0070675_100042730 3300005354 Unclassified 3704
96 Ga0070675_100084777 3300005354 Unclassified 2646
97 Ga0070675_100126077 3300005354 Bacteria 2178
98 Ga0070675_100183334 3300005354 Bacteria 1811
99 Ga0070675_100444653 3300005354 Unclassified 1162
100 Ga0070675_100515654 3300005354 Bacteria 1078
101 Ga0070675_101159773 3300005354 Bacteria 711
102 Ga0070671_100006985 3300005355 Bacteria 9043
103 Ga0070671_100009200 3300005355 Bacteria 7933
104 Ga0070671_100010632 3300005355 Bacteria 7386
105 Ga0070671_100117596 3300005355 Bacteria 2235
106 Ga0070671_100213265 3300005355 Bacteria 1638
107 Ga0070671_100251248 3300005355 Bacteria 1502
108 Ga0070671_100455729 3300005355 Unclassified 1097
109 Ga0070671_100459439 3300005355 Bacteria 1093
110 Ga0070671_100520260 3300005355 Bacteria 1024
111 Ga0070671_100727451 3300005355 Bacteria 862
112 Ga0070674_100004295 3300005356 Bacteria 8108
113 Ga0070674_100017349 3300005356 Bacteria 4526
114 Ga0070674_100061487 3300005356 Bacteria 2621
115 Ga0070674_100136976 3300005356 Bacteria 1833
116 Ga0070673_100008309 3300005364 Bacteria 6895
117 Ga0070673_100012043 3300005364 Bacteria 5925
118 Ga0070673_100012359 3300005364 Bacteria 5860
119 Ga0070673_100069064 3300005364 Bacteria 2831
120 Ga0070673_100359117 3300005364 Unclassified 1295
121 Ga0070688_100024252 3300005365 Bacteria 3576
122 Ga0070688_100088841 3300005365 Unclassified 2015
123 Ga0070688_100166542 3300005365 Unclassified 1518
124 Ga0070659_100035409 3300005366 Unclassified 3887
125 Ga0070659_100281801 3300005366 Unclassified 1383
126 Ga0070659_100319339 3300005366 Unclassified 1298
127 Ga0070659_100928889 3300005366 Bacteria 761
128 Ga0070667_100018525 3300005367 Bacteria 5775
129 Ga0070667_100051358 3300005367 Bacteria 3476
130 Ga0070667_100056208 3300005367 Bacteria 3324
131 Ga0070667_100215810 3300005367 Unclassified 1706
132 Ga0070667_100241944 3300005367 Unclassified 1611
133 Ga0070667_100520265 3300005367 Bacteria 1092
134 Ga0070667_100768811 3300005367 Unclassified 893
135 Ga0070709_10061646 3300005434 Unclassified 2388
136 Ga0070709_10101160 3300005434 Bacteria 1920
137 Ga0070709_10157553 3300005434 Unclassified 1576
138 Ga0070709_10389873 3300005434 Bacteria 1038
139 Ga0070714_100066234 3300005435 Bacteria 3113
140 Ga0070713_100065319 3300005436 Bacteria 3056
141 Ga0070713_100210626 3300005436 Bacteria 1759
142 Ga0070713_100311592 3300005436 Bacteria 1451
143 Ga0070710_10045206 3300005437 Bacteria 2447
144 Ga0070710_10158900 3300005437 Bacteria 1400
145 Ga0070710_10225392 3300005437 Bacteria 1194
146 Ga0070710_10436124 3300005437 Bacteria 885
147 Ga0070711_100003037 3300005439 Bacteria 9706
148 Ga0070711_100020337 3300005439 Bacteria 4276
149 Ga0070711_100041603 3300005439 Bacteria 3105
150 Ga0070711_100111760 3300005439 Bacteria 2006
151 Ga0070711_100115136 3300005439 Bacteria 1979
152 Ga0070705_100017828 3300005440 Bacteria 3711
153 Ga0070705_100021045 3300005440 Bacteria 3463
154 Ga0070705_100039662 3300005440 Bacteria 2673
155 Ga0070705_100378764 3300005440 Bacteria 1041
156 Ga0070700_100084729 3300005441 Unclassified 2055
157 Ga0070694_100086048 3300005444 Bacteria 2196
158 Ga0070694_100245858 3300005444 Unclassified 1351
159 Ga0070708_100014955 3300005445 Bacteria 6398
160 Ga0070708_100027669 3300005445 Bacteria 4867
161 Ga0070708_100045127 3300005445 Unclassified 3881
162 Ga0070708_100074413 3300005445 Unclassified 3063
163 Ga0070708_100141047 3300005445 Bacteria 2235
164 Ga0070708_100298506 3300005445 Unclassified 1517
165 Ga0070708_100339865 3300005445 Unclassified 1415
166 Ga0070708_100424659 3300005445 Bacteria 1254
167 Ga0070708_100922290 3300005445 Unclassified 820
168 Ga0070663_100020545 3300005455 Bacteria 4373
169 Ga0070663_100516075 3300005455 Bacteria 994
170 Ga0070663_101117233 3300005455 Unclassified 690
171 Ga0070678_100053145 3300005456 Bacteria 2944
172 Ga0070678_100142165 3300005456 Bacteria 1922
173 Ga0070662_100011457 3300005457 Bacteria 5851
174 Ga0070662_100144755 3300005457 Bacteria 1845
175 Ga0070662_100178898 3300005457 Unclassified 1671
176 Ga0070662_100827424 3300005457 Unclassified 788
177 Ga0070681_10052380 3300005458 Bacteria 4070
178 Ga0068867_100014657 3300005459 Bacteria 5556
179 Ga0070685_10050959 3300005466 Bacteria 2393
180 Ga0070685_10530275 3300005466 Unclassified 837
181 Ga0070706_100000011 3300005467 Bacteria 198585
182 Ga0070706_100012402 3300005467 Bacteria 7897
183 Ga0070706_100015234 3300005467 Bacteria 7097
184 Ga0070706_100021085 3300005467 Bacteria 5999
185 Ga0070706_100040495 3300005467 Bacteria 4301
186 Ga0070706_100068869 3300005467 Bacteria 3273
187 Ga0070706_100430206 3300005467 Bacteria 1228
188 Ga0070706_100665738 3300005467 Unclassified 966
189 Ga0070706_101044686 3300005467 Unclassified 753
190 Ga0070707_100003264 3300005468 Bacteria 15375
191 Ga0070707_100023994 3300005468 Bacteria 5771
192 Ga0070707_100024310 3300005468 Bacteria 5737
193 Ga0070707_100041589 3300005468 Bacteria 4399
194 Ga0070707_100052756 3300005468 Unclassified 3899
195 Ga0070707_100126399 3300005468 Bacteria 2484
196 Ga0070707_100244903 3300005468 Bacteria 1745
197 Ga0070707_100598422 3300005468 Unclassified 1065
198 Ga0070707_100672675 3300005468 Unclassified 998
199 Ga0070698_100000288 3300005471 Bacteria 51295
200 Ga0070698_100012794 3300005471 Bacteria 8887
201 Ga0070698_100029828 3300005471 Bacteria 5660
202 Ga0070698_100255024 3300005471 Unclassified 1686
203 Ga0070698_100294938 3300005471 Bacteria 1552
204 Ga0070698_101173497 3300005471 Bacteria 717
205 Ga0070699_100134495 3300005518 Bacteria 2181
206 Ga0070699_100206100 3300005518 Bacteria 1749
207 Ga0070699_100333238 3300005518 Bacteria 1365
208 Ga0070699_100595076 3300005518 Unclassified 1008
209 Ga0070699_100665034 3300005518 Bacteria 951
210 Ga0070699_101054423 3300005518 Unclassified 746
211 Ga0070684_100000254 3300005535 Bacteria 36890
212 Ga0070684_100260485 3300005535 Unclassified 1586
213 Ga0070684_100383706 3300005535 Unclassified 1294
214 Ga0070684_100470170 3300005535 Unclassified 1163
215 Ga0070684_100830345 3300005535 Unclassified 865
216 Ga0070684_100966149 3300005535 Unclassified 799
217 Ga0070697_100001132 3300005536 Bacteria 20163
218 Ga0070697_100017935 3300005536 Bacteria 5576
219 Ga0070697_100020084 3300005536 Bacteria 5280
220 Ga0070697_100024745 3300005536 Unclassified 4782
221 Ga0070697_100034437 3300005536 Bacteria 4083
222 Ga0070697_100038577 3300005536 Bacteria 3860
223 Ga0070697_100039499 3300005536 Unclassified 3815
224 Ga0070697_100039941 3300005536 Bacteria 3795
225 Ga0070697_100042413 3300005536 Bacteria 3682
226 Ga0070697_100087093 3300005536 Bacteria 2578
227 Ga0070697_100162632 3300005536 Bacteria 1886
228 Ga0070697_100518172 3300005536 Unclassified 1044
229 Ga0070697_100533086 3300005536 Bacteria 1029
230 Ga0070697_100637862 3300005536 Unclassified 938
231 Ga0070672_100008850 3300005543 Bacteria 6914
232 Ga0070672_100060915 3300005543 Bacteria 2973
233 Ga0070672_100071036 3300005543 Bacteria 2768
234 Ga0070672_100085054 3300005543 Bacteria 2541
235 Ga0070686_100008987 3300005544 Bacteria 5599
236 Ga0070686_100633978 3300005544 Unclassified 846
237 Ga0070695_100073372 3300005545 Bacteria 2246
238 Ga0070695_100798851 3300005545 Unclassified 756
239 Ga0070696_100033547 3300005546 Bacteria 3527
240 Ga0070696_100285926 3300005546 Bacteria 1258
241 Ga0070665_100146836 3300005548 Bacteria 2361
242 Ga0070665_100147354 3300005548 Bacteria 2356
243 Ga0070665_100160449 3300005548 Bacteria 2250
244 Ga0070665_100184912 3300005548 Bacteria 2084
245 Ga0070665_100190733 3300005548 Bacteria 2050
246 Ga0070665_100307052 3300005548 Bacteria 1590
247 Ga0070665_100787728 3300005548 Unclassified 964
248 Ga0070665_101125515 3300005548 Unclassified 796
249 Ga0070704_100007524 3300005549 Bacteria 6484
250 Ga0070704_100453595 3300005549 Bacteria 1104
251 Ga0068855_100460849 3300005563 Unclassified 1386
252 Ga0068855_100461974 3300005563 Bacteria 1384
253 Ga0068855_101232633 3300005563 Unclassified 777
254 Ga0070664_100025116 3300005564 Bacteria 4936
255 Ga0070664_100030703 3300005564 Bacteria 4484
256 Ga0070664_100127830 3300005564 Unclassified 2231
257 Ga0070664_100138533 3300005564 Bacteria 2141
258 Ga0070664_100252035 3300005564 Bacteria 1587
259 Ga0070664_100353061 3300005564 Bacteria 1338
260 Ga0070664_100745758 3300005564 Bacteria 914
261 Ga0068854_100313522 3300005578 Bacteria 1273
262 Ga0068856_100024841 3300005614 Bacteria 5837
263 Ga0070702_100192728 3300005615 Bacteria 1342
264 Ga0070702_100455904 3300005615 Unclassified 929
265 Ga0068852_100637867 3300005616 Unclassified 1072
266 Ga0068852_100641552 3300005616 Unclassified 1069
267 Ga0068859_100124988 3300005617 Bacteria 2641
268 Ga0068864_100263763 3300005618 Bacteria 1603
269 Ga0068864_100446769 3300005618 Bacteria 1236
270 Ga0068866_10017827 3300005718 Bacteria 3200
271 Ga0068861_100234604 3300005719 Bacteria 1557
272 Ga0068863_100085861 3300005841 Bacteria 2982
273 Ga0068863_100166687 3300005841 Unclassified 2112
274 Ga0068863_100172349 3300005841 Bacteria 2076
275 Ga0068863_100789166 3300005841 Unclassified 947
276 Ga0068858_100010162 3300005842 Bacteria 8933
277 Ga0068858_100212940 3300005842 Bacteria 1829
278 Ga0068858_100354330 3300005842 Unclassified 1406
279 Ga0068860_100007266 3300005843 Bacteria 11078
280 Ga0068860_101124737 3300005843 Bacteria 805
281 Ga0068860_101314894 3300005843 Unclassified 744
282 Ga0068862_100083952 3300005844 Bacteria 2766
283 Ga0068862_100316582 3300005844 Unclassified 1439
284 Ga0068862_101023174 3300005844 Unclassified 818
285 Ga0081455_10000486 3300005937 Bacteria 51545
286 Ga0081455_10003585 3300005937 Bacteria 17813
287 Ga0081455_10114154 3300005937 Unclassified 2141
288 Ga0081455_10114852 3300005937 Bacteria 2132
289 Ga0081455_10149311 3300005937 Unclassified 1804
290 Ga0081540_1000532 3300005983 Bacteria 37070
291 Ga0081540_1007016 3300005983 Bacteria 8105
292 Ga0081540_1020553 3300005983 Bacteria 3965
293 Ga0081539_10003960 3300005985 Bacteria 17145
294 Ga0081539_10005046 3300005985 Bacteria 13877
295 Ga0081539_10016932 3300005985 Bacteria 5164
296 Ga0081539_10040760 3300005985 Unclassified 2723
297 Ga0070717_10005159 3300006028 Bacteria 9525
298 Ga0070717_10005613 3300006028 Bacteria 9165
299 Ga0070717_10016084 3300006028 Bacteria 5793
300 Ga0070717_10067690 3300006028 Bacteria 2971
301 Ga0070717_10072623 3300006028 Bacteria 2873
302 Ga0070717_10461502 3300006028 Unclassified 1145
303 Ga0070717_10579642 3300006028 Bacteria 1017
304 Ga0070717_10682660 3300006028 Unclassified 933
305 Ga0070717_11226327 3300006028 Unclassified 682
306 Ga0070715_10012884 3300006163 Bacteria 3057
307 Ga0070715_10016504 3300006163 Bacteria 2775
308 Ga0070715_10291114 3300006163 Unclassified 870
309 Ga0070716_100034718 3300006173 Bacteria 2767
310 Ga0070716_100050005 3300006173 Bacteria 2371
311 Ga0070716_100052507 3300006173 Bacteria 2321
312 Ga0070716_100062450 3300006173 Bacteria 2160
313 Ga0070716_100257965 3300006173 Bacteria 1191
314 Ga0070716_100448324 3300006173 Bacteria 940
315 Ga0070712_100005405 3300006175 Bacteria 7907
316 Ga0070712_100006223 3300006175 Bacteria 7388
317 Ga0070712_100142042 3300006175 Unclassified 1833
318 Ga0070712_100160451 3300006175 Bacteria 1736
319 Ga0070712_100213429 3300006175 Unclassified 1523
320 Ga0070712_100368745 3300006175 Bacteria 1179
321 Ga0070712_100670156 3300006175 Bacteria 882
322 Ga0070712_100822959 3300006175 Unclassified 798
323 Ga0070712_100990787 3300006175 Unclassified 727
324 Ga0070712_100995804 3300006175 Unclassified 725
325 Ga0075366_10572089 3300006195 Unclassified 700
326 Ga0097621_100005808 3300006237 Bacteria 8716
327 Ga0097621_100015849 3300006237 Bacteria 5683
328 Ga0097621_100074971 3300006237 Bacteria 2803
329 Ga0097621_100129350 3300006237 Bacteria 2148
330 Ga0097621_100286979 3300006237 Unclassified 1450
331 Ga0068871_100004431 3300006358 Bacteria 9766
332 Ga0068871_100026904 3300006358 Bacteria 4493
333 Ga0068871_100199469 3300006358 Bacteria 1727
334 Ga0068871_100200713 3300006358 Unclassified 1722
335 Ga0075428_100262136 3300006844 Bacteria 1861
336 Ga0075428_100836432 3300006844 Unclassified 978
337 Ga0075431_100515654 3300006847 Unclassified 1185
338 Ga0075433_10602200 3300006852 Unclassified 965
339 Ga0075434_100052913 3300006871 Bacteria 4035
340 Ga0075434_100492373 3300006871 Unclassified 1247
341 Ga0075434_100553872 3300006871 Unclassified 1169
342 Ga0068865_100013990 3300006881 Bacteria 5091
343 Ga0068865_100162120 3300006881 Unclassified 1707
344 Ga0075436_100023561 3300006914 Bacteria 4227
345 Ga0075436_100273132 3300006914 Unclassified 1207
346 Ga0097620_100124987 3300006931 Bacteria 2641
347 Ga0075435_100440009 3300007076 Unclassified 1124
348 Ga0099795_10043076 3300007788 Bacteria 1614
349 Ga0105240_10684839 3300009093 Bacteria 1120
350 Ga0105240_11272952 3300009093 Unclassified 776
351 Ga0111539_10106439 3300009094 Bacteria 3290
352 Ga0111539_10114935 3300009094 Bacteria 3156
353 Ga0111539_10495389 3300009094 Unclassified 1423
354 Ga0105245_10074086 3300009098 Bacteria 3097
355 Ga0105245_10077081 3300009098 Unclassified 3038
356 Ga0105245_10188026 3300009098 Unclassified 1977
357 Ga0105245_10328943 3300009098 Bacteria 1508
358 Ga0105245_10571395 3300009098 Unclassified 1154
359 Ga0105245_11005435 3300009098 Bacteria 878
360 Ga0105247_10043319 3300009101 Bacteria 2757
361 Ga0105247_10130781 3300009101 Bacteria 1636
362 Ga0114129_10416208 3300009147 Bacteria 1769
363 Ga0114129_10844177 3300009147 Bacteria 1165
364 Ga0105243_10129668 3300009148 Unclassified 2138
365 Ga0105243_10132216 3300009148 Unclassified 2118
366 Ga0105243_11262403 3300009148 Bacteria 754
367 Ga0105241_10224294 3300009174 Unclassified 1581
368 Ga0105241_10739050 3300009174 Unclassified 901
369 Ga0105242_10029989 3300009176 Bacteria 4341
370 Ga0105242_10175215 3300009176 Bacteria 1888
371 Ga0105242_10325009 3300009176 Bacteria 1412
372 Ga0105237_10167421 3300009545 Bacteria 2197
373 Ga0105249_10006222 3300009553 Bacteria 10364
374 Ga0105249_10045544 3300009553 Bacteria 3990
375 Ga0105249_10727539 3300009553 Bacteria 1054
376 Ga0099796_10059088 3300010159 Unclassified 1353
377 Ga0105239_10018051 3300010375 Bacteria 7804
378 Ga0105239_10226533 3300010375 Bacteria 2097
379 Ga0105239_10669524 3300010375 Unclassified 1186
380 Ga0105246_10034754 3300011119 Bacteria 3362
381 Ga0105246_10163593 3300011119 Bacteria 1697
382 Ga0105246_10846491 3300011119 Unclassified 815
383 Ga0157373_10601331 3300013100 Unclassified 801
384 Ga0157369_10179278 3300013105 Bacteria 2229
385 Ga0157374_10004504 3300013296 Bacteria 11708
386 Ga0157374_10030925 3300013296 Unclassified 4863
387 Ga0157374_10062854 3300013296 Bacteria 3481
388 Ga0157374_10124171 3300013296 Bacteria 2494
389 Ga0157374_10154984 3300013296 Bacteria 2229
390 Ga0157374_10179307 3300013296 Bacteria 2069
391 Ga0157374_10186378 3300013296 Unclassified 2029
392 Ga0157374_10214222 3300013296 Unclassified 1889
393 Ga0157374_10248798 3300013296 Bacteria 1749
394 Ga0157374_10511776 3300013296 Bacteria 1206
395 Ga0157374_10537347 3300013296 Unclassified 1176
396 Ga0157374_10735867 3300013296 Unclassified 1000
397 Ga0157378_10004663 3300013297 Bacteria 12024
398 Ga0157378_10029641 3300013297 Bacteria 4833
399 Ga0157378_10061028 3300013297 Unclassified 3364
400 Ga0157378_10061937 3300013297 Bacteria 3340
401 Ga0157378_10067784 3300013297 Bacteria 3199
402 Ga0157378_10085694 3300013297 Bacteria 2854
403 Ga0157378_10253080 3300013297 Bacteria 1687
404 Ga0157378_10349824 3300013297 Bacteria 1443
405 Ga0157378_10496685 3300013297 Unclassified 1218
406 Ga0157378_10526729 3300013297 Bacteria 1184
407 Ga0157378_10554211 3300013297 Bacteria 1155
408 Ga0157378_10916296 3300013297 Unclassified 908
409 Ga0163162_10004005 3300013306 Bacteria 14138
410 Ga0163162_10011144 3300013306 Bacteria 8758
411 Ga0163162_10036699 3300013306 Bacteria 4887
412 Ga0163162_10039816 3300013306 Bacteria 4696
413 Ga0163162_10040041 3300013306 Bacteria 4685
414 Ga0163162_10300252 3300013306 Bacteria 1738
415 Ga0163162_10416610 3300013306 Unclassified 1475
416 Ga0163162_10519708 3300013306 Unclassified 1320
417 Ga0157372_10061403 3300013307 Bacteria 4208
418 Ga0157372_10068753 3300013307 Bacteria 3982
419 Ga0157372_10136701 3300013307 Bacteria 2823
420 Ga0157372_11388444 3300013307 Bacteria 810
421 Ga0157375_10003613 3300013308 Bacteria 13421
422 Ga0157375_10037043 3300013308 Bacteria 4670
423 Ga0157375_10135970 3300013308 Bacteria 2582
424 Ga0157375_10235267 3300013308 Bacteria 1991
425 Ga0157375_10332876 3300013308 Bacteria 1683
426 Ga0157375_10378858 3300013308 Unclassified 1581
427 Ga0157375_10398083 3300013308 Unclassified 1544
428 Ga0157375_10971227 3300013308 Bacteria 990
429 Ga0163163_10222506 3300014325 Bacteria 1936
430 Ga0163163_11519704 3300014325 Unclassified 731
431 Ga0182008_10438391 3300014497 Unclassified 708
432 Ga0157377_10082291 3300014745 Bacteria 1885
433 Ga0157377_10235911 3300014745 Unclassified 1178
434 Ga0157379_10030011 3300014968 Bacteria 4836
435 Ga0157376_10032856 3300014969 Unclassified 4171
436 Ga0157376_10062547 3300014969 Bacteria 3132
437 Ga0157376_10081011 3300014969 Unclassified 2786
438 Ga0157376_10088716 3300014969 Bacteria 2672
439 Ga0157376_10111049 3300014969 Bacteria 2413
440 Ga0157376_10142869 3300014969 Bacteria 2149
441 Ga0157376_10304067 3300014969 Unclassified 1511
442 Ga0157376_10468600 3300014969 Unclassified 1232
443 Ga0157376_10670955 3300014969 Unclassified 1039
444 Ga0157376_11175893 3300014969 Unclassified 795
445 Ga0157376_11691128 3300014969 Bacteria 668
446 Ga0182007_10076327 3300015262 Unclassified 1099
447 Ga0163161_10039588 3300017792 Bacteria 3384
448 Ga0163161_10159728 3300017792 Bacteria 1718
449 Ga0163161_10302651 3300017792 Bacteria 1259
450 Ga0207666_1001684 3300025271 Bacteria 2629
451 Ga0207673_1000646 3300025290 Bacteria 3719
452 Ga0207673_1002887 3300025290 Bacteria 1986
453 Ga0207673_1009636 3300025290 Unclassified 1236
454 Ga0207673_1031750 3300025290 Unclassified 733
455 Ga0207697_10000281 3300025315 Bacteria 28268
456 Ga0207697_10001510 3300025315 Bacteria 12642
457 Ga0207697_10002546 3300025315 Bacteria 9382
458 Ga0207697_10003172 3300025315 Bacteria 8184
459 Ga0207697_10009904 3300025315 Bacteria 4096
460 Ga0207697_10011141 3300025315 Bacteria 3812
461 Ga0207697_10012398 3300025315 Bacteria 3574
462 Ga0207697_10013296 3300025315 Unclassified 3435
463 Ga0207697_10038913 3300025315 Unclassified 1951
464 Ga0207697_10080359 3300025315 Unclassified 1373
465 Ga0207653_10006171 3300025885 Unclassified 3735
466 Ga0207682_10004815 3300025893 Bacteria 5594
467 Ga0207692_10127636 3300025898 Unclassified 1432
468 Ga0207642_10050773 3300025899 Bacteria 1872
469 Ga0207710_10038073 3300025900 Bacteria 2126
470 Ga0207710_10192462 3300025900 Bacteria 1005
471 Ga0207688_10001545 3300025901 Bacteria 12092
472 Ga0207688_10005469 3300025901 Bacteria 6907
473 Ga0207688_10043420 3300025901 Bacteria 2503
474 Ga0207688_10159234 3300025901 Unclassified 1337
475 Ga0207688_10189402 3300025901 Bacteria 1230
476 Ga0207680_10012292 3300025903 Bacteria 4356
477 Ga0207680_10028269 3300025903 Bacteria 3135
478 Ga0207680_10222950 3300025903 Unclassified 1293
479 Ga0207647_10009086 3300025904 Bacteria 7077
480 Ga0207647_10236704 3300025904 Bacteria 1049
481 Ga0207647_10243707 3300025904 Unclassified 1032
482 Ga0207685_10148187 3300025905 Bacteria 1059
483 Ga0207685_10200573 3300025905 Unclassified 937
484 Ga0207699_10009262 3300025906 Bacteria 4894
485 Ga0207699_10085515 3300025906 Unclassified 1967
486 Ga0207645_10001030 3300025907 Bacteria 23008
487 Ga0207645_10003151 3300025907 Bacteria 12633
488 Ga0207645_10008561 3300025907 Bacteria 7131
489 Ga0207645_10010303 3300025907 Bacteria 6420
490 Ga0207645_10043642 3300025907 Bacteria 2870
491 Ga0207645_10187341 3300025907 Unclassified 1359
492 Ga0207645_10621605 3300025907 Unclassified 734
493 Ga0207684_10000052 3300025910 Bacteria 228510
494 Ga0207684_10011740 3300025910 Bacteria 7641
495 Ga0207684_10015843 3300025910 Bacteria 6481
496 Ga0207684_10028320 3300025910 Bacteria 4773
497 Ga0207684_10028682 3300025910 Bacteria 4741
498 Ga0207684_10048819 3300025910 Bacteria 3590
499 Ga0207684_10190765 3300025910 Bacteria 1768
500 Ga0207684_10257943 3300025910 Unclassified 1504
501 Ga0207684_10395575 3300025910 Bacteria 1188
502 Ga0207684_10629919 3300025910 Bacteria 915
503 Ga0207684_10700144 3300025910 Bacteria 861
504 Ga0207684_10925131 3300025910 Unclassified 732
505 Ga0207654_10164387 3300025911 Unclassified 1436
506 Ga0207707_10024631 3300025912 Bacteria 5267
507 Ga0207671_10266760 3300025914 Unclassified 1348
508 Ga0207693_10009848 3300025915 Bacteria 7774
509 Ga0207693_10016372 3300025915 Bacteria 5926
510 Ga0207693_10029080 3300025915 Unclassified 4368
511 Ga0207693_10032992 3300025915 Bacteria 4086
512 Ga0207693_10047385 3300025915 Bacteria 3378
513 Ga0207693_10089441 3300025915 Bacteria 2413
514 Ga0207693_10102841 3300025915 Bacteria 2240
515 Ga0207693_10134442 3300025915 Bacteria 1944
516 Ga0207693_10294460 3300025915 Unclassified 1272
517 Ga0207693_10294461 3300025915 Unclassified 1272
518 Ga0207693_10395716 3300025915 Bacteria 1080
519 Ga0207663_10002317 3300025916 Bacteria 9127
520 Ga0207663_10034619 3300025916 Bacteria 3023
521 Ga0207663_10076307 3300025916 Unclassified 2177
522 Ga0207663_10161217 3300025916 Bacteria 1583
523 Ga0207663_10322425 3300025916 Bacteria 1161
524 Ga0207662_10000532 3300025918 Bacteria 16909
525 Ga0207657_10061423 3300025919 Unclassified 3222
526 Ga0207657_10077181 3300025919 Unclassified 2808
527 Ga0207657_10319976 3300025919 Bacteria 1227
528 Ga0207657_10355796 3300025919 Unclassified 1154
529 Ga0207657_10665842 3300025919 Bacteria 810
530 Ga0207657_10822114 3300025919 Bacteria 718
531 Ga0207649_10177784 3300025920 Unclassified 1487
532 Ga0207652_10240703 3300025921 Unclassified 1631
533 Ga0207646_10001640 3300025922 Bacteria 27348
534 Ga0207646_10003759 3300025922 Bacteria 16922
535 Ga0207646_10003836 3300025922 Bacteria 16700
536 Ga0207646_10037631 3300025922 Bacteria 4361
537 Ga0207646_10091803 3300025922 Bacteria 2717
538 Ga0207646_10164799 3300025922 Bacteria 2001
539 Ga0207646_10179804 3300025922 Bacteria 1910
540 Ga0207646_10197179 3300025922 Bacteria 1818
541 Ga0207646_10290940 3300025922 Unclassified 1476
542 Ga0207646_10571677 3300025922 Unclassified 1015
543 Ga0207646_10943958 3300025922 Unclassified 764
544 Ga0207681_10013338 3300025923 Bacteria 5084
545 Ga0207681_10017078 3300025923 Bacteria 4553
546 Ga0207681_10024960 3300025923 Unclassified 3841
547 Ga0207681_10032609 3300025923 Bacteria 3412
548 Ga0207681_10057495 3300025923 Bacteria 2658
549 Ga0207681_10101402 3300025923 Bacteria 2076
550 Ga0207681_10203742 3300025923 Unclassified 1521
551 Ga0207681_10247898 3300025923 Bacteria 1389
552 Ga0207681_10632468 3300025923 Bacteria 886
553 Ga0207650_10069982 3300025925 Unclassified 2637
554 Ga0207650_10129955 3300025925 Bacteria 1970
555 Ga0207650_10154601 3300025925 Bacteria 1813
556 Ga0207650_10418715 3300025925 Unclassified 1111
557 Ga0207650_10615040 3300025925 Unclassified 914
558 Ga0207659_10018518 3300025926 Bacteria 4566
559 Ga0207659_10021701 3300025926 Bacteria 4268
560 Ga0207659_10044610 3300025926 Bacteria 3120
561 Ga0207659_10071319 3300025926 Unclassified 2536
562 Ga0207659_10135106 3300025926 Unclassified 1908
563 Ga0207659_10222390 3300025926 Unclassified 1519
564 Ga0207659_10257277 3300025926 Bacteria 1419
565 Ga0207659_10430627 3300025926 Bacteria 1108
566 Ga0207659_10612718 3300025926 Unclassified 929
567 Ga0207687_10132076 3300025927 Unclassified 1883
568 Ga0207700_10066986 3300025928 Bacteria 2746
569 Ga0207700_10092426 3300025928 Bacteria 2392
570 Ga0207700_10240938 3300025928 Unclassified 1541
571 Ga0207700_10244906 3300025928 Unclassified 1529
572 Ga0207664_10321010 3300025929 Unclassified 1366
573 Ga0207664_10796190 3300025929 Unclassified 850
574 Ga0207664_10913629 3300025929 Unclassified 788
575 Ga0207644_10015592 3300025931 Bacteria 5103
576 Ga0207644_10017748 3300025931 Bacteria 4811
577 Ga0207644_10080828 3300025931 Unclassified 2401
578 Ga0207644_10161054 3300025931 Bacteria 1744
579 Ga0207644_10246227 3300025931 Bacteria 1425
580 Ga0207644_10282670 3300025931 Bacteria 1332
581 Ga0207644_10542331 3300025931 Unclassified 962
582 Ga0207644_10580991 3300025931 Bacteria 929
583 Ga0207690_10008181 3300025932 Bacteria 6204
584 Ga0207690_10183309 3300025932 Unclassified 1578
585 Ga0207690_10648289 3300025932 Unclassified 865
586 Ga0207706_10003378 3300025933 Bacteria 15270
587 Ga0207706_10007545 3300025933 Bacteria 10066
588 Ga0207706_10051444 3300025933 Bacteria 3637
589 Ga0207706_10212378 3300025933 Bacteria 1696
590 Ga0207706_10231715 3300025933 Unclassified 1616
591 Ga0207706_10723978 3300025933 Unclassified 849
592 Ga0207686_10013154 3300025934 Bacteria 4572
593 Ga0207686_10015885 3300025934 Bacteria 4218
594 Ga0207686_10293090 3300025934 Unclassified 1206
595 Ga0207709_10073851 3300025935 Unclassified 2174
596 Ga0207709_10458291 3300025935 Unclassified 987
597 Ga0207670_10019286 3300025936 Bacteria 4163
598 Ga0207670_10039737 3300025936 Bacteria 3083
599 Ga0207670_10080069 3300025936 Bacteria 2282
600 Ga0207669_10007580 3300025937 Bacteria 5033
601 Ga0207669_10066988 3300025937 Bacteria 2235
602 Ga0207669_10255803 3300025937 Unclassified 1307
603 Ga0207669_10659299 3300025937 Unclassified 856
604 Ga0207704_10011653 3300025938 Bacteria 4338
605 Ga0207665_10007750 3300025939 Bacteria 7088
606 Ga0207665_10029506 3300025939 Bacteria 3626
607 Ga0207665_10036891 3300025939 Bacteria 3252
608 Ga0207665_10073958 3300025939 Bacteria 2332
609 Ga0207665_10170169 3300025939 Bacteria 1573
610 Ga0207665_10204697 3300025939 Unclassified 1439
611 Ga0207665_10270734 3300025939 Bacteria 1261
612 Ga0207665_10430026 3300025939 Unclassified 1010
613 Ga0207665_10477862 3300025939 Bacteria 960
614 Ga0207665_10519987 3300025939 Unclassified 921
615 Ga0207665_10573797 3300025939 Bacteria 879
616 Ga0207691_10000701 3300025940 Bacteria 33170
617 Ga0207691_10001070 3300025940 Bacteria 27238
618 Ga0207691_10030053 3300025940 Bacteria 5080
619 Ga0207691_11155590 3300025940 Bacteria 643
620 Ga0207711_10192093 3300025941 Unclassified 1861
621 Ga0207689_10139734 3300025942 Unclassified 1995
622 Ga0207689_10525967 3300025942 Bacteria 992
623 Ga0207661_10009439 3300025944 Bacteria 6999
624 Ga0207661_10310509 3300025944 Unclassified 1415
625 Ga0207679_10022332 3300025945 Bacteria 4307
626 Ga0207679_10059913 3300025945 Bacteria 2826
627 Ga0207679_10106199 3300025945 Unclassified 2207
628 Ga0207679_10374511 3300025945 Bacteria 1247
629 Ga0207679_10420978 3300025945 Bacteria 1179
630 Ga0207667_10109661 3300025949 Unclassified 2847
631 Ga0207667_10544901 3300025949 Unclassified 1174
632 Ga0207651_10029637 3300025960 Unclassified 3470
633 Ga0207651_10105668 3300025960 Unclassified 2101
634 Ga0207651_10144653 3300025960 Unclassified 1841
635 Ga0207651_10170621 3300025960 Bacteria 1715
636 Ga0207651_10235979 3300025960 Unclassified 1488
637 Ga0207651_10335148 3300025960 Unclassified 1269
638 Ga0207712_10007453 3300025961 Bacteria 6909
639 Ga0207712_10014529 3300025961 Bacteria 5068
640 Ga0207712_10549905 3300025961 Unclassified 993
641 Ga0207668_10017951 3300025972 Unclassified 4442
642 Ga0207668_10022499 3300025972 Bacteria 4037
643 Ga0207668_10028647 3300025972 Bacteria 3644
644 Ga0207668_10042462 3300025972 Bacteria 3079
645 Ga0207668_10052123 3300025972 Bacteria 2829
646 Ga0207668_10206629 3300025972 Unclassified 1568
647 Ga0207640_10300847 3300025981 Bacteria 1269
648 Ga0207640_10886159 3300025981 Bacteria 778
649 Ga0207658_10004924 3300025986 Bacteria 9211
650 Ga0207658_10052195 3300025986 Bacteria 3016
651 Ga0207658_10146665 3300025986 Bacteria 1917
652 Ga0207658_10281767 3300025986 Unclassified 1425
653 Ga0207658_10384598 3300025986 Unclassified 1230
654 Ga0207677_10062789 3300026023 Bacteria 2579
655 Ga0207677_10370325 3300026023 Bacteria 1206
656 Ga0207703_10327616 3300026035 Bacteria 1404
657 Ga0207703_10540403 3300026035 Bacteria 1098
658 Ga0207678_10004824 3300026067 Bacteria 12114
659 Ga0207678_10174162 3300026067 Unclassified 1837
660 Ga0207678_10277388 3300026067 Bacteria 1438
661 Ga0207708_10816242 3300026075 Unclassified 804
662 Ga0207702_10081420 3300026078 Bacteria 2811
663 Ga0207702_11162545 3300026078 Unclassified 766
664 Ga0207641_10008530 3300026088 Bacteria 8465
665 Ga0207648_10015532 3300026089 Bacteria 6998
666 Ga0207648_10084443 3300026089 Bacteria 2770
667 Ga0207676_10072439 3300026095 Unclassified 2770
668 Ga0207676_10443807 3300026095 Unclassified 1222
669 Ga0207675_100101175 3300026118 Bacteria 2715
670 Ga0207675_100139331 3300026118 Bacteria 2304
671 Ga0207675_100484530 3300026118 Bacteria 1230
672 Ga0207683_10020045 3300026121 Bacteria 5714
673 Ga0207683_10025017 3300026121 Bacteria 5148
674 Ga0207683_10028676 3300026121 Bacteria 4815
675 Ga0207683_10030603 3300026121 Bacteria 4664
676 Ga0207683_10069897 3300026121 Unclassified 3101
677 Ga0207698_10149223 3300026142 Unclassified 2026
678 Ga0207698_10866642 3300026142 Unclassified 909
679 Ga0207698_11193818 3300026142 Unclassified 775
680 Ga0209179_1013682 3300027512 Unclassified 1478
681 Ga0209971_1063954 3300027682 Bacteria 891
682 Ga0209974_10034676 3300027876 Bacteria 1675
683 Ga0209974_10065148 3300027876 Unclassified 1237
684 Ga0268266_10078512 3300028379 Bacteria 2872
685 Ga0268266_10121829 3300028379 Bacteria 2321
686 Ga0268266_10145117 3300028379 Bacteria 2133
687 Ga0268266_10454840 3300028379 Unclassified 1217
688 Ga0268266_10583876 3300028379 Unclassified 1072
689 Ga0268266_11393809 3300028379 Unclassified 676
690 Ga0268266_11552443 3300028379 Unclassified 637
691 Ga0268265_10174506 3300028380 Unclassified 1841
692 Ga0268265_10523006 3300028380 Unclassified 1122
693 Ga0268265_10865720 3300028380 Unclassified 885
694 Ga0268264_10004596 3300028381 Bacteria 11730
695 Ga0268264_11087801 3300028381 Bacteria 808
696 Ga0268264_11151210 3300028381 Unclassified 785
697 Ga0373938_0020479 3300034957 Unclassified 1333
698 Ga0373926_0314976 3300035083 Unclassified 612
699 Ga0373944_0072364 3300035089 Unclassified 1125
700 Ga0373949_0056079 3300035090 Unclassified 1004
701 Ga0373923_0364414 3300035111 Unclassified 692
702 Ga0373936_0115947 3300035113 Unclassified 1141
703 Ga0373945_0231219 3300035116 Unclassified 776
704 Ga0373943_0019490 3300035170 Bacteria 3121
705 Ga0373943_0021431 3300035170 Bacteria 2985
706 Ga0373943_0175516 3300035170 Unclassified 1175
707 Ga0373943_0246014 3300035170 Bacteria 1003
708 Ga0373946_0027047 3300035171 Unclassified 2267
709 Ga0373946_0105125 3300035171 Unclassified 1271
710 Ga0373942_0013505 3300035207 Bacteria 1965
711 Ga0373931_0031944 3300035691 Bacteria 2721
712 Ga0373931_0501330 3300035691 Unclassified 783
713 Ga0373935_0133698 3300035692 Unclassified 1669
714 Ga0373935_0241878 3300035692 Bacteria 1260
715 Ga0373927_0065252 3300035695 Bacteria 2355
716 Ga0373927_0124512 3300035695 Unclassified 1683
717 Ga0373927_0637479 3300035695 Bacteria 704
718 Ga0373933_0077828 3300035724 Bacteria 2028
719 Ga0373947_0007130 3300035725 Bacteria 6481
720 Ga0373947_0076953 3300035725 Bacteria 2057
721 Ga0373947_0167959 3300035725 Bacteria 1422
722 Ga0373947_0190974 3300035725 Bacteria 1336
723 Ga0373947_0225339 3300035725 Bacteria 1233
724 Ga0373947_0299569 3300035725 Unclassified 1072
725 Ga0373937_0287910 3300036401 Unclassified 1552
726 Ga0373937_0414485 3300036401 Bacteria 1278
727 Ga0373937_0589619 3300036401 Unclassified 1055
728 Ga0373925_0024806 3300037068 Unclassified 4380
729 Ga0373925_0059108 3300037068 Bacteria 2875
730 Ga0373925_0120341 3300037068 Bacteria 2038
731 Ga0373925_0143788 3300037068 Unclassified 1868
732 Ga0373925_0260186 3300037068 Bacteria 1394
733 Ga0373925_0361466 3300037068 Unclassified 1180
734 Ga0395900_0035484 3300037418 Bacteria 5136
735 Ga0395900_0158848 3300037418 Bacteria 2307
736 Ga0395900_0225339 3300037418 Unclassified 1888
737 Ga0395900_0288535 3300037418 Bacteria 1630
738 Ga0395900_0906285 3300037418 Unclassified 805
739 Ga0395900_1525012 3300037418 Bacteria 580
740 Ga0395898_0015422 3300037466 Bacteria 7836
741 Ga0395898_0059347 3300037466 Bacteria 3722
742 Ga0395898_0601008 3300037466 Unclassified 1043
743 Ga0395898_1301856 3300037466 Unclassified 656
744 Ga0395905_0586725 3300037471 Unclassified 1016
745 Ga0395905_1165189 3300037471 Bacteria 674
746 Ga0436364_1013391 3300037853 Bacteria 1046
747 Ga0395901_0001294 3300038443 Bacteria 26427
748 Ga0395901_0125281 3300038443 Bacteria 2700
749 Ga0395901_0338284 3300038443 Bacteria 1555
750 Ga0395901_0615709 3300038443 Bacteria 1093
751 Ga0395901_0810671 3300038443 Bacteria 924
752 Ga0436362_0544766 3300039453 Unclassified 519
753 Ga0451798_0255311 3300041458 Unclassified 516
754 Ga0451853_0364943 3300041512 Unclassified 757
755 Ga0451853_3265935 3300041512 Bacteria 1092
756 Ga0439455_0014472 3300042012 Unclassified 1802
757 Ga0439458_0011354 3300042157 Unclassified 1991
758 Ga0439458_0060117 3300042157 Bacteria 948
759 Ga0439460_0051433 3300042461 Unclassified 1236
760 Ga0439440_0016520 3300042993 Unclassified 1617
761 Ga0439440_0129557 3300042993 Unclassified 709
762 Ga0466964_0010200 3300044706 Bacteria 3543
763 Ga0451576_0437515 3300045051 Unclassified 1372
764 Ga0466967_0810295 3300045976 Bacteria 930
765 Ga0495592_0003666 3300046454 Bacteria 11062
766 Ga0495592_0071957 3300046454 Bacteria 2516
767 Ga0495603_0136944 3300046455 Bacteria 1425
768 Ga0495629_0069394 3300046459 Bacteria 2459
769 Ga0495629_0292997 3300046459 Unclassified 1115
770 Ga0495651_0002481 3300046462 Bacteria 14260
771 Ga0495651_0165100 3300046462 Unclassified 1582
772 Ga0495653_0188674 3300046463 Unclassified 1408
773 Ga0495580_0085689 3300046472 Bacteria 2194
774 Ga0495605_0077750 3300046474 Unclassified 1556
775 Ga0495639_0051774 3300046475 Unclassified 1868
776 Ga0495662_0109566 3300046476 Unclassified 1353
777 Ga0495664_0023225 3300046477 Bacteria 3598
778 Ga0495584_0167766 3300046491 Unclassified 1116
779 Ga0495584_0232173 3300046491 Archaea 938
780 Ga0495618_0152914 3300046514 Unclassified 1473
781 Ga0495620_0157899 3300046515 Bacteria 882
782 Ga0495630_0379348 3300046517 Bacteria 1083
783 Ga0495632_0330158 3300046519 Unclassified 673
784 Ga0495637_0136817 3300046520 Archaea 932
785 Ga0495644_0105876 3300046523 Bacteria 1066
786 Ga0495663_0017731 3300046525 Unclassified 2023
787 Ga0495663_0141507 3300046525 Bacteria 817
788 Ga0495666_0054427 3300046526 Bacteria 1919
789 Ga0495642_0032571 3300046528 Unclassified 2092
790 Ga0495652_0062611 3300046529 Bacteria 3136
791 Ga0495652_0185848 3300046529 Bacteria 1590
792 Ga0495654_0126738 3300046530 Unclassified 1150
793 Ga0495665_0158596 3300046531 Unclassified 1180
794 Ga0495640_0079005 3300046533 Bacteria 2191
795 Ga0495586_0041598 3300046535 Bacteria 2475
796 Ga0495587_0031563 3300046536 Bacteria 3206
797 Ga0495598_0002133 3300046537 Unclassified 4039
798 Ga0495609_0249334 3300046538 Archaea 731
799 Ga0495621_0098493 3300046539 Unclassified 1110
800 Ga0495622_0163821 3300046557 Bacteria 1002
801 Ga0495633_0108727 3300046558 Unclassified 1286
802 Ga0495656_0236029 3300046615 Archaea 919
803 Ga0495634_0099295 3300046642 Unclassified 1882
804 Ga0495635_0343956 3300046663 Unclassified 996
805 Ga0495635_0372444 3300046663 Unclassified 951
806 Ga0495659_0007430 3300046664 Bacteria 3476
807 Ga0495588_0246193 3300046674 Unclassified 943
808 Ga0495657_0622887 3300046675 Unclassified 623
809 Ga0495599_0002602 3300046678 Bacteria 10523
810 Ga0495623_0008117 3300046679 Bacteria 6823
811 Ga0495646_0156660 3300046680 Unclassified 1263
812 Ga0495658_0093823 3300046683 Bacteria 1781
813 Ga0495669_0012538 3300046684 Bacteria 3609
814 Ga0495669_0022893 3300046684 Unclassified 2716
815 Ga0495669_0082058 3300046684 Unclassified 1481
816 Ga0495613_0086089 3300046689 Unclassified 2279
817 Ga0495649_0307248 3300046694 Unclassified 807
818 Ga0495600_0217469 3300046809 Unclassified 1223
819 Ga0495581_0143850 3300047315 Bacteria 1391
820 Ga0495674_0036636 3300047319 Bacteria 4414
821 Ga0495676_0101757 3300047321 Bacteria 2124
822 Ga0495675_0072265 3300047444 Bacteria 2176
823 Ga0495684_0024374 3300047471 Bacteria 4658
824 Ga0495602_0085166 3300048088 Bacteria 2642
825 Ga0495614_0007991 3300048089 Bacteria 4702
826 Ga0496100_0014612 3300048903 Bacteria 4562
827 Ga0496100_0311080 3300048903 Bacteria 1181
828 Ga0496101_0020470 3300048904 Bacteria 4530
829 Ga0496101_0073871 3300048904 Bacteria 2506
830 Ga0496101_0285318 3300048904 Bacteria 1291
831 Ga0496101_0321082 3300048904 Unclassified 1215
832 Ga0496101_0701515 3300048904 Bacteria 799
833 Ga0496102_0057850 3300048905 Bacteria 3541
834 Ga0496102_0078808 3300048905 Bacteria 3033
835 Ga0496102_0153527 3300048905 Bacteria 2164
836 Ga0496102_0279302 3300048905 Bacteria 1574
837 Ga0496102_0434581 3300048905 Bacteria 1232
838 Ga0496103_0016279 3300048906 Bacteria 4438
839 Ga0496103_0046493 3300048906 Bacteria 2680
840 Ga0496103_0312960 3300048906 Bacteria 1010
841 Ga0496104_0040248 3300048907 Bacteria 4380
842 Ga0496104_0051870 3300048907 Bacteria 3873
843 Ga0496104_0063642 3300048907 Bacteria 3499
844 Ga0496104_0094169 3300048907 Bacteria 2865
845 Ga0496104_0171742 3300048907 Unclassified 2079
846 Ga0496104_0525184 3300048907 Unclassified 1095
847 Ga0496105_0038887 3300048908 Bacteria 3920
848 Ga0496105_0322645 3300048908 Bacteria 1237
849 Ga0496105_0336194 3300048908 Bacteria 1208
850 Ga0496105_0438172 3300048908 Bacteria 1033
851 Ga0496106_0025001 3300048909 Bacteria 4442
852 Ga0496106_0077084 3300048909 Bacteria 2556
853 Ga0496106_0248457 3300048909 Bacteria 1422
854 Ga0496106_0342812 3300048909 Bacteria 1200
855 Ga0496107_0026842 3300048910 Bacteria 4086
856 Ga0496107_0067383 3300048910 Bacteria 2597
857 Ga0496107_0119523 3300048910 Bacteria 1941
858 Ga0496107_0409308 3300048910 Bacteria 1009
859 Ga0496108_0052612 3300048911 Bacteria 3413
860 Ga0496108_0063381 3300048911 Unclassified 3113
861 Ga0496108_0130017 3300048911 Bacteria 2164
862 Ga0496108_0432648 3300048911 Bacteria 1149
863 Ga0496108_0760276 3300048911 Bacteria 838
864 Ga0496108_0931755 3300048911 Bacteria 744
865 Ga0496109_0027830 3300048912 Bacteria 5052
866 Ga0496109_0042205 3300048912 Bacteria 4131
867 Ga0496109_0093658 3300048912 Bacteria 2780
868 Ga0496109_0164122 3300048912 Bacteria 2082
869 Ga0496109_0222184 3300048912 Bacteria 1776
870 Ga0496109_0446505 3300048912 Bacteria 1222
871 Ga0496109_0491271 3300048912 Unclassified 1159
872 Ga0496110_0065445 3300048913 Unclassified 3214
873 Ga0496110_0393781 3300048913 Unclassified 1263
874 Ga0496110_0555896 3300048913 Bacteria 1043
875 Ga0496110_0911827 3300048913 Unclassified 785
876 Ga0496111_0086614 3300048914 Bacteria 2292
877 Ga0496112_0001874 3300048915 Bacteria 16581
878 Ga0496112_0040797 3300048915 Unclassified 4539
879 Ga0496112_0094453 3300048915 Bacteria 2961
880 Ga0496112_0163709 3300048915 Bacteria 2190
881 Ga0496112_0236983 3300048915 Unclassified 1778
882 Ga0496112_0483833 3300048915 Bacteria 1174
883 Ga0496112_0950785 3300048915 Unclassified 780
884 Ga0496113_0055035 3300048916 Bacteria 2981
885 Ga0496113_0085381 3300048916 Unclassified 2425
886 Ga0496113_0300205 3300048916 Unclassified 1286
887 Ga0496113_0554671 3300048916 Bacteria 921
888 Ga0496114_0005274 3300048917 Bacteria 10099
889 Ga0496114_0107274 3300048917 Bacteria 2390
890 Ga0496114_0278962 3300048917 Bacteria 1473
891 Ga0496115_0004373 3300048918 Bacteria 10232
892 Ga0496115_0004459 3300048918 Bacteria 10146
893 Ga0496115_0007639 3300048918 Bacteria 7965
894 Ga0496115_0017107 3300048918 Bacteria 5532
895 Ga0496115_0103021 3300048918 Unclassified 2341
896 nmdc:mga05p37_190551_c1 3300050507 Bacteria 2490
897 nmdc:mga05p37_27192_c1 3300050507 Bacteria 6964
898 nmdc:mga05p37_679881_c1 3300050507 Bacteria 1147
899 nmdc:mga08y16_26106_c3 3300050511 Bacteria 1655
900 nmdc:mga08y16_312471_c1 3300050511 Unclassified 1618
901 nmdc:mga08y16_330091_c1 3300050511 Unclassified 1569
902 nmdc:mga0n895_169751_c1 3300050512 Unclassified 2213
903 nmdc:mga0n895_198730_c1 3300050512 Unclassified 2036
904 nmdc:mga0n895_223870_c1 3300050512 Unclassified 1909
905 nmdc:mga0n895_504204_c1 3300050512 Unclassified 1219
906 nmdc:mga0rr50_884094_c1 3300050513 Unclassified 762
907 nmdc:mga08x19_335824_c1 3300050514 Unclassified 1053
908 nmdc:mga08x19_341484_c1 3300050514 Unclassified 1044
909 nmdc:mga08x19_50281_c1 3300050514 Unclassified 2675
910 nmdc:mga0a205_234102_c1 3300050515 Bacteria 1719
911 Ga0495601_0036340 3300053077 Bacteria 3075
912 Ga0495655_0056658 3300053083 Archaea 1055
913 Ga0495595_0146473 3300053084 Bacteria 1160
914 Ga0495619_0386021 3300053085 Bacteria 968
915 Ga0495628_0218663
916 CNXas_1000015
917 JGI24035J26624_1002185
918 JGI25406J46586_10028297
919 JGI25406J46586_10033383
920 JGI25405J52794_10000124
921 Ga0065717_1001519
922 Ga0065714_10090773
923 Ga0065714_10228608
924 Ga0065704_10082945
925 Ga0065704_10083157
926 Ga0065704_10148674
927 Ga0065704_10238857
928 Ga0065712_10002542
929 Ga0065712_10008036
930 Ga0065712_10008417
931 Ga0065712_10084262
932 Ga0065712_10125226
933 Ga0065712_10138258
934 Ga0065712_10240150
935 Ga0065715_10002238
936 Ga0065715_10007980
937 Ga0065715_10013048
938 Ga0065715_10089584
939 Ga0065715_10103092
940 Ga0065715_10106469
941 Ga0065715_10120331
942 Ga0065715_10303022
943 Ga0065707_10003529
944 Ga0065707_10014870
945 Ga0070676_10002299
946 Ga0070676_10039949
947 Ga0070676_10067171
948 Ga0070676_10168250
949 Ga0070683_100007716
950 Ga0070683_100031446
951 Ga0070683_100067473
952 Ga0070683_100130551
953 Ga0070683_100161638
954 Ga0070690_100077316
955 Ga0070690_100085791
956 Ga0070690_100101108
957 Ga0070690_100107914
958 Ga0070690_100232936
959 Ga0070670_100014391
960 Ga0070670_100037989
961 Ga0070670_100069191
962 Ga0070670_100113364
963 Ga0070670_100117022
964 Ga0070670_100552400
965 Ga0070670_100681117
966 Ga0070670_101124735
967 Ga0070677_10069138
968 Ga0070677_10217156
969 Ga0068869_100120624
970 Ga0068869_100122116
971 Ga0070666_10015825
972 Ga0070666_10026780
973 Ga0070666_10086327
974 Ga0070666_10200626
975 Ga0070666_10896415
976 Ga0070680_100155543
977 Ga0070680_100589926
978 Ga0070682_100053816
979 Ga0068868_100012887
980 Ga0068868_100048425
981 Ga0068868_100053005
982 Ga0068868_100126576
983 Ga0070660_100062452
984 Ga0070660_100351029
985 Ga0070660_100384965
986 Ga0070660_100749358
987 Ga0070689_100001267
988 Ga0070689_100009006
989 Ga0070689_100075953
990 Ga0070689_100218494
991 Ga0070687_100694925
992 Ga0070687_100807312
993 Ga0070661_100096470
994 Ga0070692_10192214
995 Ga0070668_100001566
996 Ga0070668_100022038
997 Ga0070668_100047915
998 Ga0070668_100093795
999 Ga0070668_100171859
1000 Ga0070669_100005146
1001 Ga0070669_100014651
1002 Ga0070669_100035637
1003 Ga0070669_100070580
1004 Ga0070669_100473234
1005 Ga0070669_100493727
1006 Ga0070675_100000800
1007 Ga0070675_100001110
1008 Ga0070675_100032879
1009 Ga0070675_100042730
1010 Ga0070675_100084777
1011 Ga0070675_100126077
1012 Ga0070675_100183334
1013 Ga0070675_100444653
1014 Ga0070675_100515654
1015 Ga0070675_101159773
1016 Ga0070671_100006985
1017 Ga0070671_100009200
1018 Ga0070671_100010632
1019 Ga0070671_100117596
1020 Ga0070671_100213265
1021 Ga0070671_100251248
1022 Ga0070671_100455729
1023 Ga0070671_100459439
1024 Ga0070671_100520260
1025 Ga0070671_100727451
1026 Ga0070674_100004295
1027 Ga0070674_100017349
1028 Ga0070674_100061487
1029 Ga0070674_100136976
1030 Ga0070673_100008309
1031 Ga0070673_100012043
1032 Ga0070673_100012359
1033 Ga0070673_100069064
1034 Ga0070673_100359117
1035 Ga0070688_100024252
1036 Ga0070688_100088841
1037 Ga0070688_100166542
1038 Ga0070659_100035409
1039 Ga0070659_100281801
1040 Ga0070659_100319339
1041 Ga0070659_100928889
1042 Ga0070667_100018525
1043 Ga0070667_100051358
1044 Ga0070667_100056208
1045 Ga0070667_100215810
1046 Ga0070667_100241944
1047 Ga0070667_100520265
1048 Ga0070667_100768811
1049 Ga0070709_10061646
1050 Ga0070709_10101160
1051 Ga0070709_10157553
1052 Ga0070709_10389873
1053 Ga0070714_100066234
1054 Ga0070713_100065319
1055 Ga0070713_100210626
1056 Ga0070713_100311592
1057 Ga0070710_10045206
1058 Ga0070710_10158900
1059 Ga0070710_10225392
1060 Ga0070710_10436124
1061 Ga0070711_100003037
1062 Ga0070711_100020337
1063 Ga0070711_100041603
1064 Ga0070711_100111760
1065 Ga0070711_100115136
1066 Ga0070705_100017828
1067 Ga0070705_100021045
1068 Ga0070705_100039662
1069 Ga0070705_100378764
1070 Ga0070700_100084729
1071 Ga0070694_100086048
1072 Ga0070694_100245858
1073 Ga0070708_100014955
1074 Ga0070708_100027669
1075 Ga0070708_100045127
1076 Ga0070708_100074413
1077 Ga0070708_100141047
1078 Ga0070708_100298506
1079 Ga0070708_100339865
1080 Ga0070708_100424659
1081 Ga0070708_100922290
1082 Ga0070663_100020545
1083 Ga0070663_100516075
1084 Ga0070663_101117233
1085 Ga0070678_100053145
1086 Ga0070678_100142165
1087 Ga0070662_100011457
1088 Ga0070662_100144755
1089 Ga0070662_100178898
1090 Ga0070662_100827424
1091 Ga0070681_10052380
1092 Ga0068867_100014657
1093 Ga0070685_10050959
1094 Ga0070685_10530275
1095 Ga0070706_100000011
1096 Ga0070706_100012402
1097 Ga0070706_100015234
1098 Ga0070706_100021085
1099 Ga0070706_100040495
1100 Ga0070706_100068869
1101 Ga0070706_100430206
1102 Ga0070706_100665738
1103 Ga0070706_101044686
1104 Ga0070707_100003264
1105 Ga0070707_100023994
1106 Ga0070707_100024310
1107 Ga0070707_100041589
1108 Ga0070707_100052756
1109 Ga0070707_100126399
1110 Ga0070707_100244903
1111 Ga0070707_100598422
1112 Ga0070707_100672675
1113 Ga0070698_100000288
1114 Ga0070698_100012794
1115 Ga0070698_100029828
1116 Ga0070698_100255024
1117 Ga0070698_100294938
1118 Ga0070698_101173497
1119 Ga0070699_100134495
1120 Ga0070699_100206100
1121 Ga0070699_100333238
1122 Ga0070699_100595076
1123 Ga0070699_100665034
1124 Ga0070699_101054423
1125 Ga0070684_100000254
1126 Ga0070684_100260485
1127 Ga0070684_100383706
1128 Ga0070684_100470170
1129 Ga0070684_100830345
1130 Ga0070684_100966149
1131 Ga0070697_100001132
1132 Ga0070697_100017935
1133 Ga0070697_100020084
1134 Ga0070697_100024745
1135 Ga0070697_100034437
1136 Ga0070697_100038577
1137 Ga0070697_100039499
1138 Ga0070697_100039941
1139 Ga0070697_100042413
1140 Ga0070697_100087093
1141 Ga0070697_100162632
1142 Ga0070697_100518172
1143 Ga0070697_100533086
1144 Ga0070697_100637862
1145 Ga0070672_100008850
1146 Ga0070672_100060915
1147 Ga0070672_100071036
1148 Ga0070672_100085054
1149 Ga0070686_100008987
1150 Ga0070686_100633978
1151 Ga0070695_100073372
1152 Ga0070695_100798851
1153 Ga0070696_100033547
1154 Ga0070696_100285926
1155 Ga0070665_100146836
1156 Ga0070665_100147354
1157 Ga0070665_100160449
1158 Ga0070665_100184912
1159 Ga0070665_100190733
1160 Ga0070665_100307052
1161 Ga0070665_100787728
1162 Ga0070665_101125515
1163 Ga0070704_100007524
1164 Ga0070704_100453595
1165 Ga0068855_100460849
1166 Ga0068855_100461974
1167 Ga0068855_101232633
1168 Ga0070664_100025116
1169 Ga0070664_100030703
1170 Ga0070664_100127830
1171 Ga0070664_100138533
1172 Ga0070664_100252035
1173 Ga0070664_100353061
1174 Ga0070664_100745758
1175 Ga0068854_100313522
1176 Ga0068856_100024841
1177 Ga0070702_100192728
1178 Ga0070702_100455904
1179 Ga0068852_100637867
1180 Ga0068852_100641552
1181 Ga0068859_100124988
1182 Ga0068864_100263763
1183 Ga0068864_100446769
1184 Ga0068866_10017827
1185 Ga0068861_100234604
1186 Ga0068863_100085861
1187 Ga0068863_100166687
1188 Ga0068863_100172349
1189 Ga0068863_100789166
1190 Ga0068858_100010162
1191 Ga0068858_100212940
1192 Ga0068858_100354330
1193 Ga0068860_100007266
1194 Ga0068860_101124737
1195 Ga0068860_101314894
1196 Ga0068862_100083952
1197 Ga0068862_100316582
1198 Ga0068862_101023174
1199 Ga0081455_10000486
1200 Ga0081455_10003585
1201 Ga0081455_10114154
1202 Ga0081455_10114852
1203 Ga0081455_10149311
1204 Ga0081540_1000532
1205 Ga0081540_1007016
1206 Ga0081540_1020553
1207 Ga0081539_10003960
1208 Ga0081539_10005046
1209 Ga0081539_10016932
1210 Ga0081539_10040760
1211 Ga0070717_10005159
1212 Ga0070717_10005613
1213 Ga0070717_10016084
1214 Ga0070717_10067690
1215 Ga0070717_10072623
1216 Ga0070717_10461502
1217 Ga0070717_10579642
1218 Ga0070717_10682660
1219 Ga0070717_11226327
1220 Ga0070715_10012884
1221 Ga0070715_10016504
1222 Ga0070715_10291114
1223 Ga0070716_100034718
1224 Ga0070716_100050005
1225 Ga0070716_100052507
1226 Ga0070716_100062450
1227 Ga0070716_100257965
1228 Ga0070716_100448324
1229 Ga0070712_100005405
1230 Ga0070712_100006223
1231 Ga0070712_100142042
1232 Ga0070712_100160451
1233 Ga0070712_100213429
1234 Ga0070712_100368745
1235 Ga0070712_100670156
1236 Ga0070712_100822959
1237 Ga0070712_100990787
1238 Ga0070712_100995804
1239 Ga0075366_10572089
1240 Ga0097621_100005808
1241 Ga0097621_100015849
1242 Ga0097621_100074971
1243 Ga0097621_100129350
1244 Ga0097621_100286979
1245 Ga0068871_100004431
1246 Ga0068871_100026904
1247 Ga0068871_100199469
1248 Ga0068871_100200713
1249 Ga0075428_100262136
1250 Ga0075428_100836432
1251 Ga0075431_100515654
1252 Ga0075433_10602200
1253 Ga0075434_100052913
1254 Ga0075434_100492373
1255 Ga0075434_100553872
1256 Ga0068865_100013990
1257 Ga0068865_100162120
1258 Ga0075436_100023561
1259 Ga0075436_100273132
1260 Ga0097620_100124987
1261 Ga0075435_100440009
1262 Ga0099795_10043076
1263 Ga0105240_10684839
1264 Ga0105240_11272952
1265 Ga0111539_10106439
1266 Ga0111539_10114935
1267 Ga0111539_10495389
1268 Ga0105245_10074086
1269 Ga0105245_10077081
1270 Ga0105245_10188026
1271 Ga0105245_10328943
1272 Ga0105245_10571395
1273 Ga0105245_11005435
1274 Ga0105247_10043319
1275 Ga0105247_10130781
1276 Ga0114129_10416208
1277 Ga0114129_10844177
1278 Ga0105243_10129668
1279 Ga0105243_10132216
1280 Ga0105243_11262403
1281 Ga0105241_10224294
1282 Ga0105241_10739050
1283 Ga0105242_10029989
1284 Ga0105242_10175215
1285 Ga0105242_10325009
1286 Ga0105237_10167421
1287 Ga0105249_10006222
1288 Ga0105249_10045544
1289 Ga0105249_10727539
1290 Ga0099796_10059088
1291 Ga0105239_10018051
1292 Ga0105239_10226533
1293 Ga0105239_10669524
1294 Ga0105246_10034754
1295 Ga0105246_10163593
1296 Ga0105246_10846491
1297 Ga0157373_10601331
1298 Ga0157369_10179278
1299 Ga0157374_10004504
1300 Ga0157374_10030925
1301 Ga0157374_10062854
1302 Ga0157374_10124171
1303 Ga0157374_10154984
1304 Ga0157374_10179307
1305 Ga0157374_10186378
1306 Ga0157374_10214222
1307 Ga0157374_10248798
1308 Ga0157374_10511776
1309 Ga0157374_10537347
1310 Ga0157374_10735867
1311 Ga0157378_10004663
1312 Ga0157378_10029641
1313 Ga0157378_10061028
1314 Ga0157378_10061937
1315 Ga0157378_10067784
1316 Ga0157378_10085694
1317 Ga0157378_10253080
1318 Ga0157378_10349824
1319 Ga0157378_10496685
1320 Ga0157378_10526729
1321 Ga0157378_10554211
1322 Ga0157378_10916296
1323 Ga0163162_10004005
1324 Ga0163162_10011144
1325 Ga0163162_10036699
1326 Ga0163162_10039816
1327 Ga0163162_10040041
1328 Ga0163162_10300252
1329 Ga0163162_10416610
1330 Ga0163162_10519708
1331 Ga0157372_10061403
1332 Ga0157372_10068753
1333 Ga0157372_10136701
1334 Ga0157372_11388444
1335 Ga0157375_10003613
1336 Ga0157375_10037043
1337 Ga0157375_10135970
1338 Ga0157375_10235267
1339 Ga0157375_10332876
1340 Ga0157375_10378858
1341 Ga0157375_10398083
1342 Ga0157375_10971227
1343 Ga0163163_10222506
1344 Ga0163163_11519704
1345 Ga0182008_10438391
1346 Ga0157377_10082291
1347 Ga0157377_10235911
1348 Ga0157379_10030011
1349 Ga0157376_10032856
1350 Ga0157376_10062547
1351 Ga0157376_10081011
1352 Ga0157376_10088716
1353 Ga0157376_10111049
1354 Ga0157376_10142869
1355 Ga0157376_10304067
1356 Ga0157376_10468600
1357 Ga0157376_10670955
1358 Ga0157376_11175893
1359 Ga0157376_11691128
1360 Ga0182007_10076327
1361 Ga0163161_10039588
1362 Ga0163161_10159728
1363 Ga0163161_10302651
1364 Ga0207666_1001684
1365 Ga0207673_1000646
1366 Ga0207673_1002887
1367 Ga0207673_1009636
1368 Ga0207673_1031750
1369 Ga0207697_10000281
1370 Ga0207697_10001510
1371 Ga0207697_10002546
1372 Ga0207697_10003172
1373 Ga0207697_10009904
1374 Ga0207697_10011141
1375 Ga0207697_10012398
1376 Ga0207697_10013296
1377 Ga0207697_10038913
1378 Ga0207697_10080359
1379 Ga0207653_10006171
1380 Ga0207682_10004815
1381 Ga0207692_10127636
1382 Ga0207642_10050773
1383 Ga0207710_10038073
1384 Ga0207710_10192462
1385 Ga0207688_10001545
1386 Ga0207688_10005469
1387 Ga0207688_10043420
1388 Ga0207688_10159234
1389 Ga0207688_10189402
1390 Ga0207680_10012292
1391 Ga0207680_10028269
1392 Ga0207680_10222950
1393 Ga0207647_10009086
1394 Ga0207647_10236704
1395 Ga0207647_10243707
1396 Ga0207685_10148187
1397 Ga0207685_10200573
1398 Ga0207699_10009262
1399 Ga0207699_10085515
1400 Ga0207645_10001030
1401 Ga0207645_10003151
1402 Ga0207645_10008561
1403 Ga0207645_10010303
1404 Ga0207645_10043642
1405 Ga0207645_10187341
1406 Ga0207645_10621605
1407 Ga0207684_10000052
1408 Ga0207684_10011740
1409 Ga0207684_10015843
1410 Ga0207684_10028320
1411 Ga0207684_10028682
1412 Ga0207684_10048819
1413 Ga0207684_10190765
1414 Ga0207684_10257943
1415 Ga0207684_10395575
1416 Ga0207684_10629919
1417 Ga0207684_10700144
1418 Ga0207684_10925131
1419 Ga0207654_10164387
1420 Ga0207707_10024631
1421 Ga0207671_10266760
1422 Ga0207693_10009848
1423 Ga0207693_10016372
1424 Ga0207693_10029080
1425 Ga0207693_10032992
1426 Ga0207693_10047385
1427 Ga0207693_10089441
1428 Ga0207693_10102841
1429 Ga0207693_10134442
1430 Ga0207693_10294460
1431 Ga0207693_10294461
1432 Ga0207693_10395716
1433 Ga0207663_10002317
1434 Ga0207663_10034619
1435 Ga0207663_10076307
1436 Ga0207663_10161217
1437 Ga0207663_10322425
1438 Ga0207662_10000532
1439 Ga0207657_10061423
1440 Ga0207657_10077181
1441 Ga0207657_10319976
1442 Ga0207657_10355796
1443 Ga0207657_10665842
1444 Ga0207657_10822114
1445 Ga0207649_10177784
1446 Ga0207652_10240703
1447 Ga0207646_10001640
1448 Ga0207646_10003759
1449 Ga0207646_10003836
1450 Ga0207646_10037631
1451 Ga0207646_10091803
1452 Ga0207646_10164799
1453 Ga0207646_10179804
1454 Ga0207646_10197179
1455 Ga0207646_10290940
1456 Ga0207646_10571677
1457 Ga0207646_10943958
1458 Ga0207681_10013338
1459 Ga0207681_10017078
1460 Ga0207681_10024960
1461 Ga0207681_10032609
1462 Ga0207681_10057495
1463 Ga0207681_10101402
1464 Ga0207681_10203742
1465 Ga0207681_10247898
1466 Ga0207681_10632468
1467 Ga0207650_10069982
1468 Ga0207650_10129955
1469 Ga0207650_10154601
1470 Ga0207650_10418715
1471 Ga0207650_10615040
1472 Ga0207659_10018518
1473 Ga0207659_10021701
1474 Ga0207659_10044610
1475 Ga0207659_10071319
1476 Ga0207659_10135106
1477 Ga0207659_10222390
1478 Ga0207659_10257277
1479 Ga0207659_10430627
1480 Ga0207659_10612718
1481 Ga0207687_10132076
1482 Ga0207700_10066986
1483 Ga0207700_10092426
1484 Ga0207700_10240938
1485 Ga0207700_10244906
1486 Ga0207664_10321010
1487 Ga0207664_10796190
1488 Ga0207664_10913629
1489 Ga0207644_10015592
1490 Ga0207644_10017748
1491 Ga0207644_10080828
1492 Ga0207644_10161054
1493 Ga0207644_10246227
1494 Ga0207644_10282670
1495 Ga0207644_10542331
1496 Ga0207644_10580991
1497 Ga0207690_10008181
1498 Ga0207690_10183309
1499 Ga0207690_10648289
1500 Ga0207706_10003378
1501 Ga0207706_10007545
1502 Ga0207706_10051444
1503 Ga0207706_10212378
1504 Ga0207706_10231715
1505 Ga0207706_10723978
1506 Ga0207686_10013154
1507 Ga0207686_10015885
1508 Ga0207686_10293090
1509 Ga0207709_10073851
1510 Ga0207709_10458291
1511 Ga0207670_10019286
1512 Ga0207670_10039737
1513 Ga0207670_10080069
1514 Ga0207669_10007580
1515 Ga0207669_10066988
1516 Ga0207669_10255803
1517 Ga0207669_10659299
1518 Ga0207704_10011653
1519 Ga0207665_10007750
1520 Ga0207665_10029506
1521 Ga0207665_10036891
1522 Ga0207665_10073958
1523 Ga0207665_10170169
1524 Ga0207665_10204697
1525 Ga0207665_10270734
1526 Ga0207665_10430026
1527 Ga0207665_10477862
1528 Ga0207665_10519987
1529 Ga0207665_10573797
1530 Ga0207691_10000701
1531 Ga0207691_10001070
1532 Ga0207691_10030053
1533 Ga0207691_11155590
1534 Ga0207711_10192093
1535 Ga0207689_10139734
1536 Ga0207689_10525967
1537 Ga0207661_10009439
1538 Ga0207661_10310509
1539 Ga0207679_10022332
1540 Ga0207679_10059913
1541 Ga0207679_10106199
1542 Ga0207679_10374511
1543 Ga0207679_10420978
1544 Ga0207667_10109661
1545 Ga0207667_10544901
1546 Ga0207651_10029637
1547 Ga0207651_10105668
1548 Ga0207651_10144653
1549 Ga0207651_10170621
1550 Ga0207651_10235979
1551 Ga0207651_10335148
1552 Ga0207712_10007453
1553 Ga0207712_10014529
1554 Ga0207712_10549905
1555 Ga0207668_10017951
1556 Ga0207668_10022499
1557 Ga0207668_10028647
1558 Ga0207668_10042462
1559 Ga0207668_10052123
1560 Ga0207668_10206629
1561 Ga0207640_10300847
1562 Ga0207640_10886159
1563 Ga0207658_10004924
1564 Ga0207658_10052195
1565 Ga0207658_10146665
1566 Ga0207658_10281767
1567 Ga0207658_10384598
1568 Ga0207677_10062789
1569 Ga0207677_10370325
1570 Ga0207703_10327616
1571 Ga0207703_10540403
1572 Ga0207678_10004824
1573 Ga0207678_10174162
1574 Ga0207678_10277388
1575 Ga0207708_10816242
1576 Ga0207702_10081420
1577 Ga0207702_11162545
1578 Ga0207641_10008530
1579 Ga0207648_10015532
1580 Ga0207648_10084443
1581 Ga0207676_10072439
1582 Ga0207676_10443807
1583 Ga0207675_100101175
1584 Ga0207675_100139331
1585 Ga0207675_100484530
1586 Ga0207683_10020045
1587 Ga0207683_10025017
1588 Ga0207683_10028676
1589 Ga0207683_10030603
1590 Ga0207683_10069897
1591 Ga0207698_10149223
1592 Ga0207698_10866642
1593 Ga0207698_11193818
1594 Ga0209179_1013682
1595 Ga0209971_1063954
1596 Ga0209974_10034676
1597 Ga0209974_10065148
1598 Ga0268266_10078512
1599 Ga0268266_10121829
1600 Ga0268266_10145117
1601 Ga0268266_10454840
1602 Ga0268266_10583876
1603 Ga0268266_11393809
1604 Ga0268266_11552443
1605 Ga0268265_10174506
1606 Ga0268265_10523006
1607 Ga0268265_10865720
1608 Ga0268264_10004596
1609 Ga0268264_11087801
1610 Ga0268264_11151210
1611 Ga0373938_0020479
1612 Ga0373926_0314976
1613 Ga0373944_0072364
1614 Ga0373949_0056079
1615 Ga0373923_0364414
1616 Ga0373936_0115947
1617 Ga0373945_0231219
1618 Ga0373943_0019490
1619 Ga0373943_0021431
1620 Ga0373943_0175516
1621 Ga0373943_0246014
1622 Ga0373946_0027047
1623 Ga0373946_0105125
1624 Ga0373942_0013505
1625 Ga0373931_0031944
1626 Ga0373931_0501330
1627 Ga0373935_0133698
1628 Ga0373935_0241878
1629 Ga0373927_0065252
1630 Ga0373927_0124512
1631 Ga0373927_0637479
1632 Ga0373933_0077828
1633 Ga0373947_0007130
1634 Ga0373947_0076953
1635 Ga0373947_0167959
1636 Ga0373947_0190974
1637 Ga0373947_0225339
1638 Ga0373947_0299569
1639 Ga0373937_0287910
1640 Ga0373937_0414485
1641 Ga0373937_0589619
1642 Ga0373925_0024806
1643 Ga0373925_0059108
1644 Ga0373925_0120341
1645 Ga0373925_0143788
1646 Ga0373925_0260186
1647 Ga0373925_0361466
1648 Ga0395900_0035484
1649 Ga0395900_0158848
1650 Ga0395900_0225339
1651 Ga0395900_0288535
1652 Ga0395900_0906285
1653 Ga0395900_1525012
1654 Ga0395898_0015422
1655 Ga0395898_0059347
1656 Ga0395898_0601008
1657 Ga0395898_1301856
1658 Ga0395905_0586725
1659 Ga0395905_1165189
1660 Ga0436364_1013391
1661 Ga0395901_0001294
1662 Ga0395901_0125281
1663 Ga0395901_0338284
1664 Ga0395901_0615709
1665 Ga0395901_0810671
1666 Ga0436362_0544766
1667 Ga0451798_0255311
1668 Ga0451853_0364943
1669 Ga0451853_3265935
1670 Ga0439455_0014472
1671 Ga0439458_0011354
1672 Ga0439458_0060117
1673 Ga0439460_0051433
1674 Ga0439440_0016520
1675 Ga0439440_0129557
1676 Ga0466964_0010200
1677 Ga0451576_0437515
1678 Ga0466967_0810295
1679 Ga0495592_0003666
1680 Ga0495592_0071957
1681 Ga0495603_0136944
1682 Ga0495629_0069394
1683 Ga0495629_0292997
1684 Ga0495651_0002481
1685 Ga0495651_0165100
1686 Ga0495653_0188674
1687 Ga0495580_0085689
1688 Ga0495605_0077750
1689 Ga0495639_0051774
1690 Ga0495662_0109566
1691 Ga0495664_0023225
1692 Ga0495584_0167766
1693 Ga0495584_0232173
1694 Ga0495618_0152914
1695 Ga0495620_0157899
1696 Ga0495630_0379348
1697 Ga0495632_0330158
1698 Ga0495637_0136817
1699 Ga0495644_0105876
1700 Ga0495663_0017731
1701 Ga0495663_0141507
1702 Ga0495666_0054427
1703 Ga0495642_0032571
1704 Ga0495652_0062611
1705 Ga0495652_0185848
1706 Ga0495654_0126738
1707 Ga0495665_0158596
1708 Ga0495640_0079005
1709 Ga0495586_0041598
1710 Ga0495587_0031563
1711 Ga0495598_0002133
1712 Ga0495609_0249334
1713 Ga0495621_0098493
1714 Ga0495622_0163821
1715 Ga0495633_0108727
1716 Ga0495656_0236029
1717 Ga0495634_0099295
1718 Ga0495635_0343956
1719 Ga0495635_0372444
1720 Ga0495659_0007430
1721 Ga0495588_0246193
1722 Ga0495657_0622887
1723 Ga0495599_0002602
1724 Ga0495623_0008117
1725 Ga0495646_0156660
1726 Ga0495658_0093823
1727 Ga0495669_0012538
1728 Ga0495669_0022893
1729 Ga0495669_0082058
1730 Ga0495613_0086089
1731 Ga0495649_0307248
1732 Ga0495600_0217469
1733 Ga0495581_0143850
1734 Ga0495674_0036636
1735 Ga0495676_0101757
1736 Ga0495675_0072265
1737 Ga0495684_0024374
1738 Ga0495602_0085166
1739 Ga0495614_0007991
1740 Ga0496100_0014612
1741 Ga0496100_0311080
1742 Ga0496101_0020470
1743 Ga0496101_0073871
1744 Ga0496101_0285318
1745 Ga0496101_0321082
1746 Ga0496101_0701515
1747 Ga0496102_0057850
1748 Ga0496102_0078808
1749 Ga0496102_0153527
1750 Ga0496102_0279302
1751 Ga0496102_0434581
1752 Ga0496103_0016279
1753 Ga0496103_0046493
1754 Ga0496103_0312960
1755 Ga0496104_0040248
1756 Ga0496104_0051870
1757 Ga0496104_0063642
1758 Ga0496104_0094169
1759 Ga0496104_0171742
1760 Ga0496104_0525184
1761 Ga0496105_0038887
1762 Ga0496105_0322645
1763 Ga0496105_0336194
1764 Ga0496105_0438172
1765 Ga0496106_0025001
1766 Ga0496106_0077084
1767 Ga0496106_0248457
1768 Ga0496106_0342812
1769 Ga0496107_0026842
1770 Ga0496107_0067383
1771 Ga0496107_0119523
1772 Ga0496107_0409308
1773 Ga0496108_0052612
1774 Ga0496108_0063381
1775 Ga0496108_0130017
1776 Ga0496108_0432648
1777 Ga0496108_0760276
1778 Ga0496108_0931755
1779 Ga0496109_0027830
1780 Ga0496109_0042205
1781 Ga0496109_0093658
1782 Ga0496109_0164122
1783 Ga0496109_0222184
1784 Ga0496109_0446505
1785 Ga0496109_0491271
1786 Ga0496110_0065445
1787 Ga0496110_0393781
1788 Ga0496110_0555896
1789 Ga0496110_0911827
1790 Ga0496111_0086614
1791 Ga0496112_0001874
1792 Ga0496112_0040797
1793 Ga0496112_0094453
1794 Ga0496112_0163709
1795 Ga0496112_0236983
1796 Ga0496112_0483833
1797 Ga0496112_0950785
1798 Ga0496113_0055035
1799 Ga0496113_0085381
1800 Ga0496113_0300205
1801 Ga0496113_0554671
1802 Ga0496114_0005274
1803 Ga0496114_0107274
1804 Ga0496114_0278962
1805 Ga0496115_0004373
1806 Ga0496115_0004459
1807 Ga0496115_0007639
1808 Ga0496115_0017107
1809 Ga0496115_0103021
1810 nmdc:mga05p37_190551_c1
1811 nmdc:mga05p37_27192_c1
1812 nmdc:mga05p37_679881_c1
1813 nmdc:mga08y16_26106_c3
1814 nmdc:mga08y16_312471_c1
1815 nmdc:mga08y16_330091_c1
1816 nmdc:mga0n895_169751_c1
1817 nmdc:mga0n895_198730_c1
1818 nmdc:mga0n895_223870_c1
1819 nmdc:mga0n895_504204_c1
1820 nmdc:mga0rr50_884094_c1
1821 nmdc:mga08x19_335824_c1
1822 nmdc:mga08x19_341484_c1
1823 nmdc:mga08x19_50281_c1
1824 nmdc:mga0a205_234102_c1
1825 Ga0495601_0036340
1826 Ga0495655_0056658
1827 Ga0495595_0146473
1828 Ga0495619_0386021

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.7037 4 169
4rfs-assembly1.cif.gz_S structure of a pantothenate energy coupling factor transporter 0.6553 4 169
3p5n-assembly1.cif.gz_B structure and mechanism of the s component of a bacterial ecf transporter 0.5858 2 169
6zg3-assembly2.cif.gz_C the structure of ecf pant transporter in a complex with a nanobody 0.566 2 166
5kc4-assembly1.cif.gz_A structure of tmribu, orthorhombic crystal form 0.56 6 164
ID Description Score Start End Superfamily
4rfsS00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7037 4 169 1.10.1760.20
af_P0AA93_45_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6943 3 169 1.10.1760.20
af_P0ABH4_4_155_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6818 8 163 1.10.1760.20
af_Q2FZ00_2_162_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6683 1 170 1.10.1760.20
af_P0AA93_45_200_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6652 3 169 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A7V9V419-F1-model_v4 Rod shape-determining protein MreD 0.9587 1 179 GO:0016020
AF-A0A7V9V419-F1-model_v4 Rod shape-determining protein MreD 0.9535 1 179 GO:0016020
AF-A0A2W5ZLD3-F1-model_v4 Rod shape-determining protein MreD 0.9516 1 180 GO:0016020
AF-A0A2W5ZLD3-F1-model_v4 Rod shape-determining protein MreD 0.9464 1 180 GO:0016020
AF-A0A2V6FSM6-F1-model_v4 Rod shape-determining protein MreD 0.9408 1 129 GO:0016020

Map