F485487
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 911 | 759 | 394 | 304 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237084|2513569939 |
| Length | 344 |
| Sequence | KVLERPYRVLLDAGRSKSGAPALLPTRCESRTMANISVPSITTVARPAKRAANSKSSVAHDRLAVLLIFLPPALLLFTLFVIMPMGEAAWYSLYKWNGYGTPTEFIALRNFQVLFRNAAFTQALVNNGLIIVISICIQVPLAIWLATMLAHRIPGVVGYRLIFFLPYVLADVAAGLIWRFVYDGDYGLFAAVSNFFGFANPYVLADKDVAIYAVLGVIVWKYFGFHMMLFIAGLQSVDKSVLEAAEIDGATGWQKFRYVTLPLLGSTLRLSIFFAVVGSLQLFDMIMPLTGGGPSNSTQTMVTFLYTYGVMRMQVGLGSAVGVVLFIICVTLAFGYKRIFMRHD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 2 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 3 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 4 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 5 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 6 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 14 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 15 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 16 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 17 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 18 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 19 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 20 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 21 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 22 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 23 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 24 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 25 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 26 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 27 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 28 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 29 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 30 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 31 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 32 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 33 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 34 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 35 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 36 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 37 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 38 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 39 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 40 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 41 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 42 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 43 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 44 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 45 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 46 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 47 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 48 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 49 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 50 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 51 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 52 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 53 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 54 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 55 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 56 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 57 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 58 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 59 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 60 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 61 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 62 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 63 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 64 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 65 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 66 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 67 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 68 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 69 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 70 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 71 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 72 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 73 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 74 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 75 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 76 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 77 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 78 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 79 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 80 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 81 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 82 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 83 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 84 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 85 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 86 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 87 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 88 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 89 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 90 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 91 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 92 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 93 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 94 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 95 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 96 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 97 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 98 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 99 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 100 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 101 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 102 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 103 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 104 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 105 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 106 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 107 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 108 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 109 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 110 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 111 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 112 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 113 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 114 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 115 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 116 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 117 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 118 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 119 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 120 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 121 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 122 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 123 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 124 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 125 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 126 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 127 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 128 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 129 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 130 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 131 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 132 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 133 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 134 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 135 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 136 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 137 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 138 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 139 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 140 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 141 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 142 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 143 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 144 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 145 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 146 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 147 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 148 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 149 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 150 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 151 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 152 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 153 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 154 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 155 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 156 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 157 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 158 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 159 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 160 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 161 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 162 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 163 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 164 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 165 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 166 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 167 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 168 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 169 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 170 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 171 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 172 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 173 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 174 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 175 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 176 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 177 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 178 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 179 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 180 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 181 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 182 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 183 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 184 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 185 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 186 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 187 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 188 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 189 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 190 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 191 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 192 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 193 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 194 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 195 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 196 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 197 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 198 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 199 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 200 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 201 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 202 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 203 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 204 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 205 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 206 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 207 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 208 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 209 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 210 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 211 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 212 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 213 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 214 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 215 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 216 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 217 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 218 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 219 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 220 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 221 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 222 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 223 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 224 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 225 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 226 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 227 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 228 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 229 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 230 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 231 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 232 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 233 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 234 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 235 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 236 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 237 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 238 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 239 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 240 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 241 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 242 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 243 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 244 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 245 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 246 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 247 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 248 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 249 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 250 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 251 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 252 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 253 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 254 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 255 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 256 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 257 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 258 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 259 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 260 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 261 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 262 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 263 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 264 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 265 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 266 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 267 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 268 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 269 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 270 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 271 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 272 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 273 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 274 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 275 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 276 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 277 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 278 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 279 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 280 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 281 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 282 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 283 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 284 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 285 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 286 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 287 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 288 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 289 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 290 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 291 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 292 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 293 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 294 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 295 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 296 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 297 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 298 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 299 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 300 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 301 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 302 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 303 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 304 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 305 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 306 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 307 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 308 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 309 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 310 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 311 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 312 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 313 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 314 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 315 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 316 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 317 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 318 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 319 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 320 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 321 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 322 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 323 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 324 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 325 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 326 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 327 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 328 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 329 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 330 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 331 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 332 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 333 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 334 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 335 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 336 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 337 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 338 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 339 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 340 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 341 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 342 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 343 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 344 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 345 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 346 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 347 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 348 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 349 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 350 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 351 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 352 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 353 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 354 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 355 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 356 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 357 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 358 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 359 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 360 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 361 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 362 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 363 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 364 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 365 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 366 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 367 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 368 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 369 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 370 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 371 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 372 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 373 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 374 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 375 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 376 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 377 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 378 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 379 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 380 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 381 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 382 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 383 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 384 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 385 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 386 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 387 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 388 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 389 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 390 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 391 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 392 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 393 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 394 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 395 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 396 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 397 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 398 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 399 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 400 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 401 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 402 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 403 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 404 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 405 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 406 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 407 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 408 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 409 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 410 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 411 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 412 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 413 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 414 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 415 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 416 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 417 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 418 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 419 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 420 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 421 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 422 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 423 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 424 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 425 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 426 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 427 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 428 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 429 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 430 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 431 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 432 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 433 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 434 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 435 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 436 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 437 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 438 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 439 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 440 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 441 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 442 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 443 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 444 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 445 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 446 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 447 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 448 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 449 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 450 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 451 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 452 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 453 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 454 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 455 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 456 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 457 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 458 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 459 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 460 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 461 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 462 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 463 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 464 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 465 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 466 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 467 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 468 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 469 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 470 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 471 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 472 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 473 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 474 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 475 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 476 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 477 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 478 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 479 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 480 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 481 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 482 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 483 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 484 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 485 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 486 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 487 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 488 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 489 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 490 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 491 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 492 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 493 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 494 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 495 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 496 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 497 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 498 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 499 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 500 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 501 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 502 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 503 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 504 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 505 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 506 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 507 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 508 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 509 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 510 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 511 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 512 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 513 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 514 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 515 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 516 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 517 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 518 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 519 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 520 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 521 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 522 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 523 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 524 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 525 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 526 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 527 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 528 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 529 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 530 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 531 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 532 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 533 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 534 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 535 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 536 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 537 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 538 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 539 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 540 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 541 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 542 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 543 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 544 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 545 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 546 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 547 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 548 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 549 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 550 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 551 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 552 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 553 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 554 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 555 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 556 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 557 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 558 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 559 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 560 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 561 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 562 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 563 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 564 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 565 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 566 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 567 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 568 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 569 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 570 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 571 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 572 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 573 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 574 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 575 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 576 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 577 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 578 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 579 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 580 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 581 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 582 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 583 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 584 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 585 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 586 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 587 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 588 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 589 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 590 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 591 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 592 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 593 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 594 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 595 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 596 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 597 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 598 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 599 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 600 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 601 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 602 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 603 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 604 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 605 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 606 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 607 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 608 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 609 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 610 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 611 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 612 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 613 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 614 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 615 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 616 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 617 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 618 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 619 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 620 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 621 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 622 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 623 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 624 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 625 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 626 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 627 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 628 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 629 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 650 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 651 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 652 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 653 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 654 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 655 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 656 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 657 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 658 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 659 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 660 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 661 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 662 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 663 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 664 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 665 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 666 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 667 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 668 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 669 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 670 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 671 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 672 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 673 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 674 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 675 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 676 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 677 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 678 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 679 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 680 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 681 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 682 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 683 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 684 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 685 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 686 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 687 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 688 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 691 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 692 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 693 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 694 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 695 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 696 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 697 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 698 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 699 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 700 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 701 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 702 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 703 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 704 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 705 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 706 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 707 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 708 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 709 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 710 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 711 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 712 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 713 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 714 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 715 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 716 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 717 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 718 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 719 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 720 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 721 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 722 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 723 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 724 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 725 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 726 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 727 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 728 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 729 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 730 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 731 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 732 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 733 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 734 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 735 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 736 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 737 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 738 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 739 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 740 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 741 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 742 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 743 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 744 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 745 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 746 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 747 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 748 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 749 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 750 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 751 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 752 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 753 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 754 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 755 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 756 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 757 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
| 758 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 759 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 43.14 |
| Metatranscriptomes | 0.22 |
| Isolates | 56.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.55 |
| Bulb | 0 |
| Endosphere | 14.6 |
| Nodule | 44.9 |
| Rhizoplane | 1.76 |
| Rhizosphere | 25.58 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000274 | 3300001979 | Bacteria | 21830 |
| 2 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 3 | JGI25156J39149_1000014 | 3300002705 | Bacteria | 189257 |
| 4 | JGI25156J39149_1000015 | 3300002705 | Bacteria | 181949 |
| 5 | JGI25162J39368_1000930 | 3300002737 | Bacteria | 18809 |
| 6 | JGI25154J39366_1000026 | 3300002738 | Bacteria | 200613 |
| 7 | JGI25158J39367_1000140 | 3300002739 | Bacteria | 16957 |
| 8 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 9 | JGI25152J39213_1002440 | 3300002773 | Bacteria | 7071 |
| 10 | JGI25152J39213_1002693 | 3300002773 | Bacteria | 6516 |
| 11 | JGI25150J39212_1006970 | 3300002774 | Bacteria | 2298 |
| 12 | JGI25159J45721_1000260 | 3300002987 | Bacteria | 24641 |
| 13 | JGI25159J45721_1001000 | 3300002987 | Bacteria | 12200 |
| 14 | JGI25151J46595_10000238 | 3300003187 | Bacteria | 64884 |
| 15 | JGI25151J46595_10013544 | 3300003187 | Bacteria | 3665 |
| 16 | JGI25151J46595_10028316 | 3300003187 | Bacteria | 2233 |
| 17 | JGI25165J46597_1000715 | 3300003214 | Bacteria | 26079 |
| 18 | JGI25153J46596_10005165 | 3300003215 | Bacteria | 6875 |
| 19 | JGI25153J46596_10009689 | 3300003215 | Bacteria | 4437 |
| 20 | rootH1_10050195 | 3300003316 | Bacteria | 2603 |
| 21 | JGI25160J50197_1000022 | 3300003354 | Bacteria | 201071 |
| 22 | JGI25160J50197_1006405 | 3300003354 | Bacteria | 4768 |
| 23 | JGI25160J50197_1013391 | 3300003354 | Bacteria | 2797 |
| 24 | JGI25161J50226_1000024 | 3300003374 | Bacteria | 152176 |
| 25 | JGI25161J50226_1000050 | 3300003374 | Bacteria | 110628 |
| 26 | JGI25161J50226_1004866 | 3300003374 | Bacteria | 2734 |
| 27 | Ga0055526_1001371 | 3300003771 | Bacteria | 17456 |
| 28 | Ga0055526_1002463 | 3300003771 | Bacteria | 12518 |
| 29 | Ga0055526_1022297 | 3300003771 | Bacteria | 2159 |
| 30 | Ga0055524_1000880 | 3300003775 | Bacteria | 19576 |
| 31 | Ga0055524_1005903 | 3300003775 | Bacteria | 5394 |
| 32 | Ga0055524_1014378 | 3300003775 | Bacteria | 2934 |
| 33 | Ga0055528_1000106 | 3300003790 | Bacteria | 67208 |
| 34 | Ga0055528_1001160 | 3300003790 | Bacteria | 17054 |
| 35 | Ga0055528_1002460 | 3300003790 | Bacteria | 9911 |
| 36 | Ga0055528_1020224 | 3300003790 | Bacteria | 2168 |
| 37 | Ga0055540_1000103 | 3300003792 | Bacteria | 94710 |
| 38 | Ga0055540_1001450 | 3300003792 | Bacteria | 14122 |
| 39 | Ga0055540_1005697 | 3300003792 | Bacteria | 5148 |
| 40 | Ga0055540_1015308 | 3300003792 | Bacteria | 2240 |
| 41 | Ga0055531_10002344 | 3300003794 | Bacteria | 12752 |
| 42 | Ga0055543_1000023 | 3300004625 | Bacteria | 140513 |
| 43 | Ga0055543_1000025 | 3300004625 | Bacteria | 137886 |
| 44 | Ga0055543_1001443 | 3300004625 | Bacteria | 9431 |
| 45 | Ga0065165_1000200 | 3300005262 | Bacteria | 103564 |
| 46 | Ga0065165_1010583 | 3300005262 | Bacteria | 3962 |
| 47 | Ga0065165_1015319 | 3300005262 | Bacteria | 2928 |
| 48 | Ga0065165_1016842 | 3300005262 | Bacteria | 2717 |
| 49 | Ga0065704_10099334 | 3300005289 | Bacteria | 2316 |
| 50 | Ga0065707_10086155 | 3300005295 | Bacteria | 5629 |
| 51 | Ga0068869_100139575 | 3300005334 | Bacteria | 1870 |
| 52 | Ga0070682_100278482 | 3300005337 | Bacteria | 1218 |
| 53 | Ga0070660_100334670 | 3300005339 | Bacteria | 1245 |
| 54 | Ga0070669_100085057 | 3300005353 | Bacteria | 2361 |
| 55 | Ga0070674_100064095 | 3300005356 | Bacteria | 2574 |
| 56 | Ga0070714_100375601 | 3300005435 | Bacteria | 1339 |
| 57 | Ga0070700_100018816 | 3300005441 | Bacteria | 3977 |
| 58 | Ga0070708_100010723 | 3300005445 | Bacteria | 7437 |
| 59 | Ga0070678_100010927 | 3300005456 | Bacteria | 5572 |
| 60 | Ga0070678_100515330 | 3300005456 | Bacteria | 1057 |
| 61 | Ga0070678_100571440 | 3300005456 | Bacteria | 1006 |
| 62 | Ga0068867_100005603 | 3300005459 | Bacteria | 8896 |
| 63 | Ga0070706_100173652 | 3300005467 | Bacteria | 2012 |
| 64 | Ga0070706_100385952 | 3300005467 | Unclassified | 1304 |
| 65 | Ga0070707_100053165 | 3300005468 | Unclassified | 3883 |
| 66 | Ga0070698_100000683 | 3300005471 | Bacteria | 36267 |
| 67 | Ga0070699_100010118 | 3300005518 | Bacteria | 8166 |
| 68 | Ga0070697_100023899 | 3300005536 | Bacteria | 4863 |
| 69 | Ga0070697_100036048 | 3300005536 | Bacteria | 3994 |
| 70 | Ga0068853_100002653 | 3300005539 | Bacteria | 13491 |
| 71 | Ga0070672_100003609 | 3300005543 | Bacteria | 10033 |
| 72 | Ga0070672_100205484 | 3300005543 | Bacteria | 1648 |
| 73 | Ga0070665_100041738 | 3300005548 | Bacteria | 4612 |
| 74 | Ga0070665_100106324 | 3300005548 | Bacteria | 2808 |
| 75 | Ga0070665_100312963 | 3300005548 | Bacteria | 1574 |
| 76 | Ga0070664_100323372 | 3300005564 | Bacteria | 1398 |
| 77 | Ga0068859_100112421 | 3300005617 | Bacteria | 2787 |
| 78 | Ga0068863_100068199 | 3300005841 | Bacteria | 3365 |
| 79 | Ga0068858_100196888 | 3300005842 | Bacteria | 1904 |
| 80 | Ga0068860_100007737 | 3300005843 | Bacteria | 10738 |
| 81 | Ga0068860_100104396 | 3300005843 | Bacteria | 2705 |
| 82 | Ga0068862_100015023 | 3300005844 | Bacteria | 6430 |
| 83 | Ga0081455_10063610 | 3300005937 | Bacteria | 3095 |
| 84 | Ga0081455_10358414 | 3300005937 | Bacteria | 1026 |
| 85 | Ga0070717_10008768 | 3300006028 | Bacteria | 7570 |
| 86 | Ga0070717_10100395 | 3300006028 | Unclassified | 2457 |
| 87 | Ga0075365_10011384 | 3300006038 | Bacteria | 5229 |
| 88 | Ga0075365_10084238 | 3300006038 | Bacteria | 2157 |
| 89 | Ga0075368_10006397 | 3300006042 | Bacteria | 4111 |
| 90 | Ga0075368_10041422 | 3300006042 | Bacteria | 1809 |
| 91 | Ga0075368_10046801 | 3300006042 | Bacteria | 1712 |
| 92 | Ga0075363_100058622 | 3300006048 | Bacteria | 2068 |
| 93 | Ga0075363_100111375 | 3300006048 | Bacteria | 1522 |
| 94 | Ga0075364_10006628 | 3300006051 | Bacteria | 6821 |
| 95 | Ga0075364_10112000 | 3300006051 | Bacteria | 1822 |
| 96 | Ga0070712_100167100 | 3300006175 | Bacteria | 1704 |
| 97 | Ga0075362_10002240 | 3300006177 | Bacteria | 6436 |
| 98 | Ga0075362_10008554 | 3300006177 | Bacteria | 3920 |
| 99 | Ga0075367_10010707 | 3300006178 | Bacteria | 4828 |
| 100 | Ga0075369_10013141 | 3300006186 | Bacteria | 3279 |
| 101 | Ga0075366_10019997 | 3300006195 | Bacteria | 3881 |
| 102 | Ga0075370_10004585 | 3300006353 | Bacteria | 6736 |
| 103 | Ga0068865_100017435 | 3300006881 | Bacteria | 4617 |
| 104 | Ga0097620_100112427 | 3300006931 | Bacteria | 2787 |
| 105 | Ga0097620_100137443 | 3300006931 | Bacteria | 2517 |
| 106 | Ga0099826_10001105 | 3300006948 | Bacteria | 15404 |
| 107 | Ga0105240_10397442 | 3300009093 | Bacteria | 1553 |
| 108 | Ga0105243_10003302 | 3300009148 | Bacteria | 13098 |
| 109 | Ga0105243_10231545 | 3300009148 | Bacteria | 1639 |
| 110 | Ga0105241_10152911 | 3300009174 | Bacteria | 1889 |
| 111 | Ga0105237_10000188 | 3300009545 | Bacteria | 87497 |
| 112 | Ga0105237_10699753 | 3300009545 | Bacteria | 1020 |
| 113 | Ga0105249_10132075 | 3300009553 | Bacteria | 2385 |
| 114 | Ga0105249_10435134 | 3300009553 | Bacteria | 1348 |
| 115 | Ga0123341_1000095 | 3300009765 | Bacteria | 37499 |
| 116 | Ga0123342_1014091 | 3300009766 | Bacteria | 7761 |
| 117 | Ga0105239_10010200 | 3300010375 | Bacteria | 10524 |
| 118 | Ga0157373_10001757 | 3300013100 | Bacteria | 16491 |
| 119 | Ga0157373_10094929 | 3300013100 | Bacteria | 2099 |
| 120 | Ga0157373_10247589 | 3300013100 | Bacteria | 1260 |
| 121 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 122 | Ga0157370_10000211 | 3300013104 | Bacteria | 74012 |
| 123 | Ga0157369_10011908 | 3300013105 | Bacteria | 9878 |
| 124 | Ga0157369_10079367 | 3300013105 | Bacteria | 3515 |
| 125 | Ga0157378_10247293 | 3300013297 | Bacteria | 1706 |
| 126 | Ga0157378_10380163 | 3300013297 | Bacteria | 1387 |
| 127 | Ga0163162_10009513 | 3300013306 | Bacteria | 9453 |
| 128 | Ga0163162_10190716 | 3300013306 | Bacteria | 2177 |
| 129 | Ga0157375_10013667 | 3300013308 | Bacteria | 7237 |
| 130 | Ga0157380_10017418 | 3300014326 | Bacteria | 5316 |
| 131 | Ga0182008_10003079 | 3300014497 | Bacteria | 10241 |
| 132 | Ga0157379_10024269 | 3300014968 | Bacteria | 5383 |
| 133 | Ga0157376_10339119 | 3300014969 | Bacteria | 1435 |
| 134 | Ga0182007_10001612 | 3300015262 | Bacteria | 11981 |
| 135 | Ga0182005_1005419 | 3300015265 | Bacteria | 3988 |
| 136 | Ga0183362_10002 | 3300015683 | Bacteria | 1432711 |
| 137 | Ga0163161_10059617 | 3300017792 | Bacteria | 2776 |
| 138 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 139 | Ga0209436_100053 | 3300025208 | Bacteria | 63474 |
| 140 | Ga0209436_118015 | 3300025208 | Bacteria | 1016 |
| 141 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 142 | Ga0207425_1001821 | 3300025245 | Bacteria | 8251 |
| 143 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 144 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 145 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 146 | Ga0209129_1000016 | 3300025258 | Bacteria | 485491 |
| 147 | Ga0209129_1013604 | 3300025258 | Bacteria | 1781 |
| 148 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 149 | Ga0209455_1006859 | 3300025272 | Bacteria | 3309 |
| 150 | Ga0209673_1000005 | 3300025273 | Bacteria | 692788 |
| 151 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 152 | Ga0209673_1002223 | 3300025273 | Bacteria | 14103 |
| 153 | Ga0209673_1004169 | 3300025273 | Bacteria | 7904 |
| 154 | Ga0209130_1000031 | 3300025284 | Bacteria | 322932 |
| 155 | Ga0209130_1000251 | 3300025284 | Bacteria | 67741 |
| 156 | Ga0209130_1004762 | 3300025284 | Bacteria | 5015 |
| 157 | Ga0209676_1017732 | 3300025292 | Bacteria | 2508 |
| 158 | Ga0209025_1000126 | 3300025294 | Bacteria | 200866 |
| 159 | Ga0209025_1000237 | 3300025294 | Bacteria | 128553 |
| 160 | Ga0209025_1002704 | 3300025294 | Bacteria | 18049 |
| 161 | Ga0209025_1002712 | 3300025294 | Bacteria | 17992 |
| 162 | Ga0209564_1000331 | 3300025295 | Bacteria | 91919 |
| 163 | Ga0209564_1000577 | 3300025295 | Bacteria | 58129 |
| 164 | Ga0209564_1002036 | 3300025295 | Bacteria | 17487 |
| 165 | Ga0209564_1003502 | 3300025295 | Bacteria | 10647 |
| 166 | Ga0209758_1000903 | 3300025297 | Bacteria | 40307 |
| 167 | Ga0209758_1000931 | 3300025297 | Bacteria | 39600 |
| 168 | Ga0209758_1001250 | 3300025297 | Bacteria | 31516 |
| 169 | Ga0209758_1001440 | 3300025297 | Bacteria | 28025 |
| 170 | Ga0209758_1003844 | 3300025297 | Bacteria | 13177 |
| 171 | Ga0209050_1004134 | 3300025298 | Bacteria | 10072 |
| 172 | Ga0209256_1000299 | 3300025299 | Bacteria | 86909 |
| 173 | Ga0209256_1000961 | 3300025299 | Bacteria | 34812 |
| 174 | Ga0209256_1011278 | 3300025299 | Bacteria | 3599 |
| 175 | Ga0209256_1015383 | 3300025299 | Bacteria | 2681 |
| 176 | Ga0207426_1000042 | 3300025302 | Bacteria | 433289 |
| 177 | Ga0207426_1000082 | 3300025302 | Bacteria | 298939 |
| 178 | Ga0207426_1000290 | 3300025302 | Bacteria | 99519 |
| 179 | Ga0209051_1000095 | 3300025303 | Bacteria | 167840 |
| 180 | Ga0209051_1000950 | 3300025303 | Bacteria | 28418 |
| 181 | Ga0209051_1001462 | 3300025303 | Bacteria | 20029 |
| 182 | Ga0209051_1030477 | 3300025303 | Bacteria | 2092 |
| 183 | Ga0209051_1071002 | 3300025303 | Bacteria | 1048 |
| 184 | Ga0209257_1001831 | 3300025304 | Bacteria | 23241 |
| 185 | Ga0209257_1011109 | 3300025304 | Bacteria | 4401 |
| 186 | Ga0209257_1016144 | 3300025304 | Bacteria | 3045 |
| 187 | Ga0209257_1034763 | 3300025304 | Bacteria | 1567 |
| 188 | Ga0207682_10104749 | 3300025893 | Bacteria | 1240 |
| 189 | Ga0207642_10047277 | 3300025899 | Bacteria | 1923 |
| 190 | Ga0207647_10044578 | 3300025904 | Bacteria | 2770 |
| 191 | Ga0207684_10117644 | 3300025910 | Bacteria | 2277 |
| 192 | Ga0207646_10033232 | 3300025922 | Unclassified | 4667 |
| 193 | Ga0207694_10136647 | 3300025924 | Bacteria | 1969 |
| 194 | Ga0207709_10035969 | 3300025935 | Bacteria | 2932 |
| 195 | Ga0207704_10011032 | 3300025938 | Bacteria | 4433 |
| 196 | Ga0207691_10021819 | 3300025940 | Bacteria | 6044 |
| 197 | Ga0207691_10076699 | 3300025940 | Bacteria | 3012 |
| 198 | Ga0207689_10080788 | 3300025942 | Bacteria | 2672 |
| 199 | Ga0207679_10221969 | 3300025945 | Bacteria | 1590 |
| 200 | Ga0207668_10516602 | 3300025972 | Bacteria | 1030 |
| 201 | Ga0207639_10020434 | 3300026041 | Bacteria | 4740 |
| 202 | Ga0207639_10065746 | 3300026041 | Bacteria | 2816 |
| 203 | Ga0207678_10213137 | 3300026067 | Bacteria | 1652 |
| 204 | Ga0207708_10031924 | 3300026075 | Bacteria | 4000 |
| 205 | Ga0207648_10004328 | 3300026089 | Bacteria | 14625 |
| 206 | Ga0207675_100001137 | 3300026118 | Bacteria | 26351 |
| 207 | Ga0207675_100140317 | 3300026118 | Bacteria | 2295 |
| 208 | Ga0207683_10010219 | 3300026121 | Bacteria | 8006 |
| 209 | Ga0207683_10133634 | 3300026121 | Bacteria | 2232 |
| 210 | Ga0207683_10207260 | 3300026121 | Bacteria | 1783 |
| 211 | Ga0209371_1000012 | 3300027312 | Bacteria | 748304 |
| 212 | Ga0209371_1001153 | 3300027312 | Bacteria | 19333 |
| 213 | Ga0209371_1008000 | 3300027312 | Bacteria | 3580 |
| 214 | Ga0209813_10002465 | 3300027866 | Bacteria | 4236 |
| 215 | Ga0209813_10013890 | 3300027866 | Bacteria | 2158 |
| 216 | Ga0209813_10020257 | 3300027866 | Bacteria | 1859 |
| 217 | Ga0268266_10000728 | 3300028379 | Bacteria | 44205 |
| 218 | Ga0268266_10069055 | 3300028379 | Bacteria | 3061 |
| 219 | Ga0268265_10002980 | 3300028380 | Bacteria | 12384 |
| 220 | Ga0268265_10016306 | 3300028380 | Bacteria | 5100 |
| 221 | Ga0268264_10002471 | 3300028381 | Bacteria | 16246 |
| 222 | Ga0268264_10385782 | 3300028381 | Bacteria | 1342 |
| 223 | Ga0307515_10029370 | 3300028794 | Bacteria | 9295 |
| 224 | Ga0268256_1000013 | 3300030500 | Bacteria | 752103 |
| 225 | Ga0268256_1001230 | 3300030500 | Bacteria | 16198 |
| 226 | Ga0307513_10021053 | 3300031456 | Bacteria | 7708 |
| 227 | Ga0307516_10033201 | 3300031730 | Bacteria | 5193 |
| 228 | Ga0307405_10086071 | 3300031731 | Bacteria | 2068 |
| 229 | Ga0307412_10215704 | 3300031911 | Bacteria | 1468 |
| 230 | Ga0307409_100225484 | 3300031995 | Bacteria | 1695 |
| 231 | Ga0307415_100227527 | 3300032126 | Bacteria | 1499 |
| 232 | Ga0373923_0014931 | 3300035111 | Bacteria | 2925 |
| 233 | Ga0373946_0040860 | 3300035171 | Bacteria | 1900 |
| 234 | Ga0373935_0083954 | 3300035692 | Bacteria | 2074 |
| 235 | Ga0373927_0183007 | 3300035695 | Bacteria | 1375 |
| 236 | Ga0373933_0143145 | 3300035724 | Bacteria | 1510 |
| 237 | Ga0373937_0024706 | 3300036401 | Bacteria | 5422 |
| 238 | Ga0395900_0592471 | 3300037418 | Bacteria | 1050 |
| 239 | Ga0395898_0192241 | 3300037466 | Bacteria | 1950 |
| 240 | Ga0395898_0232159 | 3300037466 | Bacteria | 1759 |
| 241 | Ga0395905_0011131 | 3300037471 | Bacteria | 8701 |
| 242 | Ga0237819_10937 | 3300038705 | Bacteria | 1168 |
| 243 | Ga0436360_0181196 | 3300039438 | Bacteria | 3942 |
| 244 | Ga0436360_0631865 | 3300039438 | Bacteria | 2828 |
| 245 | Ga0436363_0080435 | 3300039450 | Bacteria | 16873 |
| 246 | Ga0451791_0306668 | 3300041451 | Bacteria | 1236 |
| 247 | Ga0451798_1010442 | 3300041458 | Bacteria | 1356 |
| 248 | Ga0451804_1133873 | 3300041463 | Bacteria | 1626 |
| 249 | Ga0451833_0067109 | 3300041491 | Bacteria | 2290 |
| 250 | Ga0451839_0001838 | 3300041496 | Bacteria | 2040 |
| 251 | Ga0451847_0304978 | 3300041503 | Bacteria | 2085 |
| 252 | Ga0451843_0634892 | 3300041509 | Bacteria | 1941 |
| 253 | Ga0451853_0324505 | 3300041512 | Bacteria | 1715 |
| 254 | Ga0439449_0043230 | 3300042007 | Bacteria | 1673 |
| 255 | Ga0466960_0039614 | 3300044901 | Bacteria | 2224 |
| 256 | Ga0495592_0107470 | 3300046454 | Bacteria | 1979 |
| 257 | Ga0495605_0075507 | 3300046474 | Bacteria | 1585 |
| 258 | Ga0495664_0075500 | 3300046477 | Bacteria | 2017 |
| 259 | Ga0495664_0105165 | 3300046477 | Bacteria | 1702 |
| 260 | Ga0495664_0106357 | 3300046477 | Bacteria | 1692 |
| 261 | Ga0495585_0012907 | 3300046492 | Bacteria | 4910 |
| 262 | Ga0495583_0008439 | 3300046506 | Bacteria | 6294 |
| 263 | Ga0495606_0008440 | 3300046507 | Bacteria | 8948 |
| 264 | Ga0495610_0091406 | 3300046512 | Bacteria | 1379 |
| 265 | Ga0495620_0038765 | 3300046515 | Bacteria | 2112 |
| 266 | Ga0495643_0005020 | 3300046522 | Bacteria | 9066 |
| 267 | Ga0495643_0014621 | 3300046522 | Bacteria | 4664 |
| 268 | Ga0495648_0022370 | 3300046524 | Bacteria | 4354 |
| 269 | Ga0495640_0062394 | 3300046533 | Bacteria | 2528 |
| 270 | Ga0495587_0132874 | 3300046536 | Bacteria | 1422 |
| 271 | Ga0495633_0022066 | 3300046558 | Bacteria | 3173 |
| 272 | Ga0495633_0026340 | 3300046558 | Bacteria | 2854 |
| 273 | Ga0495625_0130252 | 3300046660 | Bacteria | 1704 |
| 274 | Ga0495588_0001204 | 3300046674 | Bacteria | 11140 |
| 275 | Ga0495657_0138142 | 3300046675 | Bacteria | 1521 |
| 276 | Ga0495599_0052832 | 3300046678 | Bacteria | 2546 |
| 277 | Ga0495599_0311899 | 3300046678 | Bacteria | 948 |
| 278 | Ga0495658_0132694 | 3300046683 | Bacteria | 1517 |
| 279 | Ga0495670_0051364 | 3300046691 | Bacteria | 2063 |
| 280 | Ga0495671_0139570 | 3300046692 | Bacteria | 1181 |
| 281 | Ga0495649_0018570 | 3300046694 | Bacteria | 3911 |
| 282 | Ga0495600_0121462 | 3300046809 | Bacteria | 1699 |
| 283 | Ga0495660_0078075 | 3300046810 | Bacteria | 1741 |
| 284 | Ga0495674_0272488 | 3300047319 | Bacteria | 1388 |
| 285 | Ga0495683_0107685 | 3300047323 | Bacteria | 1334 |
| 286 | Ga0495681_0001104 | 3300047470 | Bacteria | 20492 |
| 287 | Ga0495686_0067976 | 3300047472 | Bacteria | 2199 |
| 288 | Ga0495615_0008259 | 3300048090 | Bacteria | 2007 |
| 289 | Ga0496102_0442358 | 3300048905 | Bacteria | 1220 |
| 290 | Ga0496106_0000288 | 3300048909 | Bacteria | 35636 |
| 291 | Ga0496106_0188584 | 3300048909 | Bacteria | 1639 |
| 292 | Ga0496109_0161522 | 3300048912 | Bacteria | 2099 |
| 293 | Ga0496110_0013366 | 3300048913 | Bacteria | 6783 |
| 294 | Ga0496111_0107242 | 3300048914 | Bacteria | 2056 |
| 295 | Ga0496113_0027381 | 3300048916 | Bacteria | 4087 |
| 296 | Ga0496116_0000042 | 3300048919 | Bacteria | 330516 |
| 297 | Ga0496116_0012229 | 3300048919 | Bacteria | 7021 |
| 298 | Ga0496116_0024746 | 3300048919 | Bacteria | 4431 |
| 299 | Ga0496117_0000016 | 3300048920 | Bacteria | 523642 |
| 300 | Ga0496117_0139850 | 3300048920 | Bacteria | 1452 |
| 301 | Ga0496118_0001168 | 3300048921 | Bacteria | 40490 |
| 302 | Ga0496118_0011735 | 3300048921 | Bacteria | 8516 |
| 303 | Ga0496118_0112514 | 3300048921 | Bacteria | 1802 |
| 304 | Ga0496119_0130517 | 3300048922 | Bacteria | 1370 |
| 305 | Ga0496119_0136800 | 3300048922 | Bacteria | 1328 |
| 306 | Ga0496120_0000056 | 3300048923 | Bacteria | 180367 |
| 307 | Ga0496121_0000240 | 3300048924 | Bacteria | 117890 |
| 308 | Ga0496121_0000836 | 3300048924 | Bacteria | 55869 |
| 309 | Ga0496121_0001142 | 3300048924 | Bacteria | 46580 |
| 310 | Ga0496121_0008563 | 3300048924 | Bacteria | 11984 |
| 311 | Ga0496121_0058530 | 3300048924 | Bacteria | 3185 |
| 312 | Ga0496121_0069238 | 3300048924 | Bacteria | 2849 |
| 313 | Ga0496121_0157630 | 3300048924 | Bacteria | 1664 |
| 314 | Ga0496121_0195744 | 3300048924 | Bacteria | 1445 |
| 315 | Ga0496121_0281548 | 3300048924 | Bacteria | 1137 |
| 316 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 317 | Ga0496122_0177009 | 3300048925 | Bacteria | 1277 |
| 318 | Ga0496122_0254149 | 3300048925 | Bacteria | 980 |
| 319 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 320 | Ga0496123_0106524 | 3300048926 | Bacteria | 1615 |
| 321 | Ga0496123_0114618 | 3300048926 | Bacteria | 1532 |
| 322 | Ga0496123_0125841 | 3300048926 | Bacteria | 1431 |
| 323 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 324 | Ga0496124_0045753 | 3300048927 | Bacteria | 3751 |
| 325 | Ga0496124_0049873 | 3300048927 | Bacteria | 3568 |
| 326 | Ga0496124_0068294 | 3300048927 | Bacteria | 2955 |
| 327 | Ga0496124_0164243 | 3300048927 | Bacteria | 1727 |
| 328 | Ga0496125_0000129 | 3300048928 | Bacteria | 163342 |
| 329 | Ga0496125_0049912 | 3300048928 | Bacteria | 3470 |
| 330 | Ga0496126_0000053 | 3300048929 | Bacteria | 311989 |
| 331 | Ga0496126_0031713 | 3300048929 | Bacteria | 4987 |
| 332 | Ga0496126_0031811 | 3300048929 | Bacteria | 4979 |
| 333 | Ga0496126_0165266 | 3300048929 | Bacteria | 1889 |
| 334 | Ga0501032_0014474 | 3300049569 | Bacteria | 5586 |
| 335 | Ga0501032_0122718 | 3300049569 | Bacteria | 1717 |
| 336 | Ga0501033_0032940 | 3300049570 | Bacteria | 3891 |
| 337 | Ga0501034_0013702 | 3300049571 | Bacteria | 8338 |
| 338 | Ga0501034_0027677 | 3300049571 | Bacteria | 5764 |
| 339 | Ga0501034_0174705 | 3300049571 | Bacteria | 2115 |
| 340 | Ga0501034_0187026 | 3300049571 | Bacteria | 2034 |
| 341 | Ga0501034_0200903 | 3300049571 | Bacteria | 1951 |
| 342 | Ga0501034_0323614 | 3300049571 | Bacteria | 1474 |
| 343 | Ga0501036_0029613 | 3300049572 | Bacteria | 4624 |
| 344 | Ga0501037_0016479 | 3300049573 | Bacteria | 5439 |
| 345 | Ga0501037_0084737 | 3300049573 | Bacteria | 2295 |
| 346 | Ga0501038_0021565 | 3300049574 | Bacteria | 5781 |
| 347 | Ga0501038_0046382 | 3300049574 | Bacteria | 3768 |
| 348 | Ga0501039_0033040 | 3300049575 | Bacteria | 3991 |
| 349 | Ga0501043_0027262 | 3300049579 | Bacteria | 4486 |
| 350 | Ga0501046_0181114 | 3300049580 | Bacteria | 1576 |
| 351 | Ga0501046_0181680 | 3300049580 | Bacteria | 1572 |
| 352 | Ga0501047_0083930 | 3300049581 | Bacteria | 3062 |
| 353 | Ga0501047_0232184 | 3300049581 | Bacteria | 1698 |
| 354 | Ga0501068_0249848 | 3300049584 | Bacteria | 1130 |
| 355 | Ga0501070_0027205 | 3300049586 | Bacteria | 4797 |
| 356 | Ga0501070_0032357 | 3300049586 | Bacteria | 4376 |
| 357 | Ga0501073_0111760 | 3300049589 | Bacteria | 1895 |
| 358 | Ga0501073_0134623 | 3300049589 | Bacteria | 1713 |
| 359 | Ga0501238_003101 | 3300049671 | Bacteria | 2029 |
| 360 | Ga0501035_0093121 | 3300049822 | Bacteria | 2651 |
| 361 | Ga0501035_0234377 | 3300049822 | Bacteria | 1563 |
| 362 | Ga0501044_0004981 | 3300049823 | Bacteria | 14857 |
| 363 | Ga0501044_0250692 | 3300049823 | Bacteria | 1711 |
| 364 | nmdc:mga03n38_30649_c1 | 3300050490 | Bacteria | 2263 |
| 365 | nmdc:mga03n38_6063_c1 | 3300050490 | Bacteria | 4172 |
| 366 | nmdc:mga00v17_252_c1 | 3300050491 | Bacteria | 31456 |
| 367 | nmdc:mga00v17_3_c1 | 3300050491 | Bacteria | 242367 |
| 368 | nmdc:mga0yw44_286_c1 | 3300050492 | Bacteria | 17382 |
| 369 | nmdc:mga0k408_45190_c1 | 3300050493 | Bacteria | 2541 |
| 370 | nmdc:mga0k408_54279_c1 | 3300050493 | Bacteria | 2323 |
| 371 | nmdc:mga06z11_60085_c1 | 3300050494 | Bacteria | 1978 |
| 372 | nmdc:mga04h51_21929_c1 | 3300050495 | Bacteria | 1926 |
| 373 | nmdc:mga07m45_264008_c1 | 3300050496 | Bacteria | 1002 |
| 374 | nmdc:mga0sz30_104_c1 | 3300050516 | Bacteria | 31594 |
| 375 | nmdc:mga0sz30_27300_c1 | 3300050516 | Bacteria | 1749 |
| 376 | Ga0500578_0084843 | 3300053086 | Bacteria | 2012 |
| 377 | Ga0500572_002948 | 3300053111 | Bacteria | 3989 |
| 378 | Ga0500618_000204 | 3300053125 | Bacteria | 47175 |
| 379 | Ga0500618_006937 | 3300053125 | Bacteria | 3276 |
| 380 | Ga0500658_0000086 | 3300053134 | Bacteria | 43329 |
| 381 | Ga0500568_0007952 | 3300053139 | Bacteria | 5153 |
| 382 | Ga0500604_0000460 | 3300053151 | Bacteria | 11248 |
| 383 | Ga0500616_0000164 | 3300053153 | Bacteria | 110715 |
| 384 | Ga0500622_0000559 | 3300053156 | Bacteria | 34086 |
| 385 | Ga0500622_0016953 | 3300053156 | Bacteria | 3885 |
| 386 | Ga0500624_000758 | 3300053157 | Bacteria | 7765 |
| 387 | Ga0500634_0000366 | 3300053161 | Bacteria | 14376 |
| 388 | Ga0500634_0002193 | 3300053161 | Bacteria | 8119 |
| 389 | Ga0500634_0010912 | 3300053161 | Bacteria | 4659 |
| 390 | Ga0500636_0000372 | 3300053177 | Bacteria | 24612 |
| 391 | Ga0500636_0000392 | 3300053177 | Bacteria | 24127 |
| 392 | Ga0587067_003653 | 3300059640 | Bacteria | 1941 |
| 393 | Ga0587072_000950 | 3300059643 | Bacteria | 3342 |
| 394 | Ga0501082_0018766 | 3300060353 | Bacteria | 5960 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013105 | Ga0157369_10011908 | Ga0157369_100119082 | 234 |
| 2 | 3300006038 | Ga0075365_10084238 | Ga0075365_100842382 | 244 |
| 3 | 3300006948 | Ga0099826_10001105 | Ga0099826_1000110513 | 244 |
| 4 | 3300025294 | Ga0209025_1002704 | Ga0209025_10027045 | 244 |
| 5 | 3300027312 | Ga0209371_1000012 | Ga0209371_1000012298 | 244 |
| 6 | 3300030500 | Ga0268256_1000013 | Ga0268256_1000013298 | 244 |
| 7 | 3300059640 | Ga0587067_003653 | Ga0587067_003653_89_1027 | 244 |
| 8 | 3300059643 | Ga0587072_000950 | Ga0587072_000950_1395_2333 | 244 |
| 9 | 3300046674 | Ga0495588_0001204 | Ga0495588_0001204_8609_9544 | 245 |
| 10 | 3300047470 | Ga0495681_0001104 | Ga0495681_0001104_16138_17073 | 245 |
| 11 | 3300053157 | Ga0500624_000758 | Ga0500624_000758_2532_3467 | 245 |
| 12 | 3300053161 | Ga0500634_0002193 | Ga0500634_0002193_6892_7827 | 245 |
| 13 | 3300025904 | Ga0207647_10044578 | Ga0207647_100445783 | 246 |
| 14 | 3300027312 | Ga0209371_1008000 | Ga0209371_10080004 | 246 |
| 15 | 3300037466 | Ga0395898_0232159 | Ga0395898_0232159_529_1476 | 246 |
| 16 | 3300046558 | Ga0495633_0026340 | Ga0495633_0026340_1270_2205 | 246 |
| 17 | 3300050516 | nmdc:mga0sz30_27300_c1 | nmdc:mga0sz30_27300_c1_192_1130 | 246 |
| 18 | 3300005548 | Ga0070665_100041738 | Ga0070665_1000417383 | 247 |
| 19 | 3300006042 | Ga0075368_10006397 | Ga0075368_100063972 | 247 |
| 20 | 3300006177 | Ga0075362_10002240 | Ga0075362_100022406 | 247 |
| 21 | 3300009148 | Ga0105243_10003302 | Ga0105243_100033025 | 247 |
| 22 | 3300013100 | Ga0157373_10001757 | Ga0157373_1000175711 | 247 |
| 23 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002548 | 247 |
| 24 | 3300013104 | Ga0157370_10000211 | Ga0157370_1000021135 | 247 |
| 25 | 3300025935 | Ga0207709_10035969 | Ga0207709_100359692 | 247 |
| 26 | 3300027866 | Ga0209813_10020257 | Ga0209813_100202572 | 247 |
| 27 | 3300028379 | Ga0268266_10069055 | Ga0268266_100690553 | 247 |
| 28 | 3300048916 | Ga0496113_0027381 | Ga0496113_0027381_571_1509 | 247 |
| 29 | 3300048919 | Ga0496116_0012229 | Ga0496116_0012229_4029_4967 | 247 |
| 30 | 3300048920 | Ga0496117_0000016 | Ga0496117_0000016_445632_446570 | 247 |
| 31 | 3300048921 | Ga0496118_0001168 | Ga0496118_0001168_35903_36841 | 247 |
| 32 | 3300048923 | Ga0496120_0000056 | Ga0496120_0000056_134609_135547 | 247 |
| 33 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_446293_447231 | 247 |
| 34 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1364452_1365390 | 247 |
| 35 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_446293_447231 | 247 |
| 36 | 3300048927 | Ga0496124_0045753 | Ga0496124_0045753_316_1254 | 247 |
| 37 | 3300050490 | nmdc:mga03n38_6063_c1 | nmdc:mga03n38_6063_c1_1887_2825 | 247 |
| 38 | 3300050491 | nmdc:mga00v17_3_c1 | nmdc:mga00v17_3_c1_226533_227471 | 247 |
| 39 | 3300050492 | nmdc:mga0yw44_286_c1 | nmdc:mga0yw44_286_c1_11620_12558 | 247 |
| 40 | 3300050493 | nmdc:mga0k408_54279_c1 | nmdc:mga0k408_54279_c1_316_1254 | 247 |
| 41 | 3300050496 | nmdc:mga07m45_264008_c1 | nmdc:mga07m45_264008_c1_11_949 | 247 |
| 42 | 3300050516 | nmdc:mga0sz30_104_c1 | nmdc:mga0sz30_104_c1_25564_26502 | 247 |
| 43 | 3300025899 | Ga0207642_10047277 | Ga0207642_100472772 | 250 |
| 44 | 3300035695 | Ga0373927_0183007 | Ga0373927_0183007_340_1227 | 250 |
| 45 | 3300049572 | Ga0501036_0029613 | Ga0501036_0029613_3333_4271 | 250 |
| 46 | 3300049573 | Ga0501037_0084737 | Ga0501037_0084737_451_1389 | 250 |
| 47 | 3300049574 | Ga0501038_0021565 | Ga0501038_0021565_676_1614 | 250 |
| 48 | 3300049581 | Ga0501047_0232184 | Ga0501047_0232184_123_1061 | 250 |
| 49 | 3300049589 | Ga0501073_0111760 | Ga0501073_0111760_152_1090 | 250 |
| 50 | 3300013306 | Ga0163162_10190716 | Ga0163162_101907162 | 251 |
| 51 | 3300049584 | Ga0501068_0249848 | Ga0501068_0249848_127_1050 | 251 |
| 52 | 3300006042 | Ga0075368_10041422 | Ga0075368_100414222 | 252 |
| 53 | 3300027866 | Ga0209813_10002465 | Ga0209813_100024653 | 252 |
| 54 | 3300038705 | Ga0237819_10937 | Ga0237819_10937_97_987 | 252 |
| 55 | 3300048909 | Ga0496106_0188584 | Ga0496106_0188584_386_1297 | 252 |
| 56 | 3300050494 | nmdc:mga06z11_60085_c1 | nmdc:mga06z11_60085_c1_953_1894 | 252 |
| 57 | 3300005334 | Ga0068869_100139575 | Ga0068869_1001395752 | 253 |
| 58 | 3300005356 | Ga0070674_100064095 | Ga0070674_1000640953 | 253 |
| 59 | 3300005441 | Ga0070700_100018816 | Ga0070700_1000188162 | 253 |
| 60 | 3300005456 | Ga0070678_100515330 | Ga0070678_1005153301 | 253 |
| 61 | 3300005459 | Ga0068867_100005603 | Ga0068867_1000056039 | 253 |
| 62 | 3300005543 | Ga0070672_100003609 | Ga0070672_1000036099 | 253 |
| 63 | 3300005617 | Ga0068859_100112421 | Ga0068859_1001124213 | 253 |
| 64 | 3300005843 | Ga0068860_100007737 | Ga0068860_1000077378 | 253 |
| 65 | 3300006881 | Ga0068865_100017435 | Ga0068865_1000174352 | 253 |
| 66 | 3300006931 | Ga0097620_100112427 | Ga0097620_1001124273 | 253 |
| 67 | 3300009553 | Ga0105249_10132075 | Ga0105249_101320752 | 253 |
| 68 | 3300013297 | Ga0157378_10247293 | Ga0157378_102472932 | 253 |
| 69 | 3300013297 | Ga0157378_10380163 | Ga0157378_103801632 | 253 |
| 70 | 3300013306 | Ga0163162_10009513 | Ga0163162_100095133 | 253 |
| 71 | 3300013308 | Ga0157375_10013667 | Ga0157375_100136679 | 253 |
| 72 | 3300014326 | Ga0157380_10017418 | Ga0157380_100174185 | 253 |
| 73 | 3300014969 | Ga0157376_10339119 | Ga0157376_103391191 | 253 |
| 74 | 3300025938 | Ga0207704_10011032 | Ga0207704_100110321 | 253 |
| 75 | 3300025940 | Ga0207691_10021819 | Ga0207691_100218195 | 253 |
| 76 | 3300025942 | Ga0207689_10080788 | Ga0207689_100807883 | 253 |
| 77 | 3300026041 | Ga0207639_10065746 | Ga0207639_100657462 | 253 |
| 78 | 3300026067 | Ga0207678_10213137 | Ga0207678_102131372 | 253 |
| 79 | 3300026075 | Ga0207708_10031924 | Ga0207708_100319244 | 253 |
| 80 | 3300026089 | Ga0207648_10004328 | Ga0207648_1000432810 | 253 |
| 81 | 3300026118 | Ga0207675_100001137 | Ga0207675_1000011376 | 253 |
| 82 | 3300026121 | Ga0207683_10133634 | Ga0207683_101336342 | 253 |
| 83 | 3300028380 | Ga0268265_10002980 | Ga0268265_100029801 | 253 |
| 84 | 3300028381 | Ga0268264_10002471 | Ga0268264_1000247110 | 253 |
| 85 | iso_pu_bacteria | 3002141150 | 3002145843 | 255 |
| 86 | 3300049579 | Ga0501043_0027262 | Ga0501043_0027262_2389_3327 | 256 |
| 87 | 3300049580 | Ga0501046_0181114 | Ga0501046_0181114_298_1236 | 256 |
| 88 | 3300049581 | Ga0501047_0083930 | Ga0501047_0083930_1556_2494 | 256 |
| 89 | 3300060353 | Ga0501082_0018766 | Ga0501082_0018766_4657_5595 | 256 |
| 90 | 3300048925 | Ga0496122_0254149 | Ga0496122_0254149_43_882 | 257 |
| 91 | 3300046477 | Ga0495664_0106357 | Ga0495664_0106357_635_1564 | 259 |
| 92 | 3300009766 | Ga0123342_1014091 | Ga0123342_10140915 | 260 |
| 93 | 3300053156 | Ga0500622_0016953 | Ga0500622_0016953_1340_2281 | 260 |
| 94 | 3300005564 | Ga0070664_100323372 | Ga0070664_1003233722 | 261 |
| 95 | 3300006051 | Ga0075364_10006628 | Ga0075364_100066282 | 261 |
| 96 | 3300025945 | Ga0207679_10221969 | Ga0207679_102219692 | 261 |
| 97 | 3300048924 | Ga0496121_0000836 | Ga0496121_0000836_31182_32120 | 261 |
| 98 | 3300048929 | Ga0496126_0165266 | Ga0496126_0165266_631_1569 | 261 |
| 99 | 3300050491 | nmdc:mga00v17_252_c1 | nmdc:mga00v17_252_c1_10942_11880 | 261 |
| 100 | 3300047472 | Ga0495686_0067976 | Ga0495686_0067976_909_1850 | 262 |
| 101 | 3300048924 | Ga0496121_0000240 | Ga0496121_0000240_3381_4334 | 264 |
| 102 | 3300053125 | Ga0500618_006937 | Ga0500618_006937_713_1672 | 264 |
| 103 | 3300046506 | Ga0495583_0008439 | Ga0495583_0008439_4313_5254 | 265 |
| 104 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_56950_57891 | 265 |
| 105 | 3300053111 | Ga0500572_002948 | Ga0500572_002948_149_1087 | 265 |
| 106 | 3300053177 | Ga0500636_0000392 | Ga0500636_0000392_18118_19056 | 265 |
| 107 | 3300005353 | Ga0070669_100085057 | Ga0070669_1000850572 | 267 |
| 108 | 3300005295 | Ga0065707_10086155 | Ga0065707_100861552 | 268 |
| 109 | 3300005337 | Ga0070682_100278482 | Ga0070682_1002784822 | 268 |
| 110 | 3300005539 | Ga0068853_100002653 | Ga0068853_1000026538 | 268 |
| 111 | 3300005842 | Ga0068858_100196888 | Ga0068858_1001968881 | 268 |
| 112 | 3300005844 | Ga0068862_100015023 | Ga0068862_1000150232 | 268 |
| 113 | 3300005937 | Ga0081455_10063610 | Ga0081455_100636103 | 268 |
| 114 | 3300006175 | Ga0070712_100167100 | Ga0070712_1001671002 | 268 |
| 115 | 3300006353 | Ga0075370_10004585 | Ga0075370_100045853 | 268 |
| 116 | 3300009174 | Ga0105241_10152911 | Ga0105241_101529111 | 268 |
| 117 | 3300009765 | Ga0123341_1000095 | Ga0123341_10000959 | 268 |
| 118 | 3300013100 | Ga0157373_10247589 | Ga0157373_102475892 | 268 |
| 119 | 3300025924 | Ga0207694_10136647 | Ga0207694_101366472 | 268 |
| 120 | 3300026041 | Ga0207639_10020434 | Ga0207639_100204342 | 268 |
| 121 | 3300026118 | Ga0207675_100140317 | Ga0207675_1001403172 | 268 |
| 122 | 3300026121 | Ga0207683_10010219 | Ga0207683_100102195 | 268 |
| 123 | 3300028380 | Ga0268265_10016306 | Ga0268265_100163065 | 268 |
| 124 | 3300031730 | Ga0307516_10033201 | Ga0307516_100332013 | 268 |
| 125 | 3300031731 | Ga0307405_10086071 | Ga0307405_100860711 | 268 |
| 126 | 3300032126 | Ga0307415_100227527 | Ga0307415_1002275272 | 268 |
| 127 | 3300035724 | Ga0373933_0143145 | Ga0373933_0143145_23_883 | 268 |
| 128 | 3300037418 | Ga0395900_0592471 | Ga0395900_0592471_165_1013 | 268 |
| 129 | 3300046675 | Ga0495657_0138142 | Ga0495657_0138142_570_1412 | 268 |
| 130 | 3300046678 | Ga0495599_0311899 | Ga0495599_0311899_29_871 | 268 |
| 131 | 3300046809 | Ga0495600_0121462 | Ga0495600_0121462_450_1292 | 268 |
| 132 | 3300048914 | Ga0496111_0107242 | Ga0496111_0107242_985_1872 | 268 |
| 133 | 3300048924 | Ga0496121_0281548 | Ga0496121_0281548_29_871 | 268 |
| 134 | 3300048928 | Ga0496125_0000129 | Ga0496125_0000129_153078_153965 | 268 |
| 135 | 3300049571 | Ga0501034_0027677 | Ga0501034_0027677_3031_3930 | 268 |
| 136 | iso_pu_bacteria | 2643221736 | 2644742730 | 268 |
| 137 | iso_pu_bacteria | 2852387548 | 2852391877 | 268 |
| 138 | iso_pu_bacteria | 2894232714 | 2894233508 | 268 |
| 139 | iso_pu_bacteria | 2896384573 | 2896387545 | 268 |
| 140 | iso_pu_bacteria | 8057529695 | 8057532068 | 268 |
| 141 | 3300005289 | Ga0065704_10099334 | Ga0065704_100993341 | 269 |
| 142 | 3300037471 | Ga0395905_0011131 | Ga0395905_0011131_3714_4655 | 269 |
| 143 | 3300044901 | Ga0466960_0039614 | Ga0466960_0039614_350_1291 | 269 |
| 144 | 3300048926 | Ga0496123_0114618 | Ga0496123_0114618_35_973 | 269 |
| 145 | iso_pu_bacteria | 2671180139 | 2671695279 | 269 |
| 146 | 3300005456 | Ga0070678_100571440 | Ga0070678_1005714401 | 270 |
| 147 | 3300026121 | Ga0207683_10207260 | Ga0207683_102072602 | 270 |
| 148 | 3300048905 | Ga0496102_0442358 | Ga0496102_0442358_214_1119 | 271 |
| 149 | iso_pu_bacteria | 2510917026 | 2511168701 | 271 |
| 150 | iso_pu_bacteria | 2585427633 | 2585997420 | 271 |
| 151 | iso_pu_bacteria | 2585427634 | 2586002026 | 271 |
| 152 | iso_pu_bacteria | 2838675328 | 2838677768 | 271 |
| 153 | iso_pu_bacteria | 2838714209 | 2838717327 | 271 |
| 154 | iso_pu_bacteria | 2838719591 | 2838722063 | 271 |
| 155 | iso_pu_bacteria | 2838724970 | 2838728076 | 271 |
| 156 | iso_pu_bacteria | 2841846520 | 2841849737 | 271 |
| 157 | iso_pu_bacteria | 2841859092 | 2841864250 | 271 |
| 158 | iso_pu_bacteria | 2842124991 | 2842127515 | 271 |
| 159 | iso_pu_bacteria | 2842130223 | 2842132661 | 271 |
| 160 | iso_pu_bacteria | 2842152218 | 2842154655 | 271 |
| 161 | iso_pu_bacteria | 2842170452 | 2842173152 | 271 |
| 162 | iso_pu_bacteria | 2842175837 | 2842178275 | 271 |
| 163 | iso_pu_bacteria | 2842187318 | 2842190434 | 271 |
| 164 | iso_pu_bacteria | 2842211629 | 2842214748 | 271 |
| 165 | iso_pu_bacteria | 2842224351 | 2842227469 | 271 |
| 166 | iso_pu_bacteria | 2842515876 | 2842521003 | 271 |
| 167 | iso_pu_bacteria | 2899792073 | 2899793509 | 271 |
| 168 | iso_pu_bacteria | 2899845264 | 2899847704 | 271 |
| 169 | iso_pu_bacteria | 2919114240 | 2919117593 | 271 |
| 170 | iso_pu_bacteria | 2926754445 | 2926759030 | 271 |
| 171 | iso_pu_bacteria | 2926760298 | 2926763453 | 271 |
| 172 | 3300002774 | JGI25150J39212_1006970 | JGI25150J39212_10069701 | 272 |
| 173 | 3300003187 | JGI25151J46595_10013544 | JGI25151J46595_100135442 | 272 |
| 174 | 3300009545 | Ga0105237_10699753 | Ga0105237_106997532 | 272 |
| 175 | 3300009553 | Ga0105249_10435134 | Ga0105249_104351342 | 272 |
| 176 | 3300037466 | Ga0395898_0192241 | Ga0395898_0192241_666_1616 | 272 |
| 177 | 3300009148 | Ga0105243_10231545 | Ga0105243_102315452 | 273 |
| 178 | 3300053161 | Ga0500634_0000366 | Ga0500634_0000366_8185_9126 | 273 |
| 179 | iso_pu_bacteria | 2643221688 | 2644492602 | 273 |
| 180 | iso_pu_bacteria | 2939669807 | 2939673011 | 273 |
| 181 | 3300005435 | Ga0070714_100375601 | Ga0070714_1003756012 | 274 |
| 182 | 3300005445 | Ga0070708_100010723 | Ga0070708_1000107236 | 274 |
| 183 | 3300005467 | Ga0070706_100173652 | Ga0070706_1001736522 | 274 |
| 184 | 3300005467 | Ga0070706_100385952 | Ga0070706_1003859521 | 274 |
| 185 | 3300005468 | Ga0070707_100053165 | Ga0070707_1000531652 | 274 |
| 186 | 3300005471 | Ga0070698_100000683 | Ga0070698_10000068314 | 274 |
| 187 | 3300005518 | Ga0070699_100010118 | Ga0070699_1000101187 | 274 |
| 188 | 3300005536 | Ga0070697_100036048 | Ga0070697_1000360485 | 274 |
| 189 | 3300006028 | Ga0070717_10008768 | Ga0070717_100087685 | 274 |
| 190 | 3300006028 | Ga0070717_10100395 | Ga0070717_101003953 | 274 |
| 191 | 3300025910 | Ga0207684_10117644 | Ga0207684_101176443 | 274 |
| 192 | 3300025922 | Ga0207646_10033232 | Ga0207646_100332322 | 274 |
| 193 | 3300035111 | Ga0373923_0014931 | Ga0373923_0014931_1447_2379 | 274 |
| 194 | 3300035171 | Ga0373946_0040860 | Ga0373946_0040860_67_999 | 274 |
| 195 | 3300035692 | Ga0373935_0083954 | Ga0373935_0083954_842_1774 | 274 |
| 196 | 3300036401 | Ga0373937_0024706 | Ga0373937_0024706_3519_4451 | 274 |
| 197 | 3300046454 | Ga0495592_0107470 | Ga0495592_0107470_505_1437 | 274 |
| 198 | 3300046477 | Ga0495664_0105165 | Ga0495664_0105165_254_1186 | 274 |
| 199 | 3300046533 | Ga0495640_0062394 | Ga0495640_0062394_875_1807 | 274 |
| 200 | 3300046536 | Ga0495587_0132874 | Ga0495587_0132874_340_1272 | 274 |
| 201 | 3300046678 | Ga0495599_0052832 | Ga0495599_0052832_244_1176 | 274 |
| 202 | 3300046683 | Ga0495658_0132694 | Ga0495658_0132694_142_1074 | 274 |
| 203 | 3300047319 | Ga0495674_0272488 | Ga0495674_0272488_292_1224 | 274 |
| 204 | iso_pu_bacteria | 2835312727 | 2835317168 | 274 |
| 205 | iso_pu_bacteria | 2882456835 | 2882462471 | 274 |
| 206 | iso_pu_bacteria | 8005658619 | 8005661272 | 274 |
| 207 | 3300003215 | JGI25153J46596_10009689 | JGI25153J46596_100096893 | 275 |
| 208 | 3300003792 | Ga0055540_1001450 | Ga0055540_10014505 | 275 |
| 209 | 3300005543 | Ga0070672_100205484 | Ga0070672_1002054842 | 275 |
| 210 | 3300005548 | Ga0070665_100312963 | Ga0070665_1003129632 | 275 |
| 211 | 3300017792 | Ga0163161_10059617 | Ga0163161_100596173 | 275 |
| 212 | 3300025297 | Ga0209758_1000903 | Ga0209758_100090337 | 275 |
| 213 | 3300025297 | Ga0209758_1001250 | Ga0209758_100125017 | 275 |
| 214 | 3300025303 | Ga0209051_1001462 | Ga0209051_100146212 | 275 |
| 215 | 3300025304 | Ga0209257_1001831 | Ga0209257_100183115 | 275 |
| 216 | 3300025304 | Ga0209257_1034763 | Ga0209257_10347632 | 275 |
| 217 | 3300025893 | Ga0207682_10104749 | Ga0207682_101047491 | 275 |
| 218 | 3300025940 | Ga0207691_10076699 | Ga0207691_100766992 | 275 |
| 219 | 3300039450 | Ga0436363_0080435 | Ga0436363_0080435_6394_7380 | 275 |
| 220 | 3300041509 | Ga0451843_0634892 | Ga0451843_0634892_364_1317 | 275 |
| 221 | 3300046522 | Ga0495643_0014621 | Ga0495643_0014621_488_1411 | 275 |
| 222 | 3300048090 | Ga0495615_0008259 | Ga0495615_0008259_402_1346 | 275 |
| 223 | 3300048920 | Ga0496117_0139850 | Ga0496117_0139850_171_1097 | 275 |
| 224 | 3300048924 | Ga0496121_0001142 | Ga0496121_0001142_34569_35495 | 275 |
| 225 | 3300048926 | Ga0496123_0106524 | Ga0496123_0106524_679_1602 | 275 |
| 226 | 3300048928 | Ga0496125_0049912 | Ga0496125_0049912_784_1707 | 275 |
| 227 | 3300049571 | Ga0501034_0200903 | Ga0501034_0200903_1009_1938 | 275 |
| 228 | 3300049573 | Ga0501037_0016479 | Ga0501037_0016479_1676_2605 | 275 |
| 229 | 3300049575 | Ga0501039_0033040 | Ga0501039_0033040_605_1534 | 275 |
| 230 | 3300049586 | Ga0501070_0032357 | Ga0501070_0032357_434_1363 | 275 |
| 231 | 3300049822 | Ga0501035_0234377 | Ga0501035_0234377_295_1224 | 275 |
| 232 | 3300049823 | Ga0501044_0250692 | Ga0501044_0250692_228_1157 | 275 |
| 233 | 3300053151 | Ga0500604_0000460 | Ga0500604_0000460_45_971 | 275 |
| 234 | 3300053177 | Ga0500636_0000372 | Ga0500636_0000372_12528_13427 | 275 |
| 235 | iso_pu_bacteria | 2551306091 | 2551726795 | 275 |
| 236 | iso_pu_bacteria | 2757320392 | 2757569225 | 275 |
| 237 | iso_pu_bacteria | 8018150411 | 8018154834 | 275 |
| 238 | 3300005456 | Ga0070678_100010927 | Ga0070678_1000109271 | 276 |
| 239 | 3300005841 | Ga0068863_100068199 | Ga0068863_1000681991 | 276 |
| 240 | 3300005843 | Ga0068860_100104396 | Ga0068860_1001043963 | 276 |
| 241 | 3300006195 | Ga0075366_10019997 | Ga0075366_100199973 | 276 |
| 242 | 3300006931 | Ga0097620_100137443 | Ga0097620_1001374432 | 276 |
| 243 | 3300014497 | Ga0182008_10003079 | Ga0182008_100030797 | 276 |
| 244 | 3300014968 | Ga0157379_10024269 | Ga0157379_100242693 | 276 |
| 245 | 3300015262 | Ga0182007_10001612 | Ga0182007_100016124 | 276 |
| 246 | 3300015683 | Ga0183362_10002 | Ga0183362_10002221 | 276 |
| 247 | 3300028381 | Ga0268264_10385782 | Ga0268264_103857821 | 276 |
| 248 | 3300031911 | Ga0307412_10215704 | Ga0307412_102157042 | 276 |
| 249 | 3300039438 | Ga0436360_0181196 | Ga0436360_0181196_1291_2265 | 276 |
| 250 | 3300048912 | Ga0496109_0161522 | Ga0496109_0161522_35_982 | 276 |
| 251 | 3300048913 | Ga0496110_0013366 | Ga0496110_0013366_2509_3456 | 276 |
| 252 | 3300048927 | Ga0496124_0068294 | Ga0496124_0068294_592_1527 | 276 |
| 253 | 3300050493 | nmdc:mga0k408_45190_c1 | nmdc:mga0k408_45190_c1_1502_2443 | 276 |
| 254 | iso_pu_bacteria | 2508501122 | 2509109477 | 276 |
| 255 | iso_pu_bacteria | 2509276019 | 2509378213 | 276 |
| 256 | iso_pu_bacteria | 2509276021 | 2509386983 | 276 |
| 257 | iso_pu_bacteria | 2509276033 | 2509442511 | 276 |
| 258 | iso_pu_bacteria | 2510065019 | 2510132964 | 276 |
| 259 | iso_pu_bacteria | 2510065057 | 2510307612 | 276 |
| 260 | iso_pu_bacteria | 2510461069 | 2510840357 | 276 |
| 261 | iso_pu_bacteria | 2510461076 | 2510894345 | 276 |
| 262 | iso_pu_bacteria | 2510461076 | 2510899370 | 276 |
| 263 | iso_pu_bacteria | 2510917022 | 2511133074 | 276 |
| 264 | iso_pu_bacteria | 2510917028 | 2511181453 | 276 |
| 265 | iso_pu_bacteria | 2510917030 | 2511200216 | 276 |
| 266 | iso_pu_bacteria | 2511231052 | 2511503213 | 276 |
| 267 | iso_pu_bacteria | 2512047086 | 2512534485 | 276 |
| 268 | iso_pu_bacteria | 2512875026 | 2512973706 | 276 |
| 269 | iso_pu_bacteria | 2513237085 | 2513575211 | 276 |
| 270 | iso_pu_bacteria | 2513237086 | 2513585178 | 276 |
| 271 | iso_pu_bacteria | 2513237088 | 2513595280 | 276 |
| 272 | iso_pu_bacteria | 2513237089 | 2513601776 | 276 |
| 273 | iso_pu_bacteria | 2513237091 | 2513616963 | 276 |
| 274 | iso_pu_bacteria | 2513237093 | 2513633107 | 276 |
| 275 | iso_pu_bacteria | 2513237103 | 2513710155 | 276 |
| 276 | iso_pu_bacteria | 2513237138 | 2513866727 | 276 |
| 277 | iso_pu_bacteria | 2513237140 | 2513884179 | 276 |
| 278 | iso_pu_bacteria | 2513237143 | 2513903508 | 276 |
| 279 | iso_pu_bacteria | 2513237144 | 2513911441 | 276 |
| 280 | iso_pu_bacteria | 2513237146 | 2513928829 | 276 |
| 281 | iso_pu_bacteria | 2513237160 | 2514003640 | 276 |
| 282 | iso_pu_bacteria | 2513237162 | 2514021789 | 276 |
| 283 | iso_pu_bacteria | 2515075009 | 2515111916 | 276 |
| 284 | iso_pu_bacteria | 2515154107 | 2515610950 | 276 |
| 285 | iso_pu_bacteria | 2515154113 | 2515633718 | 276 |
| 286 | iso_pu_bacteria | 2515154114 | 2515645108 | 276 |
| 287 | iso_pu_bacteria | 2515154116 | 2515660249 | 276 |
| 288 | iso_pu_bacteria | 2515154134 | 2515738907 | 276 |
| 289 | iso_pu_bacteria | 2516143018 | 2516206344 | 276 |
| 290 | iso_pu_bacteria | 2516653046 | 2516894645 | 276 |
| 291 | iso_pu_bacteria | 2516653077 | 2517035655 | 276 |
| 292 | iso_pu_bacteria | 2516653085 | 2517076084 | 276 |
| 293 | iso_pu_bacteria | 2517093000 | 2517094836 | 276 |
| 294 | iso_pu_bacteria | 2517287029 | 2517406465 | 276 |
| 295 | iso_pu_bacteria | 2517487022 | 2517571291 | 276 |
| 296 | iso_pu_bacteria | 2519899620 | 2520379453 | 276 |
| 297 | iso_pu_bacteria | 2524023207 | 2524450563 | 276 |
| 298 | iso_pu_bacteria | 2524023209 | 2524458596 | 276 |
| 299 | iso_pu_bacteria | 2529292951 | 2530645223 | 276 |
| 300 | iso_pu_bacteria | 2534681796 | 2535520187 | 276 |
| 301 | iso_pu_bacteria | 2537561587 | 2537876817 | 276 |
| 302 | iso_pu_bacteria | 2551306084 | 2551679629 | 276 |
| 303 | iso_pu_bacteria | 2551306085 | 2551687372 | 276 |
| 304 | iso_pu_bacteria | 2551306086 | 2551691563 | 276 |
| 305 | iso_pu_bacteria | 2551306087 | 2551700716 | 276 |
| 306 | iso_pu_bacteria | 2551306089 | 2551715511 | 276 |
| 307 | iso_pu_bacteria | 2551306090 | 2551723034 | 276 |
| 308 | iso_pu_bacteria | 2551306092 | 2551736014 | 276 |
| 309 | iso_pu_bacteria | 2551306093 | 2551744717 | 276 |
| 310 | iso_pu_bacteria | 2554235003 | 2554245666 | 276 |
| 311 | iso_pu_bacteria | 2558860100 | 2558867301 | 276 |
| 312 | iso_pu_bacteria | 2558860242 | 2559296505 | 276 |
| 313 | iso_pu_bacteria | 2582581294 | 2585204273 | 276 |
| 314 | iso_pu_bacteria | 2582581298 | 2585222371 | 276 |
| 315 | iso_pu_bacteria | 2582581299 | 2585231972 | 276 |
| 316 | iso_pu_bacteria | 2582581304 | 2585258731 | 276 |
| 317 | iso_pu_bacteria | 2582581307 | 2585271812 | 276 |
| 318 | iso_pu_bacteria | 2582581308 | 2585279822 | 276 |
| 319 | iso_pu_bacteria | 2582581315 | 2585326636 | 276 |
| 320 | iso_pu_bacteria | 2582581316 | 2585333813 | 276 |
| 321 | iso_pu_bacteria | 2582581867 | 2585401466 | 276 |
| 322 | iso_pu_bacteria | 2585427526 | 2585528241 | 276 |
| 323 | iso_pu_bacteria | 2585427527 | 2585531774 | 276 |
| 324 | iso_pu_bacteria | 2585427528 | 2585540439 | 276 |
| 325 | iso_pu_bacteria | 2585427529 | 2585544677 | 276 |
| 326 | iso_pu_bacteria | 2585427530 | 2585551278 | 276 |
| 327 | iso_pu_bacteria | 2585427531 | 2585563823 | 276 |
| 328 | iso_pu_bacteria | 2585427590 | 2585821159 | 276 |
| 329 | iso_pu_bacteria | 2585427593 | 2585838650 | 276 |
| 330 | iso_pu_bacteria | 2585427594 | 2585842901 | 276 |
| 331 | iso_pu_bacteria | 2585427608 | 2585896980 | 276 |
| 332 | iso_pu_bacteria | 2585427609 | 2585907162 | 276 |
| 333 | iso_pu_bacteria | 2585428125 | 2587982844 | 276 |
| 334 | iso_pu_bacteria | 2599185170 | 2599414846 | 276 |
| 335 | iso_pu_bacteria | 2599185210 | 2599603000 | 276 |
| 336 | iso_pu_bacteria | 2600254933 | 2600376169 | 276 |
| 337 | iso_pu_bacteria | 2600255279 | 2601610621 | 276 |
| 338 | iso_pu_bacteria | 2600255308 | 2601747049 | 276 |
| 339 | iso_pu_bacteria | 2615840624 | 2616292746 | 276 |
| 340 | iso_pu_bacteria | 2615840626 | 2616306613 | 276 |
| 341 | iso_pu_bacteria | 2615840698 | 2616551248 | 276 |
| 342 | iso_pu_bacteria | 2617270742 | 2617382992 | 276 |
| 343 | iso_pu_bacteria | 2643221568 | 2643857047 | 276 |
| 344 | iso_pu_bacteria | 2643221582 | 2643917549 | 276 |
| 345 | iso_pu_bacteria | 2643221599 | 2644003483 | 276 |
| 346 | iso_pu_bacteria | 2643221634 | 2644195571 | 276 |
| 347 | iso_pu_bacteria | 2643221643 | 2644242314 | 276 |
| 348 | iso_pu_bacteria | 2643221693 | 2644520632 | 276 |
| 349 | iso_pu_bacteria | 2667528174 | 2671113373 | 276 |
| 350 | iso_pu_bacteria | 2690316117 | 2692314746 | 276 |
| 351 | iso_pu_bacteria | 2718217882 | 2719180888 | 276 |
| 352 | iso_pu_bacteria | 2718217927 | 2719385492 | 276 |
| 353 | iso_pu_bacteria | 2718217997 | 2719665317 | 276 |
| 354 | iso_pu_bacteria | 2718218009 | 2719731637 | 276 |
| 355 | iso_pu_bacteria | 2718218199 | 2720491737 | 276 |
| 356 | iso_pu_bacteria | 2718218233 | 2720619856 | 276 |
| 357 | iso_pu_bacteria | 2718218363 | 2721146982 | 276 |
| 358 | iso_pu_bacteria | 2718218365 | 2721158512 | 276 |
| 359 | iso_pu_bacteria | 2718218366 | 2721163900 | 276 |
| 360 | iso_pu_bacteria | 2718218423 | 2721399240 | 276 |
| 361 | iso_pu_bacteria | 2721755514 | 2722840070 | 276 |
| 362 | iso_pu_bacteria | 2721755556 | 2723026650 | 276 |
| 363 | iso_pu_bacteria | 2721755684 | 2723560264 | 276 |
| 364 | iso_pu_bacteria | 2721755809 | 2724038053 | 276 |
| 365 | iso_pu_bacteria | 2721755810 | 2724044393 | 276 |
| 366 | iso_pu_bacteria | 2721755823 | 2724109905 | 276 |
| 367 | iso_pu_bacteria | 2724679232 | 2725949846 | 276 |
| 368 | iso_pu_bacteria | 2728369352 | 2730107586 | 276 |
| 369 | iso_pu_bacteria | 2728369365 | 2730164125 | 276 |
| 370 | iso_pu_bacteria | 2728369397 | 2730298144 | 276 |
| 371 | iso_pu_bacteria | 2738541293 | 2738801519 | 276 |
| 372 | iso_pu_bacteria | 2738541333 | 2739037931 | 276 |
| 373 | iso_pu_bacteria | 2765235942 | 2766062343 | 276 |
| 374 | iso_pu_bacteria | 2775507266 | 2778179028 | 276 |
| 375 | iso_pu_bacteria | 2791355256 | 2793299155 | 276 |
| 376 | iso_pu_bacteria | 2791355259 | 2793313806 | 276 |
| 377 | iso_pu_bacteria | 2791355260 | 2793321172 | 276 |
| 378 | iso_pu_bacteria | 2791355261 | 2793326398 | 276 |
| 379 | iso_pu_bacteria | 2791355262 | 2793337020 | 276 |
| 380 | iso_pu_bacteria | 2791355263 | 2793341239 | 276 |
| 381 | iso_pu_bacteria | 2791355264 | 2793347588 | 276 |
| 382 | iso_pu_bacteria | 2791355265 | 2793352341 | 276 |
| 383 | iso_pu_bacteria | 2791355266 | 2793361482 | 276 |
| 384 | iso_pu_bacteria | 2802428858 | 2802717342 | 276 |
| 385 | iso_pu_bacteria | 2802428859 | 2802724669 | 276 |
| 386 | iso_pu_bacteria | 2802428860 | 2802729421 | 276 |
| 387 | iso_pu_bacteria | 2802428861 | 2802736766 | 276 |
| 388 | iso_pu_bacteria | 2802428862 | 2802743172 | 276 |
| 389 | iso_pu_bacteria | 2802428863 | 2802749702 | 276 |
| 390 | iso_pu_bacteria | 2802429605 | 2805927677 | 276 |
| 391 | iso_pu_bacteria | 2802429606 | 2805936154 | 276 |
| 392 | iso_pu_bacteria | 2802429633 | 2806045460 | 276 |
| 393 | iso_pu_bacteria | 2802429634 | 2806051737 | 276 |
| 394 | iso_pu_bacteria | 2802429635 | 2806061781 | 276 |
| 395 | iso_pu_bacteria | 2802429636 | 2806067962 | 276 |
| 396 | iso_pu_bacteria | 2802429637 | 2806072689 | 276 |
| 397 | iso_pu_bacteria | 2808606387 | 2808986956 | 276 |
| 398 | iso_pu_bacteria | 2818991439 | 2819560741 | 276 |
| 399 | iso_pu_bacteria | 2818991448 | 2819611615 | 276 |
| 400 | iso_pu_bacteria | 2818991453 | 2819638709 | 276 |
| 401 | iso_pu_bacteria | 2838016132 | 2838018852 | 276 |
| 402 | iso_pu_bacteria | 2838022645 | 2838025445 | 276 |
| 403 | iso_pu_bacteria | 2838029111 | 2838031040 | 276 |
| 404 | iso_pu_bacteria | 2838035591 | 2838039435 | 276 |
| 405 | iso_pu_bacteria | 2838042994 | 2838043140 | 276 |
| 406 | iso_pu_bacteria | 2838048938 | 2838052082 | 276 |
| 407 | iso_pu_bacteria | 2838061910 | 2838067301 | 276 |
| 408 | iso_pu_bacteria | 2838068647 | 2838071416 | 276 |
| 409 | iso_pu_bacteria | 2838661181 | 2838667609 | 276 |
| 410 | iso_pu_bacteria | 2838668709 | 2838670123 | 276 |
| 411 | iso_pu_bacteria | 2838680041 | 2838682542 | 276 |
| 412 | iso_pu_bacteria | 2838686498 | 2838689155 | 276 |
| 413 | iso_pu_bacteria | 2838694306 | 2838697113 | 276 |
| 414 | iso_pu_bacteria | 2838701080 | 2838702494 | 276 |
| 415 | iso_pu_bacteria | 2838707686 | 2838709646 | 276 |
| 416 | iso_pu_bacteria | 2838729681 | 2838730503 | 276 |
| 417 | iso_pu_bacteria | 2838742623 | 2838743444 | 276 |
| 418 | iso_pu_bacteria | 2841851746 | 2841854880 | 276 |
| 419 | iso_pu_bacteria | 2841864319 | 2841864860 | 276 |
| 420 | iso_pu_bacteria | 2842077413 | 2842077820 | 276 |
| 421 | iso_pu_bacteria | 2842110456 | 2842110853 | 276 |
| 422 | iso_pu_bacteria | 2842118031 | 2842119672 | 276 |
| 423 | iso_pu_bacteria | 2842146304 | 2842146961 | 276 |
| 424 | iso_pu_bacteria | 2842156927 | 2842157743 | 276 |
| 425 | iso_pu_bacteria | 2842163707 | 2842164953 | 276 |
| 426 | iso_pu_bacteria | 2842180545 | 2842180672 | 276 |
| 427 | iso_pu_bacteria | 2842192696 | 2842196943 | 276 |
| 428 | iso_pu_bacteria | 2842198810 | 2842201013 | 276 |
| 429 | iso_pu_bacteria | 2842205361 | 2842206341 | 276 |
| 430 | iso_pu_bacteria | 2842217011 | 2842220682 | 276 |
| 431 | iso_pu_bacteria | 2842229732 | 2842231276 | 276 |
| 432 | iso_pu_bacteria | 2842237096 | 2842239059 | 276 |
| 433 | iso_pu_bacteria | 2842243621 | 2842244623 | 276 |
| 434 | iso_pu_bacteria | 2842250916 | 2842252026 | 276 |
| 435 | iso_pu_bacteria | 2842257432 | 2842258436 | 276 |
| 436 | iso_pu_bacteria | 2842264693 | 2842267472 | 276 |
| 437 | iso_pu_bacteria | 2842271015 | 2842273175 | 276 |
| 438 | iso_pu_bacteria | 2842278818 | 2842279798 | 276 |
| 439 | iso_pu_bacteria | 2842285085 | 2842287445 | 276 |
| 440 | iso_pu_bacteria | 2842291075 | 2842291482 | 276 |
| 441 | iso_pu_bacteria | 2842298080 | 2842300143 | 276 |
| 442 | iso_pu_bacteria | 2842304105 | 2842309342 | 276 |
| 443 | iso_pu_bacteria | 2842311132 | 2842315462 | 276 |
| 444 | iso_pu_bacteria | 2842317721 | 2842318211 | 276 |
| 445 | iso_pu_bacteria | 2842341865 | 2842347212 | 276 |
| 446 | iso_pu_bacteria | 2842357229 | 2842359054 | 276 |
| 447 | iso_pu_bacteria | 2842363717 | 2842366603 | 276 |
| 448 | iso_pu_bacteria | 2842370503 | 2842373109 | 276 |
| 449 | iso_pu_bacteria | 2842377471 | 2842377878 | 276 |
| 450 | iso_pu_bacteria | 2842384541 | 2842386181 | 276 |
| 451 | iso_pu_bacteria | 2842395702 | 2842397357 | 276 |
| 452 | iso_pu_bacteria | 2842402390 | 2842405026 | 276 |
| 453 | iso_pu_bacteria | 2842409023 | 2842411608 | 276 |
| 454 | iso_pu_bacteria | 2842415677 | 2842417941 | 276 |
| 455 | iso_pu_bacteria | 2842422224 | 2842424926 | 276 |
| 456 | iso_pu_bacteria | 2842428310 | 2842431950 | 276 |
| 457 | iso_pu_bacteria | 2842434925 | 2842438063 | 276 |
| 458 | iso_pu_bacteria | 2842441272 | 2842444876 | 276 |
| 459 | iso_pu_bacteria | 2842447887 | 2842451791 | 276 |
| 460 | iso_pu_bacteria | 2842462802 | 2842465746 | 276 |
| 461 | iso_pu_bacteria | 2842469257 | 2842472680 | 276 |
| 462 | iso_pu_bacteria | 2842475841 | 2842477772 | 276 |
| 463 | iso_pu_bacteria | 2842482326 | 2842485078 | 276 |
| 464 | iso_pu_bacteria | 2842489311 | 2842492827 | 276 |
| 465 | iso_pu_bacteria | 2842495871 | 2842496478 | 276 |
| 466 | iso_pu_bacteria | 2842502639 | 2842504356 | 276 |
| 467 | iso_pu_bacteria | 2842509118 | 2842511578 | 276 |
| 468 | iso_pu_bacteria | 2844454524 | 2844459490 | 276 |
| 469 | iso_pu_bacteria | 2847417321 | 2847420198 | 276 |
| 470 | iso_pu_bacteria | 2848992105 | 2848995096 | 276 |
| 471 | iso_pu_bacteria | 2854896431 | 2854902099 | 276 |
| 472 | iso_pu_bacteria | 2854916844 | 2854921325 | 276 |
| 473 | iso_pu_bacteria | 2855825444 | 2855827271 | 276 |
| 474 | iso_pu_bacteria | 2855839649 | 2855842653 | 276 |
| 475 | iso_pu_bacteria | 2855872281 | 2855874617 | 276 |
| 476 | iso_pu_bacteria | 2857516855 | 2857523750 | 276 |
| 477 | iso_pu_bacteria | 2858800743 | 2858803464 | 276 |
| 478 | iso_pu_bacteria | 2915980308 | 2915982557 | 276 |
| 479 | iso_pu_bacteria | 2915986958 | 2915991167 | 276 |
| 480 | iso_pu_bacteria | 2915993759 | 2916000268 | 276 |
| 481 | iso_pu_bacteria | 2916000859 | 2916007194 | 276 |
| 482 | iso_pu_bacteria | 2916007675 | 2916008428 | 276 |
| 483 | iso_pu_bacteria | 2916014648 | 2916019690 | 276 |
| 484 | iso_pu_bacteria | 2916021584 | 2916026734 | 276 |
| 485 | iso_pu_bacteria | 2916028427 | 2916033535 | 276 |
| 486 | iso_pu_bacteria | 2916035215 | 2916039641 | 276 |
| 487 | iso_pu_bacteria | 2916041962 | 2916047019 | 276 |
| 488 | iso_pu_bacteria | 2916048683 | 2916052836 | 276 |
| 489 | iso_pu_bacteria | 2916055098 | 2916059548 | 276 |
| 490 | iso_pu_bacteria | 2916061851 | 2916065155 | 276 |
| 491 | iso_pu_bacteria | 2916068649 | 2916071223 | 276 |
| 492 | iso_pu_bacteria | 2916076590 | 2916078054 | 276 |
| 493 | iso_pu_bacteria | 2919100787 | 2919102931 | 276 |
| 494 | iso_pu_bacteria | 2919166419 | 2919170193 | 276 |
| 495 | iso_pu_bacteria | 2919171160 | 2919173716 | 276 |
| 496 | iso_pu_bacteria | 2919408235 | 2919411171 | 276 |
| 497 | iso_pu_bacteria | 2921208531 | 2921211456 | 276 |
| 498 | iso_pu_bacteria | 2921237296 | 2921244031 | 276 |
| 499 | iso_pu_bacteria | 2921244191 | 2921248742 | 276 |
| 500 | iso_pu_bacteria | 2921250672 | 2921254682 | 276 |
| 501 | iso_pu_bacteria | 2921257292 | 2921262131 | 276 |
| 502 | iso_pu_bacteria | 2921263974 | 2921270677 | 276 |
| 503 | iso_pu_bacteria | 2921282425 | 2921288814 | 276 |
| 504 | iso_pu_bacteria | 2921289301 | 2921296337 | 276 |
| 505 | iso_pu_bacteria | 2921296804 | 2921298086 | 276 |
| 506 | iso_pu_bacteria | 2923556063 | 2923556953 | 276 |
| 507 | iso_pu_bacteria | 2924144063 | 2924147723 | 276 |
| 508 | iso_pu_bacteria | 2924150972 | 2924156448 | 276 |
| 509 | iso_pu_bacteria | 2924158325 | 2924160182 | 276 |
| 510 | iso_pu_bacteria | 2924165586 | 2924170218 | 276 |
| 511 | iso_pu_bacteria | 2924172951 | 2924177618 | 276 |
| 512 | iso_pu_bacteria | 2924179722 | 2924186297 | 276 |
| 513 | iso_pu_bacteria | 2924186466 | 2924191583 | 276 |
| 514 | iso_pu_bacteria | 2924193448 | 2924195237 | 276 |
| 515 | iso_pu_bacteria | 2924200457 | 2924204794 | 276 |
| 516 | iso_pu_bacteria | 2924207177 | 2924209354 | 276 |
| 517 | iso_pu_bacteria | 2924214083 | 2924214361 | 276 |
| 518 | iso_pu_bacteria | 2924221636 | 2924228794 | 276 |
| 519 | iso_pu_bacteria | 2924228884 | 2924234396 | 276 |
| 520 | iso_pu_bacteria | 2933006813 | 2933009962 | 276 |
| 521 | iso_pu_bacteria | 2933011516 | 2933011585 | 276 |
| 522 | iso_pu_bacteria | 2933016740 | 2933023384 | 276 |
| 523 | iso_pu_bacteria | 2933570622 | 2933575885 | 276 |
| 524 | iso_pu_bacteria | 2933586486 | 2933586878 | 276 |
| 525 | iso_pu_bacteria | 2933594066 | 2933595931 | 276 |
| 526 | iso_pu_bacteria | 2935894831 | 2935899021 | 276 |
| 527 | iso_pu_bacteria | 2935901341 | 2935904400 | 276 |
| 528 | iso_pu_bacteria | 2936367885 | 2936373076 | 276 |
| 529 | iso_pu_bacteria | 2936375103 | 2936381220 | 276 |
| 530 | iso_pu_bacteria | 2936381700 | 2936385985 | 276 |
| 531 | iso_pu_bacteria | 2936996657 | 2936997572 | 276 |
| 532 | iso_pu_bacteria | 2937002841 | 2937007598 | 276 |
| 533 | iso_pu_bacteria | 2937009748 | 2937013956 | 276 |
| 534 | iso_pu_bacteria | 2937016420 | 2937020894 | 276 |
| 535 | iso_pu_bacteria | 2937023124 | 2937024771 | 276 |
| 536 | iso_pu_bacteria | 2937029754 | 2937033304 | 276 |
| 537 | iso_pu_bacteria | 2937036028 | 2937036084 | 276 |
| 538 | iso_pu_bacteria | 2937042894 | 2937049239 | 276 |
| 539 | iso_pu_bacteria | 2937049772 | 2937056141 | 276 |
| 540 | iso_pu_bacteria | 2937056579 | 2937061425 | 276 |
| 541 | iso_pu_bacteria | 2937063883 | 2937069220 | 276 |
| 542 | iso_pu_bacteria | 2937071275 | 2937076306 | 276 |
| 543 | iso_pu_bacteria | 2937078374 | 2937082356 | 276 |
| 544 | iso_pu_bacteria | 2937084907 | 2937086372 | 276 |
| 545 | iso_pu_bacteria | 2937091812 | 2937097284 | 276 |
| 546 | iso_pu_bacteria | 2937098957 | 2937106254 | 276 |
| 547 | iso_pu_bacteria | 2937106411 | 2937106986 | 276 |
| 548 | iso_pu_bacteria | 2937113482 | 2937118164 | 276 |
| 549 | iso_pu_bacteria | 2937119839 | 2937121741 | 276 |
| 550 | iso_pu_bacteria | 2937126314 | 2937127836 | 276 |
| 551 | iso_pu_bacteria | 2954011201 | 2954011753 | 276 |
| 552 | iso_pu_bacteria | 2957375807 | 2957378890 | 276 |
| 553 | iso_pu_bacteria | 2957382221 | 2957383854 | 276 |
| 554 | iso_pu_bacteria | 2957388812 | 2957391478 | 276 |
| 555 | iso_pu_bacteria | 2957395598 | 2957400528 | 276 |
| 556 | iso_pu_bacteria | 2957402308 | 2957403943 | 276 |
| 557 | iso_pu_bacteria | 2957408893 | 2957409852 | 276 |
| 558 | iso_pu_bacteria | 2957415311 | 2957420548 | 276 |
| 559 | iso_pu_bacteria | 2957422303 | 2957424467 | 276 |
| 560 | iso_pu_bacteria | 2957437181 | 2957439745 | 276 |
| 561 | iso_pu_bacteria | 2957443900 | 2957449060 | 276 |
| 562 | iso_pu_bacteria | 2957450854 | 2957456777 | 276 |
| 563 | iso_pu_bacteria | 2957457609 | 2957462781 | 276 |
| 564 | iso_pu_bacteria | 2957464669 | 2957467499 | 276 |
| 565 | iso_pu_bacteria | 2957471148 | 2957477460 | 276 |
| 566 | iso_pu_bacteria | 2957478035 | 2957482479 | 276 |
| 567 | iso_pu_bacteria | 2957484790 | 2957485146 | 276 |
| 568 | iso_pu_bacteria | 2957491536 | 2957497285 | 276 |
| 569 | iso_pu_bacteria | 2957498199 | 2957504678 | 276 |
| 570 | iso_pu_bacteria | 2957505466 | 2957510698 | 276 |
| 571 | iso_pu_bacteria | 2960584000 | 2960584334 | 276 |
| 572 | iso_pu_bacteria | 2960591022 | 2960594968 | 276 |
| 573 | iso_pu_bacteria | 2960597568 | 2960599390 | 276 |
| 574 | iso_pu_bacteria | 2960603979 | 2960609060 | 276 |
| 575 | iso_pu_bacteria | 2960610863 | 2960612173 | 276 |
| 576 | iso_pu_bacteria | 2960617483 | 2960618174 | 276 |
| 577 | iso_pu_bacteria | 2960624210 | 2960625907 | 276 |
| 578 | iso_pu_bacteria | 2960631154 | 2960634754 | 276 |
| 579 | iso_pu_bacteria | 2960637947 | 2960638291 | 276 |
| 580 | iso_pu_bacteria | 2960645483 | 2960650760 | 276 |
| 581 | iso_pu_bacteria | 2960652885 | 2960655400 | 276 |
| 582 | iso_pu_bacteria | 2960660292 | 2960665721 | 276 |
| 583 | iso_pu_bacteria | 2960667422 | 2960672033 | 276 |
| 584 | iso_pu_bacteria | 2960674078 | 2960678020 | 276 |
| 585 | iso_pu_bacteria | 2960680706 | 2960684287 | 276 |
| 586 | iso_pu_bacteria | 2960687367 | 2960693680 | 276 |
| 587 | iso_pu_bacteria | 2960693952 | 2960696680 | 276 |
| 588 | iso_pu_bacteria | 2964607997 | 2964609637 | 276 |
| 589 | iso_pu_bacteria | 2964615318 | 2964619689 | 276 |
| 590 | iso_pu_bacteria | 2964621998 | 2964626219 | 276 |
| 591 | iso_pu_bacteria | 2964628898 | 2964630458 | 276 |
| 592 | iso_pu_bacteria | 2964636051 | 2964636461 | 276 |
| 593 | iso_pu_bacteria | 2964643177 | 2964645252 | 276 |
| 594 | iso_pu_bacteria | 2964649959 | 2964652693 | 276 |
| 595 | iso_pu_bacteria | 2964656573 | 2964662333 | 276 |
| 596 | iso_pu_bacteria | 2964663802 | 2964666246 | 276 |
| 597 | iso_pu_bacteria | 2964670856 | 2964672782 | 276 |
| 598 | iso_pu_bacteria | 2964678106 | 2964678261 | 276 |
| 599 | iso_pu_bacteria | 2964685014 | 2964691415 | 276 |
| 600 | iso_pu_bacteria | 2964691889 | 2964696560 | 276 |
| 601 | iso_pu_bacteria | 2964698721 | 2964702203 | 276 |
| 602 | iso_pu_bacteria | 2964705432 | 2964712483 | 276 |
| 603 | iso_pu_bacteria | 2964712639 | 2964712898 | 276 |
| 604 | iso_pu_bacteria | 2964719344 | 2964720229 | 276 |
| 605 | iso_pu_bacteria | 2967664464 | 2967670988 | 276 |
| 606 | iso_pu_bacteria | 2967671571 | 2967672034 | 276 |
| 607 | iso_pu_bacteria | 2967678726 | 2967680556 | 276 |
| 608 | iso_pu_bacteria | 2967686174 | 2967689162 | 276 |
| 609 | iso_pu_bacteria | 2967693043 | 2967695487 | 276 |
| 610 | iso_pu_bacteria | 2967699805 | 2967705879 | 276 |
| 611 | iso_pu_bacteria | 2967706974 | 2967713904 | 276 |
| 612 | iso_pu_bacteria | 2967714385 | 2967719096 | 276 |
| 613 | iso_pu_bacteria | 2967721400 | 2967727141 | 276 |
| 614 | iso_pu_bacteria | 2967728569 | 2967731939 | 276 |
| 615 | iso_pu_bacteria | 2967735183 | 2967736798 | 276 |
| 616 | iso_pu_bacteria | 2967742019 | 2967744095 | 276 |
| 617 | iso_pu_bacteria | 2967748971 | 2967749885 | 276 |
| 618 | iso_pu_bacteria | 2967755722 | 2967756234 | 276 |
| 619 | iso_pu_bacteria | 2967762386 | 2967768611 | 276 |
| 620 | iso_pu_bacteria | 2967769361 | 2967773789 | 276 |
| 621 | iso_pu_bacteria | 2967775926 | 2967778532 | 276 |
| 622 | iso_pu_bacteria | 2970019648 | 2970026271 | 276 |
| 623 | iso_pu_bacteria | 2970026789 | 2970029935 | 276 |
| 624 | iso_pu_bacteria | 2970033650 | 2970038835 | 276 |
| 625 | iso_pu_bacteria | 2970040964 | 2970045680 | 276 |
| 626 | iso_pu_bacteria | 2970047711 | 2970052365 | 276 |
| 627 | iso_pu_bacteria | 2970054988 | 2970059732 | 276 |
| 628 | iso_pu_bacteria | 2970061556 | 2970062315 | 276 |
| 629 | iso_pu_bacteria | 2970068827 | 2970075610 | 276 |
| 630 | iso_pu_bacteria | 2970076120 | 2970081663 | 276 |
| 631 | iso_pu_bacteria | 2970082768 | 2970086382 | 276 |
| 632 | iso_pu_bacteria | 2970088815 | 2970093948 | 276 |
| 633 | iso_pu_bacteria | 2970095765 | 2970101817 | 276 |
| 634 | iso_pu_bacteria | 2970102677 | 2970106878 | 276 |
| 635 | iso_pu_bacteria | 2970109326 | 2970111442 | 276 |
| 636 | iso_pu_bacteria | 2970116247 | 2970121495 | 276 |
| 637 | iso_pu_bacteria | 2970122695 | 2970125865 | 276 |
| 638 | iso_pu_bacteria | 2970129317 | 2970131896 | 276 |
| 639 | iso_pu_bacteria | 2970136068 | 2970138148 | 276 |
| 640 | iso_pu_bacteria | 2970143518 | 2970143730 | 276 |
| 641 | iso_pu_bacteria | 2970149975 | 2970154403 | 276 |
| 642 | iso_pu_bacteria | 2970156795 | 2970157585 | 276 |
| 643 | iso_pu_bacteria | 2970164137 | 2970168920 | 276 |
| 644 | iso_pu_bacteria | 2970170962 | 2970176842 | 276 |
| 645 | iso_pu_bacteria | 2970177841 | 2970180221 | 276 |
| 646 | iso_pu_bacteria | 2970184632 | 2970189601 | 276 |
| 647 | iso_pu_bacteria | 2970191845 | 2970196880 | 276 |
| 648 | iso_pu_bacteria | 2977516862 | 2977518426 | 276 |
| 649 | iso_pu_bacteria | 2977523885 | 2977524513 | 276 |
| 650 | iso_pu_bacteria | 2977530762 | 2977534668 | 276 |
| 651 | iso_pu_bacteria | 2977537788 | 2977542351 | 276 |
| 652 | iso_pu_bacteria | 2977544691 | 2977551425 | 276 |
| 653 | iso_pu_bacteria | 2977551784 | 2977553309 | 276 |
| 654 | iso_pu_bacteria | 2977558990 | 2977565493 | 276 |
| 655 | iso_pu_bacteria | 2977565890 | 2977569296 | 276 |
| 656 | iso_pu_bacteria | 2977572785 | 2977579189 | 276 |
| 657 | iso_pu_bacteria | 2977579622 | 2977585480 | 276 |
| 658 | iso_pu_bacteria | 2978969890 | 2978970179 | 276 |
| 659 | iso_pu_bacteria | 2979089926 | 2979091512 | 276 |
| 660 | iso_pu_bacteria | 2979095461 | 2979097032 | 276 |
| 661 | iso_pu_bacteria | 2979100975 | 2979101292 | 276 |
| 662 | iso_pu_bacteria | 2984509177 | 2984510753 | 276 |
| 663 | iso_pu_bacteria | 2984518228 | 2984518546 | 276 |
| 664 | iso_pu_bacteria | 2984537506 | 2984539103 | 276 |
| 665 | iso_pu_bacteria | 2984587000 | 2984587206 | 276 |
| 666 | iso_pu_bacteria | 2984601300 | 2984605797 | 276 |
| 667 | iso_pu_bacteria | 2996887358 | 2996887398 | 276 |
| 668 | iso_pu_bacteria | 2996893221 | 2996898424 | 276 |
| 669 | iso_pu_bacteria | 3005409236 | 3005409806 | 276 |
| 670 | iso_pu_bacteria | 3005416602 | 3005421512 | 276 |
| 671 | iso_pu_bacteria | 3005445848 | 3005450864 | 276 |
| 672 | iso_pu_bacteria | 3005452660 | 3005456883 | 276 |
| 673 | iso_pu_bacteria | 639633055 | 639648208 | 276 |
| 674 | iso_pu_bacteria | 648276728 | 648737093 | 276 |
| 675 | iso_pu_bacteria | 650716007 | 650842922 | 276 |
| 676 | iso_pu_bacteria | 8003570095 | 8003573257 | 276 |
| 677 | iso_pu_bacteria | 8003992118 | 8003995235 | 276 |
| 678 | iso_pu_bacteria | 8003999396 | 8004002951 | 276 |
| 679 | iso_pu_bacteria | 8005258706 | 8005261961 | 276 |
| 680 | iso_pu_bacteria | 8005275841 | 8005280263 | 276 |
| 681 | iso_pu_bacteria | 8005289223 | 8005294847 | 276 |
| 682 | iso_pu_bacteria | 8005301065 | 8005306992 | 276 |
| 683 | iso_pu_bacteria | 8005307578 | 8005314188 | 276 |
| 684 | iso_pu_bacteria | 8005314921 | 8005319785 | 276 |
| 685 | iso_pu_bacteria | 8005321885 | 8005321925 | 276 |
| 686 | iso_pu_bacteria | 8005376324 | 8005378856 | 276 |
| 687 | iso_pu_bacteria | 8005382845 | 8005388053 | 276 |
| 688 | iso_pu_bacteria | 8005395548 | 8005396991 | 276 |
| 689 | iso_pu_bacteria | 8005430974 | 8005433178 | 276 |
| 690 | iso_pu_bacteria | 8005460587 | 8005462576 | 276 |
| 691 | iso_pu_bacteria | 8005484373 | 8005490410 | 276 |
| 692 | iso_pu_bacteria | 8005497431 | 8005499958 | 276 |
| 693 | iso_pu_bacteria | 8005542996 | 8005547919 | 276 |
| 694 | iso_pu_bacteria | 8005556819 | 8005558054 | 276 |
| 695 | iso_pu_bacteria | 8005563573 | 8005569229 | 276 |
| 696 | iso_pu_bacteria | 8005570704 | 8005575486 | 276 |
| 697 | iso_pu_bacteria | 8005619151 | 8005621325 | 276 |
| 698 | iso_pu_bacteria | 8005626139 | 8005631386 | 276 |
| 699 | iso_pu_bacteria | 8005645114 | 8005647054 | 276 |
| 700 | iso_pu_bacteria | 8005668836 | 8005671374 | 276 |
| 701 | iso_pu_bacteria | 8005682033 | 8005686984 | 276 |
| 702 | iso_pu_bacteria | 8005688590 | 8005694907 | 276 |
| 703 | iso_pu_bacteria | 8005695170 | 8005696082 | 276 |
| 704 | iso_pu_bacteria | 8018127388 | 8018129615 | 276 |
| 705 | iso_pu_bacteria | 8018163183 | 8018168162 | 276 |
| 706 | iso_pu_bacteria | 8023680758 | 8023681021 | 276 |
| 707 | iso_pu_bacteria | 8024479707 | 8024485817 | 276 |
| 708 | iso_pu_bacteria | 8024486573 | 8024487224 | 276 |
| 709 | iso_pu_bacteria | 8024501048 | 8024505288 | 276 |
| 710 | iso_pu_bacteria | 8046767195 | 8046767383 | 276 |
| 711 | iso_pu_bacteria | 8056382006 | 8056387501 | 276 |
| 712 | iso_pu_bacteria | 8057575449 | 8057578491 | 276 |
| 713 | iso_pu_bacteria | 8057874678 | 8057875424 | 276 |
| 714 | 3300006038 | Ga0075365_10011384 | Ga0075365_100113845 | 277 |
| 715 | 3300006042 | Ga0075368_10046801 | Ga0075368_100468012 | 277 |
| 716 | 3300006178 | Ga0075367_10010707 | Ga0075367_100107073 | 277 |
| 717 | 3300015265 | Ga0182005_1005419 | Ga0182005_10054193 | 277 |
| 718 | 3300027866 | Ga0209813_10013890 | Ga0209813_100138902 | 277 |
| 719 | 3300039438 | Ga0436360_0631865 | Ga0436360_0631865_690_1637 | 277 |
| 720 | 3300046477 | Ga0495664_0075500 | Ga0495664_0075500_698_1642 | 277 |
| 721 | 3300048922 | Ga0496119_0136800 | Ga0496119_0136800_389_1303 | 277 |
| 722 | 3300048924 | Ga0496121_0157630 | Ga0496121_0157630_265_1200 | 277 |
| 723 | 3300049571 | Ga0501034_0013702 | Ga0501034_0013702_6053_7012 | 277 |
| 724 | 3300049571 | Ga0501034_0323614 | Ga0501034_0323614_77_1006 | 277 |
| 725 | 3300049671 | Ga0501238_003101 | Ga0501238_003101_560_1492 | 277 |
| 726 | 3300050495 | nmdc:mga04h51_21929_c1 | nmdc:mga04h51_21929_c1_767_1702 | 277 |
| 727 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_1000004113 | 278 |
| 728 | 3300002705 | JGI25156J39149_1000014 | JGI25156J39149_100001467 | 278 |
| 729 | 3300002705 | JGI25156J39149_1000015 | JGI25156J39149_100001529 | 278 |
| 730 | 3300002738 | JGI25154J39366_1000026 | JGI25154J39366_100002641 | 278 |
| 731 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_1000005150 | 278 |
| 732 | 3300002987 | JGI25159J45721_1001000 | JGI25159J45721_10010001 | 278 |
| 733 | 3300003354 | JGI25160J50197_1000022 | JGI25160J50197_100002277 | 278 |
| 734 | 3300003374 | JGI25161J50226_1000024 | JGI25161J50226_100002455 | 278 |
| 735 | 3300004625 | Ga0055543_1000025 | Ga0055543_100002577 | 278 |
| 736 | 3300005262 | Ga0065165_1000200 | Ga0065165_100020077 | 278 |
| 737 | 3300025206 | Ga0209435_100009 | Ga0209435_100009147 | 278 |
| 738 | 3300025208 | Ga0209436_118015 | Ga0209436_1180151 | 278 |
| 739 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018147 | 278 |
| 740 | 3300025250 | Ga0209026_1000043 | Ga0209026_1000043147 | 278 |
| 741 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007147 | 278 |
| 742 | 3300025284 | Ga0209130_1000251 | Ga0209130_100025155 | 278 |
| 743 | 3300025302 | Ga0207426_1000082 | Ga0207426_100008290 | 278 |
| 744 | 3300049571 | Ga0501034_0187026 | Ga0501034_0187026_726_1664 | 278 |
| 745 | 3300049589 | Ga0501073_0134623 | Ga0501073_0134623_472_1482 | 278 |
| 746 | iso_pu_bacteria | 2599185236 | 2599724259 | 278 |
| 747 | iso_pu_bacteria | 2995392953 | 2995395568 | 278 |
| 748 | 3300005536 | Ga0070697_100023899 | Ga0070697_1000238992 | 279 |
| 749 | 3300031456 | Ga0307513_10021053 | Ga0307513_100210534 | 279 |
| 750 | 3300049569 | Ga0501032_0122718 | Ga0501032_0122718_440_1375 | 279 |
| 751 | 3300049570 | Ga0501033_0032940 | Ga0501033_0032940_143_1078 | 279 |
| 752 | 3300049571 | Ga0501034_0174705 | Ga0501034_0174705_542_1477 | 279 |
| 753 | iso_pu_bacteria | 2891048133 | 2891051284 | 279 |
| 754 | 3300001979 | JGI24740J21852_10000274 | JGI24740J21852_100002742 | 280 |
| 755 | 3300002737 | JGI25162J39368_1000930 | JGI25162J39368_100093017 | 280 |
| 756 | 3300002739 | JGI25158J39367_1000140 | JGI25158J39367_10001406 | 280 |
| 757 | 3300002773 | JGI25152J39213_1002440 | JGI25152J39213_10024407 | 280 |
| 758 | 3300002773 | JGI25152J39213_1002693 | JGI25152J39213_10026934 | 280 |
| 759 | 3300002987 | JGI25159J45721_1000260 | JGI25159J45721_100026022 | 280 |
| 760 | 3300003187 | JGI25151J46595_10000238 | JGI25151J46595_1000023870 | 280 |
| 761 | 3300003187 | JGI25151J46595_10028316 | JGI25151J46595_100283162 | 280 |
| 762 | 3300003214 | JGI25165J46597_1000715 | JGI25165J46597_10007152 | 280 |
| 763 | 3300003215 | JGI25153J46596_10005165 | JGI25153J46596_100051652 | 280 |
| 764 | 3300003316 | rootH1_10050195 | rootH1_100501951 | 280 |
| 765 | 3300003354 | JGI25160J50197_1006405 | JGI25160J50197_10064052 | 280 |
| 766 | 3300003354 | JGI25160J50197_1013391 | JGI25160J50197_10133913 | 280 |
| 767 | 3300003374 | JGI25161J50226_1000050 | JGI25161J50226_100005026 | 280 |
| 768 | 3300003374 | JGI25161J50226_1004866 | JGI25161J50226_10048661 | 280 |
| 769 | 3300003771 | Ga0055526_1001371 | Ga0055526_100137112 | 280 |
| 770 | 3300003771 | Ga0055526_1002463 | Ga0055526_100246310 | 280 |
| 771 | 3300003771 | Ga0055526_1022297 | Ga0055526_10222972 | 280 |
| 772 | 3300003775 | Ga0055524_1000880 | Ga0055524_100088014 | 280 |
| 773 | 3300003775 | Ga0055524_1005903 | Ga0055524_10059033 | 280 |
| 774 | 3300003775 | Ga0055524_1014378 | Ga0055524_10143782 | 280 |
| 775 | 3300003790 | Ga0055528_1000106 | Ga0055528_100010643 | 280 |
| 776 | 3300003790 | Ga0055528_1001160 | Ga0055528_100116015 | 280 |
| 777 | 3300003790 | Ga0055528_1002460 | Ga0055528_10024609 | 280 |
| 778 | 3300003790 | Ga0055528_1020224 | Ga0055528_10202242 | 280 |
| 779 | 3300003792 | Ga0055540_1000103 | Ga0055540_100010327 | 280 |
| 780 | 3300003792 | Ga0055540_1005697 | Ga0055540_10056975 | 280 |
| 781 | 3300003792 | Ga0055540_1015308 | Ga0055540_10153082 | 280 |
| 782 | 3300003794 | Ga0055531_10002344 | Ga0055531_100023445 | 280 |
| 783 | 3300004625 | Ga0055543_1000023 | Ga0055543_100002344 | 280 |
| 784 | 3300004625 | Ga0055543_1001443 | Ga0055543_10014435 | 280 |
| 785 | 3300005262 | Ga0065165_1010583 | Ga0065165_10105832 | 280 |
| 786 | 3300005262 | Ga0065165_1015319 | Ga0065165_10153192 | 280 |
| 787 | 3300005262 | Ga0065165_1016842 | Ga0065165_10168421 | 280 |
| 788 | 3300005339 | Ga0070660_100334670 | Ga0070660_1003346702 | 280 |
| 789 | 3300005548 | Ga0070665_100106324 | Ga0070665_1001063242 | 280 |
| 790 | 3300005937 | Ga0081455_10358414 | Ga0081455_103584141 | 280 |
| 791 | 3300006048 | Ga0075363_100058622 | Ga0075363_1000586222 | 280 |
| 792 | 3300006048 | Ga0075363_100111375 | Ga0075363_1001113752 | 280 |
| 793 | 3300006051 | Ga0075364_10112000 | Ga0075364_101120002 | 280 |
| 794 | 3300006177 | Ga0075362_10008554 | Ga0075362_100085542 | 280 |
| 795 | 3300006186 | Ga0075369_10013141 | Ga0075369_100131413 | 280 |
| 796 | 3300009093 | Ga0105240_10397442 | Ga0105240_103974422 | 280 |
| 797 | 3300009545 | Ga0105237_10000188 | Ga0105237_1000018824 | 280 |
| 798 | 3300010375 | Ga0105239_10010200 | Ga0105239_1001020010 | 280 |
| 799 | 3300013100 | Ga0157373_10094929 | Ga0157373_100949292 | 280 |
| 800 | 3300013105 | Ga0157369_10079367 | Ga0157369_100793673 | 280 |
| 801 | 3300025208 | Ga0209436_100053 | Ga0209436_10005360 | 280 |
| 802 | 3300025233 | Ga0209437_100057 | Ga0209437_100057317 | 280 |
| 803 | 3300025245 | Ga0207425_1001821 | Ga0207425_10018214 | 280 |
| 804 | 3300025258 | Ga0209129_1000016 | Ga0209129_1000016425 | 280 |
| 805 | 3300025258 | Ga0209129_1013604 | Ga0209129_10136042 | 280 |
| 806 | 3300025261 | Ga0209233_1000130 | Ga0209233_1000130119 | 280 |
| 807 | 3300025272 | Ga0209455_1006859 | Ga0209455_10068592 | 280 |
| 808 | 3300025273 | Ga0209673_1000005 | Ga0209673_1000005205 | 280 |
| 809 | 3300025273 | Ga0209673_1000139 | Ga0209673_100013982 | 280 |
| 810 | 3300025273 | Ga0209673_1002223 | Ga0209673_10022232 | 280 |
| 811 | 3300025273 | Ga0209673_1004169 | Ga0209673_10041692 | 280 |
| 812 | 3300025284 | Ga0209130_1000031 | Ga0209130_100003174 | 280 |
| 813 | 3300025284 | Ga0209130_1004762 | Ga0209130_10047625 | 280 |
| 814 | 3300025292 | Ga0209676_1017732 | Ga0209676_10177322 | 280 |
| 815 | 3300025294 | Ga0209025_1000126 | Ga0209025_1000126159 | 280 |
| 816 | 3300025294 | Ga0209025_1000237 | Ga0209025_100023794 | 280 |
| 817 | 3300025294 | Ga0209025_1002712 | Ga0209025_10027125 | 280 |
| 818 | 3300025295 | Ga0209564_1000331 | Ga0209564_100033134 | 280 |
| 819 | 3300025295 | Ga0209564_1000577 | Ga0209564_100057724 | 280 |
| 820 | 3300025295 | Ga0209564_1002036 | Ga0209564_100203621 | 280 |
| 821 | 3300025295 | Ga0209564_1003502 | Ga0209564_10035027 | 280 |
| 822 | 3300025297 | Ga0209758_1000931 | Ga0209758_100093125 | 280 |
| 823 | 3300025297 | Ga0209758_1001440 | Ga0209758_100144014 | 280 |
| 824 | 3300025297 | Ga0209758_1003844 | Ga0209758_10038442 | 280 |
| 825 | 3300025298 | Ga0209050_1004134 | Ga0209050_10041348 | 280 |
| 826 | 3300025299 | Ga0209256_1000299 | Ga0209256_100029929 | 280 |
| 827 | 3300025299 | Ga0209256_1000961 | Ga0209256_100096114 | 280 |
| 828 | 3300025299 | Ga0209256_1011278 | Ga0209256_10112782 | 280 |
| 829 | 3300025299 | Ga0209256_1015383 | Ga0209256_10153833 | 280 |
| 830 | 3300025302 | Ga0207426_1000042 | Ga0207426_1000042336 | 280 |
| 831 | 3300025302 | Ga0207426_1000290 | Ga0207426_100029071 | 280 |
| 832 | 3300025303 | Ga0209051_1000095 | Ga0209051_100009549 | 280 |
| 833 | 3300025303 | Ga0209051_1000950 | Ga0209051_100095013 | 280 |
| 834 | 3300025303 | Ga0209051_1030477 | Ga0209051_10304772 | 280 |
| 835 | 3300025303 | Ga0209051_1071002 | Ga0209051_10710022 | 280 |
| 836 | 3300025304 | Ga0209257_1011109 | Ga0209257_10111094 | 280 |
| 837 | 3300025304 | Ga0209257_1016144 | Ga0209257_10161442 | 280 |
| 838 | 3300025972 | Ga0207668_10516602 | Ga0207668_105166022 | 280 |
| 839 | 3300027312 | Ga0209371_1001153 | Ga0209371_10011537 | 280 |
| 840 | 3300028379 | Ga0268266_10000728 | Ga0268266_1000072827 | 280 |
| 841 | 3300028794 | Ga0307515_10029370 | Ga0307515_100293706 | 280 |
| 842 | 3300030500 | Ga0268256_1001230 | Ga0268256_100123013 | 280 |
| 843 | 3300031995 | Ga0307409_100225484 | Ga0307409_1002254842 | 280 |
| 844 | 3300041451 | Ga0451791_0306668 | Ga0451791_0306668_79_1017 | 280 |
| 845 | 3300041458 | Ga0451798_1010442 | Ga0451798_1010442_289_1227 | 280 |
| 846 | 3300041463 | Ga0451804_1133873 | Ga0451804_1133873_655_1599 | 280 |
| 847 | 3300041491 | Ga0451833_0067109 | Ga0451833_0067109_172_1110 | 280 |
| 848 | 3300041496 | Ga0451839_0001838 | Ga0451839_0001838_1072_2010 | 280 |
| 849 | 3300041503 | Ga0451847_0304978 | Ga0451847_0304978_28_966 | 280 |
| 850 | 3300041512 | Ga0451853_0324505 | Ga0451853_0324505_437_1375 | 280 |
| 851 | 3300042007 | Ga0439449_0043230 | Ga0439449_0043230_531_1469 | 280 |
| 852 | 3300046474 | Ga0495605_0075507 | Ga0495605_0075507_198_1136 | 280 |
| 853 | 3300046492 | Ga0495585_0012907 | Ga0495585_0012907_1179_2117 | 280 |
| 854 | 3300046507 | Ga0495606_0008440 | Ga0495606_0008440_81_1019 | 280 |
| 855 | 3300046512 | Ga0495610_0091406 | Ga0495610_0091406_60_998 | 280 |
| 856 | 3300046515 | Ga0495620_0038765 | Ga0495620_0038765_449_1387 | 280 |
| 857 | 3300046522 | Ga0495643_0005020 | Ga0495643_0005020_3472_4410 | 280 |
| 858 | 3300046524 | Ga0495648_0022370 | Ga0495648_0022370_755_1693 | 280 |
| 859 | 3300046558 | Ga0495633_0022066 | Ga0495633_0022066_1029_1967 | 280 |
| 860 | 3300046660 | Ga0495625_0130252 | Ga0495625_0130252_214_1152 | 280 |
| 861 | 3300046691 | Ga0495670_0051364 | Ga0495670_0051364_883_1821 | 280 |
| 862 | 3300046692 | Ga0495671_0139570 | Ga0495671_0139570_185_1123 | 280 |
| 863 | 3300046694 | Ga0495649_0018570 | Ga0495649_0018570_28_966 | 280 |
| 864 | 3300046810 | Ga0495660_0078075 | Ga0495660_0078075_346_1284 | 280 |
| 865 | 3300047323 | Ga0495683_0107685 | Ga0495683_0107685_16_954 | 280 |
| 866 | 3300048909 | Ga0496106_0000288 | Ga0496106_0000288_31442_32380 | 280 |
| 867 | 3300048919 | Ga0496116_0000042 | Ga0496116_0000042_112890_113885 | 280 |
| 868 | 3300048919 | Ga0496116_0024746 | Ga0496116_0024746_1880_2818 | 280 |
| 869 | 3300048921 | Ga0496118_0011735 | Ga0496118_0011735_4159_5097 | 280 |
| 870 | 3300048921 | Ga0496118_0112514 | Ga0496118_0112514_238_1197 | 280 |
| 871 | 3300048922 | Ga0496119_0130517 | Ga0496119_0130517_211_1224 | 280 |
| 872 | 3300048924 | Ga0496121_0008563 | Ga0496121_0008563_6036_6974 | 280 |
| 873 | 3300048924 | Ga0496121_0058530 | Ga0496121_0058530_329_1267 | 280 |
| 874 | 3300048924 | Ga0496121_0069238 | Ga0496121_0069238_1342_2280 | 280 |
| 875 | 3300048924 | Ga0496121_0195744 | Ga0496121_0195744_304_1245 | 280 |
| 876 | 3300048925 | Ga0496122_0177009 | Ga0496122_0177009_169_1182 | 280 |
| 877 | 3300048926 | Ga0496123_0125841 | Ga0496123_0125841_400_1338 | 280 |
| 878 | 3300048927 | Ga0496124_0049873 | Ga0496124_0049873_2195_3133 | 280 |
| 879 | 3300048927 | Ga0496124_0164243 | Ga0496124_0164243_88_1083 | 280 |
| 880 | 3300048929 | Ga0496126_0000053 | Ga0496126_0000053_176764_177759 | 280 |
| 881 | 3300048929 | Ga0496126_0031713 | Ga0496126_0031713_2145_3083 | 280 |
| 882 | 3300048929 | Ga0496126_0031811 | Ga0496126_0031811_1418_2359 | 280 |
| 883 | 3300049569 | Ga0501032_0014474 | Ga0501032_0014474_2655_3599 | 280 |
| 884 | 3300049574 | Ga0501038_0046382 | Ga0501038_0046382_579_1523 | 280 |
| 885 | 3300049580 | Ga0501046_0181680 | Ga0501046_0181680_231_1175 | 280 |
| 886 | 3300049586 | Ga0501070_0027205 | Ga0501070_0027205_667_1611 | 280 |
| 887 | 3300049822 | Ga0501035_0093121 | Ga0501035_0093121_810_1754 | 280 |
| 888 | 3300049823 | Ga0501044_0004981 | Ga0501044_0004981_10617_11561 | 280 |
| 889 | 3300050490 | nmdc:mga03n38_30649_c1 | nmdc:mga03n38_30649_c1_567_1505 | 280 |
| 890 | 3300053086 | Ga0500578_0084843 | Ga0500578_0084843_450_1388 | 280 |
| 891 | 3300053125 | Ga0500618_000204 | Ga0500618_000204_4281_5222 | 280 |
| 892 | 3300053134 | Ga0500658_0000086 | Ga0500658_0000086_10286_11224 | 280 |
| 893 | 3300053139 | Ga0500568_0007952 | Ga0500568_0007952_2889_3827 | 280 |
| 894 | 3300053153 | Ga0500616_0000164 | Ga0500616_0000164_99822_100790 | 280 |
| 895 | 3300053156 | Ga0500622_0000559 | Ga0500622_0000559_29768_30706 | 280 |
| 896 | 3300053161 | Ga0500634_0010912 | Ga0500634_0010912_444_1382 | 280 |
| 897 | iso_pu_bacteria | 2513237084 | 2513569939 | 280 |
| 898 | iso_pu_bacteria | 2718218232 | 2720613006 | 280 |
| 899 | iso_pu_bacteria | 2718218235 | 2720631284 | 280 |
| 900 | iso_pu_bacteria | 2718218269 | 2720775011 | 280 |
| 901 | iso_pu_bacteria | 2721755685 | 2723566831 | 280 |
| 902 | iso_pu_bacteria | 2721755819 | 2724089618 | 280 |
| 903 | iso_pu_bacteria | 2721755822 | 2724104096 | 280 |
| 904 | iso_pu_bacteria | 2751185821 | 2753463911 | 280 |
| 905 | iso_pu_bacteria | 2791355267 | 2793366493 | 280 |
| 906 | iso_pu_bacteria | 2850079185 | 2850082537 | 280 |
| 907 | iso_pu_bacteria | 2933599457 | 2933602215 | 280 |
| 908 | iso_pu_bacteria | 8005282627 | 8005288335 | 280 |
| 909 | iso_pu_bacteria | 8018176218 | 8018177947 | 280 |
| 910 | iso_pu_bacteria | 8054460903 | 8054464317 | 280 |
| 911 | iso_pu_bacteria | 8056375014 | 8056380205 | 280 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
138
343
0.8
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8968 | 13 | 276 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.89 | 13 | 276 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8825 | 13 | 276 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.8734 | 13 | 276 |
| 4xtc-assembly1.cif.gz_M | crystal structure of bacterial alginate abc transporter in complex with alginate pentasaccharide-bound periplasmic protein | 0.8546 | 13 | 278 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9136 | 40 | 279 | 1.10.3720.10 |
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9047 | 13 | 272 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9028 | 40 | 279 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8936 | 41 | 279 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8915 | 41 | 274 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S6UP24-F1-model_v4 | Hypothetical ABC transporter permease protein yurN | 0.9612 | 19 | 280 |
GO:0005886
GO:0055085 |
| AF-A0A0S6UP24-F1-model_v4 | Hypothetical ABC transporter permease protein yurN | 0.9542 | 19 | 280 |
GO:0005886
GO:0055085 |
| AF-A0A074TH60-F1-model_v4 | Sugar ABC transporter permease | 0.9528 | 13 | 279 |
GO:0005886
GO:0055085 |
| AF-A0A8A6KC01-F1-model_v4 | deleted | 0.9519 | 13 | 280 |
|
| AF-A0A7T8XUY2-F1-model_v4 | deleted | 0.9466 | 13 | 278 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar