F485487

General Info

Members Datasets Scaffolds Average Seq Length
911 759 394 304

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237084|2513569939
Length 344
Sequence KVLERPYRVLLDAGRSKSGAPALLPTRCESRTMANISVPSITTVARPAKRAANSKSSVAHDRLAVLLIFLPPALLLFTLFVIMPMGEAAWYSLYKWNGYGTPTEFIALRNFQVLFRNAAFTQALVNNGLIIVISICIQVPLAIWLATMLAHRIPGVVGYRLIFFLPYVLADVAAGLIWRFVYDGDYGLFAAVSNFFGFANPYVLADKDVAIYAVLGVIVWKYFGFHMMLFIAGLQSVDKSVLEAAEIDGATGWQKFRYVTLPLLGSTLRLSIFFAVVGSLQLFDMIMPLTGGGPSNSTQTMVTFLYTYGVMRMQVGLGSAVGVVLFIICVTLAFGYKRIFMRHD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
30 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
31 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
32 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
33 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
34 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
35 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
36 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
37 2516143018 Ensifer sp. BR816 Isolate Nodule
38 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
39 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
40 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
41 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
42 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
43 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
44 2519899620 Rhizobium sp. Pop5 Isolate Nodule
45 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
46 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
47 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
48 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
49 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
50 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
51 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
52 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
53 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
54 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
55 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
56 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
57 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
58 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
59 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
62 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
63 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
64 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
65 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
66 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
67 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
68 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
69 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
70 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
71 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
72 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
73 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
74 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
75 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
76 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
77 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
78 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
79 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
80 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
81 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
82 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
83 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
84 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
85 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
86 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
87 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
88 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
89 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
90 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
91 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
92 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
93 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
94 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
95 2643221568 Rhizobium sp. Root564 Isolate Unclassified
96 2643221582 Rhizobium sp. Root651 Isolate Unclassified
97 2643221599 Rhizobium sp. Root708 Isolate Unclassified
98 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
99 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
100 2643221688 Rhizobium sp. Root482 Isolate Unclassified
101 2643221693 Rhizobium sp. Root491 Isolate Unclassified
102 2643221736 Bosea sp. Root483D1 Isolate Unclassified
103 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
104 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
105 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
106 2718217882 Rhizobium sp. N741 Isolate Nodule
107 2718217927 Rhizobium sp. N324 Isolate Nodule
108 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
109 2718218009 Rhizobium sp. N561 Isolate Nodule
110 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
111 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
112 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
113 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
114 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
115 2718218363 Rhizobium sp. N113 Isolate Nodule
116 2718218365 Rhizobium sp. N731 Isolate Nodule
117 2718218366 Rhizobium sp. N621 Isolate Nodule
118 2718218423 Rhizobium sp. N941 Isolate Nodule
119 2721755514 Rhizobium sp. N6212 Isolate Nodule
120 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
121 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
122 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
123 2721755809 Rhizobium sp. N541 Isolate Nodule
124 2721755810 Rhizobium sp. N871 Isolate Nodule
125 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
126 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
127 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
128 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
129 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
130 2728369365 Rhizobium sp. N1341 Isolate Nodule
131 2728369397 Rhizobium sp. N1314 Isolate Nodule
132 2738541293 Rhizobium sp. GV031 Isolate Unclassified
133 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
134 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
135 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
136 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
137 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
138 2791355256 Rhizobium sp. M10 Isolate Nodule
139 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
140 2791355260 Rhizobium sp. L9 Isolate Nodule
141 2791355261 Rhizobium sp. J15 Isolate Nodule
142 2791355262 Rhizobium sp. M1 Isolate Nodule
143 2791355263 Rhizobium chutanense C5 Isolate Nodule
144 2791355264 Rhizobium sp. S9 Isolate Nodule
145 2791355265 Rhizobium sp. H4 Isolate Nodule
146 2791355266 Rhizobium sp. L43 Isolate Nodule
147 2791355267 Rhizobium sp. L18 Isolate Nodule
148 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
149 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
150 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
151 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
152 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
153 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
154 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
155 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
156 2802429633 Rhizobium anhuiense J3 Isolate Nodule
157 2802429634 Rhizobium anhuiense S10 Isolate Nodule
158 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
159 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
160 2802429637 Rhizobium anhuiense C15 Isolate Nodule
161 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
162 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
163 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
164 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
165 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
166 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
167 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
168 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
169 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
170 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
171 2838048938 Rhizobium pisi 27/80 Isolate Nodule
172 2838061910 Rhizobium phaseoli L15 Isolate Nodule
173 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
174 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
175 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
176 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
177 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
178 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
179 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
180 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
181 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
182 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
183 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
184 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
185 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
186 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
187 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
188 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
189 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
190 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
191 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
192 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
193 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
194 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
195 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
196 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
197 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
198 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
199 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
200 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
201 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
202 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
203 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
204 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
205 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
206 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
207 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
208 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
209 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
210 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
211 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
212 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
213 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
214 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
215 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
216 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
217 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
218 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
219 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
220 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
221 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
222 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
223 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
224 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
225 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
226 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
227 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
228 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
229 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
230 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
231 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
232 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
233 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
234 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
235 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
236 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
237 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
238 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
239 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
240 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
241 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
242 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
243 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
244 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
245 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
246 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
247 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
248 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
249 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
250 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
251 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
252 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
253 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
254 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
255 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
256 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
257 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
258 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
259 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
260 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
261 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
262 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
263 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
264 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
265 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
266 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
267 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
268 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
269 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
270 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
271 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
272 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
273 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
274 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
275 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
276 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
277 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
278 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
279 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
280 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
281 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
282 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
283 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
284 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
285 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
286 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
287 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
288 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
289 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
290 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
291 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
292 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
293 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
294 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
295 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
296 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
297 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
298 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
299 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
300 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
301 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
302 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
303 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
304 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
305 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
306 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
307 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
308 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
309 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
310 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
311 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
312 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
313 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
314 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
315 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
316 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
317 2933599457 Rhizobium phaseoli M3 Isolate Nodule
318 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
319 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
320 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
321 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
322 2936381700 Rhizobium chutanense C16 Isolate Unclassified
323 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
324 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
325 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
326 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
327 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
328 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
329 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
330 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
331 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
332 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
333 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
334 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
335 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
336 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
337 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
338 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
339 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
340 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
341 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
342 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
343 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
344 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
345 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
346 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
347 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
348 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
349 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
350 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
351 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
352 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
353 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
354 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
355 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
356 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
357 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
358 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
359 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
360 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
361 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
362 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
363 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
364 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
365 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
366 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
367 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
368 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
369 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
370 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
371 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
372 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
373 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
374 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
375 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
376 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
377 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
378 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
379 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
380 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
381 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
382 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
383 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
384 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
385 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
386 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
387 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
388 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
389 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
390 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
391 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
392 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
393 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
394 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
395 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
396 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
397 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
398 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
399 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
400 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
401 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
402 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
403 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
404 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
405 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
406 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
407 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
408 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
409 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
410 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
411 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
412 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
413 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
414 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
415 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
416 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
417 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
418 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
419 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
420 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
421 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
422 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
423 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
424 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
425 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
426 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
427 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
428 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
429 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
430 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
431 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
432 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
433 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
434 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
435 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
436 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
437 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
438 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
439 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
440 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
441 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
442 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
443 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
444 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
445 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
446 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
447 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
448 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
449 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
450 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
451 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
452 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
453 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
454 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
455 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
456 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
457 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
458 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
459 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
460 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
461 2996887358 Rhizobium sp. R711 Isolate Nodule
462 2996893221 Rhizobium sp. R635 Isolate Nodule
463 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
464 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
465 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
466 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
467 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
468 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
469 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
470 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
471 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
472 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
473 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
474 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
475 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
476 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
477 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
478 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
479 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
480 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
481 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
482 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
483 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
484 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
485 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
486 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
487 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
488 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
489 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
490 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
491 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
492 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
493 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
494 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
495 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
496 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
497 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
498 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
499 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
500 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
501 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
502 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
503 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
504 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
505 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
506 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
507 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
508 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
509 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
510 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
511 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
512 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
513 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
514 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
515 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
516 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
517 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
518 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
519 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
520 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
521 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
522 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
523 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
524 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
525 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
526 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
527 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
528 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
529 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
530 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
531 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
532 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
533 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
534 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
535 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
536 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
537 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
538 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
539 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
540 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
541 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
542 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
543 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
544 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
545 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
546 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
547 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
548 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
549 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
550 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
551 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
552 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
553 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
554 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
555 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
556 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
557 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
558 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
559 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
560 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
561 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
562 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
563 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
564 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
565 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
566 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
567 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
568 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
569 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
570 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
571 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
572 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
573 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
574 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
575 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
576 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
577 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
578 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
579 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
580 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
581 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
582 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
583 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
584 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
585 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
586 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
587 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
588 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
589 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
590 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
591 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
592 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
593 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
594 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
595 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
596 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
597 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
598 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
599 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
600 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
601 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
602 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
603 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
604 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
605 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
606 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
607 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
608 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
609 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
610 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
611 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
612 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
613 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
614 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
615 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
616 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
617 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
618 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
619 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
620 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
621 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
622 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
623 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
624 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
625 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
626 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
627 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
628 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
629 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
630 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
631 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
632 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
633 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
634 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
635 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
636 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
637 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
638 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
639 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
640 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
641 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
642 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
643 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
644 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
645 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
646 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
647 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
648 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
649 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
650 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
651 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
652 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
653 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
654 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
655 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
656 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
657 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
658 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
659 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
660 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
661 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
662 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
663 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
664 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
665 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
666 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
667 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
668 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
669 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
670 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
671 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
672 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
673 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
674 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
675 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
676 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
677 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
678 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
679 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
680 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
681 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
682 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
683 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
684 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
685 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
686 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
687 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
688 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
690 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
691 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
692 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
693 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
694 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
695 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
696 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
697 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
698 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
699 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
700 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
701 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
702 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
703 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
704 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
705 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
706 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
707 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
708 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
709 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
712 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
713 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
714 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
715 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
716 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
717 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
718 8005258706 Rhizobium sp. R693 Isolate Nodule
719 8005275841 Rhizobium sp. N4311 Isolate Nodule
720 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
721 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
722 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
723 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
724 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
725 8005321885 Rhizobium sp. R72 Isolate Nodule
726 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
727 8005382845 Rhizobium sp. R634 Isolate Nodule
728 8005395548 Rhizobium sp. R339 Isolate Nodule
729 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
730 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
731 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
732 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
733 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
734 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
735 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
736 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
737 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
738 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
739 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
740 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
741 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
742 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
743 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
744 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
745 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
746 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
747 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
748 8018176218 Rhizobium sp. N122 Isolate Nodule
749 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
750 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
751 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
752 8024501048 Rhizobium sp. H4 Isolate Nodule
753 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
754 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
755 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
756 8056382006 Rhizobium croatiense 13T Isolate Nodule
757 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule
758 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
759 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.14
Metatranscriptomes 0.22
Isolates 56.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.55
Bulb 0
Endosphere 14.6
Nodule 44.9
Rhizoplane 1.76
Rhizosphere 25.58
Stem 0
Stem Tuber 0
Unclassified 12.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000274 3300001979 Bacteria 21830
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1000930 3300002737 Bacteria 18809
6 JGI25154J39366_1000026 3300002738 Bacteria 200613
7 JGI25158J39367_1000140 3300002739 Bacteria 16957
8 JGI25157J39369_1000005 3300002741 Bacteria 269089
9 JGI25152J39213_1002440 3300002773 Bacteria 7071
10 JGI25152J39213_1002693 3300002773 Bacteria 6516
11 JGI25150J39212_1006970 3300002774 Bacteria 2298
12 JGI25159J45721_1000260 3300002987 Bacteria 24641
13 JGI25159J45721_1001000 3300002987 Bacteria 12200
14 JGI25151J46595_10000238 3300003187 Bacteria 64884
15 JGI25151J46595_10013544 3300003187 Bacteria 3665
16 JGI25151J46595_10028316 3300003187 Bacteria 2233
17 JGI25165J46597_1000715 3300003214 Bacteria 26079
18 JGI25153J46596_10005165 3300003215 Bacteria 6875
19 JGI25153J46596_10009689 3300003215 Bacteria 4437
20 rootH1_10050195 3300003316 Bacteria 2603
21 JGI25160J50197_1000022 3300003354 Bacteria 201071
22 JGI25160J50197_1006405 3300003354 Bacteria 4768
23 JGI25160J50197_1013391 3300003354 Bacteria 2797
24 JGI25161J50226_1000024 3300003374 Bacteria 152176
25 JGI25161J50226_1000050 3300003374 Bacteria 110628
26 JGI25161J50226_1004866 3300003374 Bacteria 2734
27 Ga0055526_1001371 3300003771 Bacteria 17456
28 Ga0055526_1002463 3300003771 Bacteria 12518
29 Ga0055526_1022297 3300003771 Bacteria 2159
30 Ga0055524_1000880 3300003775 Bacteria 19576
31 Ga0055524_1005903 3300003775 Bacteria 5394
32 Ga0055524_1014378 3300003775 Bacteria 2934
33 Ga0055528_1000106 3300003790 Bacteria 67208
34 Ga0055528_1001160 3300003790 Bacteria 17054
35 Ga0055528_1002460 3300003790 Bacteria 9911
36 Ga0055528_1020224 3300003790 Bacteria 2168
37 Ga0055540_1000103 3300003792 Bacteria 94710
38 Ga0055540_1001450 3300003792 Bacteria 14122
39 Ga0055540_1005697 3300003792 Bacteria 5148
40 Ga0055540_1015308 3300003792 Bacteria 2240
41 Ga0055531_10002344 3300003794 Bacteria 12752
42 Ga0055543_1000023 3300004625 Bacteria 140513
43 Ga0055543_1000025 3300004625 Bacteria 137886
44 Ga0055543_1001443 3300004625 Bacteria 9431
45 Ga0065165_1000200 3300005262 Bacteria 103564
46 Ga0065165_1010583 3300005262 Bacteria 3962
47 Ga0065165_1015319 3300005262 Bacteria 2928
48 Ga0065165_1016842 3300005262 Bacteria 2717
49 Ga0065704_10099334 3300005289 Bacteria 2316
50 Ga0065707_10086155 3300005295 Bacteria 5629
51 Ga0068869_100139575 3300005334 Bacteria 1870
52 Ga0070682_100278482 3300005337 Bacteria 1218
53 Ga0070660_100334670 3300005339 Bacteria 1245
54 Ga0070669_100085057 3300005353 Bacteria 2361
55 Ga0070674_100064095 3300005356 Bacteria 2574
56 Ga0070714_100375601 3300005435 Bacteria 1339
57 Ga0070700_100018816 3300005441 Bacteria 3977
58 Ga0070708_100010723 3300005445 Bacteria 7437
59 Ga0070678_100010927 3300005456 Bacteria 5572
60 Ga0070678_100515330 3300005456 Bacteria 1057
61 Ga0070678_100571440 3300005456 Bacteria 1006
62 Ga0068867_100005603 3300005459 Bacteria 8896
63 Ga0070706_100173652 3300005467 Bacteria 2012
64 Ga0070706_100385952 3300005467 Unclassified 1304
65 Ga0070707_100053165 3300005468 Unclassified 3883
66 Ga0070698_100000683 3300005471 Bacteria 36267
67 Ga0070699_100010118 3300005518 Bacteria 8166
68 Ga0070697_100023899 3300005536 Bacteria 4863
69 Ga0070697_100036048 3300005536 Bacteria 3994
70 Ga0068853_100002653 3300005539 Bacteria 13491
71 Ga0070672_100003609 3300005543 Bacteria 10033
72 Ga0070672_100205484 3300005543 Bacteria 1648
73 Ga0070665_100041738 3300005548 Bacteria 4612
74 Ga0070665_100106324 3300005548 Bacteria 2808
75 Ga0070665_100312963 3300005548 Bacteria 1574
76 Ga0070664_100323372 3300005564 Bacteria 1398
77 Ga0068859_100112421 3300005617 Bacteria 2787
78 Ga0068863_100068199 3300005841 Bacteria 3365
79 Ga0068858_100196888 3300005842 Bacteria 1904
80 Ga0068860_100007737 3300005843 Bacteria 10738
81 Ga0068860_100104396 3300005843 Bacteria 2705
82 Ga0068862_100015023 3300005844 Bacteria 6430
83 Ga0081455_10063610 3300005937 Bacteria 3095
84 Ga0081455_10358414 3300005937 Bacteria 1026
85 Ga0070717_10008768 3300006028 Bacteria 7570
86 Ga0070717_10100395 3300006028 Unclassified 2457
87 Ga0075365_10011384 3300006038 Bacteria 5229
88 Ga0075365_10084238 3300006038 Bacteria 2157
89 Ga0075368_10006397 3300006042 Bacteria 4111
90 Ga0075368_10041422 3300006042 Bacteria 1809
91 Ga0075368_10046801 3300006042 Bacteria 1712
92 Ga0075363_100058622 3300006048 Bacteria 2068
93 Ga0075363_100111375 3300006048 Bacteria 1522
94 Ga0075364_10006628 3300006051 Bacteria 6821
95 Ga0075364_10112000 3300006051 Bacteria 1822
96 Ga0070712_100167100 3300006175 Bacteria 1704
97 Ga0075362_10002240 3300006177 Bacteria 6436
98 Ga0075362_10008554 3300006177 Bacteria 3920
99 Ga0075367_10010707 3300006178 Bacteria 4828
100 Ga0075369_10013141 3300006186 Bacteria 3279
101 Ga0075366_10019997 3300006195 Bacteria 3881
102 Ga0075370_10004585 3300006353 Bacteria 6736
103 Ga0068865_100017435 3300006881 Bacteria 4617
104 Ga0097620_100112427 3300006931 Bacteria 2787
105 Ga0097620_100137443 3300006931 Bacteria 2517
106 Ga0099826_10001105 3300006948 Bacteria 15404
107 Ga0105240_10397442 3300009093 Bacteria 1553
108 Ga0105243_10003302 3300009148 Bacteria 13098
109 Ga0105243_10231545 3300009148 Bacteria 1639
110 Ga0105241_10152911 3300009174 Bacteria 1889
111 Ga0105237_10000188 3300009545 Bacteria 87497
112 Ga0105237_10699753 3300009545 Bacteria 1020
113 Ga0105249_10132075 3300009553 Bacteria 2385
114 Ga0105249_10435134 3300009553 Bacteria 1348
115 Ga0123341_1000095 3300009765 Bacteria 37499
116 Ga0123342_1014091 3300009766 Bacteria 7761
117 Ga0105239_10010200 3300010375 Bacteria 10524
118 Ga0157373_10001757 3300013100 Bacteria 16491
119 Ga0157373_10094929 3300013100 Bacteria 2099
120 Ga0157373_10247589 3300013100 Bacteria 1260
121 Ga0157371_10000002 3300013102 Bacteria 665040
122 Ga0157370_10000211 3300013104 Bacteria 74012
123 Ga0157369_10011908 3300013105 Bacteria 9878
124 Ga0157369_10079367 3300013105 Bacteria 3515
125 Ga0157378_10247293 3300013297 Bacteria 1706
126 Ga0157378_10380163 3300013297 Bacteria 1387
127 Ga0163162_10009513 3300013306 Bacteria 9453
128 Ga0163162_10190716 3300013306 Bacteria 2177
129 Ga0157375_10013667 3300013308 Bacteria 7237
130 Ga0157380_10017418 3300014326 Bacteria 5316
131 Ga0182008_10003079 3300014497 Bacteria 10241
132 Ga0157379_10024269 3300014968 Bacteria 5383
133 Ga0157376_10339119 3300014969 Bacteria 1435
134 Ga0182007_10001612 3300015262 Bacteria 11981
135 Ga0182005_1005419 3300015265 Bacteria 3988
136 Ga0183362_10002 3300015683 Bacteria 1432711
137 Ga0163161_10059617 3300017792 Bacteria 2776
138 Ga0209435_100009 3300025206 Bacteria 476614
139 Ga0209436_100053 3300025208 Bacteria 63474
140 Ga0209436_118015 3300025208 Bacteria 1016
141 Ga0209437_100057 3300025233 Bacteria 362922
142 Ga0207425_1001821 3300025245 Bacteria 8251
143 Ga0209646_1000018 3300025246 Bacteria 476716
144 Ga0209026_1000043 3300025250 Bacteria 269142
145 Ga0209759_1000007 3300025256 Bacteria 476614
146 Ga0209129_1000016 3300025258 Bacteria 485491
147 Ga0209129_1013604 3300025258 Bacteria 1781
148 Ga0209233_1000130 3300025261 Bacteria 205687
149 Ga0209455_1006859 3300025272 Bacteria 3309
150 Ga0209673_1000005 3300025273 Bacteria 692788
151 Ga0209673_1000139 3300025273 Bacteria 157765
152 Ga0209673_1002223 3300025273 Bacteria 14103
153 Ga0209673_1004169 3300025273 Bacteria 7904
154 Ga0209130_1000031 3300025284 Bacteria 322932
155 Ga0209130_1000251 3300025284 Bacteria 67741
156 Ga0209130_1004762 3300025284 Bacteria 5015
157 Ga0209676_1017732 3300025292 Bacteria 2508
158 Ga0209025_1000126 3300025294 Bacteria 200866
159 Ga0209025_1000237 3300025294 Bacteria 128553
160 Ga0209025_1002704 3300025294 Bacteria 18049
161 Ga0209025_1002712 3300025294 Bacteria 17992
162 Ga0209564_1000331 3300025295 Bacteria 91919
163 Ga0209564_1000577 3300025295 Bacteria 58129
164 Ga0209564_1002036 3300025295 Bacteria 17487
165 Ga0209564_1003502 3300025295 Bacteria 10647
166 Ga0209758_1000903 3300025297 Bacteria 40307
167 Ga0209758_1000931 3300025297 Bacteria 39600
168 Ga0209758_1001250 3300025297 Bacteria 31516
169 Ga0209758_1001440 3300025297 Bacteria 28025
170 Ga0209758_1003844 3300025297 Bacteria 13177
171 Ga0209050_1004134 3300025298 Bacteria 10072
172 Ga0209256_1000299 3300025299 Bacteria 86909
173 Ga0209256_1000961 3300025299 Bacteria 34812
174 Ga0209256_1011278 3300025299 Bacteria 3599
175 Ga0209256_1015383 3300025299 Bacteria 2681
176 Ga0207426_1000042 3300025302 Bacteria 433289
177 Ga0207426_1000082 3300025302 Bacteria 298939
178 Ga0207426_1000290 3300025302 Bacteria 99519
179 Ga0209051_1000095 3300025303 Bacteria 167840
180 Ga0209051_1000950 3300025303 Bacteria 28418
181 Ga0209051_1001462 3300025303 Bacteria 20029
182 Ga0209051_1030477 3300025303 Bacteria 2092
183 Ga0209051_1071002 3300025303 Bacteria 1048
184 Ga0209257_1001831 3300025304 Bacteria 23241
185 Ga0209257_1011109 3300025304 Bacteria 4401
186 Ga0209257_1016144 3300025304 Bacteria 3045
187 Ga0209257_1034763 3300025304 Bacteria 1567
188 Ga0207682_10104749 3300025893 Bacteria 1240
189 Ga0207642_10047277 3300025899 Bacteria 1923
190 Ga0207647_10044578 3300025904 Bacteria 2770
191 Ga0207684_10117644 3300025910 Bacteria 2277
192 Ga0207646_10033232 3300025922 Unclassified 4667
193 Ga0207694_10136647 3300025924 Bacteria 1969
194 Ga0207709_10035969 3300025935 Bacteria 2932
195 Ga0207704_10011032 3300025938 Bacteria 4433
196 Ga0207691_10021819 3300025940 Bacteria 6044
197 Ga0207691_10076699 3300025940 Bacteria 3012
198 Ga0207689_10080788 3300025942 Bacteria 2672
199 Ga0207679_10221969 3300025945 Bacteria 1590
200 Ga0207668_10516602 3300025972 Bacteria 1030
201 Ga0207639_10020434 3300026041 Bacteria 4740
202 Ga0207639_10065746 3300026041 Bacteria 2816
203 Ga0207678_10213137 3300026067 Bacteria 1652
204 Ga0207708_10031924 3300026075 Bacteria 4000
205 Ga0207648_10004328 3300026089 Bacteria 14625
206 Ga0207675_100001137 3300026118 Bacteria 26351
207 Ga0207675_100140317 3300026118 Bacteria 2295
208 Ga0207683_10010219 3300026121 Bacteria 8006
209 Ga0207683_10133634 3300026121 Bacteria 2232
210 Ga0207683_10207260 3300026121 Bacteria 1783
211 Ga0209371_1000012 3300027312 Bacteria 748304
212 Ga0209371_1001153 3300027312 Bacteria 19333
213 Ga0209371_1008000 3300027312 Bacteria 3580
214 Ga0209813_10002465 3300027866 Bacteria 4236
215 Ga0209813_10013890 3300027866 Bacteria 2158
216 Ga0209813_10020257 3300027866 Bacteria 1859
217 Ga0268266_10000728 3300028379 Bacteria 44205
218 Ga0268266_10069055 3300028379 Bacteria 3061
219 Ga0268265_10002980 3300028380 Bacteria 12384
220 Ga0268265_10016306 3300028380 Bacteria 5100
221 Ga0268264_10002471 3300028381 Bacteria 16246
222 Ga0268264_10385782 3300028381 Bacteria 1342
223 Ga0307515_10029370 3300028794 Bacteria 9295
224 Ga0268256_1000013 3300030500 Bacteria 752103
225 Ga0268256_1001230 3300030500 Bacteria 16198
226 Ga0307513_10021053 3300031456 Bacteria 7708
227 Ga0307516_10033201 3300031730 Bacteria 5193
228 Ga0307405_10086071 3300031731 Bacteria 2068
229 Ga0307412_10215704 3300031911 Bacteria 1468
230 Ga0307409_100225484 3300031995 Bacteria 1695
231 Ga0307415_100227527 3300032126 Bacteria 1499
232 Ga0373923_0014931 3300035111 Bacteria 2925
233 Ga0373946_0040860 3300035171 Bacteria 1900
234 Ga0373935_0083954 3300035692 Bacteria 2074
235 Ga0373927_0183007 3300035695 Bacteria 1375
236 Ga0373933_0143145 3300035724 Bacteria 1510
237 Ga0373937_0024706 3300036401 Bacteria 5422
238 Ga0395900_0592471 3300037418 Bacteria 1050
239 Ga0395898_0192241 3300037466 Bacteria 1950
240 Ga0395898_0232159 3300037466 Bacteria 1759
241 Ga0395905_0011131 3300037471 Bacteria 8701
242 Ga0237819_10937 3300038705 Bacteria 1168
243 Ga0436360_0181196 3300039438 Bacteria 3942
244 Ga0436360_0631865 3300039438 Bacteria 2828
245 Ga0436363_0080435 3300039450 Bacteria 16873
246 Ga0451791_0306668 3300041451 Bacteria 1236
247 Ga0451798_1010442 3300041458 Bacteria 1356
248 Ga0451804_1133873 3300041463 Bacteria 1626
249 Ga0451833_0067109 3300041491 Bacteria 2290
250 Ga0451839_0001838 3300041496 Bacteria 2040
251 Ga0451847_0304978 3300041503 Bacteria 2085
252 Ga0451843_0634892 3300041509 Bacteria 1941
253 Ga0451853_0324505 3300041512 Bacteria 1715
254 Ga0439449_0043230 3300042007 Bacteria 1673
255 Ga0466960_0039614 3300044901 Bacteria 2224
256 Ga0495592_0107470 3300046454 Bacteria 1979
257 Ga0495605_0075507 3300046474 Bacteria 1585
258 Ga0495664_0075500 3300046477 Bacteria 2017
259 Ga0495664_0105165 3300046477 Bacteria 1702
260 Ga0495664_0106357 3300046477 Bacteria 1692
261 Ga0495585_0012907 3300046492 Bacteria 4910
262 Ga0495583_0008439 3300046506 Bacteria 6294
263 Ga0495606_0008440 3300046507 Bacteria 8948
264 Ga0495610_0091406 3300046512 Bacteria 1379
265 Ga0495620_0038765 3300046515 Bacteria 2112
266 Ga0495643_0005020 3300046522 Bacteria 9066
267 Ga0495643_0014621 3300046522 Bacteria 4664
268 Ga0495648_0022370 3300046524 Bacteria 4354
269 Ga0495640_0062394 3300046533 Bacteria 2528
270 Ga0495587_0132874 3300046536 Bacteria 1422
271 Ga0495633_0022066 3300046558 Bacteria 3173
272 Ga0495633_0026340 3300046558 Bacteria 2854
273 Ga0495625_0130252 3300046660 Bacteria 1704
274 Ga0495588_0001204 3300046674 Bacteria 11140
275 Ga0495657_0138142 3300046675 Bacteria 1521
276 Ga0495599_0052832 3300046678 Bacteria 2546
277 Ga0495599_0311899 3300046678 Bacteria 948
278 Ga0495658_0132694 3300046683 Bacteria 1517
279 Ga0495670_0051364 3300046691 Bacteria 2063
280 Ga0495671_0139570 3300046692 Bacteria 1181
281 Ga0495649_0018570 3300046694 Bacteria 3911
282 Ga0495600_0121462 3300046809 Bacteria 1699
283 Ga0495660_0078075 3300046810 Bacteria 1741
284 Ga0495674_0272488 3300047319 Bacteria 1388
285 Ga0495683_0107685 3300047323 Bacteria 1334
286 Ga0495681_0001104 3300047470 Bacteria 20492
287 Ga0495686_0067976 3300047472 Bacteria 2199
288 Ga0495615_0008259 3300048090 Bacteria 2007
289 Ga0496102_0442358 3300048905 Bacteria 1220
290 Ga0496106_0000288 3300048909 Bacteria 35636
291 Ga0496106_0188584 3300048909 Bacteria 1639
292 Ga0496109_0161522 3300048912 Bacteria 2099
293 Ga0496110_0013366 3300048913 Bacteria 6783
294 Ga0496111_0107242 3300048914 Bacteria 2056
295 Ga0496113_0027381 3300048916 Bacteria 4087
296 Ga0496116_0000042 3300048919 Bacteria 330516
297 Ga0496116_0012229 3300048919 Bacteria 7021
298 Ga0496116_0024746 3300048919 Bacteria 4431
299 Ga0496117_0000016 3300048920 Bacteria 523642
300 Ga0496117_0139850 3300048920 Bacteria 1452
301 Ga0496118_0001168 3300048921 Bacteria 40490
302 Ga0496118_0011735 3300048921 Bacteria 8516
303 Ga0496118_0112514 3300048921 Bacteria 1802
304 Ga0496119_0130517 3300048922 Bacteria 1370
305 Ga0496119_0136800 3300048922 Bacteria 1328
306 Ga0496120_0000056 3300048923 Bacteria 180367
307 Ga0496121_0000240 3300048924 Bacteria 117890
308 Ga0496121_0000836 3300048924 Bacteria 55869
309 Ga0496121_0001142 3300048924 Bacteria 46580
310 Ga0496121_0008563 3300048924 Bacteria 11984
311 Ga0496121_0058530 3300048924 Bacteria 3185
312 Ga0496121_0069238 3300048924 Bacteria 2849
313 Ga0496121_0157630 3300048924 Bacteria 1664
314 Ga0496121_0195744 3300048924 Bacteria 1445
315 Ga0496121_0281548 3300048924 Bacteria 1137
316 Ga0496122_0000002 3300048925 Bacteria 905834
317 Ga0496122_0177009 3300048925 Bacteria 1277
318 Ga0496122_0254149 3300048925 Bacteria 980
319 Ga0496123_0000002 3300048926 Bacteria 1811682
320 Ga0496123_0106524 3300048926 Bacteria 1615
321 Ga0496123_0114618 3300048926 Bacteria 1532
322 Ga0496123_0125841 3300048926 Bacteria 1431
323 Ga0496124_0000080 3300048927 Bacteria 210439
324 Ga0496124_0045753 3300048927 Bacteria 3751
325 Ga0496124_0049873 3300048927 Bacteria 3568
326 Ga0496124_0068294 3300048927 Bacteria 2955
327 Ga0496124_0164243 3300048927 Bacteria 1727
328 Ga0496125_0000129 3300048928 Bacteria 163342
329 Ga0496125_0049912 3300048928 Bacteria 3470
330 Ga0496126_0000053 3300048929 Bacteria 311989
331 Ga0496126_0031713 3300048929 Bacteria 4987
332 Ga0496126_0031811 3300048929 Bacteria 4979
333 Ga0496126_0165266 3300048929 Bacteria 1889
334 Ga0501032_0014474 3300049569 Bacteria 5586
335 Ga0501032_0122718 3300049569 Bacteria 1717
336 Ga0501033_0032940 3300049570 Bacteria 3891
337 Ga0501034_0013702 3300049571 Bacteria 8338
338 Ga0501034_0027677 3300049571 Bacteria 5764
339 Ga0501034_0174705 3300049571 Bacteria 2115
340 Ga0501034_0187026 3300049571 Bacteria 2034
341 Ga0501034_0200903 3300049571 Bacteria 1951
342 Ga0501034_0323614 3300049571 Bacteria 1474
343 Ga0501036_0029613 3300049572 Bacteria 4624
344 Ga0501037_0016479 3300049573 Bacteria 5439
345 Ga0501037_0084737 3300049573 Bacteria 2295
346 Ga0501038_0021565 3300049574 Bacteria 5781
347 Ga0501038_0046382 3300049574 Bacteria 3768
348 Ga0501039_0033040 3300049575 Bacteria 3991
349 Ga0501043_0027262 3300049579 Bacteria 4486
350 Ga0501046_0181114 3300049580 Bacteria 1576
351 Ga0501046_0181680 3300049580 Bacteria 1572
352 Ga0501047_0083930 3300049581 Bacteria 3062
353 Ga0501047_0232184 3300049581 Bacteria 1698
354 Ga0501068_0249848 3300049584 Bacteria 1130
355 Ga0501070_0027205 3300049586 Bacteria 4797
356 Ga0501070_0032357 3300049586 Bacteria 4376
357 Ga0501073_0111760 3300049589 Bacteria 1895
358 Ga0501073_0134623 3300049589 Bacteria 1713
359 Ga0501238_003101 3300049671 Bacteria 2029
360 Ga0501035_0093121 3300049822 Bacteria 2651
361 Ga0501035_0234377 3300049822 Bacteria 1563
362 Ga0501044_0004981 3300049823 Bacteria 14857
363 Ga0501044_0250692 3300049823 Bacteria 1711
364 nmdc:mga03n38_30649_c1 3300050490 Bacteria 2263
365 nmdc:mga03n38_6063_c1 3300050490 Bacteria 4172
366 nmdc:mga00v17_252_c1 3300050491 Bacteria 31456
367 nmdc:mga00v17_3_c1 3300050491 Bacteria 242367
368 nmdc:mga0yw44_286_c1 3300050492 Bacteria 17382
369 nmdc:mga0k408_45190_c1 3300050493 Bacteria 2541
370 nmdc:mga0k408_54279_c1 3300050493 Bacteria 2323
371 nmdc:mga06z11_60085_c1 3300050494 Bacteria 1978
372 nmdc:mga04h51_21929_c1 3300050495 Bacteria 1926
373 nmdc:mga07m45_264008_c1 3300050496 Bacteria 1002
374 nmdc:mga0sz30_104_c1 3300050516 Bacteria 31594
375 nmdc:mga0sz30_27300_c1 3300050516 Bacteria 1749
376 Ga0500578_0084843 3300053086 Bacteria 2012
377 Ga0500572_002948 3300053111 Bacteria 3989
378 Ga0500618_000204 3300053125 Bacteria 47175
379 Ga0500618_006937 3300053125 Bacteria 3276
380 Ga0500658_0000086 3300053134 Bacteria 43329
381 Ga0500568_0007952 3300053139 Bacteria 5153
382 Ga0500604_0000460 3300053151 Bacteria 11248
383 Ga0500616_0000164 3300053153 Bacteria 110715
384 Ga0500622_0000559 3300053156 Bacteria 34086
385 Ga0500622_0016953 3300053156 Bacteria 3885
386 Ga0500624_000758 3300053157 Bacteria 7765
387 Ga0500634_0000366 3300053161 Bacteria 14376
388 Ga0500634_0002193 3300053161 Bacteria 8119
389 Ga0500634_0010912 3300053161 Bacteria 4659
390 Ga0500636_0000372 3300053177 Bacteria 24612
391 Ga0500636_0000392 3300053177 Bacteria 24127
392 Ga0587067_003653 3300059640 Bacteria 1941
393 Ga0587072_000950 3300059643 Bacteria 3342
394 Ga0501082_0018766 3300060353 Bacteria 5960

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10011908 Ga0157369_100119082 234
2 3300006038 Ga0075365_10084238 Ga0075365_100842382 244
3 3300006948 Ga0099826_10001105 Ga0099826_1000110513 244
4 3300025294 Ga0209025_1002704 Ga0209025_10027045 244
5 3300027312 Ga0209371_1000012 Ga0209371_1000012298 244
6 3300030500 Ga0268256_1000013 Ga0268256_1000013298 244
7 3300059640 Ga0587067_003653 Ga0587067_003653_89_1027 244
8 3300059643 Ga0587072_000950 Ga0587072_000950_1395_2333 244
9 3300046674 Ga0495588_0001204 Ga0495588_0001204_8609_9544 245
10 3300047470 Ga0495681_0001104 Ga0495681_0001104_16138_17073 245
11 3300053157 Ga0500624_000758 Ga0500624_000758_2532_3467 245
12 3300053161 Ga0500634_0002193 Ga0500634_0002193_6892_7827 245
13 3300025904 Ga0207647_10044578 Ga0207647_100445783 246
14 3300027312 Ga0209371_1008000 Ga0209371_10080004 246
15 3300037466 Ga0395898_0232159 Ga0395898_0232159_529_1476 246
16 3300046558 Ga0495633_0026340 Ga0495633_0026340_1270_2205 246
17 3300050516 nmdc:mga0sz30_27300_c1 nmdc:mga0sz30_27300_c1_192_1130 246
18 3300005548 Ga0070665_100041738 Ga0070665_1000417383 247
19 3300006042 Ga0075368_10006397 Ga0075368_100063972 247
20 3300006177 Ga0075362_10002240 Ga0075362_100022406 247
21 3300009148 Ga0105243_10003302 Ga0105243_100033025 247
22 3300013100 Ga0157373_10001757 Ga0157373_1000175711 247
23 3300013102 Ga0157371_10000002 Ga0157371_10000002548 247
24 3300013104 Ga0157370_10000211 Ga0157370_1000021135 247
25 3300025935 Ga0207709_10035969 Ga0207709_100359692 247
26 3300027866 Ga0209813_10020257 Ga0209813_100202572 247
27 3300028379 Ga0268266_10069055 Ga0268266_100690553 247
28 3300048916 Ga0496113_0027381 Ga0496113_0027381_571_1509 247
29 3300048919 Ga0496116_0012229 Ga0496116_0012229_4029_4967 247
30 3300048920 Ga0496117_0000016 Ga0496117_0000016_445632_446570 247
31 3300048921 Ga0496118_0001168 Ga0496118_0001168_35903_36841 247
32 3300048923 Ga0496120_0000056 Ga0496120_0000056_134609_135547 247
33 3300048925 Ga0496122_0000002 Ga0496122_0000002_446293_447231 247
34 3300048926 Ga0496123_0000002 Ga0496123_0000002_1364452_1365390 247
35 3300048926 Ga0496123_0000002 Ga0496123_0000002_446293_447231 247
36 3300048927 Ga0496124_0045753 Ga0496124_0045753_316_1254 247
37 3300050490 nmdc:mga03n38_6063_c1 nmdc:mga03n38_6063_c1_1887_2825 247
38 3300050491 nmdc:mga00v17_3_c1 nmdc:mga00v17_3_c1_226533_227471 247
39 3300050492 nmdc:mga0yw44_286_c1 nmdc:mga0yw44_286_c1_11620_12558 247
40 3300050493 nmdc:mga0k408_54279_c1 nmdc:mga0k408_54279_c1_316_1254 247
41 3300050496 nmdc:mga07m45_264008_c1 nmdc:mga07m45_264008_c1_11_949 247
42 3300050516 nmdc:mga0sz30_104_c1 nmdc:mga0sz30_104_c1_25564_26502 247
43 3300025899 Ga0207642_10047277 Ga0207642_100472772 250
44 3300035695 Ga0373927_0183007 Ga0373927_0183007_340_1227 250
45 3300049572 Ga0501036_0029613 Ga0501036_0029613_3333_4271 250
46 3300049573 Ga0501037_0084737 Ga0501037_0084737_451_1389 250
47 3300049574 Ga0501038_0021565 Ga0501038_0021565_676_1614 250
48 3300049581 Ga0501047_0232184 Ga0501047_0232184_123_1061 250
49 3300049589 Ga0501073_0111760 Ga0501073_0111760_152_1090 250
50 3300013306 Ga0163162_10190716 Ga0163162_101907162 251
51 3300049584 Ga0501068_0249848 Ga0501068_0249848_127_1050 251
52 3300006042 Ga0075368_10041422 Ga0075368_100414222 252
53 3300027866 Ga0209813_10002465 Ga0209813_100024653 252
54 3300038705 Ga0237819_10937 Ga0237819_10937_97_987 252
55 3300048909 Ga0496106_0188584 Ga0496106_0188584_386_1297 252
56 3300050494 nmdc:mga06z11_60085_c1 nmdc:mga06z11_60085_c1_953_1894 252
57 3300005334 Ga0068869_100139575 Ga0068869_1001395752 253
58 3300005356 Ga0070674_100064095 Ga0070674_1000640953 253
59 3300005441 Ga0070700_100018816 Ga0070700_1000188162 253
60 3300005456 Ga0070678_100515330 Ga0070678_1005153301 253
61 3300005459 Ga0068867_100005603 Ga0068867_1000056039 253
62 3300005543 Ga0070672_100003609 Ga0070672_1000036099 253
63 3300005617 Ga0068859_100112421 Ga0068859_1001124213 253
64 3300005843 Ga0068860_100007737 Ga0068860_1000077378 253
65 3300006881 Ga0068865_100017435 Ga0068865_1000174352 253
66 3300006931 Ga0097620_100112427 Ga0097620_1001124273 253
67 3300009553 Ga0105249_10132075 Ga0105249_101320752 253
68 3300013297 Ga0157378_10247293 Ga0157378_102472932 253
69 3300013297 Ga0157378_10380163 Ga0157378_103801632 253
70 3300013306 Ga0163162_10009513 Ga0163162_100095133 253
71 3300013308 Ga0157375_10013667 Ga0157375_100136679 253
72 3300014326 Ga0157380_10017418 Ga0157380_100174185 253
73 3300014969 Ga0157376_10339119 Ga0157376_103391191 253
74 3300025938 Ga0207704_10011032 Ga0207704_100110321 253
75 3300025940 Ga0207691_10021819 Ga0207691_100218195 253
76 3300025942 Ga0207689_10080788 Ga0207689_100807883 253
77 3300026041 Ga0207639_10065746 Ga0207639_100657462 253
78 3300026067 Ga0207678_10213137 Ga0207678_102131372 253
79 3300026075 Ga0207708_10031924 Ga0207708_100319244 253
80 3300026089 Ga0207648_10004328 Ga0207648_1000432810 253
81 3300026118 Ga0207675_100001137 Ga0207675_1000011376 253
82 3300026121 Ga0207683_10133634 Ga0207683_101336342 253
83 3300028380 Ga0268265_10002980 Ga0268265_100029801 253
84 3300028381 Ga0268264_10002471 Ga0268264_1000247110 253
85 iso_pu_bacteria 3002141150 3002145843 255
86 3300049579 Ga0501043_0027262 Ga0501043_0027262_2389_3327 256
87 3300049580 Ga0501046_0181114 Ga0501046_0181114_298_1236 256
88 3300049581 Ga0501047_0083930 Ga0501047_0083930_1556_2494 256
89 3300060353 Ga0501082_0018766 Ga0501082_0018766_4657_5595 256
90 3300048925 Ga0496122_0254149 Ga0496122_0254149_43_882 257
91 3300046477 Ga0495664_0106357 Ga0495664_0106357_635_1564 259
92 3300009766 Ga0123342_1014091 Ga0123342_10140915 260
93 3300053156 Ga0500622_0016953 Ga0500622_0016953_1340_2281 260
94 3300005564 Ga0070664_100323372 Ga0070664_1003233722 261
95 3300006051 Ga0075364_10006628 Ga0075364_100066282 261
96 3300025945 Ga0207679_10221969 Ga0207679_102219692 261
97 3300048924 Ga0496121_0000836 Ga0496121_0000836_31182_32120 261
98 3300048929 Ga0496126_0165266 Ga0496126_0165266_631_1569 261
99 3300050491 nmdc:mga00v17_252_c1 nmdc:mga00v17_252_c1_10942_11880 261
100 3300047472 Ga0495686_0067976 Ga0495686_0067976_909_1850 262
101 3300048924 Ga0496121_0000240 Ga0496121_0000240_3381_4334 264
102 3300053125 Ga0500618_006937 Ga0500618_006937_713_1672 264
103 3300046506 Ga0495583_0008439 Ga0495583_0008439_4313_5254 265
104 3300048927 Ga0496124_0000080 Ga0496124_0000080_56950_57891 265
105 3300053111 Ga0500572_002948 Ga0500572_002948_149_1087 265
106 3300053177 Ga0500636_0000392 Ga0500636_0000392_18118_19056 265
107 3300005353 Ga0070669_100085057 Ga0070669_1000850572 267
108 3300005295 Ga0065707_10086155 Ga0065707_100861552 268
109 3300005337 Ga0070682_100278482 Ga0070682_1002784822 268
110 3300005539 Ga0068853_100002653 Ga0068853_1000026538 268
111 3300005842 Ga0068858_100196888 Ga0068858_1001968881 268
112 3300005844 Ga0068862_100015023 Ga0068862_1000150232 268
113 3300005937 Ga0081455_10063610 Ga0081455_100636103 268
114 3300006175 Ga0070712_100167100 Ga0070712_1001671002 268
115 3300006353 Ga0075370_10004585 Ga0075370_100045853 268
116 3300009174 Ga0105241_10152911 Ga0105241_101529111 268
117 3300009765 Ga0123341_1000095 Ga0123341_10000959 268
118 3300013100 Ga0157373_10247589 Ga0157373_102475892 268
119 3300025924 Ga0207694_10136647 Ga0207694_101366472 268
120 3300026041 Ga0207639_10020434 Ga0207639_100204342 268
121 3300026118 Ga0207675_100140317 Ga0207675_1001403172 268
122 3300026121 Ga0207683_10010219 Ga0207683_100102195 268
123 3300028380 Ga0268265_10016306 Ga0268265_100163065 268
124 3300031730 Ga0307516_10033201 Ga0307516_100332013 268
125 3300031731 Ga0307405_10086071 Ga0307405_100860711 268
126 3300032126 Ga0307415_100227527 Ga0307415_1002275272 268
127 3300035724 Ga0373933_0143145 Ga0373933_0143145_23_883 268
128 3300037418 Ga0395900_0592471 Ga0395900_0592471_165_1013 268
129 3300046675 Ga0495657_0138142 Ga0495657_0138142_570_1412 268
130 3300046678 Ga0495599_0311899 Ga0495599_0311899_29_871 268
131 3300046809 Ga0495600_0121462 Ga0495600_0121462_450_1292 268
132 3300048914 Ga0496111_0107242 Ga0496111_0107242_985_1872 268
133 3300048924 Ga0496121_0281548 Ga0496121_0281548_29_871 268
134 3300048928 Ga0496125_0000129 Ga0496125_0000129_153078_153965 268
135 3300049571 Ga0501034_0027677 Ga0501034_0027677_3031_3930 268
136 iso_pu_bacteria 2643221736 2644742730 268
137 iso_pu_bacteria 2852387548 2852391877 268
138 iso_pu_bacteria 2894232714 2894233508 268
139 iso_pu_bacteria 2896384573 2896387545 268
140 iso_pu_bacteria 8057529695 8057532068 268
141 3300005289 Ga0065704_10099334 Ga0065704_100993341 269
142 3300037471 Ga0395905_0011131 Ga0395905_0011131_3714_4655 269
143 3300044901 Ga0466960_0039614 Ga0466960_0039614_350_1291 269
144 3300048926 Ga0496123_0114618 Ga0496123_0114618_35_973 269
145 iso_pu_bacteria 2671180139 2671695279 269
146 3300005456 Ga0070678_100571440 Ga0070678_1005714401 270
147 3300026121 Ga0207683_10207260 Ga0207683_102072602 270
148 3300048905 Ga0496102_0442358 Ga0496102_0442358_214_1119 271
149 iso_pu_bacteria 2510917026 2511168701 271
150 iso_pu_bacteria 2585427633 2585997420 271
151 iso_pu_bacteria 2585427634 2586002026 271
152 iso_pu_bacteria 2838675328 2838677768 271
153 iso_pu_bacteria 2838714209 2838717327 271
154 iso_pu_bacteria 2838719591 2838722063 271
155 iso_pu_bacteria 2838724970 2838728076 271
156 iso_pu_bacteria 2841846520 2841849737 271
157 iso_pu_bacteria 2841859092 2841864250 271
158 iso_pu_bacteria 2842124991 2842127515 271
159 iso_pu_bacteria 2842130223 2842132661 271
160 iso_pu_bacteria 2842152218 2842154655 271
161 iso_pu_bacteria 2842170452 2842173152 271
162 iso_pu_bacteria 2842175837 2842178275 271
163 iso_pu_bacteria 2842187318 2842190434 271
164 iso_pu_bacteria 2842211629 2842214748 271
165 iso_pu_bacteria 2842224351 2842227469 271
166 iso_pu_bacteria 2842515876 2842521003 271
167 iso_pu_bacteria 2899792073 2899793509 271
168 iso_pu_bacteria 2899845264 2899847704 271
169 iso_pu_bacteria 2919114240 2919117593 271
170 iso_pu_bacteria 2926754445 2926759030 271
171 iso_pu_bacteria 2926760298 2926763453 271
172 3300002774 JGI25150J39212_1006970 JGI25150J39212_10069701 272
173 3300003187 JGI25151J46595_10013544 JGI25151J46595_100135442 272
174 3300009545 Ga0105237_10699753 Ga0105237_106997532 272
175 3300009553 Ga0105249_10435134 Ga0105249_104351342 272
176 3300037466 Ga0395898_0192241 Ga0395898_0192241_666_1616 272
177 3300009148 Ga0105243_10231545 Ga0105243_102315452 273
178 3300053161 Ga0500634_0000366 Ga0500634_0000366_8185_9126 273
179 iso_pu_bacteria 2643221688 2644492602 273
180 iso_pu_bacteria 2939669807 2939673011 273
181 3300005435 Ga0070714_100375601 Ga0070714_1003756012 274
182 3300005445 Ga0070708_100010723 Ga0070708_1000107236 274
183 3300005467 Ga0070706_100173652 Ga0070706_1001736522 274
184 3300005467 Ga0070706_100385952 Ga0070706_1003859521 274
185 3300005468 Ga0070707_100053165 Ga0070707_1000531652 274
186 3300005471 Ga0070698_100000683 Ga0070698_10000068314 274
187 3300005518 Ga0070699_100010118 Ga0070699_1000101187 274
188 3300005536 Ga0070697_100036048 Ga0070697_1000360485 274
189 3300006028 Ga0070717_10008768 Ga0070717_100087685 274
190 3300006028 Ga0070717_10100395 Ga0070717_101003953 274
191 3300025910 Ga0207684_10117644 Ga0207684_101176443 274
192 3300025922 Ga0207646_10033232 Ga0207646_100332322 274
193 3300035111 Ga0373923_0014931 Ga0373923_0014931_1447_2379 274
194 3300035171 Ga0373946_0040860 Ga0373946_0040860_67_999 274
195 3300035692 Ga0373935_0083954 Ga0373935_0083954_842_1774 274
196 3300036401 Ga0373937_0024706 Ga0373937_0024706_3519_4451 274
197 3300046454 Ga0495592_0107470 Ga0495592_0107470_505_1437 274
198 3300046477 Ga0495664_0105165 Ga0495664_0105165_254_1186 274
199 3300046533 Ga0495640_0062394 Ga0495640_0062394_875_1807 274
200 3300046536 Ga0495587_0132874 Ga0495587_0132874_340_1272 274
201 3300046678 Ga0495599_0052832 Ga0495599_0052832_244_1176 274
202 3300046683 Ga0495658_0132694 Ga0495658_0132694_142_1074 274
203 3300047319 Ga0495674_0272488 Ga0495674_0272488_292_1224 274
204 iso_pu_bacteria 2835312727 2835317168 274
205 iso_pu_bacteria 2882456835 2882462471 274
206 iso_pu_bacteria 8005658619 8005661272 274
207 3300003215 JGI25153J46596_10009689 JGI25153J46596_100096893 275
208 3300003792 Ga0055540_1001450 Ga0055540_10014505 275
209 3300005543 Ga0070672_100205484 Ga0070672_1002054842 275
210 3300005548 Ga0070665_100312963 Ga0070665_1003129632 275
211 3300017792 Ga0163161_10059617 Ga0163161_100596173 275
212 3300025297 Ga0209758_1000903 Ga0209758_100090337 275
213 3300025297 Ga0209758_1001250 Ga0209758_100125017 275
214 3300025303 Ga0209051_1001462 Ga0209051_100146212 275
215 3300025304 Ga0209257_1001831 Ga0209257_100183115 275
216 3300025304 Ga0209257_1034763 Ga0209257_10347632 275
217 3300025893 Ga0207682_10104749 Ga0207682_101047491 275
218 3300025940 Ga0207691_10076699 Ga0207691_100766992 275
219 3300039450 Ga0436363_0080435 Ga0436363_0080435_6394_7380 275
220 3300041509 Ga0451843_0634892 Ga0451843_0634892_364_1317 275
221 3300046522 Ga0495643_0014621 Ga0495643_0014621_488_1411 275
222 3300048090 Ga0495615_0008259 Ga0495615_0008259_402_1346 275
223 3300048920 Ga0496117_0139850 Ga0496117_0139850_171_1097 275
224 3300048924 Ga0496121_0001142 Ga0496121_0001142_34569_35495 275
225 3300048926 Ga0496123_0106524 Ga0496123_0106524_679_1602 275
226 3300048928 Ga0496125_0049912 Ga0496125_0049912_784_1707 275
227 3300049571 Ga0501034_0200903 Ga0501034_0200903_1009_1938 275
228 3300049573 Ga0501037_0016479 Ga0501037_0016479_1676_2605 275
229 3300049575 Ga0501039_0033040 Ga0501039_0033040_605_1534 275
230 3300049586 Ga0501070_0032357 Ga0501070_0032357_434_1363 275
231 3300049822 Ga0501035_0234377 Ga0501035_0234377_295_1224 275
232 3300049823 Ga0501044_0250692 Ga0501044_0250692_228_1157 275
233 3300053151 Ga0500604_0000460 Ga0500604_0000460_45_971 275
234 3300053177 Ga0500636_0000372 Ga0500636_0000372_12528_13427 275
235 iso_pu_bacteria 2551306091 2551726795 275
236 iso_pu_bacteria 2757320392 2757569225 275
237 iso_pu_bacteria 8018150411 8018154834 275
238 3300005456 Ga0070678_100010927 Ga0070678_1000109271 276
239 3300005841 Ga0068863_100068199 Ga0068863_1000681991 276
240 3300005843 Ga0068860_100104396 Ga0068860_1001043963 276
241 3300006195 Ga0075366_10019997 Ga0075366_100199973 276
242 3300006931 Ga0097620_100137443 Ga0097620_1001374432 276
243 3300014497 Ga0182008_10003079 Ga0182008_100030797 276
244 3300014968 Ga0157379_10024269 Ga0157379_100242693 276
245 3300015262 Ga0182007_10001612 Ga0182007_100016124 276
246 3300015683 Ga0183362_10002 Ga0183362_10002221 276
247 3300028381 Ga0268264_10385782 Ga0268264_103857821 276
248 3300031911 Ga0307412_10215704 Ga0307412_102157042 276
249 3300039438 Ga0436360_0181196 Ga0436360_0181196_1291_2265 276
250 3300048912 Ga0496109_0161522 Ga0496109_0161522_35_982 276
251 3300048913 Ga0496110_0013366 Ga0496110_0013366_2509_3456 276
252 3300048927 Ga0496124_0068294 Ga0496124_0068294_592_1527 276
253 3300050493 nmdc:mga0k408_45190_c1 nmdc:mga0k408_45190_c1_1502_2443 276
254 iso_pu_bacteria 2508501122 2509109477 276
255 iso_pu_bacteria 2509276019 2509378213 276
256 iso_pu_bacteria 2509276021 2509386983 276
257 iso_pu_bacteria 2509276033 2509442511 276
258 iso_pu_bacteria 2510065019 2510132964 276
259 iso_pu_bacteria 2510065057 2510307612 276
260 iso_pu_bacteria 2510461069 2510840357 276
261 iso_pu_bacteria 2510461076 2510894345 276
262 iso_pu_bacteria 2510461076 2510899370 276
263 iso_pu_bacteria 2510917022 2511133074 276
264 iso_pu_bacteria 2510917028 2511181453 276
265 iso_pu_bacteria 2510917030 2511200216 276
266 iso_pu_bacteria 2511231052 2511503213 276
267 iso_pu_bacteria 2512047086 2512534485 276
268 iso_pu_bacteria 2512875026 2512973706 276
269 iso_pu_bacteria 2513237085 2513575211 276
270 iso_pu_bacteria 2513237086 2513585178 276
271 iso_pu_bacteria 2513237088 2513595280 276
272 iso_pu_bacteria 2513237089 2513601776 276
273 iso_pu_bacteria 2513237091 2513616963 276
274 iso_pu_bacteria 2513237093 2513633107 276
275 iso_pu_bacteria 2513237103 2513710155 276
276 iso_pu_bacteria 2513237138 2513866727 276
277 iso_pu_bacteria 2513237140 2513884179 276
278 iso_pu_bacteria 2513237143 2513903508 276
279 iso_pu_bacteria 2513237144 2513911441 276
280 iso_pu_bacteria 2513237146 2513928829 276
281 iso_pu_bacteria 2513237160 2514003640 276
282 iso_pu_bacteria 2513237162 2514021789 276
283 iso_pu_bacteria 2515075009 2515111916 276
284 iso_pu_bacteria 2515154107 2515610950 276
285 iso_pu_bacteria 2515154113 2515633718 276
286 iso_pu_bacteria 2515154114 2515645108 276
287 iso_pu_bacteria 2515154116 2515660249 276
288 iso_pu_bacteria 2515154134 2515738907 276
289 iso_pu_bacteria 2516143018 2516206344 276
290 iso_pu_bacteria 2516653046 2516894645 276
291 iso_pu_bacteria 2516653077 2517035655 276
292 iso_pu_bacteria 2516653085 2517076084 276
293 iso_pu_bacteria 2517093000 2517094836 276
294 iso_pu_bacteria 2517287029 2517406465 276
295 iso_pu_bacteria 2517487022 2517571291 276
296 iso_pu_bacteria 2519899620 2520379453 276
297 iso_pu_bacteria 2524023207 2524450563 276
298 iso_pu_bacteria 2524023209 2524458596 276
299 iso_pu_bacteria 2529292951 2530645223 276
300 iso_pu_bacteria 2534681796 2535520187 276
301 iso_pu_bacteria 2537561587 2537876817 276
302 iso_pu_bacteria 2551306084 2551679629 276
303 iso_pu_bacteria 2551306085 2551687372 276
304 iso_pu_bacteria 2551306086 2551691563 276
305 iso_pu_bacteria 2551306087 2551700716 276
306 iso_pu_bacteria 2551306089 2551715511 276
307 iso_pu_bacteria 2551306090 2551723034 276
308 iso_pu_bacteria 2551306092 2551736014 276
309 iso_pu_bacteria 2551306093 2551744717 276
310 iso_pu_bacteria 2554235003 2554245666 276
311 iso_pu_bacteria 2558860100 2558867301 276
312 iso_pu_bacteria 2558860242 2559296505 276
313 iso_pu_bacteria 2582581294 2585204273 276
314 iso_pu_bacteria 2582581298 2585222371 276
315 iso_pu_bacteria 2582581299 2585231972 276
316 iso_pu_bacteria 2582581304 2585258731 276
317 iso_pu_bacteria 2582581307 2585271812 276
318 iso_pu_bacteria 2582581308 2585279822 276
319 iso_pu_bacteria 2582581315 2585326636 276
320 iso_pu_bacteria 2582581316 2585333813 276
321 iso_pu_bacteria 2582581867 2585401466 276
322 iso_pu_bacteria 2585427526 2585528241 276
323 iso_pu_bacteria 2585427527 2585531774 276
324 iso_pu_bacteria 2585427528 2585540439 276
325 iso_pu_bacteria 2585427529 2585544677 276
326 iso_pu_bacteria 2585427530 2585551278 276
327 iso_pu_bacteria 2585427531 2585563823 276
328 iso_pu_bacteria 2585427590 2585821159 276
329 iso_pu_bacteria 2585427593 2585838650 276
330 iso_pu_bacteria 2585427594 2585842901 276
331 iso_pu_bacteria 2585427608 2585896980 276
332 iso_pu_bacteria 2585427609 2585907162 276
333 iso_pu_bacteria 2585428125 2587982844 276
334 iso_pu_bacteria 2599185170 2599414846 276
335 iso_pu_bacteria 2599185210 2599603000 276
336 iso_pu_bacteria 2600254933 2600376169 276
337 iso_pu_bacteria 2600255279 2601610621 276
338 iso_pu_bacteria 2600255308 2601747049 276
339 iso_pu_bacteria 2615840624 2616292746 276
340 iso_pu_bacteria 2615840626 2616306613 276
341 iso_pu_bacteria 2615840698 2616551248 276
342 iso_pu_bacteria 2617270742 2617382992 276
343 iso_pu_bacteria 2643221568 2643857047 276
344 iso_pu_bacteria 2643221582 2643917549 276
345 iso_pu_bacteria 2643221599 2644003483 276
346 iso_pu_bacteria 2643221634 2644195571 276
347 iso_pu_bacteria 2643221643 2644242314 276
348 iso_pu_bacteria 2643221693 2644520632 276
349 iso_pu_bacteria 2667528174 2671113373 276
350 iso_pu_bacteria 2690316117 2692314746 276
351 iso_pu_bacteria 2718217882 2719180888 276
352 iso_pu_bacteria 2718217927 2719385492 276
353 iso_pu_bacteria 2718217997 2719665317 276
354 iso_pu_bacteria 2718218009 2719731637 276
355 iso_pu_bacteria 2718218199 2720491737 276
356 iso_pu_bacteria 2718218233 2720619856 276
357 iso_pu_bacteria 2718218363 2721146982 276
358 iso_pu_bacteria 2718218365 2721158512 276
359 iso_pu_bacteria 2718218366 2721163900 276
360 iso_pu_bacteria 2718218423 2721399240 276
361 iso_pu_bacteria 2721755514 2722840070 276
362 iso_pu_bacteria 2721755556 2723026650 276
363 iso_pu_bacteria 2721755684 2723560264 276
364 iso_pu_bacteria 2721755809 2724038053 276
365 iso_pu_bacteria 2721755810 2724044393 276
366 iso_pu_bacteria 2721755823 2724109905 276
367 iso_pu_bacteria 2724679232 2725949846 276
368 iso_pu_bacteria 2728369352 2730107586 276
369 iso_pu_bacteria 2728369365 2730164125 276
370 iso_pu_bacteria 2728369397 2730298144 276
371 iso_pu_bacteria 2738541293 2738801519 276
372 iso_pu_bacteria 2738541333 2739037931 276
373 iso_pu_bacteria 2765235942 2766062343 276
374 iso_pu_bacteria 2775507266 2778179028 276
375 iso_pu_bacteria 2791355256 2793299155 276
376 iso_pu_bacteria 2791355259 2793313806 276
377 iso_pu_bacteria 2791355260 2793321172 276
378 iso_pu_bacteria 2791355261 2793326398 276
379 iso_pu_bacteria 2791355262 2793337020 276
380 iso_pu_bacteria 2791355263 2793341239 276
381 iso_pu_bacteria 2791355264 2793347588 276
382 iso_pu_bacteria 2791355265 2793352341 276
383 iso_pu_bacteria 2791355266 2793361482 276
384 iso_pu_bacteria 2802428858 2802717342 276
385 iso_pu_bacteria 2802428859 2802724669 276
386 iso_pu_bacteria 2802428860 2802729421 276
387 iso_pu_bacteria 2802428861 2802736766 276
388 iso_pu_bacteria 2802428862 2802743172 276
389 iso_pu_bacteria 2802428863 2802749702 276
390 iso_pu_bacteria 2802429605 2805927677 276
391 iso_pu_bacteria 2802429606 2805936154 276
392 iso_pu_bacteria 2802429633 2806045460 276
393 iso_pu_bacteria 2802429634 2806051737 276
394 iso_pu_bacteria 2802429635 2806061781 276
395 iso_pu_bacteria 2802429636 2806067962 276
396 iso_pu_bacteria 2802429637 2806072689 276
397 iso_pu_bacteria 2808606387 2808986956 276
398 iso_pu_bacteria 2818991439 2819560741 276
399 iso_pu_bacteria 2818991448 2819611615 276
400 iso_pu_bacteria 2818991453 2819638709 276
401 iso_pu_bacteria 2838016132 2838018852 276
402 iso_pu_bacteria 2838022645 2838025445 276
403 iso_pu_bacteria 2838029111 2838031040 276
404 iso_pu_bacteria 2838035591 2838039435 276
405 iso_pu_bacteria 2838042994 2838043140 276
406 iso_pu_bacteria 2838048938 2838052082 276
407 iso_pu_bacteria 2838061910 2838067301 276
408 iso_pu_bacteria 2838068647 2838071416 276
409 iso_pu_bacteria 2838661181 2838667609 276
410 iso_pu_bacteria 2838668709 2838670123 276
411 iso_pu_bacteria 2838680041 2838682542 276
412 iso_pu_bacteria 2838686498 2838689155 276
413 iso_pu_bacteria 2838694306 2838697113 276
414 iso_pu_bacteria 2838701080 2838702494 276
415 iso_pu_bacteria 2838707686 2838709646 276
416 iso_pu_bacteria 2838729681 2838730503 276
417 iso_pu_bacteria 2838742623 2838743444 276
418 iso_pu_bacteria 2841851746 2841854880 276
419 iso_pu_bacteria 2841864319 2841864860 276
420 iso_pu_bacteria 2842077413 2842077820 276
421 iso_pu_bacteria 2842110456 2842110853 276
422 iso_pu_bacteria 2842118031 2842119672 276
423 iso_pu_bacteria 2842146304 2842146961 276
424 iso_pu_bacteria 2842156927 2842157743 276
425 iso_pu_bacteria 2842163707 2842164953 276
426 iso_pu_bacteria 2842180545 2842180672 276
427 iso_pu_bacteria 2842192696 2842196943 276
428 iso_pu_bacteria 2842198810 2842201013 276
429 iso_pu_bacteria 2842205361 2842206341 276
430 iso_pu_bacteria 2842217011 2842220682 276
431 iso_pu_bacteria 2842229732 2842231276 276
432 iso_pu_bacteria 2842237096 2842239059 276
433 iso_pu_bacteria 2842243621 2842244623 276
434 iso_pu_bacteria 2842250916 2842252026 276
435 iso_pu_bacteria 2842257432 2842258436 276
436 iso_pu_bacteria 2842264693 2842267472 276
437 iso_pu_bacteria 2842271015 2842273175 276
438 iso_pu_bacteria 2842278818 2842279798 276
439 iso_pu_bacteria 2842285085 2842287445 276
440 iso_pu_bacteria 2842291075 2842291482 276
441 iso_pu_bacteria 2842298080 2842300143 276
442 iso_pu_bacteria 2842304105 2842309342 276
443 iso_pu_bacteria 2842311132 2842315462 276
444 iso_pu_bacteria 2842317721 2842318211 276
445 iso_pu_bacteria 2842341865 2842347212 276
446 iso_pu_bacteria 2842357229 2842359054 276
447 iso_pu_bacteria 2842363717 2842366603 276
448 iso_pu_bacteria 2842370503 2842373109 276
449 iso_pu_bacteria 2842377471 2842377878 276
450 iso_pu_bacteria 2842384541 2842386181 276
451 iso_pu_bacteria 2842395702 2842397357 276
452 iso_pu_bacteria 2842402390 2842405026 276
453 iso_pu_bacteria 2842409023 2842411608 276
454 iso_pu_bacteria 2842415677 2842417941 276
455 iso_pu_bacteria 2842422224 2842424926 276
456 iso_pu_bacteria 2842428310 2842431950 276
457 iso_pu_bacteria 2842434925 2842438063 276
458 iso_pu_bacteria 2842441272 2842444876 276
459 iso_pu_bacteria 2842447887 2842451791 276
460 iso_pu_bacteria 2842462802 2842465746 276
461 iso_pu_bacteria 2842469257 2842472680 276
462 iso_pu_bacteria 2842475841 2842477772 276
463 iso_pu_bacteria 2842482326 2842485078 276
464 iso_pu_bacteria 2842489311 2842492827 276
465 iso_pu_bacteria 2842495871 2842496478 276
466 iso_pu_bacteria 2842502639 2842504356 276
467 iso_pu_bacteria 2842509118 2842511578 276
468 iso_pu_bacteria 2844454524 2844459490 276
469 iso_pu_bacteria 2847417321 2847420198 276
470 iso_pu_bacteria 2848992105 2848995096 276
471 iso_pu_bacteria 2854896431 2854902099 276
472 iso_pu_bacteria 2854916844 2854921325 276
473 iso_pu_bacteria 2855825444 2855827271 276
474 iso_pu_bacteria 2855839649 2855842653 276
475 iso_pu_bacteria 2855872281 2855874617 276
476 iso_pu_bacteria 2857516855 2857523750 276
477 iso_pu_bacteria 2858800743 2858803464 276
478 iso_pu_bacteria 2915980308 2915982557 276
479 iso_pu_bacteria 2915986958 2915991167 276
480 iso_pu_bacteria 2915993759 2916000268 276
481 iso_pu_bacteria 2916000859 2916007194 276
482 iso_pu_bacteria 2916007675 2916008428 276
483 iso_pu_bacteria 2916014648 2916019690 276
484 iso_pu_bacteria 2916021584 2916026734 276
485 iso_pu_bacteria 2916028427 2916033535 276
486 iso_pu_bacteria 2916035215 2916039641 276
487 iso_pu_bacteria 2916041962 2916047019 276
488 iso_pu_bacteria 2916048683 2916052836 276
489 iso_pu_bacteria 2916055098 2916059548 276
490 iso_pu_bacteria 2916061851 2916065155 276
491 iso_pu_bacteria 2916068649 2916071223 276
492 iso_pu_bacteria 2916076590 2916078054 276
493 iso_pu_bacteria 2919100787 2919102931 276
494 iso_pu_bacteria 2919166419 2919170193 276
495 iso_pu_bacteria 2919171160 2919173716 276
496 iso_pu_bacteria 2919408235 2919411171 276
497 iso_pu_bacteria 2921208531 2921211456 276
498 iso_pu_bacteria 2921237296 2921244031 276
499 iso_pu_bacteria 2921244191 2921248742 276
500 iso_pu_bacteria 2921250672 2921254682 276
501 iso_pu_bacteria 2921257292 2921262131 276
502 iso_pu_bacteria 2921263974 2921270677 276
503 iso_pu_bacteria 2921282425 2921288814 276
504 iso_pu_bacteria 2921289301 2921296337 276
505 iso_pu_bacteria 2921296804 2921298086 276
506 iso_pu_bacteria 2923556063 2923556953 276
507 iso_pu_bacteria 2924144063 2924147723 276
508 iso_pu_bacteria 2924150972 2924156448 276
509 iso_pu_bacteria 2924158325 2924160182 276
510 iso_pu_bacteria 2924165586 2924170218 276
511 iso_pu_bacteria 2924172951 2924177618 276
512 iso_pu_bacteria 2924179722 2924186297 276
513 iso_pu_bacteria 2924186466 2924191583 276
514 iso_pu_bacteria 2924193448 2924195237 276
515 iso_pu_bacteria 2924200457 2924204794 276
516 iso_pu_bacteria 2924207177 2924209354 276
517 iso_pu_bacteria 2924214083 2924214361 276
518 iso_pu_bacteria 2924221636 2924228794 276
519 iso_pu_bacteria 2924228884 2924234396 276
520 iso_pu_bacteria 2933006813 2933009962 276
521 iso_pu_bacteria 2933011516 2933011585 276
522 iso_pu_bacteria 2933016740 2933023384 276
523 iso_pu_bacteria 2933570622 2933575885 276
524 iso_pu_bacteria 2933586486 2933586878 276
525 iso_pu_bacteria 2933594066 2933595931 276
526 iso_pu_bacteria 2935894831 2935899021 276
527 iso_pu_bacteria 2935901341 2935904400 276
528 iso_pu_bacteria 2936367885 2936373076 276
529 iso_pu_bacteria 2936375103 2936381220 276
530 iso_pu_bacteria 2936381700 2936385985 276
531 iso_pu_bacteria 2936996657 2936997572 276
532 iso_pu_bacteria 2937002841 2937007598 276
533 iso_pu_bacteria 2937009748 2937013956 276
534 iso_pu_bacteria 2937016420 2937020894 276
535 iso_pu_bacteria 2937023124 2937024771 276
536 iso_pu_bacteria 2937029754 2937033304 276
537 iso_pu_bacteria 2937036028 2937036084 276
538 iso_pu_bacteria 2937042894 2937049239 276
539 iso_pu_bacteria 2937049772 2937056141 276
540 iso_pu_bacteria 2937056579 2937061425 276
541 iso_pu_bacteria 2937063883 2937069220 276
542 iso_pu_bacteria 2937071275 2937076306 276
543 iso_pu_bacteria 2937078374 2937082356 276
544 iso_pu_bacteria 2937084907 2937086372 276
545 iso_pu_bacteria 2937091812 2937097284 276
546 iso_pu_bacteria 2937098957 2937106254 276
547 iso_pu_bacteria 2937106411 2937106986 276
548 iso_pu_bacteria 2937113482 2937118164 276
549 iso_pu_bacteria 2937119839 2937121741 276
550 iso_pu_bacteria 2937126314 2937127836 276
551 iso_pu_bacteria 2954011201 2954011753 276
552 iso_pu_bacteria 2957375807 2957378890 276
553 iso_pu_bacteria 2957382221 2957383854 276
554 iso_pu_bacteria 2957388812 2957391478 276
555 iso_pu_bacteria 2957395598 2957400528 276
556 iso_pu_bacteria 2957402308 2957403943 276
557 iso_pu_bacteria 2957408893 2957409852 276
558 iso_pu_bacteria 2957415311 2957420548 276
559 iso_pu_bacteria 2957422303 2957424467 276
560 iso_pu_bacteria 2957437181 2957439745 276
561 iso_pu_bacteria 2957443900 2957449060 276
562 iso_pu_bacteria 2957450854 2957456777 276
563 iso_pu_bacteria 2957457609 2957462781 276
564 iso_pu_bacteria 2957464669 2957467499 276
565 iso_pu_bacteria 2957471148 2957477460 276
566 iso_pu_bacteria 2957478035 2957482479 276
567 iso_pu_bacteria 2957484790 2957485146 276
568 iso_pu_bacteria 2957491536 2957497285 276
569 iso_pu_bacteria 2957498199 2957504678 276
570 iso_pu_bacteria 2957505466 2957510698 276
571 iso_pu_bacteria 2960584000 2960584334 276
572 iso_pu_bacteria 2960591022 2960594968 276
573 iso_pu_bacteria 2960597568 2960599390 276
574 iso_pu_bacteria 2960603979 2960609060 276
575 iso_pu_bacteria 2960610863 2960612173 276
576 iso_pu_bacteria 2960617483 2960618174 276
577 iso_pu_bacteria 2960624210 2960625907 276
578 iso_pu_bacteria 2960631154 2960634754 276
579 iso_pu_bacteria 2960637947 2960638291 276
580 iso_pu_bacteria 2960645483 2960650760 276
581 iso_pu_bacteria 2960652885 2960655400 276
582 iso_pu_bacteria 2960660292 2960665721 276
583 iso_pu_bacteria 2960667422 2960672033 276
584 iso_pu_bacteria 2960674078 2960678020 276
585 iso_pu_bacteria 2960680706 2960684287 276
586 iso_pu_bacteria 2960687367 2960693680 276
587 iso_pu_bacteria 2960693952 2960696680 276
588 iso_pu_bacteria 2964607997 2964609637 276
589 iso_pu_bacteria 2964615318 2964619689 276
590 iso_pu_bacteria 2964621998 2964626219 276
591 iso_pu_bacteria 2964628898 2964630458 276
592 iso_pu_bacteria 2964636051 2964636461 276
593 iso_pu_bacteria 2964643177 2964645252 276
594 iso_pu_bacteria 2964649959 2964652693 276
595 iso_pu_bacteria 2964656573 2964662333 276
596 iso_pu_bacteria 2964663802 2964666246 276
597 iso_pu_bacteria 2964670856 2964672782 276
598 iso_pu_bacteria 2964678106 2964678261 276
599 iso_pu_bacteria 2964685014 2964691415 276
600 iso_pu_bacteria 2964691889 2964696560 276
601 iso_pu_bacteria 2964698721 2964702203 276
602 iso_pu_bacteria 2964705432 2964712483 276
603 iso_pu_bacteria 2964712639 2964712898 276
604 iso_pu_bacteria 2964719344 2964720229 276
605 iso_pu_bacteria 2967664464 2967670988 276
606 iso_pu_bacteria 2967671571 2967672034 276
607 iso_pu_bacteria 2967678726 2967680556 276
608 iso_pu_bacteria 2967686174 2967689162 276
609 iso_pu_bacteria 2967693043 2967695487 276
610 iso_pu_bacteria 2967699805 2967705879 276
611 iso_pu_bacteria 2967706974 2967713904 276
612 iso_pu_bacteria 2967714385 2967719096 276
613 iso_pu_bacteria 2967721400 2967727141 276
614 iso_pu_bacteria 2967728569 2967731939 276
615 iso_pu_bacteria 2967735183 2967736798 276
616 iso_pu_bacteria 2967742019 2967744095 276
617 iso_pu_bacteria 2967748971 2967749885 276
618 iso_pu_bacteria 2967755722 2967756234 276
619 iso_pu_bacteria 2967762386 2967768611 276
620 iso_pu_bacteria 2967769361 2967773789 276
621 iso_pu_bacteria 2967775926 2967778532 276
622 iso_pu_bacteria 2970019648 2970026271 276
623 iso_pu_bacteria 2970026789 2970029935 276
624 iso_pu_bacteria 2970033650 2970038835 276
625 iso_pu_bacteria 2970040964 2970045680 276
626 iso_pu_bacteria 2970047711 2970052365 276
627 iso_pu_bacteria 2970054988 2970059732 276
628 iso_pu_bacteria 2970061556 2970062315 276
629 iso_pu_bacteria 2970068827 2970075610 276
630 iso_pu_bacteria 2970076120 2970081663 276
631 iso_pu_bacteria 2970082768 2970086382 276
632 iso_pu_bacteria 2970088815 2970093948 276
633 iso_pu_bacteria 2970095765 2970101817 276
634 iso_pu_bacteria 2970102677 2970106878 276
635 iso_pu_bacteria 2970109326 2970111442 276
636 iso_pu_bacteria 2970116247 2970121495 276
637 iso_pu_bacteria 2970122695 2970125865 276
638 iso_pu_bacteria 2970129317 2970131896 276
639 iso_pu_bacteria 2970136068 2970138148 276
640 iso_pu_bacteria 2970143518 2970143730 276
641 iso_pu_bacteria 2970149975 2970154403 276
642 iso_pu_bacteria 2970156795 2970157585 276
643 iso_pu_bacteria 2970164137 2970168920 276
644 iso_pu_bacteria 2970170962 2970176842 276
645 iso_pu_bacteria 2970177841 2970180221 276
646 iso_pu_bacteria 2970184632 2970189601 276
647 iso_pu_bacteria 2970191845 2970196880 276
648 iso_pu_bacteria 2977516862 2977518426 276
649 iso_pu_bacteria 2977523885 2977524513 276
650 iso_pu_bacteria 2977530762 2977534668 276
651 iso_pu_bacteria 2977537788 2977542351 276
652 iso_pu_bacteria 2977544691 2977551425 276
653 iso_pu_bacteria 2977551784 2977553309 276
654 iso_pu_bacteria 2977558990 2977565493 276
655 iso_pu_bacteria 2977565890 2977569296 276
656 iso_pu_bacteria 2977572785 2977579189 276
657 iso_pu_bacteria 2977579622 2977585480 276
658 iso_pu_bacteria 2978969890 2978970179 276
659 iso_pu_bacteria 2979089926 2979091512 276
660 iso_pu_bacteria 2979095461 2979097032 276
661 iso_pu_bacteria 2979100975 2979101292 276
662 iso_pu_bacteria 2984509177 2984510753 276
663 iso_pu_bacteria 2984518228 2984518546 276
664 iso_pu_bacteria 2984537506 2984539103 276
665 iso_pu_bacteria 2984587000 2984587206 276
666 iso_pu_bacteria 2984601300 2984605797 276
667 iso_pu_bacteria 2996887358 2996887398 276
668 iso_pu_bacteria 2996893221 2996898424 276
669 iso_pu_bacteria 3005409236 3005409806 276
670 iso_pu_bacteria 3005416602 3005421512 276
671 iso_pu_bacteria 3005445848 3005450864 276
672 iso_pu_bacteria 3005452660 3005456883 276
673 iso_pu_bacteria 639633055 639648208 276
674 iso_pu_bacteria 648276728 648737093 276
675 iso_pu_bacteria 650716007 650842922 276
676 iso_pu_bacteria 8003570095 8003573257 276
677 iso_pu_bacteria 8003992118 8003995235 276
678 iso_pu_bacteria 8003999396 8004002951 276
679 iso_pu_bacteria 8005258706 8005261961 276
680 iso_pu_bacteria 8005275841 8005280263 276
681 iso_pu_bacteria 8005289223 8005294847 276
682 iso_pu_bacteria 8005301065 8005306992 276
683 iso_pu_bacteria 8005307578 8005314188 276
684 iso_pu_bacteria 8005314921 8005319785 276
685 iso_pu_bacteria 8005321885 8005321925 276
686 iso_pu_bacteria 8005376324 8005378856 276
687 iso_pu_bacteria 8005382845 8005388053 276
688 iso_pu_bacteria 8005395548 8005396991 276
689 iso_pu_bacteria 8005430974 8005433178 276
690 iso_pu_bacteria 8005460587 8005462576 276
691 iso_pu_bacteria 8005484373 8005490410 276
692 iso_pu_bacteria 8005497431 8005499958 276
693 iso_pu_bacteria 8005542996 8005547919 276
694 iso_pu_bacteria 8005556819 8005558054 276
695 iso_pu_bacteria 8005563573 8005569229 276
696 iso_pu_bacteria 8005570704 8005575486 276
697 iso_pu_bacteria 8005619151 8005621325 276
698 iso_pu_bacteria 8005626139 8005631386 276
699 iso_pu_bacteria 8005645114 8005647054 276
700 iso_pu_bacteria 8005668836 8005671374 276
701 iso_pu_bacteria 8005682033 8005686984 276
702 iso_pu_bacteria 8005688590 8005694907 276
703 iso_pu_bacteria 8005695170 8005696082 276
704 iso_pu_bacteria 8018127388 8018129615 276
705 iso_pu_bacteria 8018163183 8018168162 276
706 iso_pu_bacteria 8023680758 8023681021 276
707 iso_pu_bacteria 8024479707 8024485817 276
708 iso_pu_bacteria 8024486573 8024487224 276
709 iso_pu_bacteria 8024501048 8024505288 276
710 iso_pu_bacteria 8046767195 8046767383 276
711 iso_pu_bacteria 8056382006 8056387501 276
712 iso_pu_bacteria 8057575449 8057578491 276
713 iso_pu_bacteria 8057874678 8057875424 276
714 3300006038 Ga0075365_10011384 Ga0075365_100113845 277
715 3300006042 Ga0075368_10046801 Ga0075368_100468012 277
716 3300006178 Ga0075367_10010707 Ga0075367_100107073 277
717 3300015265 Ga0182005_1005419 Ga0182005_10054193 277
718 3300027866 Ga0209813_10013890 Ga0209813_100138902 277
719 3300039438 Ga0436360_0631865 Ga0436360_0631865_690_1637 277
720 3300046477 Ga0495664_0075500 Ga0495664_0075500_698_1642 277
721 3300048922 Ga0496119_0136800 Ga0496119_0136800_389_1303 277
722 3300048924 Ga0496121_0157630 Ga0496121_0157630_265_1200 277
723 3300049571 Ga0501034_0013702 Ga0501034_0013702_6053_7012 277
724 3300049571 Ga0501034_0323614 Ga0501034_0323614_77_1006 277
725 3300049671 Ga0501238_003101 Ga0501238_003101_560_1492 277
726 3300050495 nmdc:mga04h51_21929_c1 nmdc:mga04h51_21929_c1_767_1702 277
727 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004113 278
728 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001467 278
729 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001529 278
730 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002641 278
731 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005150 278
732 3300002987 JGI25159J45721_1001000 JGI25159J45721_10010001 278
733 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002277 278
734 3300003374 JGI25161J50226_1000024 JGI25161J50226_100002455 278
735 3300004625 Ga0055543_1000025 Ga0055543_100002577 278
736 3300005262 Ga0065165_1000200 Ga0065165_100020077 278
737 3300025206 Ga0209435_100009 Ga0209435_100009147 278
738 3300025208 Ga0209436_118015 Ga0209436_1180151 278
739 3300025246 Ga0209646_1000018 Ga0209646_1000018147 278
740 3300025250 Ga0209026_1000043 Ga0209026_1000043147 278
741 3300025256 Ga0209759_1000007 Ga0209759_1000007147 278
742 3300025284 Ga0209130_1000251 Ga0209130_100025155 278
743 3300025302 Ga0207426_1000082 Ga0207426_100008290 278
744 3300049571 Ga0501034_0187026 Ga0501034_0187026_726_1664 278
745 3300049589 Ga0501073_0134623 Ga0501073_0134623_472_1482 278
746 iso_pu_bacteria 2599185236 2599724259 278
747 iso_pu_bacteria 2995392953 2995395568 278
748 3300005536 Ga0070697_100023899 Ga0070697_1000238992 279
749 3300031456 Ga0307513_10021053 Ga0307513_100210534 279
750 3300049569 Ga0501032_0122718 Ga0501032_0122718_440_1375 279
751 3300049570 Ga0501033_0032940 Ga0501033_0032940_143_1078 279
752 3300049571 Ga0501034_0174705 Ga0501034_0174705_542_1477 279
753 iso_pu_bacteria 2891048133 2891051284 279
754 3300001979 JGI24740J21852_10000274 JGI24740J21852_100002742 280
755 3300002737 JGI25162J39368_1000930 JGI25162J39368_100093017 280
756 3300002739 JGI25158J39367_1000140 JGI25158J39367_10001406 280
757 3300002773 JGI25152J39213_1002440 JGI25152J39213_10024407 280
758 3300002773 JGI25152J39213_1002693 JGI25152J39213_10026934 280
759 3300002987 JGI25159J45721_1000260 JGI25159J45721_100026022 280
760 3300003187 JGI25151J46595_10000238 JGI25151J46595_1000023870 280
761 3300003187 JGI25151J46595_10028316 JGI25151J46595_100283162 280
762 3300003214 JGI25165J46597_1000715 JGI25165J46597_10007152 280
763 3300003215 JGI25153J46596_10005165 JGI25153J46596_100051652 280
764 3300003316 rootH1_10050195 rootH1_100501951 280
765 3300003354 JGI25160J50197_1006405 JGI25160J50197_10064052 280
766 3300003354 JGI25160J50197_1013391 JGI25160J50197_10133913 280
767 3300003374 JGI25161J50226_1000050 JGI25161J50226_100005026 280
768 3300003374 JGI25161J50226_1004866 JGI25161J50226_10048661 280
769 3300003771 Ga0055526_1001371 Ga0055526_100137112 280
770 3300003771 Ga0055526_1002463 Ga0055526_100246310 280
771 3300003771 Ga0055526_1022297 Ga0055526_10222972 280
772 3300003775 Ga0055524_1000880 Ga0055524_100088014 280
773 3300003775 Ga0055524_1005903 Ga0055524_10059033 280
774 3300003775 Ga0055524_1014378 Ga0055524_10143782 280
775 3300003790 Ga0055528_1000106 Ga0055528_100010643 280
776 3300003790 Ga0055528_1001160 Ga0055528_100116015 280
777 3300003790 Ga0055528_1002460 Ga0055528_10024609 280
778 3300003790 Ga0055528_1020224 Ga0055528_10202242 280
779 3300003792 Ga0055540_1000103 Ga0055540_100010327 280
780 3300003792 Ga0055540_1005697 Ga0055540_10056975 280
781 3300003792 Ga0055540_1015308 Ga0055540_10153082 280
782 3300003794 Ga0055531_10002344 Ga0055531_100023445 280
783 3300004625 Ga0055543_1000023 Ga0055543_100002344 280
784 3300004625 Ga0055543_1001443 Ga0055543_10014435 280
785 3300005262 Ga0065165_1010583 Ga0065165_10105832 280
786 3300005262 Ga0065165_1015319 Ga0065165_10153192 280
787 3300005262 Ga0065165_1016842 Ga0065165_10168421 280
788 3300005339 Ga0070660_100334670 Ga0070660_1003346702 280
789 3300005548 Ga0070665_100106324 Ga0070665_1001063242 280
790 3300005937 Ga0081455_10358414 Ga0081455_103584141 280
791 3300006048 Ga0075363_100058622 Ga0075363_1000586222 280
792 3300006048 Ga0075363_100111375 Ga0075363_1001113752 280
793 3300006051 Ga0075364_10112000 Ga0075364_101120002 280
794 3300006177 Ga0075362_10008554 Ga0075362_100085542 280
795 3300006186 Ga0075369_10013141 Ga0075369_100131413 280
796 3300009093 Ga0105240_10397442 Ga0105240_103974422 280
797 3300009545 Ga0105237_10000188 Ga0105237_1000018824 280
798 3300010375 Ga0105239_10010200 Ga0105239_1001020010 280
799 3300013100 Ga0157373_10094929 Ga0157373_100949292 280
800 3300013105 Ga0157369_10079367 Ga0157369_100793673 280
801 3300025208 Ga0209436_100053 Ga0209436_10005360 280
802 3300025233 Ga0209437_100057 Ga0209437_100057317 280
803 3300025245 Ga0207425_1001821 Ga0207425_10018214 280
804 3300025258 Ga0209129_1000016 Ga0209129_1000016425 280
805 3300025258 Ga0209129_1013604 Ga0209129_10136042 280
806 3300025261 Ga0209233_1000130 Ga0209233_1000130119 280
807 3300025272 Ga0209455_1006859 Ga0209455_10068592 280
808 3300025273 Ga0209673_1000005 Ga0209673_1000005205 280
809 3300025273 Ga0209673_1000139 Ga0209673_100013982 280
810 3300025273 Ga0209673_1002223 Ga0209673_10022232 280
811 3300025273 Ga0209673_1004169 Ga0209673_10041692 280
812 3300025284 Ga0209130_1000031 Ga0209130_100003174 280
813 3300025284 Ga0209130_1004762 Ga0209130_10047625 280
814 3300025292 Ga0209676_1017732 Ga0209676_10177322 280
815 3300025294 Ga0209025_1000126 Ga0209025_1000126159 280
816 3300025294 Ga0209025_1000237 Ga0209025_100023794 280
817 3300025294 Ga0209025_1002712 Ga0209025_10027125 280
818 3300025295 Ga0209564_1000331 Ga0209564_100033134 280
819 3300025295 Ga0209564_1000577 Ga0209564_100057724 280
820 3300025295 Ga0209564_1002036 Ga0209564_100203621 280
821 3300025295 Ga0209564_1003502 Ga0209564_10035027 280
822 3300025297 Ga0209758_1000931 Ga0209758_100093125 280
823 3300025297 Ga0209758_1001440 Ga0209758_100144014 280
824 3300025297 Ga0209758_1003844 Ga0209758_10038442 280
825 3300025298 Ga0209050_1004134 Ga0209050_10041348 280
826 3300025299 Ga0209256_1000299 Ga0209256_100029929 280
827 3300025299 Ga0209256_1000961 Ga0209256_100096114 280
828 3300025299 Ga0209256_1011278 Ga0209256_10112782 280
829 3300025299 Ga0209256_1015383 Ga0209256_10153833 280
830 3300025302 Ga0207426_1000042 Ga0207426_1000042336 280
831 3300025302 Ga0207426_1000290 Ga0207426_100029071 280
832 3300025303 Ga0209051_1000095 Ga0209051_100009549 280
833 3300025303 Ga0209051_1000950 Ga0209051_100095013 280
834 3300025303 Ga0209051_1030477 Ga0209051_10304772 280
835 3300025303 Ga0209051_1071002 Ga0209051_10710022 280
836 3300025304 Ga0209257_1011109 Ga0209257_10111094 280
837 3300025304 Ga0209257_1016144 Ga0209257_10161442 280
838 3300025972 Ga0207668_10516602 Ga0207668_105166022 280
839 3300027312 Ga0209371_1001153 Ga0209371_10011537 280
840 3300028379 Ga0268266_10000728 Ga0268266_1000072827 280
841 3300028794 Ga0307515_10029370 Ga0307515_100293706 280
842 3300030500 Ga0268256_1001230 Ga0268256_100123013 280
843 3300031995 Ga0307409_100225484 Ga0307409_1002254842 280
844 3300041451 Ga0451791_0306668 Ga0451791_0306668_79_1017 280
845 3300041458 Ga0451798_1010442 Ga0451798_1010442_289_1227 280
846 3300041463 Ga0451804_1133873 Ga0451804_1133873_655_1599 280
847 3300041491 Ga0451833_0067109 Ga0451833_0067109_172_1110 280
848 3300041496 Ga0451839_0001838 Ga0451839_0001838_1072_2010 280
849 3300041503 Ga0451847_0304978 Ga0451847_0304978_28_966 280
850 3300041512 Ga0451853_0324505 Ga0451853_0324505_437_1375 280
851 3300042007 Ga0439449_0043230 Ga0439449_0043230_531_1469 280
852 3300046474 Ga0495605_0075507 Ga0495605_0075507_198_1136 280
853 3300046492 Ga0495585_0012907 Ga0495585_0012907_1179_2117 280
854 3300046507 Ga0495606_0008440 Ga0495606_0008440_81_1019 280
855 3300046512 Ga0495610_0091406 Ga0495610_0091406_60_998 280
856 3300046515 Ga0495620_0038765 Ga0495620_0038765_449_1387 280
857 3300046522 Ga0495643_0005020 Ga0495643_0005020_3472_4410 280
858 3300046524 Ga0495648_0022370 Ga0495648_0022370_755_1693 280
859 3300046558 Ga0495633_0022066 Ga0495633_0022066_1029_1967 280
860 3300046660 Ga0495625_0130252 Ga0495625_0130252_214_1152 280
861 3300046691 Ga0495670_0051364 Ga0495670_0051364_883_1821 280
862 3300046692 Ga0495671_0139570 Ga0495671_0139570_185_1123 280
863 3300046694 Ga0495649_0018570 Ga0495649_0018570_28_966 280
864 3300046810 Ga0495660_0078075 Ga0495660_0078075_346_1284 280
865 3300047323 Ga0495683_0107685 Ga0495683_0107685_16_954 280
866 3300048909 Ga0496106_0000288 Ga0496106_0000288_31442_32380 280
867 3300048919 Ga0496116_0000042 Ga0496116_0000042_112890_113885 280
868 3300048919 Ga0496116_0024746 Ga0496116_0024746_1880_2818 280
869 3300048921 Ga0496118_0011735 Ga0496118_0011735_4159_5097 280
870 3300048921 Ga0496118_0112514 Ga0496118_0112514_238_1197 280
871 3300048922 Ga0496119_0130517 Ga0496119_0130517_211_1224 280
872 3300048924 Ga0496121_0008563 Ga0496121_0008563_6036_6974 280
873 3300048924 Ga0496121_0058530 Ga0496121_0058530_329_1267 280
874 3300048924 Ga0496121_0069238 Ga0496121_0069238_1342_2280 280
875 3300048924 Ga0496121_0195744 Ga0496121_0195744_304_1245 280
876 3300048925 Ga0496122_0177009 Ga0496122_0177009_169_1182 280
877 3300048926 Ga0496123_0125841 Ga0496123_0125841_400_1338 280
878 3300048927 Ga0496124_0049873 Ga0496124_0049873_2195_3133 280
879 3300048927 Ga0496124_0164243 Ga0496124_0164243_88_1083 280
880 3300048929 Ga0496126_0000053 Ga0496126_0000053_176764_177759 280
881 3300048929 Ga0496126_0031713 Ga0496126_0031713_2145_3083 280
882 3300048929 Ga0496126_0031811 Ga0496126_0031811_1418_2359 280
883 3300049569 Ga0501032_0014474 Ga0501032_0014474_2655_3599 280
884 3300049574 Ga0501038_0046382 Ga0501038_0046382_579_1523 280
885 3300049580 Ga0501046_0181680 Ga0501046_0181680_231_1175 280
886 3300049586 Ga0501070_0027205 Ga0501070_0027205_667_1611 280
887 3300049822 Ga0501035_0093121 Ga0501035_0093121_810_1754 280
888 3300049823 Ga0501044_0004981 Ga0501044_0004981_10617_11561 280
889 3300050490 nmdc:mga03n38_30649_c1 nmdc:mga03n38_30649_c1_567_1505 280
890 3300053086 Ga0500578_0084843 Ga0500578_0084843_450_1388 280
891 3300053125 Ga0500618_000204 Ga0500618_000204_4281_5222 280
892 3300053134 Ga0500658_0000086 Ga0500658_0000086_10286_11224 280
893 3300053139 Ga0500568_0007952 Ga0500568_0007952_2889_3827 280
894 3300053153 Ga0500616_0000164 Ga0500616_0000164_99822_100790 280
895 3300053156 Ga0500622_0000559 Ga0500622_0000559_29768_30706 280
896 3300053161 Ga0500634_0010912 Ga0500634_0010912_444_1382 280
897 iso_pu_bacteria 2513237084 2513569939 280
898 iso_pu_bacteria 2718218232 2720613006 280
899 iso_pu_bacteria 2718218235 2720631284 280
900 iso_pu_bacteria 2718218269 2720775011 280
901 iso_pu_bacteria 2721755685 2723566831 280
902 iso_pu_bacteria 2721755819 2724089618 280
903 iso_pu_bacteria 2721755822 2724104096 280
904 iso_pu_bacteria 2751185821 2753463911 280
905 iso_pu_bacteria 2791355267 2793366493 280
906 iso_pu_bacteria 2850079185 2850082537 280
907 iso_pu_bacteria 2933599457 2933602215 280
908 iso_pu_bacteria 8005282627 8005288335 280
909 iso_pu_bacteria 8018176218 8018177947 280
910 iso_pu_bacteria 8054460903 8054464317 280
911 iso_pu_bacteria 8056375014 8056380205 280

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

138

343

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8968 13 276
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.89 13 276
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8825 13 276
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.8734 13 276
4xtc-assembly1.cif.gz_M crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein 0.8546 13 278
ID Description Score Start End Superfamily
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9136 40 279 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9047 13 272 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9028 40 279 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8936 41 279 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8915 41 274 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0S6UP24-F1-model_v4 Hypothetical ABC transporter permease protein yurN 0.9612 19 280 GO:0005886
GO:0055085
AF-A0A0S6UP24-F1-model_v4 Hypothetical ABC transporter permease protein yurN 0.9542 19 280 GO:0005886
GO:0055085
AF-A0A074TH60-F1-model_v4 Sugar ABC transporter permease 0.9528 13 279 GO:0005886
GO:0055085
AF-A0A8A6KC01-F1-model_v4 deleted 0.9519 13 280
AF-A0A7T8XUY2-F1-model_v4 deleted 0.9466 13 278

Feature Viewer

pLDDT pTM Quality
82.01 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map