F485218
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 902 | 333 | 1804 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300037466|Ga0395898_0590056|Ga0395898_0590056_174_614 |
| Length | 146 |
| Sequence | VRARSKNLSTDERSDDVAEESYPEDLKYHPEHDWARIEGDTATLGITWYGQDALGELVHYEPPDVGATLSKDGAYGEVESVKAVSDLIAPLSGEVLEVNQKVVDEPETVNADPYGDGWLVRIRVSDPGETDALMDAESYRSHLQTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 60 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 61 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 162 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 169 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 173 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 177 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 178 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 192 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 193 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 194 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 198 | 3300038699 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 201 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 204 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 205 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 206 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 207 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 210 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 261 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 263 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 264 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 265 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 266 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 267 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 268 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 269 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 271 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 272 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 273 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 274 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 275 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 276 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 302 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 312 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 313 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 314 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 315 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.1 |
| Nodule | 0 |
| Rhizoplane | 12.08 |
| Rhizosphere | 84.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395898_0590056 | 3300037466 | Bacteria | 1054 |
| 2 | JGI25406J46586_10036185 | 3300003203 | Bacteria | 1794 |
| 3 | JGI25406J46586_10170740 | 3300003203 | Unclassified | 634 |
| 4 | Ga0070658_10008240 | 3300005327 | Bacteria | 8383 |
| 5 | Ga0070658_10512798 | 3300005327 | Bacteria | 1036 |
| 6 | Ga0070683_100005095 | 3300005329 | Bacteria | 10922 |
| 7 | Ga0070683_100008967 | 3300005329 | Bacteria | 8527 |
| 8 | Ga0070683_100147264 | 3300005329 | Bacteria | 2232 |
| 9 | Ga0070683_100210639 | 3300005329 | Bacteria | 1846 |
| 10 | Ga0070683_102099234 | 3300005329 | Bacteria | 543 |
| 11 | Ga0070690_101253862 | 3300005330 | Bacteria | 593 |
| 12 | Ga0070666_10142825 | 3300005335 | Bacteria | 1668 |
| 13 | Ga0070680_100061784 | 3300005336 | Bacteria | 3067 |
| 14 | Ga0070680_100712558 | 3300005336 | Bacteria | 864 |
| 15 | Ga0070680_101043513 | 3300005336 | Bacteria | 706 |
| 16 | Ga0070680_101544923 | 3300005336 | Bacteria | 575 |
| 17 | Ga0070680_101658759 | 3300005336 | Unclassified | 554 |
| 18 | Ga0070682_100232060 | 3300005337 | Bacteria | 1320 |
| 19 | Ga0070682_100531497 | 3300005337 | Bacteria | 917 |
| 20 | Ga0068868_100775841 | 3300005338 | Bacteria | 863 |
| 21 | Ga0070660_100045171 | 3300005339 | Bacteria | 3371 |
| 22 | Ga0070660_100077437 | 3300005339 | Bacteria | 2605 |
| 23 | Ga0070660_100670785 | 3300005339 | Unclassified | 869 |
| 24 | Ga0070660_100680924 | 3300005339 | Unclassified | 862 |
| 25 | Ga0070660_100826626 | 3300005339 | Bacteria | 780 |
| 26 | Ga0070691_10771556 | 3300005341 | Bacteria | 583 |
| 27 | Ga0070687_100381079 | 3300005343 | Bacteria | 919 |
| 28 | Ga0070661_100206900 | 3300005344 | Bacteria | 1501 |
| 29 | Ga0070661_100583191 | 3300005344 | Bacteria | 902 |
| 30 | Ga0070661_101010636 | 3300005344 | Bacteria | 690 |
| 31 | Ga0070692_10632675 | 3300005345 | Bacteria | 712 |
| 32 | Ga0070668_100097191 | 3300005347 | Bacteria | 2329 |
| 33 | Ga0070668_100306058 | 3300005347 | Bacteria | 1334 |
| 34 | Ga0070668_100309106 | 3300005347 | Bacteria | 1328 |
| 35 | Ga0070669_100457680 | 3300005353 | Bacteria | 1053 |
| 36 | Ga0070671_100386286 | 3300005355 | Bacteria | 1197 |
| 37 | Ga0070671_100559681 | 3300005355 | Bacteria | 986 |
| 38 | Ga0070671_102038603 | 3300005355 | Bacteria | 511 |
| 39 | Ga0070674_100216807 | 3300005356 | Bacteria | 1487 |
| 40 | Ga0070674_100233845 | 3300005356 | Bacteria | 1436 |
| 41 | Ga0070673_100855926 | 3300005364 | Bacteria | 841 |
| 42 | Ga0070688_100173502 | 3300005365 | Bacteria | 1490 |
| 43 | Ga0070659_100056686 | 3300005366 | Bacteria | 3089 |
| 44 | Ga0070659_100280626 | 3300005366 | Bacteria | 1386 |
| 45 | Ga0070659_101009031 | 3300005366 | Bacteria | 731 |
| 46 | Ga0070709_10063824 | 3300005434 | Bacteria | 2353 |
| 47 | Ga0070714_100443034 | 3300005435 | Bacteria | 1233 |
| 48 | Ga0070714_101310714 | 3300005435 | Bacteria | 707 |
| 49 | Ga0070713_100202845 | 3300005436 | Bacteria | 1792 |
| 50 | Ga0070713_100452660 | 3300005436 | Bacteria | 1206 |
| 51 | Ga0070713_100466729 | 3300005436 | Bacteria | 1187 |
| 52 | Ga0070713_100839756 | 3300005436 | Viruses | 882 |
| 53 | Ga0070713_100947523 | 3300005436 | Unclassified | 829 |
| 54 | Ga0070713_101441098 | 3300005436 | Unclassified | 668 |
| 55 | Ga0070710_10009026 | 3300005437 | Bacteria | 4874 |
| 56 | Ga0070710_10099411 | 3300005437 | Bacteria | 1730 |
| 57 | Ga0070710_10309267 | 3300005437 | Bacteria | 1034 |
| 58 | Ga0070701_10085966 | 3300005438 | Unclassified | 1713 |
| 59 | Ga0070711_100038326 | 3300005439 | Bacteria | 3223 |
| 60 | Ga0070711_100168410 | 3300005439 | Bacteria | 1667 |
| 61 | Ga0070711_100202229 | 3300005439 | Bacteria | 1534 |
| 62 | Ga0070705_100123792 | 3300005440 | Bacteria | 1674 |
| 63 | Ga0070705_100553676 | 3300005440 | Bacteria | 882 |
| 64 | Ga0070705_101948893 | 3300005440 | Bacteria | 501 |
| 65 | Ga0070700_101125289 | 3300005441 | Bacteria | 652 |
| 66 | Ga0070694_100074768 | 3300005444 | Bacteria | 2342 |
| 67 | Ga0070694_100090238 | 3300005444 | Bacteria | 2149 |
| 68 | Ga0070708_100171666 | 3300005445 | Bacteria | 2025 |
| 69 | Ga0070708_100186023 | 3300005445 | Bacteria | 1942 |
| 70 | Ga0070708_100294220 | 3300005445 | Bacteria | 1529 |
| 71 | Ga0070708_100353176 | 3300005445 | Bacteria | 1386 |
| 72 | Ga0070708_100714660 | 3300005445 | Bacteria | 943 |
| 73 | Ga0070708_102195912 | 3300005445 | Bacteria | 510 |
| 74 | Ga0070663_100546089 | 3300005455 | Bacteria | 968 |
| 75 | Ga0070678_100228885 | 3300005456 | Bacteria | 1549 |
| 76 | Ga0070678_100930602 | 3300005456 | Bacteria | 796 |
| 77 | Ga0070681_10022081 | 3300005458 | Bacteria | 6386 |
| 78 | Ga0070681_10111187 | 3300005458 | Bacteria | 2679 |
| 79 | Ga0070685_10852669 | 3300005466 | Bacteria | 675 |
| 80 | Ga0070706_100229391 | 3300005467 | Bacteria | 1733 |
| 81 | Ga0070706_100233059 | 3300005467 | Bacteria | 1719 |
| 82 | Ga0070707_100629281 | 3300005468 | Unclassified | 1036 |
| 83 | Ga0070707_100772166 | 3300005468 | Bacteria | 925 |
| 84 | Ga0070707_101886825 | 3300005468 | Unclassified | 565 |
| 85 | Ga0070698_100032881 | 3300005471 | Bacteria | 5373 |
| 86 | Ga0070698_100386912 | 3300005471 | Bacteria | 1331 |
| 87 | Ga0070699_100322895 | 3300005518 | Bacteria | 1388 |
| 88 | Ga0070679_100007568 | 3300005530 | Bacteria | 10159 |
| 89 | Ga0070679_100013106 | 3300005530 | Bacteria | 7939 |
| 90 | Ga0070684_100000286 | 3300005535 | Bacteria | 35165 |
| 91 | Ga0070684_100010068 | 3300005535 | Bacteria | 7474 |
| 92 | Ga0070684_100020927 | 3300005535 | Bacteria | 5431 |
| 93 | Ga0070684_100488073 | 3300005535 | Unclassified | 1140 |
| 94 | Ga0070684_100758427 | 3300005535 | Bacteria | 906 |
| 95 | Ga0070697_100069763 | 3300005536 | Bacteria | 2879 |
| 96 | Ga0070697_100235797 | 3300005536 | Bacteria | 1562 |
| 97 | Ga0070697_101173066 | 3300005536 | Bacteria | 684 |
| 98 | Ga0070686_100171734 | 3300005544 | Bacteria | 1534 |
| 99 | Ga0070686_101384173 | 3300005544 | Bacteria | 590 |
| 100 | Ga0070695_100330904 | 3300005545 | Bacteria | 1135 |
| 101 | Ga0070695_100483213 | 3300005545 | Bacteria | 955 |
| 102 | Ga0070696_100075073 | 3300005546 | Bacteria | 2385 |
| 103 | Ga0070696_100534900 | 3300005546 | Bacteria | 937 |
| 104 | Ga0070693_100510772 | 3300005547 | Bacteria | 854 |
| 105 | Ga0070693_101312426 | 3300005547 | Bacteria | 560 |
| 106 | Ga0070665_100459721 | 3300005548 | Bacteria | 1283 |
| 107 | Ga0070704_100082166 | 3300005549 | Bacteria | 2375 |
| 108 | Ga0068855_100017076 | 3300005563 | Bacteria | 8730 |
| 109 | Ga0068855_100077276 | 3300005563 | Bacteria | 3862 |
| 110 | Ga0068855_100077741 | 3300005563 | Bacteria | 3850 |
| 111 | Ga0068855_102062937 | 3300005563 | Bacteria | 575 |
| 112 | Ga0070664_100137055 | 3300005564 | Bacteria | 2153 |
| 113 | Ga0070664_100223690 | 3300005564 | Bacteria | 1685 |
| 114 | Ga0068857_100096601 | 3300005577 | Bacteria | 2648 |
| 115 | Ga0068857_100130441 | 3300005577 | Bacteria | 2267 |
| 116 | Ga0068856_100054954 | 3300005614 | Bacteria | 3929 |
| 117 | Ga0068856_100688561 | 3300005614 | Bacteria | 1043 |
| 118 | Ga0068856_100817094 | 3300005614 | Bacteria | 952 |
| 119 | Ga0070702_100028067 | 3300005615 | Bacteria | 3046 |
| 120 | Ga0070702_100848141 | 3300005615 | Bacteria | 711 |
| 121 | Ga0068859_102150856 | 3300005617 | Bacteria | 616 |
| 122 | Ga0068861_100057930 | 3300005719 | Bacteria | 2961 |
| 123 | Ga0068870_10114627 | 3300005840 | Bacteria | 1544 |
| 124 | Ga0068870_10561980 | 3300005840 | Bacteria | 770 |
| 125 | Ga0068862_100743184 | 3300005844 | Bacteria | 954 |
| 126 | Ga0081455_10032931 | 3300005937 | Bacteria | 4663 |
| 127 | Ga0081455_10112401 | 3300005937 | Bacteria | 2162 |
| 128 | Ga0081455_10123075 | 3300005937 | Bacteria | 2041 |
| 129 | Ga0081455_10148585 | 3300005937 | Unclassified | 1809 |
| 130 | Ga0081455_10162975 | 3300005937 | Bacteria | 1707 |
| 131 | Ga0081455_10376675 | 3300005937 | Bacteria | 993 |
| 132 | Ga0081455_10852386 | 3300005937 | Bacteria | 569 |
| 133 | Ga0081538_10022318 | 3300005981 | Bacteria | 4589 |
| 134 | Ga0081539_10000041 | 3300005985 | Bacteria | 292660 |
| 135 | Ga0081539_10042610 | 3300005985 | Bacteria | 2641 |
| 136 | Ga0081539_10237100 | 3300005985 | Bacteria | 819 |
| 137 | Ga0081539_10284082 | 3300005985 | Bacteria | 719 |
| 138 | Ga0070717_10050974 | 3300006028 | Bacteria | 3404 |
| 139 | Ga0070717_10588683 | 3300006028 | Bacteria | 1009 |
| 140 | Ga0070717_12051928 | 3300006028 | Unclassified | 515 |
| 141 | Ga0075365_10003891 | 3300006038 | Bacteria | 7814 |
| 142 | Ga0075365_10015202 | 3300006038 | Bacteria | 4650 |
| 143 | Ga0075365_10153616 | 3300006038 | Bacteria | 1602 |
| 144 | Ga0075365_10171956 | 3300006038 | Bacteria | 1512 |
| 145 | Ga0075365_10415227 | 3300006038 | Bacteria | 950 |
| 146 | Ga0075363_100298189 | 3300006048 | Bacteria | 935 |
| 147 | Ga0075363_100839151 | 3300006048 | Bacteria | 560 |
| 148 | Ga0075364_10123730 | 3300006051 | Bacteria | 1732 |
| 149 | Ga0075364_10125182 | 3300006051 | Bacteria | 1723 |
| 150 | Ga0075364_10132352 | 3300006051 | Bacteria | 1674 |
| 151 | Ga0075364_10455044 | 3300006051 | Bacteria | 874 |
| 152 | Ga0075364_10497899 | 3300006051 | Bacteria | 833 |
| 153 | Ga0075432_10020848 | 3300006058 | Bacteria | 2242 |
| 154 | Ga0070716_100111073 | 3300006173 | Bacteria | 1699 |
| 155 | Ga0070716_100169461 | 3300006173 | Bacteria | 1424 |
| 156 | Ga0070716_100971576 | 3300006173 | Bacteria | 670 |
| 157 | Ga0070712_100015956 | 3300006175 | Bacteria | 4844 |
| 158 | Ga0070712_100062040 | 3300006175 | Bacteria | 2642 |
| 159 | Ga0070712_100593532 | 3300006175 | Bacteria | 937 |
| 160 | Ga0070712_100615216 | 3300006175 | Bacteria | 920 |
| 161 | Ga0070712_100952525 | 3300006175 | Unclassified | 741 |
| 162 | Ga0070712_100978973 | 3300006175 | Bacteria | 731 |
| 163 | Ga0075367_10133745 | 3300006178 | Bacteria | 1534 |
| 164 | Ga0075367_10216978 | 3300006178 | Bacteria | 1197 |
| 165 | Ga0075367_10999641 | 3300006178 | Bacteria | 534 |
| 166 | Ga0097621_100213116 | 3300006237 | Bacteria | 1681 |
| 167 | Ga0097621_100363984 | 3300006237 | Bacteria | 1289 |
| 168 | Ga0068871_101061968 | 3300006358 | Bacteria | 756 |
| 169 | Ga0068871_101750675 | 3300006358 | Bacteria | 590 |
| 170 | Ga0075428_100007984 | 3300006844 | Bacteria | 11740 |
| 171 | Ga0075428_100036324 | 3300006844 | Bacteria | 5428 |
| 172 | Ga0075428_100309683 | 3300006844 | Bacteria | 1697 |
| 173 | Ga0075428_100580490 | 3300006844 | Bacteria | 1198 |
| 174 | Ga0075428_100583764 | 3300006844 | Unclassified | 1194 |
| 175 | Ga0075428_102132311 | 3300006844 | Bacteria | 579 |
| 176 | Ga0075431_100038295 | 3300006847 | Bacteria | 4937 |
| 177 | Ga0075431_100235771 | 3300006847 | Bacteria | 1863 |
| 178 | Ga0075433_10468092 | 3300006852 | Bacteria | 1110 |
| 179 | Ga0075433_10756443 | 3300006852 | Bacteria | 850 |
| 180 | Ga0075433_10987625 | 3300006852 | Bacteria | 733 |
| 181 | Ga0075434_100028518 | 3300006871 | Bacteria | 5485 |
| 182 | Ga0075434_100047775 | 3300006871 | Bacteria | 4246 |
| 183 | Ga0075434_100049169 | 3300006871 | Bacteria | 4186 |
| 184 | Ga0075429_100314316 | 3300006880 | Bacteria | 1371 |
| 185 | Ga0075429_100437594 | 3300006880 | Bacteria | 1146 |
| 186 | Ga0068865_101109617 | 3300006881 | Bacteria | 697 |
| 187 | Ga0075436_100002183 | 3300006914 | Bacteria | 13493 |
| 188 | Ga0075436_100029390 | 3300006914 | Bacteria | 3779 |
| 189 | Ga0075436_100369654 | 3300006914 | Bacteria | 1036 |
| 190 | Ga0097620_102150825 | 3300006931 | Bacteria | 616 |
| 191 | Ga0075435_100012599 | 3300007076 | Bacteria | 6264 |
| 192 | Ga0075435_100055348 | 3300007076 | Bacteria | 3204 |
| 193 | Ga0075435_100083256 | 3300007076 | Bacteria | 2630 |
| 194 | Ga0075435_100087463 | 3300007076 | Bacteria | 2568 |
| 195 | Ga0075435_100379651 | 3300007076 | Bacteria | 1214 |
| 196 | Ga0105240_10027311 | 3300009093 | Bacteria | 7474 |
| 197 | Ga0105240_10492909 | 3300009093 | Bacteria | 1364 |
| 198 | Ga0111539_10011337 | 3300009094 | Bacteria | 11196 |
| 199 | Ga0111539_10040887 | 3300009094 | Bacteria | 5579 |
| 200 | Ga0111539_10966657 | 3300009094 | Unclassified | 990 |
| 201 | Ga0111539_11978653 | 3300009094 | Bacteria | 676 |
| 202 | Ga0105245_10122828 | 3300009098 | Bacteria | 2427 |
| 203 | Ga0105245_10137493 | 3300009098 | Bacteria | 2298 |
| 204 | Ga0105245_10211852 | 3300009098 | Bacteria | 1865 |
| 205 | Ga0105245_10251480 | 3300009098 | Bacteria | 1717 |
| 206 | Ga0105245_10259335 | 3300009098 | Bacteria | 1691 |
| 207 | Ga0105245_10348748 | 3300009098 | Bacteria | 1466 |
| 208 | Ga0105245_11862597 | 3300009098 | Bacteria | 655 |
| 209 | Ga0114129_10000727 | 3300009147 | Bacteria | 41768 |
| 210 | Ga0114129_10012477 | 3300009147 | Bacteria | 12097 |
| 211 | Ga0114129_10024257 | 3300009147 | Bacteria | 8593 |
| 212 | Ga0114129_10170675 | 3300009147 | Bacteria | 2966 |
| 213 | Ga0114129_10327639 | 3300009147 | Bacteria | 2034 |
| 214 | Ga0114129_10919239 | 3300009147 | Bacteria | 1107 |
| 215 | Ga0114129_11431861 | 3300009147 | Bacteria | 852 |
| 216 | Ga0114129_13133112 | 3300009147 | Unclassified | 540 |
| 217 | Ga0105243_10054496 | 3300009148 | Bacteria | 3175 |
| 218 | Ga0105243_10109909 | 3300009148 | Bacteria | 2304 |
| 219 | Ga0105243_10374651 | 3300009148 | Bacteria | 1314 |
| 220 | Ga0105243_12750862 | 3300009148 | Bacteria | 532 |
| 221 | Ga0105241_10829209 | 3300009174 | Bacteria | 854 |
| 222 | Ga0105242_10083979 | 3300009176 | Bacteria | 2667 |
| 223 | Ga0105242_10134171 | 3300009176 | Bacteria | 2141 |
| 224 | Ga0105242_10329695 | 3300009176 | Bacteria | 1403 |
| 225 | Ga0105242_10934870 | 3300009176 | Bacteria | 870 |
| 226 | Ga0105242_11306124 | 3300009176 | Bacteria | 749 |
| 227 | Ga0105242_11383508 | 3300009176 | Bacteria | 730 |
| 228 | Ga0105248_10160218 | 3300009177 | Bacteria | 2538 |
| 229 | Ga0105248_11006895 | 3300009177 | Bacteria | 941 |
| 230 | Ga0105237_10974551 | 3300009545 | Bacteria | 855 |
| 231 | Ga0105238_10996094 | 3300009551 | Bacteria | 859 |
| 232 | Ga0105249_10624440 | 3300009553 | Bacteria | 1134 |
| 233 | Ga0105239_10221657 | 3300010375 | Bacteria | 2121 |
| 234 | Ga0105239_10362957 | 3300010375 | Bacteria | 1636 |
| 235 | Ga0105239_13244118 | 3300010375 | Bacteria | 530 |
| 236 | Ga0105246_10969760 | 3300011119 | Unclassified | 767 |
| 237 | Ga0157370_10093330 | 3300013104 | Bacteria | 2824 |
| 238 | Ga0157370_10372328 | 3300013104 | Bacteria | 1316 |
| 239 | Ga0157370_10611214 | 3300013104 | Bacteria | 998 |
| 240 | Ga0157370_11539966 | 3300013104 | Bacteria | 598 |
| 241 | Ga0157369_10006794 | 3300013105 | Bacteria | 13198 |
| 242 | Ga0157369_10732870 | 3300013105 | Bacteria | 1017 |
| 243 | Ga0157369_11690269 | 3300013105 | Bacteria | 643 |
| 244 | Ga0157374_10128262 | 3300013296 | Bacteria | 2453 |
| 245 | Ga0157374_11043122 | 3300013296 | Bacteria | 837 |
| 246 | Ga0157374_11300703 | 3300013296 | Bacteria | 749 |
| 247 | Ga0157378_10101928 | 3300013297 | Bacteria | 2622 |
| 248 | Ga0157378_10275550 | 3300013297 | Bacteria | 1620 |
| 249 | Ga0157378_12248028 | 3300013297 | Bacteria | 597 |
| 250 | Ga0163162_10093384 | 3300013306 | Bacteria | 3093 |
| 251 | Ga0157372_10287435 | 3300013307 | Bacteria | 1912 |
| 252 | Ga0157372_10830094 | 3300013307 | Bacteria | 1073 |
| 253 | Ga0157372_11319231 | 3300013307 | Bacteria | 833 |
| 254 | Ga0157372_12120176 | 3300013307 | Bacteria | 646 |
| 255 | Ga0157372_13018400 | 3300013307 | Bacteria | 538 |
| 256 | Ga0157375_10297023 | 3300013308 | Bacteria | 1779 |
| 257 | Ga0157375_10790965 | 3300013308 | Bacteria | 1098 |
| 258 | Ga0157375_11036210 | 3300013308 | Bacteria | 959 |
| 259 | Ga0157375_11204406 | 3300013308 | Bacteria | 888 |
| 260 | Ga0163163_10164086 | 3300014325 | Bacteria | 2267 |
| 261 | Ga0163163_12034623 | 3300014325 | Bacteria | 634 |
| 262 | Ga0182008_10250564 | 3300014497 | Bacteria | 913 |
| 263 | Ga0182008_10845273 | 3300014497 | Bacteria | 535 |
| 264 | Ga0157377_10030329 | 3300014745 | Bacteria | 2928 |
| 265 | Ga0157377_10313810 | 3300014745 | Unclassified | 1039 |
| 266 | Ga0157379_10256715 | 3300014968 | Bacteria | 1588 |
| 267 | Ga0157376_10094137 | 3300014969 | Bacteria | 2602 |
| 268 | Ga0157376_10254312 | 3300014969 | Bacteria | 1642 |
| 269 | Ga0157376_10464925 | 3300014969 | Bacteria | 1237 |
| 270 | Ga0157376_10704573 | 3300014969 | Bacteria | 1015 |
| 271 | Ga0157376_11751010 | 3300014969 | Bacteria | 657 |
| 272 | Ga0182007_10280670 | 3300015262 | Bacteria | 606 |
| 273 | Ga0163161_10342206 | 3300017792 | Bacteria | 1187 |
| 274 | Ga0197907_10799915 | 3300020069 | Bacteria | 1483 |
| 275 | Ga0206353_10259235 | 3300020082 | Bacteria | 769 |
| 276 | Ga0206353_11073166 | 3300020082 | Bacteria | 4497 |
| 277 | Ga0224712_10422282 | 3300022467 | Bacteria | 638 |
| 278 | Ga0207692_10063853 | 3300025898 | Bacteria | 1915 |
| 279 | Ga0207692_10125979 | 3300025898 | Bacteria | 1441 |
| 280 | Ga0207642_10329929 | 3300025899 | Bacteria | 894 |
| 281 | Ga0207688_10091228 | 3300025901 | Bacteria | 1750 |
| 282 | Ga0207688_10490131 | 3300025901 | Bacteria | 769 |
| 283 | Ga0207647_10234741 | 3300025904 | Bacteria | 1055 |
| 284 | Ga0207685_10451309 | 3300025905 | Bacteria | 668 |
| 285 | Ga0207705_10019314 | 3300025909 | Bacteria | 4873 |
| 286 | Ga0207705_10045782 | 3300025909 | Bacteria | 3144 |
| 287 | Ga0207684_10441074 | 3300025910 | Bacteria | 1118 |
| 288 | Ga0207654_10455777 | 3300025911 | Bacteria | 897 |
| 289 | Ga0207707_10030088 | 3300025912 | Bacteria | 4747 |
| 290 | Ga0207707_10031620 | 3300025912 | Bacteria | 4632 |
| 291 | Ga0207695_10138907 | 3300025913 | Bacteria | 2381 |
| 292 | Ga0207695_10365656 | 3300025913 | Bacteria | 1329 |
| 293 | Ga0207693_10006225 | 3300025915 | Bacteria | 9898 |
| 294 | Ga0207693_10023433 | 3300025915 | Bacteria | 4902 |
| 295 | Ga0207693_10252700 | 3300025915 | Bacteria | 1383 |
| 296 | Ga0207663_10059220 | 3300025916 | Bacteria | 2422 |
| 297 | Ga0207663_10285045 | 3300025916 | Bacteria | 1228 |
| 298 | Ga0207663_10689903 | 3300025916 | Bacteria | 808 |
| 299 | Ga0207660_10140212 | 3300025917 | Bacteria | 1848 |
| 300 | Ga0207660_11160961 | 3300025917 | Unclassified | 629 |
| 301 | Ga0207662_10352534 | 3300025918 | Bacteria | 989 |
| 302 | Ga0207657_10002271 | 3300025919 | Bacteria | 20838 |
| 303 | Ga0207657_10342322 | 3300025919 | Unclassified | 1180 |
| 304 | Ga0207657_10731425 | 3300025919 | Bacteria | 767 |
| 305 | Ga0207649_11234295 | 3300025920 | Bacteria | 591 |
| 306 | Ga0207652_10006892 | 3300025921 | Bacteria | 9156 |
| 307 | Ga0207652_10020012 | 3300025921 | Bacteria | 5510 |
| 308 | Ga0207646_10489785 | 3300025922 | Bacteria | 1108 |
| 309 | Ga0207646_10718454 | 3300025922 | Bacteria | 893 |
| 310 | Ga0207681_10001013 | 3300025923 | Bacteria | 18329 |
| 311 | Ga0207681_11778714 | 3300025923 | Bacteria | 514 |
| 312 | Ga0207650_11333318 | 3300025925 | Bacteria | 611 |
| 313 | Ga0207659_10359004 | 3300025926 | Bacteria | 1211 |
| 314 | Ga0207687_10049998 | 3300025927 | Bacteria | 2909 |
| 315 | Ga0207687_10100296 | 3300025927 | Bacteria | 2129 |
| 316 | Ga0207687_10681934 | 3300025927 | Bacteria | 871 |
| 317 | Ga0207687_10682290 | 3300025927 | Bacteria | 871 |
| 318 | Ga0207687_10864587 | 3300025927 | Unclassified | 773 |
| 319 | Ga0207687_11003703 | 3300025927 | Bacteria | 716 |
| 320 | Ga0207687_11205023 | 3300025927 | Bacteria | 651 |
| 321 | Ga0207700_10296300 | 3300025928 | Bacteria | 1395 |
| 322 | Ga0207700_10608149 | 3300025928 | Bacteria | 973 |
| 323 | Ga0207700_10666842 | 3300025928 | Unclassified | 928 |
| 324 | Ga0207700_10781608 | 3300025928 | Bacteria | 854 |
| 325 | Ga0207700_11069270 | 3300025928 | Bacteria | 722 |
| 326 | Ga0207664_10339744 | 3300025929 | Bacteria | 1327 |
| 327 | Ga0207664_10565140 | 3300025929 | Bacteria | 1021 |
| 328 | Ga0207644_10199581 | 3300025931 | Bacteria | 1577 |
| 329 | Ga0207644_10326211 | 3300025931 | Bacteria | 1242 |
| 330 | Ga0207644_10860961 | 3300025931 | Bacteria | 759 |
| 331 | Ga0207690_10653091 | 3300025932 | Bacteria | 862 |
| 332 | Ga0207690_11077391 | 3300025932 | Bacteria | 670 |
| 333 | Ga0207706_10219535 | 3300025933 | Bacteria | 1665 |
| 334 | Ga0207686_10312281 | 3300025934 | Bacteria | 1171 |
| 335 | Ga0207686_10364590 | 3300025934 | Bacteria | 1091 |
| 336 | Ga0207686_10504363 | 3300025934 | Bacteria | 939 |
| 337 | Ga0207686_10588042 | 3300025934 | Bacteria | 874 |
| 338 | Ga0207709_10091967 | 3300025935 | Bacteria | 1985 |
| 339 | Ga0207709_10110243 | 3300025935 | Bacteria | 1839 |
| 340 | Ga0207709_10958849 | 3300025935 | Bacteria | 698 |
| 341 | Ga0207709_11631939 | 3300025935 | Bacteria | 536 |
| 342 | Ga0207669_11933980 | 3300025937 | Bacteria | 504 |
| 343 | Ga0207704_10440476 | 3300025938 | Bacteria | 1038 |
| 344 | Ga0207665_10007335 | 3300025939 | Bacteria | 7294 |
| 345 | Ga0207665_10154222 | 3300025939 | Bacteria | 1647 |
| 346 | Ga0207711_10753361 | 3300025941 | Bacteria | 908 |
| 347 | Ga0207689_11041366 | 3300025942 | Bacteria | 690 |
| 348 | Ga0207661_10003778 | 3300025944 | Bacteria | 10556 |
| 349 | Ga0207661_10019199 | 3300025944 | Bacteria | 5092 |
| 350 | Ga0207661_10094389 | 3300025944 | Bacteria | 2499 |
| 351 | Ga0207661_10229811 | 3300025944 | Bacteria | 1642 |
| 352 | Ga0207661_10632168 | 3300025944 | Bacteria | 983 |
| 353 | Ga0207679_10042141 | 3300025945 | Bacteria | 3279 |
| 354 | Ga0207679_10130440 | 3300025945 | Bacteria | 2016 |
| 355 | Ga0207667_10062476 | 3300025949 | Bacteria | 3894 |
| 356 | Ga0207667_10151667 | 3300025949 | Bacteria | 2385 |
| 357 | Ga0207667_10438227 | 3300025949 | Bacteria | 1328 |
| 358 | Ga0207712_10129121 | 3300025961 | Bacteria | 1923 |
| 359 | Ga0207668_10061896 | 3300025972 | Bacteria | 2634 |
| 360 | Ga0207668_10106338 | 3300025972 | Bacteria | 2096 |
| 361 | Ga0207668_10152887 | 3300025972 | Bacteria | 1789 |
| 362 | Ga0207668_11239844 | 3300025972 | Bacteria | 671 |
| 363 | Ga0207677_10627762 | 3300026023 | Bacteria | 946 |
| 364 | Ga0207678_10342509 | 3300026067 | Bacteria | 1288 |
| 365 | Ga0207678_10826813 | 3300026067 | Bacteria | 818 |
| 366 | Ga0207708_11121002 | 3300026075 | Bacteria | 686 |
| 367 | Ga0207702_10026096 | 3300026078 | Bacteria | 4851 |
| 368 | Ga0207702_10055906 | 3300026078 | Bacteria | 3349 |
| 369 | Ga0207702_11244373 | 3300026078 | Bacteria | 738 |
| 370 | Ga0207648_10039412 | 3300026089 | Bacteria | 4155 |
| 371 | Ga0207676_10838310 | 3300026095 | Bacteria | 899 |
| 372 | Ga0207674_10103020 | 3300026116 | Bacteria | 2834 |
| 373 | Ga0207674_10108055 | 3300026116 | Bacteria | 2759 |
| 374 | Ga0207675_100088997 | 3300026118 | Bacteria | 2900 |
| 375 | Ga0207675_101388605 | 3300026118 | Bacteria | 723 |
| 376 | Ga0207683_11329260 | 3300026121 | Bacteria | 665 |
| 377 | Ga0207683_11684754 | 3300026121 | Bacteria | 583 |
| 378 | Ga0268266_10252098 | 3300028379 | Bacteria | 1633 |
| 379 | Ga0268265_10998321 | 3300028380 | Bacteria | 827 |
| 380 | Ga0268264_10596134 | 3300028381 | Bacteria | 1088 |
| 381 | Ga0265319_1025488 | 3300028563 | Bacteria | 2116 |
| 382 | Ga0265318_10052499 | 3300028577 | Bacteria | 1530 |
| 383 | Ga0265318_10078356 | 3300028577 | Bacteria | 1221 |
| 384 | Ga0265318_10087716 | 3300028577 | Bacteria | 1146 |
| 385 | Ga0265322_10054404 | 3300028654 | Unclassified | 1135 |
| 386 | Ga0265338_10007064 | 3300028800 | Bacteria | 14079 |
| 387 | Ga0265338_10382411 | 3300028800 | Unclassified | 1006 |
| 388 | Ga0265338_10506487 | 3300028800 | Bacteria | 849 |
| 389 | Ga0265320_10070894 | 3300031240 | Bacteria | 1642 |
| 390 | Ga0265327_10017969 | 3300031251 | Bacteria | 4405 |
| 391 | Ga0265327_10088501 | 3300031251 | Bacteria | 1514 |
| 392 | Ga0307405_10128514 | 3300031731 | Bacteria | 1747 |
| 393 | Ga0307413_10453533 | 3300031824 | Bacteria | 1018 |
| 394 | Ga0307410_10346642 | 3300031852 | Bacteria | 1185 |
| 395 | Ga0307410_11576523 | 3300031852 | Bacteria | 580 |
| 396 | Ga0307406_10218345 | 3300031901 | Bacteria | 1415 |
| 397 | Ga0307407_11274296 | 3300031903 | Bacteria | 576 |
| 398 | Ga0307412_10295070 | 3300031911 | Bacteria | 1279 |
| 399 | Ga0307409_100413067 | 3300031995 | Bacteria | 1292 |
| 400 | Ga0307409_101331804 | 3300031995 | Bacteria | 743 |
| 401 | Ga0307416_100051442 | 3300032002 | Bacteria | 3291 |
| 402 | Ga0307416_100260956 | 3300032002 | Bacteria | 1693 |
| 403 | Ga0307416_101081339 | 3300032002 | Bacteria | 906 |
| 404 | Ga0307416_101655456 | 3300032002 | Unclassified | 745 |
| 405 | Ga0307414_10493413 | 3300032004 | Bacteria | 1082 |
| 406 | Ga0307415_100038491 | 3300032126 | Bacteria | 3152 |
| 407 | Ga0307415_100305203 | 3300032126 | Bacteria | 1320 |
| 408 | Ga0307415_100650673 | 3300032126 | Bacteria | 945 |
| 409 | Ga0307415_101497355 | 3300032126 | Bacteria | 645 |
| 410 | Ga0373926_0059401 | 3300035083 | Unclassified | 1392 |
| 411 | Ga0373944_0010616 | 3300035089 | Bacteria | 2512 |
| 412 | Ga0373941_0417103 | 3300035115 | Bacteria | 558 |
| 413 | Ga0373945_0012208 | 3300035116 | Bacteria | 2849 |
| 414 | Ga0373956_0159685 | 3300035119 | Bacteria | 1062 |
| 415 | Ga0373943_0000112 | 3300035170 | Bacteria | 30215 |
| 416 | Ga0373943_0069862 | 3300035170 | Bacteria | 1776 |
| 417 | Ga0373943_0409292 | 3300035170 | Bacteria | 784 |
| 418 | Ga0373946_0008171 | 3300035171 | Bacteria | 3840 |
| 419 | Ga0373955_0134969 | 3300035172 | Bacteria | 1443 |
| 420 | Ga0373931_0512209 | 3300035691 | Bacteria | 775 |
| 421 | Ga0373935_0091508 | 3300035692 | Bacteria | 1992 |
| 422 | Ga0373927_0021849 | 3300035695 | Bacteria | 4194 |
| 423 | Ga0373933_0413786 | 3300035724 | Bacteria | 880 |
| 424 | Ga0373947_0000600 | 3300035725 | Bacteria | 21231 |
| 425 | Ga0373947_0205433 | 3300035725 | Bacteria | 1290 |
| 426 | Ga0373937_0709846 | 3300036401 | Bacteria | 952 |
| 427 | Ga0373937_0940959 | 3300036401 | Bacteria | 813 |
| 428 | Ga0316584_0500003 | 3300036712 | Bacteria | 854 |
| 429 | Ga0373925_0009167 | 3300037068 | Bacteria | 7203 |
| 430 | Ga0395899_0001446 | 3300037312 | Bacteria | 20244 |
| 431 | Ga0395899_0013404 | 3300037312 | Bacteria | 6272 |
| 432 | Ga0395899_0019546 | 3300037312 | Bacteria | 5144 |
| 433 | Ga0395899_0020632 | 3300037312 | Bacteria | 4995 |
| 434 | Ga0395899_0029130 | 3300037312 | Bacteria | 4152 |
| 435 | Ga0395899_0062762 | 3300037312 | Bacteria | 2735 |
| 436 | Ga0395899_0084198 | 3300037312 | Bacteria | 2311 |
| 437 | Ga0395899_0156099 | 3300037312 | Bacteria | 1615 |
| 438 | Ga0395899_0246384 | 3300037312 | Bacteria | 1228 |
| 439 | Ga0395899_0272482 | 3300037312 | Bacteria | 1154 |
| 440 | Ga0395900_0000871 | 3300037418 | Bacteria | 39650 |
| 441 | Ga0395900_0001970 | 3300037418 | Bacteria | 23182 |
| 442 | Ga0395900_0008763 | 3300037418 | Bacteria | 10393 |
| 443 | Ga0395900_0013678 | 3300037418 | Bacteria | 8285 |
| 444 | Ga0395900_0024341 | 3300037418 | Bacteria | 6200 |
| 445 | Ga0395900_0041807 | 3300037418 | Bacteria | 4724 |
| 446 | Ga0395900_0043734 | 3300037418 | Bacteria | 4617 |
| 447 | Ga0395900_0188662 | 3300037418 | Bacteria | 2092 |
| 448 | Ga0395900_0203195 | 3300037418 | Bacteria | 2004 |
| 449 | Ga0395900_0227314 | 3300037418 | Bacteria | 1878 |
| 450 | Ga0395900_0324415 | 3300037418 | Bacteria | 1519 |
| 451 | Ga0395900_0364281 | 3300037418 | Bacteria | 1416 |
| 452 | Ga0395900_0391491 | 3300037418 | Bacteria | 1356 |
| 453 | Ga0395900_0633137 | 3300037418 | Bacteria | 1007 |
| 454 | Ga0395898_0003281 | 3300037466 | Bacteria | 18190 |
| 455 | Ga0395898_0003578 | 3300037466 | Bacteria | 17318 |
| 456 | Ga0395898_0011698 | 3300037466 | Bacteria | 9099 |
| 457 | Ga0395898_0017911 | 3300037466 | Bacteria | 7227 |
| 458 | Ga0395898_0039798 | 3300037466 | Bacteria | 4651 |
| 459 | Ga0395898_0058640 | 3300037466 | Bacteria | 3747 |
| 460 | Ga0395898_0069093 | 3300037466 | Bacteria | 3418 |
| 461 | Ga0395898_0069994 | 3300037466 | Bacteria | 3393 |
| 462 | Ga0395898_0077875 | 3300037466 | Bacteria | 3200 |
| 463 | Ga0395898_0102181 | 3300037466 | Bacteria | 2752 |
| 464 | Ga0395898_0163183 | 3300037466 | Bacteria | 2131 |
| 465 | Ga0395898_0196377 | 3300037466 | Bacteria | 1927 |
| 466 | Ga0395898_0482248 | 3300037466 | Bacteria | 1180 |
| 467 | Ga0395898_0499507 | 3300037466 | Bacteria | 1157 |
| 468 | Ga0395898_0603532 | 3300037466 | Bacteria | 1040 |
| 469 | Ga0395898_0634691 | 3300037466 | Bacteria | 1011 |
| 470 | Ga0395898_0774995 | 3300037466 | Bacteria | 900 |
| 471 | Ga0395905_0001130 | 3300037471 | Bacteria | 33392 |
| 472 | Ga0395905_0002425 | 3300037471 | Bacteria | 20684 |
| 473 | Ga0395905_0006790 | 3300037471 | Bacteria | 11468 |
| 474 | Ga0395905_0034713 | 3300037471 | Bacteria | 4737 |
| 475 | Ga0395905_0085832 | 3300037471 | Bacteria | 2949 |
| 476 | Ga0395905_0178137 | 3300037471 | Bacteria | 1995 |
| 477 | Ga0395905_0345195 | 3300037471 | Bacteria | 1380 |
| 478 | Ga0395905_0612284 | 3300037471 | Bacteria | 991 |
| 479 | Ga0395905_1288090 | 3300037471 | Bacteria | 634 |
| 480 | Ga0395905_1795841 | 3300037471 | Bacteria | 519 |
| 481 | Ga0395901_0004009 | 3300038443 | Bacteria | 14831 |
| 482 | Ga0395901_0005447 | 3300038443 | Bacteria | 12885 |
| 483 | Ga0395901_0006956 | 3300038443 | Bacteria | 11428 |
| 484 | Ga0395901_0007511 | 3300038443 | Bacteria | 11008 |
| 485 | Ga0395901_0016021 | 3300038443 | Bacteria | 7637 |
| 486 | Ga0395901_0038828 | 3300038443 | Bacteria | 4924 |
| 487 | Ga0395901_0061730 | 3300038443 | Bacteria | 3900 |
| 488 | Ga0395901_0062370 | 3300038443 | Bacteria | 3879 |
| 489 | Ga0395901_0093813 | 3300038443 | Bacteria | 3143 |
| 490 | Ga0395901_0118265 | 3300038443 | Bacteria | 2784 |
| 491 | Ga0395901_0127957 | 3300038443 | Bacteria | 2669 |
| 492 | Ga0395901_0144701 | 3300038443 | Bacteria | 2499 |
| 493 | Ga0395901_0239619 | 3300038443 | Bacteria | 1892 |
| 494 | Ga0395901_0267913 | 3300038443 | Bacteria | 1777 |
| 495 | Ga0395901_0383850 | 3300038443 | Bacteria | 1445 |
| 496 | Ga0395901_0434513 | 3300038443 | Bacteria | 1344 |
| 497 | Ga0395901_0516672 | 3300038443 | Bacteria | 1214 |
| 498 | Ga0395901_0706815 | 3300038443 | Bacteria | 1005 |
| 499 | Ga0395901_1356169 | 3300038443 | Unclassified | 671 |
| 500 | Ga0395901_1934535 | 3300038443 | Bacteria | 537 |
| 501 | Ga0242419_009978 | 3300038698 | Bacteria | 723 |
| 502 | Ga0242422_03412 | 3300038699 | Bacteria | 1040 |
| 503 | Ga0436363_0452021 | 3300039450 | Bacteria | 770 |
| 504 | Ga0451835_0186085 | 3300041492 | Unclassified | 1001 |
| 505 | Ga0451839_1214626 | 3300041496 | Unclassified | 677 |
| 506 | Ga0451853_2305819 | 3300041512 | Bacteria | 1007 |
| 507 | Ga0466969_0337257 | 3300044656 | Bacteria | 682 |
| 508 | Ga0453683_0557697 | 3300044673 | Bacteria | 746 |
| 509 | Ga0466965_0428286 | 3300044683 | Bacteria | 734 |
| 510 | Ga0466966_0131090 | 3300044684 | Bacteria | 1535 |
| 511 | Ga0466966_0723016 | 3300044684 | Bacteria | 600 |
| 512 | Ga0466961_0330984 | 3300044693 | Bacteria | 928 |
| 513 | Ga0466963_0006377 | 3300044694 | Bacteria | 6980 |
| 514 | Ga0466963_0009698 | 3300044694 | Bacteria | 5808 |
| 515 | Ga0466963_0288214 | 3300044694 | Bacteria | 1154 |
| 516 | Ga0466963_0331079 | 3300044694 | Bacteria | 1072 |
| 517 | Ga0466968_0600552 | 3300044735 | Unclassified | 556 |
| 518 | Ga0466959_0640218 | 3300045049 | Bacteria | 714 |
| 519 | Ga0466967_0035947 | 3300045976 | Bacteria | 4223 |
| 520 | Ga0466967_0046714 | 3300045976 | Bacteria | 3771 |
| 521 | Ga0466967_0046844 | 3300045976 | Bacteria | 3767 |
| 522 | Ga0466967_0062330 | 3300045976 | Bacteria | 3310 |
| 523 | Ga0466967_0249412 | 3300045976 | Bacteria | 1695 |
| 524 | Ga0466967_0409917 | 3300045976 | Bacteria | 1320 |
| 525 | Ga0466967_1112655 | 3300045976 | Bacteria | 787 |
| 526 | Ga0466967_2277628 | 3300045976 | Unclassified | 537 |
| 527 | Ga0495592_0165482 | 3300046454 | Bacteria | 1518 |
| 528 | Ga0495592_0291818 | 3300046454 | Bacteria | 1063 |
| 529 | Ga0495603_0254211 | 3300046455 | Bacteria | 1012 |
| 530 | Ga0495603_0768697 | 3300046455 | Bacteria | 550 |
| 531 | Ga0495629_0000593 | 3300046459 | Bacteria | 29449 |
| 532 | Ga0495629_0011270 | 3300046459 | Bacteria | 6495 |
| 533 | Ga0495629_0222495 | 3300046459 | Bacteria | 1302 |
| 534 | Ga0495641_0000529 | 3300046461 | Bacteria | 32060 |
| 535 | Ga0495641_0019594 | 3300046461 | Bacteria | 3455 |
| 536 | Ga0495641_0063366 | 3300046461 | Bacteria | 1666 |
| 537 | Ga0495641_0120231 | 3300046461 | Bacteria | 1172 |
| 538 | Ga0495641_0320446 | 3300046461 | Bacteria | 699 |
| 539 | Ga0495651_0082191 | 3300046462 | Bacteria | 2430 |
| 540 | Ga0495651_0170718 | 3300046462 | Bacteria | 1549 |
| 541 | Ga0495653_0006289 | 3300046463 | Bacteria | 9743 |
| 542 | Ga0495653_0115903 | 3300046463 | Bacteria | 1917 |
| 543 | Ga0495653_0178742 | 3300046463 | Unclassified | 1458 |
| 544 | Ga0495653_0181433 | 3300046463 | Bacteria | 1444 |
| 545 | Ga0495582_0000056 | 3300046473 | Bacteria | 57084 |
| 546 | Ga0495582_0106181 | 3300046473 | Bacteria | 1575 |
| 547 | Ga0495582_0151341 | 3300046473 | Bacteria | 1317 |
| 548 | Ga0495605_0068460 | 3300046474 | Bacteria | 1682 |
| 549 | Ga0495639_0003603 | 3300046475 | Bacteria | 6681 |
| 550 | Ga0495662_0015110 | 3300046476 | Bacteria | 3750 |
| 551 | Ga0495662_0058719 | 3300046476 | Bacteria | 1858 |
| 552 | Ga0495662_0572808 | 3300046476 | Bacteria | 553 |
| 553 | Ga0495664_0111202 | 3300046477 | Bacteria | 1653 |
| 554 | Ga0495584_0123605 | 3300046491 | Bacteria | 1311 |
| 555 | Ga0495584_0303429 | 3300046491 | Bacteria | 811 |
| 556 | Ga0495608_0012356 | 3300046511 | Bacteria | 5929 |
| 557 | Ga0495608_0263552 | 3300046511 | Bacteria | 1072 |
| 558 | Ga0495618_0218025 | 3300046514 | Bacteria | 1204 |
| 559 | Ga0495628_0580398 | 3300046516 | Bacteria | 802 |
| 560 | Ga0495630_0005694 | 3300046517 | Bacteria | 8809 |
| 561 | Ga0495630_0297650 | 3300046517 | Bacteria | 1233 |
| 562 | Ga0495663_0100296 | 3300046525 | Bacteria | 953 |
| 563 | Ga0495666_0041659 | 3300046526 | Bacteria | 2223 |
| 564 | Ga0495666_0223944 | 3300046526 | Bacteria | 861 |
| 565 | Ga0495652_0215186 | 3300046529 | Bacteria | 1447 |
| 566 | Ga0495665_0000910 | 3300046531 | Bacteria | 15584 |
| 567 | Ga0495665_0360023 | 3300046531 | Bacteria | 740 |
| 568 | Ga0495665_0395869 | 3300046531 | Bacteria | 701 |
| 569 | Ga0495640_0017849 | 3300046533 | Bacteria | 5278 |
| 570 | Ga0495640_0074570 | 3300046533 | Bacteria | 2268 |
| 571 | Ga0495587_0115628 | 3300046536 | Bacteria | 1539 |
| 572 | Ga0495609_0215392 | 3300046538 | Bacteria | 799 |
| 573 | Ga0495645_0390316 | 3300046543 | Unclassified | 889 |
| 574 | Ga0495645_0489058 | 3300046543 | Bacteria | 771 |
| 575 | Ga0495667_0047005 | 3300046559 | Bacteria | 2852 |
| 576 | Ga0495667_0228023 | 3300046559 | Bacteria | 1188 |
| 577 | Ga0495656_0020716 | 3300046615 | Bacteria | 2553 |
| 578 | Ga0495656_0069782 | 3300046615 | Bacteria | 1558 |
| 579 | Ga0495668_0843772 | 3300046616 | Bacteria | 508 |
| 580 | Ga0495634_0026999 | 3300046642 | Bacteria | 4000 |
| 581 | Ga0495634_0059917 | 3300046642 | Bacteria | 2534 |
| 582 | Ga0495634_0129034 | 3300046642 | Bacteria | 1613 |
| 583 | Ga0495634_0293268 | 3300046642 | Bacteria | 985 |
| 584 | Ga0495635_0062901 | 3300046663 | Bacteria | 2548 |
| 585 | Ga0495635_0068001 | 3300046663 | Bacteria | 2443 |
| 586 | Ga0495661_0506470 | 3300046665 | Bacteria | 575 |
| 587 | Ga0495657_0141611 | 3300046675 | Bacteria | 1498 |
| 588 | Ga0495657_0419244 | 3300046675 | Bacteria | 786 |
| 589 | Ga0495599_0472628 | 3300046678 | Unclassified | 740 |
| 590 | Ga0495646_0176412 | 3300046680 | Bacteria | 1175 |
| 591 | Ga0495647_0036946 | 3300046681 | Bacteria | 1841 |
| 592 | Ga0495647_0039362 | 3300046681 | Bacteria | 1792 |
| 593 | Ga0495658_0000204 | 3300046683 | Bacteria | 34365 |
| 594 | Ga0495658_0023753 | 3300046683 | Bacteria | 3258 |
| 595 | Ga0495658_0656960 | 3300046683 | Bacteria | 672 |
| 596 | Ga0495613_0000401 | 3300046689 | Bacteria | 37127 |
| 597 | Ga0495613_0028490 | 3300046689 | Bacteria | 4154 |
| 598 | Ga0495613_0142879 | 3300046689 | Bacteria | 1709 |
| 599 | Ga0495624_0006658 | 3300046690 | Bacteria | 8170 |
| 600 | Ga0495624_0596970 | 3300046690 | Bacteria | 658 |
| 601 | Ga0495589_0297348 | 3300046794 | Bacteria | 749 |
| 602 | Ga0495600_0030104 | 3300046809 | Bacteria | 3515 |
| 603 | Ga0495600_0344849 | 3300046809 | Bacteria | 934 |
| 604 | Ga0495600_0957011 | 3300046809 | Bacteria | 503 |
| 605 | Ga0495581_0000517 | 3300047315 | Bacteria | 19788 |
| 606 | Ga0495581_0009359 | 3300047315 | Bacteria | 5669 |
| 607 | Ga0495581_0213008 | 3300047315 | Bacteria | 1130 |
| 608 | Ga0495604_0074351 | 3300047317 | Bacteria | 2561 |
| 609 | Ga0495604_0148497 | 3300047317 | Bacteria | 1668 |
| 610 | Ga0495674_0029603 | 3300047319 | Bacteria | 4985 |
| 611 | Ga0495674_1054872 | 3300047319 | Unclassified | 620 |
| 612 | Ga0495676_0010912 | 3300047321 | Bacteria | 8212 |
| 613 | Ga0495676_0026584 | 3300047321 | Bacteria | 4980 |
| 614 | Ga0495676_0027069 | 3300047321 | Bacteria | 4924 |
| 615 | Ga0495680_0004651 | 3300047322 | Bacteria | 13073 |
| 616 | Ga0495680_0008870 | 3300047322 | Bacteria | 9095 |
| 617 | Ga0495680_0019712 | 3300047322 | Bacteria | 5690 |
| 618 | Ga0495680_0317005 | 3300047322 | Bacteria | 1092 |
| 619 | Ga0495675_0260164 | 3300047444 | Bacteria | 1040 |
| 620 | Ga0495684_0020222 | 3300047471 | Bacteria | 5128 |
| 621 | Ga0495684_0233497 | 3300047471 | Unclassified | 1344 |
| 622 | Ga0495684_0834263 | 3300047471 | Bacteria | 599 |
| 623 | Ga0495593_0001987 | 3300047673 | Bacteria | 12195 |
| 624 | Ga0495593_0099580 | 3300047673 | Bacteria | 1492 |
| 625 | Ga0495614_0026119 | 3300048089 | Bacteria | 2517 |
| 626 | Ga0496100_0002141 | 3300048903 | Bacteria | 9943 |
| 627 | Ga0496100_0044261 | 3300048903 | Bacteria | 2850 |
| 628 | Ga0496100_0048104 | 3300048903 | Bacteria | 2752 |
| 629 | Ga0496100_0068131 | 3300048903 | Bacteria | 2366 |
| 630 | Ga0496100_0081240 | 3300048903 | Bacteria | 2189 |
| 631 | Ga0496100_0791936 | 3300048903 | Bacteria | 742 |
| 632 | Ga0496101_0018182 | 3300048904 | Bacteria | 4776 |
| 633 | Ga0496101_0029430 | 3300048904 | Bacteria | 3841 |
| 634 | Ga0496101_0074736 | 3300048904 | Bacteria | 2493 |
| 635 | Ga0496101_0121800 | 3300048904 | Bacteria | 1972 |
| 636 | Ga0496101_0133624 | 3300048904 | Bacteria | 1886 |
| 637 | Ga0496101_0154321 | 3300048904 | Bacteria | 1758 |
| 638 | Ga0496101_0158421 | 3300048904 | Bacteria | 1735 |
| 639 | Ga0496101_0178505 | 3300048904 | Bacteria | 1634 |
| 640 | Ga0496101_0326361 | 3300048904 | Bacteria | 1204 |
| 641 | Ga0496101_0764501 | 3300048904 | Bacteria | 762 |
| 642 | Ga0496102_0015240 | 3300048905 | Bacteria | 6693 |
| 643 | Ga0496102_0023826 | 3300048905 | Bacteria | 5439 |
| 644 | Ga0496102_0081453 | 3300048905 | Bacteria | 2984 |
| 645 | Ga0496102_0172819 | 3300048905 | Bacteria | 2034 |
| 646 | Ga0496102_0225713 | 3300048905 | Bacteria | 1766 |
| 647 | Ga0496102_0337572 | 3300048905 | Bacteria | 1419 |
| 648 | Ga0496102_0610899 | 3300048905 | Bacteria | 1013 |
| 649 | Ga0496102_0646653 | 3300048905 | Bacteria | 981 |
| 650 | Ga0496102_1549033 | 3300048905 | Bacteria | 581 |
| 651 | Ga0496103_0009328 | 3300048906 | Bacteria | 5813 |
| 652 | Ga0496103_0081294 | 3300048906 | Bacteria | 2038 |
| 653 | Ga0496103_0103250 | 3300048906 | Bacteria | 1806 |
| 654 | Ga0496103_0143006 | 3300048906 | Bacteria | 1530 |
| 655 | Ga0496103_0147150 | 3300048906 | Bacteria | 1508 |
| 656 | Ga0496104_0000571 | 3300048907 | Bacteria | 31432 |
| 657 | Ga0496104_0004078 | 3300048907 | Bacteria | 12675 |
| 658 | Ga0496104_0013102 | 3300048907 | Bacteria | 7472 |
| 659 | Ga0496104_0063550 | 3300048907 | Bacteria | 3501 |
| 660 | Ga0496104_0477178 | 3300048907 | Bacteria | 1158 |
| 661 | Ga0496105_0019907 | 3300048908 | Bacteria | 5415 |
| 662 | Ga0496105_0021402 | 3300048908 | Bacteria | 5233 |
| 663 | Ga0496105_0102434 | 3300048908 | Bacteria | 2364 |
| 664 | Ga0496105_0240795 | 3300048908 | Bacteria | 1468 |
| 665 | Ga0496105_0340463 | 3300048908 | Bacteria | 1199 |
| 666 | Ga0496105_0582406 | 3300048908 | Bacteria | 870 |
| 667 | Ga0496105_0660240 | 3300048908 | Bacteria | 806 |
| 668 | Ga0496106_0001809 | 3300048909 | Bacteria | 15988 |
| 669 | Ga0496106_0061267 | 3300048909 | Bacteria | 2854 |
| 670 | Ga0496106_0212736 | 3300048909 | Bacteria | 1540 |
| 671 | Ga0496106_0249434 | 3300048909 | Bacteria | 1419 |
| 672 | Ga0496106_0268126 | 3300048909 | Bacteria | 1367 |
| 673 | Ga0496107_0029831 | 3300048910 | Bacteria | 3884 |
| 674 | Ga0496107_0053635 | 3300048910 | Bacteria | 2908 |
| 675 | Ga0496107_0180795 | 3300048910 | Bacteria | 1566 |
| 676 | Ga0496107_0198279 | 3300048910 | Bacteria | 1492 |
| 677 | Ga0496107_0491331 | 3300048910 | Bacteria | 910 |
| 678 | Ga0496107_0570107 | 3300048910 | Bacteria | 838 |
| 679 | Ga0496108_0006700 | 3300048911 | Bacteria | 9326 |
| 680 | Ga0496108_0015055 | 3300048911 | Bacteria | 6315 |
| 681 | Ga0496108_0037194 | 3300048911 | Bacteria | 4053 |
| 682 | Ga0496108_0098939 | 3300048911 | Bacteria | 2486 |
| 683 | Ga0496108_0213516 | 3300048911 | Bacteria | 1675 |
| 684 | Ga0496108_0286532 | 3300048911 | Bacteria | 1434 |
| 685 | Ga0496108_0602890 | 3300048911 | Bacteria | 957 |
| 686 | Ga0496108_0913356 | 3300048911 | Unclassified | 753 |
| 687 | Ga0496109_0000638 | 3300048912 | Bacteria | 29181 |
| 688 | Ga0496109_0000992 | 3300048912 | Bacteria | 23409 |
| 689 | Ga0496109_0017313 | 3300048912 | Bacteria | 6314 |
| 690 | Ga0496109_0236587 | 3300048912 | Bacteria | 1718 |
| 691 | Ga0496109_0255488 | 3300048912 | Bacteria | 1650 |
| 692 | Ga0496109_0292057 | 3300048912 | Bacteria | 1537 |
| 693 | Ga0496109_0834842 | 3300048912 | Bacteria | 859 |
| 694 | Ga0496109_0882527 | 3300048912 | Bacteria | 832 |
| 695 | Ga0496109_1794561 | 3300048912 | Bacteria | 547 |
| 696 | Ga0496110_0001697 | 3300048913 | Bacteria | 16194 |
| 697 | Ga0496110_0004437 | 3300048913 | Bacteria | 10877 |
| 698 | Ga0496110_0030272 | 3300048913 | Bacteria | 4665 |
| 699 | Ga0496110_0163250 | 3300048913 | Bacteria | 2019 |
| 700 | Ga0496110_0280503 | 3300048913 | Bacteria | 1517 |
| 701 | Ga0496110_0601741 | 3300048913 | Bacteria | 997 |
| 702 | Ga0496110_0635728 | 3300048913 | Bacteria | 966 |
| 703 | Ga0496110_0883451 | 3300048913 | Bacteria | 799 |
| 704 | Ga0496111_0000025 | 3300048914 | Bacteria | 62100 |
| 705 | Ga0496111_0000598 | 3300048914 | Bacteria | 19022 |
| 706 | Ga0496111_0019783 | 3300048914 | Bacteria | 4682 |
| 707 | Ga0496111_0027978 | 3300048914 | Bacteria | 3993 |
| 708 | Ga0496111_0058238 | 3300048914 | Bacteria | 2797 |
| 709 | Ga0496111_0194638 | 3300048914 | Bacteria | 1507 |
| 710 | Ga0496111_0265303 | 3300048914 | Bacteria | 1274 |
| 711 | Ga0496111_0347061 | 3300048914 | Bacteria | 1099 |
| 712 | Ga0496112_0001024 | 3300048915 | Bacteria | 20548 |
| 713 | Ga0496112_0185421 | 3300048915 | Bacteria | 2044 |
| 714 | Ga0496112_0253100 | 3300048915 | Bacteria | 1712 |
| 715 | Ga0496112_0488967 | 3300048915 | Bacteria | 1167 |
| 716 | Ga0496112_0530166 | 3300048915 | Unclassified | 1112 |
| 717 | Ga0496112_0717772 | 3300048915 | Bacteria | 927 |
| 718 | Ga0496112_0818207 | 3300048915 | Bacteria | 856 |
| 719 | Ga0496113_0207636 | 3300048916 | Bacteria | 1558 |
| 720 | Ga0496113_0418151 | 3300048916 | Bacteria | 1077 |
| 721 | Ga0496114_0001903 | 3300048917 | Bacteria | 15881 |
| 722 | Ga0496114_0019534 | 3300048917 | Bacteria | 5490 |
| 723 | Ga0496114_0039807 | 3300048917 | Bacteria | 3890 |
| 724 | Ga0496114_0045742 | 3300048917 | Bacteria | 3637 |
| 725 | Ga0496114_0093503 | 3300048917 | Bacteria | 2556 |
| 726 | Ga0496114_0094560 | 3300048917 | Bacteria | 2542 |
| 727 | Ga0496114_0116801 | 3300048917 | Bacteria | 2291 |
| 728 | Ga0496114_0147736 | 3300048917 | Bacteria | 2038 |
| 729 | Ga0496114_0429351 | 3300048917 | Bacteria | 1170 |
| 730 | Ga0496114_0555414 | 3300048917 | Bacteria | 1014 |
| 731 | Ga0496115_0005415 | 3300048918 | Bacteria | 9283 |
| 732 | Ga0496115_0035750 | 3300048918 | Bacteria | 3932 |
| 733 | Ga0496115_0298254 | 3300048918 | Bacteria | 1321 |
| 734 | Ga0496115_0546724 | 3300048918 | Bacteria | 926 |
| 735 | Ga0501031_0002836 | 3300049568 | Bacteria | 11064 |
| 736 | Ga0501031_0215861 | 3300049568 | Bacteria | 1249 |
| 737 | Ga0501032_0023044 | 3300049569 | Bacteria | 4310 |
| 738 | Ga0501032_0590662 | 3300049569 | Bacteria | 707 |
| 739 | Ga0501034_0064118 | 3300049571 | Bacteria | 3688 |
| 740 | Ga0501036_0006773 | 3300049572 | Bacteria | 9303 |
| 741 | Ga0501036_0073602 | 3300049572 | Bacteria | 2888 |
| 742 | Ga0501036_0301277 | 3300049572 | Bacteria | 1341 |
| 743 | Ga0501036_0764951 | 3300049572 | Bacteria | 796 |
| 744 | Ga0501036_0992622 | 3300049572 | Bacteria | 687 |
| 745 | Ga0501036_1314319 | 3300049572 | Bacteria | 587 |
| 746 | Ga0501037_0103140 | 3300049573 | Bacteria | 2057 |
| 747 | Ga0501037_0228977 | 3300049573 | Unclassified | 1305 |
| 748 | Ga0501038_0024691 | 3300049574 | Bacteria | 5359 |
| 749 | Ga0501038_0129474 | 3300049574 | Bacteria | 2074 |
| 750 | Ga0501038_0401156 | 3300049574 | Bacteria | 1061 |
| 751 | Ga0501039_0004746 | 3300049575 | Bacteria | 10292 |
| 752 | Ga0501039_0181537 | 3300049575 | Bacteria | 1655 |
| 753 | Ga0501039_0394550 | 3300049575 | Bacteria | 1087 |
| 754 | Ga0501040_0004225 | 3300049576 | Bacteria | 9349 |
| 755 | Ga0501040_0052394 | 3300049576 | Bacteria | 2793 |
| 756 | Ga0501041_0004653 | 3300049577 | Bacteria | 7961 |
| 757 | Ga0501041_0089853 | 3300049577 | Bacteria | 1896 |
| 758 | Ga0501042_0008074 | 3300049578 | Bacteria | 6926 |
| 759 | Ga0501042_0009416 | 3300049578 | Bacteria | 6508 |
| 760 | Ga0501042_0090944 | 3300049578 | Bacteria | 2190 |
| 761 | Ga0501042_0184233 | 3300049578 | Bacteria | 1506 |
| 762 | Ga0501042_0573871 | 3300049578 | Unclassified | 820 |
| 763 | Ga0501043_0049092 | 3300049579 | Bacteria | 3317 |
| 764 | Ga0501043_0784959 | 3300049579 | Bacteria | 690 |
| 765 | Ga0501046_0001448 | 3300049580 | Bacteria | 22833 |
| 766 | Ga0501046_0132061 | 3300049580 | Bacteria | 1893 |
| 767 | Ga0501046_0328974 | 3300049580 | Bacteria | 1112 |
| 768 | Ga0501046_0708062 | 3300049580 | Bacteria | 709 |
| 769 | Ga0501047_0230687 | 3300049581 | Bacteria | 1705 |
| 770 | Ga0501047_0502347 | 3300049581 | Bacteria | 1039 |
| 771 | Ga0501047_0646821 | 3300049581 | Bacteria | 877 |
| 772 | Ga0501047_0742354 | 3300049581 | Bacteria | 798 |
| 773 | Ga0501048_0003992 | 3300049582 | Bacteria | 11203 |
| 774 | Ga0501048_0119455 | 3300049582 | Bacteria | 1862 |
| 775 | Ga0501048_0236980 | 3300049582 | Bacteria | 1295 |
| 776 | Ga0501067_0086276 | 3300049583 | Bacteria | 1742 |
| 777 | Ga0501067_0223945 | 3300049583 | Bacteria | 1047 |
| 778 | Ga0501067_0224914 | 3300049583 | Bacteria | 1045 |
| 779 | Ga0501067_0231389 | 3300049583 | Bacteria | 1029 |
| 780 | Ga0501068_0377105 | 3300049584 | Bacteria | 913 |
| 781 | Ga0501068_0600260 | 3300049584 | Bacteria | 717 |
| 782 | Ga0501069_0059219 | 3300049585 | Bacteria | 2137 |
| 783 | Ga0501069_0075565 | 3300049585 | Bacteria | 1892 |
| 784 | Ga0501069_0128744 | 3300049585 | Bacteria | 1449 |
| 785 | Ga0501069_0149679 | 3300049585 | Bacteria | 1341 |
| 786 | Ga0501069_0257508 | 3300049585 | Bacteria | 1018 |
| 787 | Ga0501069_0638757 | 3300049585 | Bacteria | 640 |
| 788 | Ga0501070_0003866 | 3300049586 | Bacteria | 12917 |
| 789 | Ga0501070_0128150 | 3300049586 | Bacteria | 2097 |
| 790 | Ga0501070_0273348 | 3300049586 | Unclassified | 1379 |
| 791 | Ga0501070_0315070 | 3300049586 | Bacteria | 1273 |
| 792 | Ga0501070_0517461 | 3300049586 | Bacteria | 957 |
| 793 | Ga0501070_0697168 | 3300049586 | Bacteria | 803 |
| 794 | Ga0501071_0026636 | 3300049587 | Bacteria | 4059 |
| 795 | Ga0501071_1021160 | 3300049587 | Bacteria | 639 |
| 796 | Ga0501071_1115318 | 3300049587 | Bacteria | 609 |
| 797 | Ga0501072_0011874 | 3300049588 | Bacteria | 6653 |
| 798 | Ga0501072_0026024 | 3300049588 | Bacteria | 4559 |
| 799 | Ga0501072_0034638 | 3300049588 | Bacteria | 3957 |
| 800 | Ga0501073_0006969 | 3300049589 | Bacteria | 8417 |
| 801 | Ga0501073_0020460 | 3300049589 | Bacteria | 4772 |
| 802 | Ga0501074_0018234 | 3300049590 | Bacteria | 5099 |
| 803 | Ga0501074_0035342 | 3300049590 | Bacteria | 3620 |
| 804 | Ga0501074_0063116 | 3300049590 | Bacteria | 2668 |
| 805 | Ga0501075_0006432 | 3300049591 | Bacteria | 8087 |
| 806 | Ga0501075_0027647 | 3300049591 | Bacteria | 4181 |
| 807 | Ga0501075_0260221 | 3300049591 | Bacteria | 1322 |
| 808 | Ga0501075_0787888 | 3300049591 | Bacteria | 723 |
| 809 | Ga0501076_0008714 | 3300049592 | Bacteria | 7448 |
| 810 | Ga0501076_0124959 | 3300049592 | Bacteria | 2084 |
| 811 | Ga0501076_0674294 | 3300049592 | Bacteria | 853 |
| 812 | Ga0501077_0010250 | 3300049593 | Bacteria | 5833 |
| 813 | Ga0501077_0989404 | 3300049593 | Bacteria | 541 |
| 814 | Ga0501242_029051 | 3300049674 | Bacteria | 741 |
| 815 | Ga0501243_066454 | 3300049675 | Bacteria | 678 |
| 816 | Ga0501079_0010771 | 3300049741 | Bacteria | 6961 |
| 817 | Ga0501079_0109663 | 3300049741 | Bacteria | 2144 |
| 818 | Ga0501079_0145539 | 3300049741 | Bacteria | 1846 |
| 819 | Ga0501079_1569962 | 3300049741 | Unclassified | 518 |
| 820 | Ga0501080_0007957 | 3300049742 | Bacteria | 9606 |
| 821 | Ga0501080_0070880 | 3300049742 | Bacteria | 3241 |
| 822 | Ga0501080_0209697 | 3300049742 | Bacteria | 1786 |
| 823 | Ga0501081_0011195 | 3300049743 | Bacteria | 5865 |
| 824 | Ga0501081_0035504 | 3300049743 | Bacteria | 3394 |
| 825 | Ga0501081_0036002 | 3300049743 | Bacteria | 3372 |
| 826 | Ga0501081_0047344 | 3300049743 | Bacteria | 2959 |
| 827 | Ga0501083_0033307 | 3300049744 | Bacteria | 3529 |
| 828 | Ga0501283_098101 | 3300049779 | Bacteria | 568 |
| 829 | Ga0501035_0008623 | 3300049822 | Bacteria | 9486 |
| 830 | Ga0501035_0014191 | 3300049822 | Bacteria | 7352 |
| 831 | Ga0501035_0458567 | 3300049822 | Bacteria | 1054 |
| 832 | Ga0501035_0734223 | 3300049822 | Bacteria | 794 |
| 833 | Ga0501044_0078509 | 3300049823 | Bacteria | 3345 |
| 834 | Ga0501044_0162808 | 3300049823 | Bacteria | 2206 |
| 835 | Ga0501044_0808063 | 3300049823 | Bacteria | 817 |
| 836 | Ga0501045_0005742 | 3300049824 | Bacteria | 8593 |
| 837 | Ga0501045_0033361 | 3300049824 | Bacteria | 3732 |
| 838 | Ga0501045_0047826 | 3300049824 | Bacteria | 3116 |
| 839 | nmdc:mga03n38_844024_c1 | 3300050490 | Bacteria | 535 |
| 840 | nmdc:mga00v17_127916_c1 | 3300050491 | Bacteria | 1622 |
| 841 | nmdc:mga00v17_144754_c1 | 3300050491 | Bacteria | 1525 |
| 842 | nmdc:mga00v17_259255_c1 | 3300050491 | Bacteria | 1128 |
| 843 | nmdc:mga00v17_632437_c1 | 3300050491 | Bacteria | 689 |
| 844 | nmdc:mga0yw44_273301_c1 | 3300050492 | Bacteria | 1128 |
| 845 | nmdc:mga0yw44_328455_c1 | 3300050492 | Bacteria | 1028 |
| 846 | nmdc:mga0yw44_47913_c1 | 3300050492 | Bacteria | 2575 |
| 847 | nmdc:mga0yw44_946406_c1 | 3300050492 | Bacteria | 584 |
| 848 | nmdc:mga0yw44_996418_c1 | 3300050492 | Bacteria | 567 |
| 849 | nmdc:mga06z11_156255_c1 | 3300050494 | Bacteria | 1300 |
| 850 | nmdc:mga06z11_187276_c1 | 3300050494 | Bacteria | 1196 |
| 851 | nmdc:mga06z11_200348_c1 | 3300050494 | Bacteria | 1159 |
| 852 | nmdc:mga05p37_205574_c1 | 3300050507 | Bacteria | 2382 |
| 853 | nmdc:mga05p37_206353_c1 | 3300050507 | Bacteria | 2377 |
| 854 | nmdc:mga05p37_59740_c1 | 3300050507 | Bacteria | 4695 |
| 855 | nmdc:mga05p37_718187_c1 | 3300050507 | Bacteria | 1107 |
| 856 | nmdc:mga06r32_125637_c1 | 3300050510 | Bacteria | 2533 |
| 857 | nmdc:mga06r32_289020_c1 | 3300050510 | Bacteria | 1626 |
| 858 | nmdc:mga08y16_77841_c1 | 3300050511 | Bacteria | 3457 |
| 859 | nmdc:mga0n895_11302_c1 | 3300050512 | Bacteria | 7956 |
| 860 | nmdc:mga0n895_1512414_c1 | 3300050512 | Bacteria | 637 |
| 861 | nmdc:mga0n895_418012_c1 | 3300050512 | Bacteria | 1355 |
| 862 | nmdc:mga0n895_77600_c1 | 3300050512 | Bacteria | 3305 |
| 863 | nmdc:mga0n895_91185_c1 | 3300050512 | Bacteria | 3050 |
| 864 | nmdc:mga0n895_99622_c1 | 3300050512 | Bacteria | 2914 |
| 865 | nmdc:mga0rr50_101254_c1 | 3300050513 | Bacteria | 2264 |
| 866 | nmdc:mga0rr50_328964_c1 | 3300050513 | Bacteria | 1282 |
| 867 | nmdc:mga0rr50_4672_c1 | 3300050513 | Bacteria | 8072 |
| 868 | nmdc:mga0rr50_468178_c1 | 3300050513 | Bacteria | 1069 |
| 869 | nmdc:mga0rr50_702115_c1 | 3300050513 | Bacteria | 863 |
| 870 | nmdc:mga08x19_59131_c1 | 3300050514 | Bacteria | 2481 |
| 871 | nmdc:mga0a205_22729_c1 | 3300050515 | Bacteria | 5945 |
| 872 | nmdc:mga0a205_39954_c1 | 3300050515 | Bacteria | 4517 |
| 873 | nmdc:mga0a205_50115_c1 | 3300050515 | Bacteria | 4031 |
| 874 | nmdc:mga0a205_758204_c1 | 3300050515 | Unclassified | 819 |
| 875 | Ga0495601_0101811 | 3300053077 | Bacteria | 1855 |
| 876 | Ga0495601_0151594 | 3300053077 | Bacteria | 1513 |
| 877 | Ga0495601_0175373 | 3300053077 | Bacteria | 1401 |
| 878 | Ga0495601_0459364 | 3300053077 | Unclassified | 823 |
| 879 | Ga0495601_0991394 | 3300053077 | Unclassified | 528 |
| 880 | Ga0495612_0055292 | 3300053078 | Bacteria | 1636 |
| 881 | Ga0495595_0009175 | 3300053084 | Bacteria | 4086 |
| 882 | Ga0495595_0023650 | 3300053084 | Bacteria | 2708 |
| 883 | Ga0495619_0001914 | 3300053085 | Bacteria | 13865 |
| 884 | Ga0495619_0008233 | 3300053085 | Bacteria | 6597 |
| 885 | Ga0495619_0019321 | 3300053085 | Bacteria | 4329 |
| 886 | Ga0495619_0063338 | 3300053085 | Bacteria | 2463 |
| 887 | Ga0495619_0075685 | 3300053085 | Bacteria | 2259 |
| 888 | Ga0501084_0013416 | 3300054114 | Bacteria | 6780 |
| 889 | Ga0501084_0072442 | 3300054114 | Bacteria | 2885 |
| 890 | Ga0501084_0219343 | 3300054114 | Bacteria | 1605 |
| 891 | Ga0501084_0776493 | 3300054114 | Bacteria | 807 |
| 892 | Ga0501084_0892034 | 3300054114 | Bacteria | 748 |
| 893 | Ga0587070_135859 | 3300059491 | Bacteria | 603 |
| 894 | Ga0587073_0218009 | 3300059492 | Unclassified | 581 |
| 895 | Ga0587077_196937 | 3300059493 | Bacteria | 555 |
| 896 | Ga0587067_179603 | 3300059640 | Bacteria | 550 |
| 897 | Ga0501082_0037616 | 3300060353 | Bacteria | 4173 |
| 898 | Ga0466962_0367385 | 3300061719 | Bacteria | 718 |
| 899 | Ga0530510_0018249 | 3300061734 | Bacteria | 4974 |
| 900 | Ga0530510_0171003 | 3300061734 | Bacteria | 1609 |
| 901 | Ga0530510_0519490 | 3300061734 | Bacteria | 903 |
| 902 | Ga0530510_0605013 | 3300061734 | Bacteria | 834 |
| 903 | Ga0395898_0590056 | |||
| 904 | JGI25406J46586_10036185 | |||
| 905 | JGI25406J46586_10170740 | |||
| 906 | Ga0070658_10008240 | |||
| 907 | Ga0070658_10512798 | |||
| 908 | Ga0070683_100005095 | |||
| 909 | Ga0070683_100008967 | |||
| 910 | Ga0070683_100147264 | |||
| 911 | Ga0070683_100210639 | |||
| 912 | Ga0070683_102099234 | |||
| 913 | Ga0070690_101253862 | |||
| 914 | Ga0070666_10142825 | |||
| 915 | Ga0070680_100061784 | |||
| 916 | Ga0070680_100712558 | |||
| 917 | Ga0070680_101043513 | |||
| 918 | Ga0070680_101544923 | |||
| 919 | Ga0070680_101658759 | |||
| 920 | Ga0070682_100232060 | |||
| 921 | Ga0070682_100531497 | |||
| 922 | Ga0068868_100775841 | |||
| 923 | Ga0070660_100045171 | |||
| 924 | Ga0070660_100077437 | |||
| 925 | Ga0070660_100670785 | |||
| 926 | Ga0070660_100680924 | |||
| 927 | Ga0070660_100826626 | |||
| 928 | Ga0070691_10771556 | |||
| 929 | Ga0070687_100381079 | |||
| 930 | Ga0070661_100206900 | |||
| 931 | Ga0070661_100583191 | |||
| 932 | Ga0070661_101010636 | |||
| 933 | Ga0070692_10632675 | |||
| 934 | Ga0070668_100097191 | |||
| 935 | Ga0070668_100306058 | |||
| 936 | Ga0070668_100309106 | |||
| 937 | Ga0070669_100457680 | |||
| 938 | Ga0070671_100386286 | |||
| 939 | Ga0070671_100559681 | |||
| 940 | Ga0070671_102038603 | |||
| 941 | Ga0070674_100216807 | |||
| 942 | Ga0070674_100233845 | |||
| 943 | Ga0070673_100855926 | |||
| 944 | Ga0070688_100173502 | |||
| 945 | Ga0070659_100056686 | |||
| 946 | Ga0070659_100280626 | |||
| 947 | Ga0070659_101009031 | |||
| 948 | Ga0070709_10063824 | |||
| 949 | Ga0070714_100443034 | |||
| 950 | Ga0070714_101310714 | |||
| 951 | Ga0070713_100202845 | |||
| 952 | Ga0070713_100452660 | |||
| 953 | Ga0070713_100466729 | |||
| 954 | Ga0070713_100839756 | |||
| 955 | Ga0070713_100947523 | |||
| 956 | Ga0070713_101441098 | |||
| 957 | Ga0070710_10009026 | |||
| 958 | Ga0070710_10099411 | |||
| 959 | Ga0070710_10309267 | |||
| 960 | Ga0070701_10085966 | |||
| 961 | Ga0070711_100038326 | |||
| 962 | Ga0070711_100168410 | |||
| 963 | Ga0070711_100202229 | |||
| 964 | Ga0070705_100123792 | |||
| 965 | Ga0070705_100553676 | |||
| 966 | Ga0070705_101948893 | |||
| 967 | Ga0070700_101125289 | |||
| 968 | Ga0070694_100074768 | |||
| 969 | Ga0070694_100090238 | |||
| 970 | Ga0070708_100171666 | |||
| 971 | Ga0070708_100186023 | |||
| 972 | Ga0070708_100294220 | |||
| 973 | Ga0070708_100353176 | |||
| 974 | Ga0070708_100714660 | |||
| 975 | Ga0070708_102195912 | |||
| 976 | Ga0070663_100546089 | |||
| 977 | Ga0070678_100228885 | |||
| 978 | Ga0070678_100930602 | |||
| 979 | Ga0070681_10022081 | |||
| 980 | Ga0070681_10111187 | |||
| 981 | Ga0070685_10852669 | |||
| 982 | Ga0070706_100229391 | |||
| 983 | Ga0070706_100233059 | |||
| 984 | Ga0070707_100629281 | |||
| 985 | Ga0070707_100772166 | |||
| 986 | Ga0070707_101886825 | |||
| 987 | Ga0070698_100032881 | |||
| 988 | Ga0070698_100386912 | |||
| 989 | Ga0070699_100322895 | |||
| 990 | Ga0070679_100007568 | |||
| 991 | Ga0070679_100013106 | |||
| 992 | Ga0070684_100000286 | |||
| 993 | Ga0070684_100010068 | |||
| 994 | Ga0070684_100020927 | |||
| 995 | Ga0070684_100488073 | |||
| 996 | Ga0070684_100758427 | |||
| 997 | Ga0070697_100069763 | |||
| 998 | Ga0070697_100235797 | |||
| 999 | Ga0070697_101173066 | |||
| 1000 | Ga0070686_100171734 | |||
| 1001 | Ga0070686_101384173 | |||
| 1002 | Ga0070695_100330904 | |||
| 1003 | Ga0070695_100483213 | |||
| 1004 | Ga0070696_100075073 | |||
| 1005 | Ga0070696_100534900 | |||
| 1006 | Ga0070693_100510772 | |||
| 1007 | Ga0070693_101312426 | |||
| 1008 | Ga0070665_100459721 | |||
| 1009 | Ga0070704_100082166 | |||
| 1010 | Ga0068855_100017076 | |||
| 1011 | Ga0068855_100077276 | |||
| 1012 | Ga0068855_100077741 | |||
| 1013 | Ga0068855_102062937 | |||
| 1014 | Ga0070664_100137055 | |||
| 1015 | Ga0070664_100223690 | |||
| 1016 | Ga0068857_100096601 | |||
| 1017 | Ga0068857_100130441 | |||
| 1018 | Ga0068856_100054954 | |||
| 1019 | Ga0068856_100688561 | |||
| 1020 | Ga0068856_100817094 | |||
| 1021 | Ga0070702_100028067 | |||
| 1022 | Ga0070702_100848141 | |||
| 1023 | Ga0068859_102150856 | |||
| 1024 | Ga0068861_100057930 | |||
| 1025 | Ga0068870_10114627 | |||
| 1026 | Ga0068870_10561980 | |||
| 1027 | Ga0068862_100743184 | |||
| 1028 | Ga0081455_10032931 | |||
| 1029 | Ga0081455_10112401 | |||
| 1030 | Ga0081455_10123075 | |||
| 1031 | Ga0081455_10148585 | |||
| 1032 | Ga0081455_10162975 | |||
| 1033 | Ga0081455_10376675 | |||
| 1034 | Ga0081455_10852386 | |||
| 1035 | Ga0081538_10022318 | |||
| 1036 | Ga0081539_10000041 | |||
| 1037 | Ga0081539_10042610 | |||
| 1038 | Ga0081539_10237100 | |||
| 1039 | Ga0081539_10284082 | |||
| 1040 | Ga0070717_10050974 | |||
| 1041 | Ga0070717_10588683 | |||
| 1042 | Ga0070717_12051928 | |||
| 1043 | Ga0075365_10003891 | |||
| 1044 | Ga0075365_10015202 | |||
| 1045 | Ga0075365_10153616 | |||
| 1046 | Ga0075365_10171956 | |||
| 1047 | Ga0075365_10415227 | |||
| 1048 | Ga0075363_100298189 | |||
| 1049 | Ga0075363_100839151 | |||
| 1050 | Ga0075364_10123730 | |||
| 1051 | Ga0075364_10125182 | |||
| 1052 | Ga0075364_10132352 | |||
| 1053 | Ga0075364_10455044 | |||
| 1054 | Ga0075364_10497899 | |||
| 1055 | Ga0075432_10020848 | |||
| 1056 | Ga0070716_100111073 | |||
| 1057 | Ga0070716_100169461 | |||
| 1058 | Ga0070716_100971576 | |||
| 1059 | Ga0070712_100015956 | |||
| 1060 | Ga0070712_100062040 | |||
| 1061 | Ga0070712_100593532 | |||
| 1062 | Ga0070712_100615216 | |||
| 1063 | Ga0070712_100952525 | |||
| 1064 | Ga0070712_100978973 | |||
| 1065 | Ga0075367_10133745 | |||
| 1066 | Ga0075367_10216978 | |||
| 1067 | Ga0075367_10999641 | |||
| 1068 | Ga0097621_100213116 | |||
| 1069 | Ga0097621_100363984 | |||
| 1070 | Ga0068871_101061968 | |||
| 1071 | Ga0068871_101750675 | |||
| 1072 | Ga0075428_100007984 | |||
| 1073 | Ga0075428_100036324 | |||
| 1074 | Ga0075428_100309683 | |||
| 1075 | Ga0075428_100580490 | |||
| 1076 | Ga0075428_100583764 | |||
| 1077 | Ga0075428_102132311 | |||
| 1078 | Ga0075431_100038295 | |||
| 1079 | Ga0075431_100235771 | |||
| 1080 | Ga0075433_10468092 | |||
| 1081 | Ga0075433_10756443 | |||
| 1082 | Ga0075433_10987625 | |||
| 1083 | Ga0075434_100028518 | |||
| 1084 | Ga0075434_100047775 | |||
| 1085 | Ga0075434_100049169 | |||
| 1086 | Ga0075429_100314316 | |||
| 1087 | Ga0075429_100437594 | |||
| 1088 | Ga0068865_101109617 | |||
| 1089 | Ga0075436_100002183 | |||
| 1090 | Ga0075436_100029390 | |||
| 1091 | Ga0075436_100369654 | |||
| 1092 | Ga0097620_102150825 | |||
| 1093 | Ga0075435_100012599 | |||
| 1094 | Ga0075435_100055348 | |||
| 1095 | Ga0075435_100083256 | |||
| 1096 | Ga0075435_100087463 | |||
| 1097 | Ga0075435_100379651 | |||
| 1098 | Ga0105240_10027311 | |||
| 1099 | Ga0105240_10492909 | |||
| 1100 | Ga0111539_10011337 | |||
| 1101 | Ga0111539_10040887 | |||
| 1102 | Ga0111539_10966657 | |||
| 1103 | Ga0111539_11978653 | |||
| 1104 | Ga0105245_10122828 | |||
| 1105 | Ga0105245_10137493 | |||
| 1106 | Ga0105245_10211852 | |||
| 1107 | Ga0105245_10251480 | |||
| 1108 | Ga0105245_10259335 | |||
| 1109 | Ga0105245_10348748 | |||
| 1110 | Ga0105245_11862597 | |||
| 1111 | Ga0114129_10000727 | |||
| 1112 | Ga0114129_10012477 | |||
| 1113 | Ga0114129_10024257 | |||
| 1114 | Ga0114129_10170675 | |||
| 1115 | Ga0114129_10327639 | |||
| 1116 | Ga0114129_10919239 | |||
| 1117 | Ga0114129_11431861 | |||
| 1118 | Ga0114129_13133112 | |||
| 1119 | Ga0105243_10054496 | |||
| 1120 | Ga0105243_10109909 | |||
| 1121 | Ga0105243_10374651 | |||
| 1122 | Ga0105243_12750862 | |||
| 1123 | Ga0105241_10829209 | |||
| 1124 | Ga0105242_10083979 | |||
| 1125 | Ga0105242_10134171 | |||
| 1126 | Ga0105242_10329695 | |||
| 1127 | Ga0105242_10934870 | |||
| 1128 | Ga0105242_11306124 | |||
| 1129 | Ga0105242_11383508 | |||
| 1130 | Ga0105248_10160218 | |||
| 1131 | Ga0105248_11006895 | |||
| 1132 | Ga0105237_10974551 | |||
| 1133 | Ga0105238_10996094 | |||
| 1134 | Ga0105249_10624440 | |||
| 1135 | Ga0105239_10221657 | |||
| 1136 | Ga0105239_10362957 | |||
| 1137 | Ga0105239_13244118 | |||
| 1138 | Ga0105246_10969760 | |||
| 1139 | Ga0157370_10093330 | |||
| 1140 | Ga0157370_10372328 | |||
| 1141 | Ga0157370_10611214 | |||
| 1142 | Ga0157370_11539966 | |||
| 1143 | Ga0157369_10006794 | |||
| 1144 | Ga0157369_10732870 | |||
| 1145 | Ga0157369_11690269 | |||
| 1146 | Ga0157374_10128262 | |||
| 1147 | Ga0157374_11043122 | |||
| 1148 | Ga0157374_11300703 | |||
| 1149 | Ga0157378_10101928 | |||
| 1150 | Ga0157378_10275550 | |||
| 1151 | Ga0157378_12248028 | |||
| 1152 | Ga0163162_10093384 | |||
| 1153 | Ga0157372_10287435 | |||
| 1154 | Ga0157372_10830094 | |||
| 1155 | Ga0157372_11319231 | |||
| 1156 | Ga0157372_12120176 | |||
| 1157 | Ga0157372_13018400 | |||
| 1158 | Ga0157375_10297023 | |||
| 1159 | Ga0157375_10790965 | |||
| 1160 | Ga0157375_11036210 | |||
| 1161 | Ga0157375_11204406 | |||
| 1162 | Ga0163163_10164086 | |||
| 1163 | Ga0163163_12034623 | |||
| 1164 | Ga0182008_10250564 | |||
| 1165 | Ga0182008_10845273 | |||
| 1166 | Ga0157377_10030329 | |||
| 1167 | Ga0157377_10313810 | |||
| 1168 | Ga0157379_10256715 | |||
| 1169 | Ga0157376_10094137 | |||
| 1170 | Ga0157376_10254312 | |||
| 1171 | Ga0157376_10464925 | |||
| 1172 | Ga0157376_10704573 | |||
| 1173 | Ga0157376_11751010 | |||
| 1174 | Ga0182007_10280670 | |||
| 1175 | Ga0163161_10342206 | |||
| 1176 | Ga0197907_10799915 | |||
| 1177 | Ga0206353_10259235 | |||
| 1178 | Ga0206353_11073166 | |||
| 1179 | Ga0224712_10422282 | |||
| 1180 | Ga0207692_10063853 | |||
| 1181 | Ga0207692_10125979 | |||
| 1182 | Ga0207642_10329929 | |||
| 1183 | Ga0207688_10091228 | |||
| 1184 | Ga0207688_10490131 | |||
| 1185 | Ga0207647_10234741 | |||
| 1186 | Ga0207685_10451309 | |||
| 1187 | Ga0207705_10019314 | |||
| 1188 | Ga0207705_10045782 | |||
| 1189 | Ga0207684_10441074 | |||
| 1190 | Ga0207654_10455777 | |||
| 1191 | Ga0207707_10030088 | |||
| 1192 | Ga0207707_10031620 | |||
| 1193 | Ga0207695_10138907 | |||
| 1194 | Ga0207695_10365656 | |||
| 1195 | Ga0207693_10006225 | |||
| 1196 | Ga0207693_10023433 | |||
| 1197 | Ga0207693_10252700 | |||
| 1198 | Ga0207663_10059220 | |||
| 1199 | Ga0207663_10285045 | |||
| 1200 | Ga0207663_10689903 | |||
| 1201 | Ga0207660_10140212 | |||
| 1202 | Ga0207660_11160961 | |||
| 1203 | Ga0207662_10352534 | |||
| 1204 | Ga0207657_10002271 | |||
| 1205 | Ga0207657_10342322 | |||
| 1206 | Ga0207657_10731425 | |||
| 1207 | Ga0207649_11234295 | |||
| 1208 | Ga0207652_10006892 | |||
| 1209 | Ga0207652_10020012 | |||
| 1210 | Ga0207646_10489785 | |||
| 1211 | Ga0207646_10718454 | |||
| 1212 | Ga0207681_10001013 | |||
| 1213 | Ga0207681_11778714 | |||
| 1214 | Ga0207650_11333318 | |||
| 1215 | Ga0207659_10359004 | |||
| 1216 | Ga0207687_10049998 | |||
| 1217 | Ga0207687_10100296 | |||
| 1218 | Ga0207687_10681934 | |||
| 1219 | Ga0207687_10682290 | |||
| 1220 | Ga0207687_10864587 | |||
| 1221 | Ga0207687_11003703 | |||
| 1222 | Ga0207687_11205023 | |||
| 1223 | Ga0207700_10296300 | |||
| 1224 | Ga0207700_10608149 | |||
| 1225 | Ga0207700_10666842 | |||
| 1226 | Ga0207700_10781608 | |||
| 1227 | Ga0207700_11069270 | |||
| 1228 | Ga0207664_10339744 | |||
| 1229 | Ga0207664_10565140 | |||
| 1230 | Ga0207644_10199581 | |||
| 1231 | Ga0207644_10326211 | |||
| 1232 | Ga0207644_10860961 | |||
| 1233 | Ga0207690_10653091 | |||
| 1234 | Ga0207690_11077391 | |||
| 1235 | Ga0207706_10219535 | |||
| 1236 | Ga0207686_10312281 | |||
| 1237 | Ga0207686_10364590 | |||
| 1238 | Ga0207686_10504363 | |||
| 1239 | Ga0207686_10588042 | |||
| 1240 | Ga0207709_10091967 | |||
| 1241 | Ga0207709_10110243 | |||
| 1242 | Ga0207709_10958849 | |||
| 1243 | Ga0207709_11631939 | |||
| 1244 | Ga0207669_11933980 | |||
| 1245 | Ga0207704_10440476 | |||
| 1246 | Ga0207665_10007335 | |||
| 1247 | Ga0207665_10154222 | |||
| 1248 | Ga0207711_10753361 | |||
| 1249 | Ga0207689_11041366 | |||
| 1250 | Ga0207661_10003778 | |||
| 1251 | Ga0207661_10019199 | |||
| 1252 | Ga0207661_10094389 | |||
| 1253 | Ga0207661_10229811 | |||
| 1254 | Ga0207661_10632168 | |||
| 1255 | Ga0207679_10042141 | |||
| 1256 | Ga0207679_10130440 | |||
| 1257 | Ga0207667_10062476 | |||
| 1258 | Ga0207667_10151667 | |||
| 1259 | Ga0207667_10438227 | |||
| 1260 | Ga0207712_10129121 | |||
| 1261 | Ga0207668_10061896 | |||
| 1262 | Ga0207668_10106338 | |||
| 1263 | Ga0207668_10152887 | |||
| 1264 | Ga0207668_11239844 | |||
| 1265 | Ga0207677_10627762 | |||
| 1266 | Ga0207678_10342509 | |||
| 1267 | Ga0207678_10826813 | |||
| 1268 | Ga0207708_11121002 | |||
| 1269 | Ga0207702_10026096 | |||
| 1270 | Ga0207702_10055906 | |||
| 1271 | Ga0207702_11244373 | |||
| 1272 | Ga0207648_10039412 | |||
| 1273 | Ga0207676_10838310 | |||
| 1274 | Ga0207674_10103020 | |||
| 1275 | Ga0207674_10108055 | |||
| 1276 | Ga0207675_100088997 | |||
| 1277 | Ga0207675_101388605 | |||
| 1278 | Ga0207683_11329260 | |||
| 1279 | Ga0207683_11684754 | |||
| 1280 | Ga0268266_10252098 | |||
| 1281 | Ga0268265_10998321 | |||
| 1282 | Ga0268264_10596134 | |||
| 1283 | Ga0265319_1025488 | |||
| 1284 | Ga0265318_10052499 | |||
| 1285 | Ga0265318_10078356 | |||
| 1286 | Ga0265318_10087716 | |||
| 1287 | Ga0265322_10054404 | |||
| 1288 | Ga0265338_10007064 | |||
| 1289 | Ga0265338_10382411 | |||
| 1290 | Ga0265338_10506487 | |||
| 1291 | Ga0265320_10070894 | |||
| 1292 | Ga0265327_10017969 | |||
| 1293 | Ga0265327_10088501 | |||
| 1294 | Ga0307405_10128514 | |||
| 1295 | Ga0307413_10453533 | |||
| 1296 | Ga0307410_10346642 | |||
| 1297 | Ga0307410_11576523 | |||
| 1298 | Ga0307406_10218345 | |||
| 1299 | Ga0307407_11274296 | |||
| 1300 | Ga0307412_10295070 | |||
| 1301 | Ga0307409_100413067 | |||
| 1302 | Ga0307409_101331804 | |||
| 1303 | Ga0307416_100051442 | |||
| 1304 | Ga0307416_100260956 | |||
| 1305 | Ga0307416_101081339 | |||
| 1306 | Ga0307416_101655456 | |||
| 1307 | Ga0307414_10493413 | |||
| 1308 | Ga0307415_100038491 | |||
| 1309 | Ga0307415_100305203 | |||
| 1310 | Ga0307415_100650673 | |||
| 1311 | Ga0307415_101497355 | |||
| 1312 | Ga0373926_0059401 | |||
| 1313 | Ga0373944_0010616 | |||
| 1314 | Ga0373941_0417103 | |||
| 1315 | Ga0373945_0012208 | |||
| 1316 | Ga0373956_0159685 | |||
| 1317 | Ga0373943_0000112 | |||
| 1318 | Ga0373943_0069862 | |||
| 1319 | Ga0373943_0409292 | |||
| 1320 | Ga0373946_0008171 | |||
| 1321 | Ga0373955_0134969 | |||
| 1322 | Ga0373931_0512209 | |||
| 1323 | Ga0373935_0091508 | |||
| 1324 | Ga0373927_0021849 | |||
| 1325 | Ga0373933_0413786 | |||
| 1326 | Ga0373947_0000600 | |||
| 1327 | Ga0373947_0205433 | |||
| 1328 | Ga0373937_0709846 | |||
| 1329 | Ga0373937_0940959 | |||
| 1330 | Ga0316584_0500003 | |||
| 1331 | Ga0373925_0009167 | |||
| 1332 | Ga0395899_0001446 | |||
| 1333 | Ga0395899_0013404 | |||
| 1334 | Ga0395899_0019546 | |||
| 1335 | Ga0395899_0020632 | |||
| 1336 | Ga0395899_0029130 | |||
| 1337 | Ga0395899_0062762 | |||
| 1338 | Ga0395899_0084198 | |||
| 1339 | Ga0395899_0156099 | |||
| 1340 | Ga0395899_0246384 | |||
| 1341 | Ga0395899_0272482 | |||
| 1342 | Ga0395900_0000871 | |||
| 1343 | Ga0395900_0001970 | |||
| 1344 | Ga0395900_0008763 | |||
| 1345 | Ga0395900_0013678 | |||
| 1346 | Ga0395900_0024341 | |||
| 1347 | Ga0395900_0041807 | |||
| 1348 | Ga0395900_0043734 | |||
| 1349 | Ga0395900_0188662 | |||
| 1350 | Ga0395900_0203195 | |||
| 1351 | Ga0395900_0227314 | |||
| 1352 | Ga0395900_0324415 | |||
| 1353 | Ga0395900_0364281 | |||
| 1354 | Ga0395900_0391491 | |||
| 1355 | Ga0395900_0633137 | |||
| 1356 | Ga0395898_0003281 | |||
| 1357 | Ga0395898_0003578 | |||
| 1358 | Ga0395898_0011698 | |||
| 1359 | Ga0395898_0017911 | |||
| 1360 | Ga0395898_0039798 | |||
| 1361 | Ga0395898_0058640 | |||
| 1362 | Ga0395898_0069093 | |||
| 1363 | Ga0395898_0069994 | |||
| 1364 | Ga0395898_0077875 | |||
| 1365 | Ga0395898_0102181 | |||
| 1366 | Ga0395898_0163183 | |||
| 1367 | Ga0395898_0196377 | |||
| 1368 | Ga0395898_0482248 | |||
| 1369 | Ga0395898_0499507 | |||
| 1370 | Ga0395898_0603532 | |||
| 1371 | Ga0395898_0634691 | |||
| 1372 | Ga0395898_0774995 | |||
| 1373 | Ga0395905_0001130 | |||
| 1374 | Ga0395905_0002425 | |||
| 1375 | Ga0395905_0006790 | |||
| 1376 | Ga0395905_0034713 | |||
| 1377 | Ga0395905_0085832 | |||
| 1378 | Ga0395905_0178137 | |||
| 1379 | Ga0395905_0345195 | |||
| 1380 | Ga0395905_0612284 | |||
| 1381 | Ga0395905_1288090 | |||
| 1382 | Ga0395905_1795841 | |||
| 1383 | Ga0395901_0004009 | |||
| 1384 | Ga0395901_0005447 | |||
| 1385 | Ga0395901_0006956 | |||
| 1386 | Ga0395901_0007511 | |||
| 1387 | Ga0395901_0016021 | |||
| 1388 | Ga0395901_0038828 | |||
| 1389 | Ga0395901_0061730 | |||
| 1390 | Ga0395901_0062370 | |||
| 1391 | Ga0395901_0093813 | |||
| 1392 | Ga0395901_0118265 | |||
| 1393 | Ga0395901_0127957 | |||
| 1394 | Ga0395901_0144701 | |||
| 1395 | Ga0395901_0239619 | |||
| 1396 | Ga0395901_0267913 | |||
| 1397 | Ga0395901_0383850 | |||
| 1398 | Ga0395901_0434513 | |||
| 1399 | Ga0395901_0516672 | |||
| 1400 | Ga0395901_0706815 | |||
| 1401 | Ga0395901_1356169 | |||
| 1402 | Ga0395901_1934535 | |||
| 1403 | Ga0242419_009978 | |||
| 1404 | Ga0242422_03412 | |||
| 1405 | Ga0436363_0452021 | |||
| 1406 | Ga0451835_0186085 | |||
| 1407 | Ga0451839_1214626 | |||
| 1408 | Ga0451853_2305819 | |||
| 1409 | Ga0466969_0337257 | |||
| 1410 | Ga0453683_0557697 | |||
| 1411 | Ga0466965_0428286 | |||
| 1412 | Ga0466966_0131090 | |||
| 1413 | Ga0466966_0723016 | |||
| 1414 | Ga0466961_0330984 | |||
| 1415 | Ga0466963_0006377 | |||
| 1416 | Ga0466963_0009698 | |||
| 1417 | Ga0466963_0288214 | |||
| 1418 | Ga0466963_0331079 | |||
| 1419 | Ga0466968_0600552 | |||
| 1420 | Ga0466959_0640218 | |||
| 1421 | Ga0466967_0035947 | |||
| 1422 | Ga0466967_0046714 | |||
| 1423 | Ga0466967_0046844 | |||
| 1424 | Ga0466967_0062330 | |||
| 1425 | Ga0466967_0249412 | |||
| 1426 | Ga0466967_0409917 | |||
| 1427 | Ga0466967_1112655 | |||
| 1428 | Ga0466967_2277628 | |||
| 1429 | Ga0495592_0165482 | |||
| 1430 | Ga0495592_0291818 | |||
| 1431 | Ga0495603_0254211 | |||
| 1432 | Ga0495603_0768697 | |||
| 1433 | Ga0495629_0000593 | |||
| 1434 | Ga0495629_0011270 | |||
| 1435 | Ga0495629_0222495 | |||
| 1436 | Ga0495641_0000529 | |||
| 1437 | Ga0495641_0019594 | |||
| 1438 | Ga0495641_0063366 | |||
| 1439 | Ga0495641_0120231 | |||
| 1440 | Ga0495641_0320446 | |||
| 1441 | Ga0495651_0082191 | |||
| 1442 | Ga0495651_0170718 | |||
| 1443 | Ga0495653_0006289 | |||
| 1444 | Ga0495653_0115903 | |||
| 1445 | Ga0495653_0178742 | |||
| 1446 | Ga0495653_0181433 | |||
| 1447 | Ga0495582_0000056 | |||
| 1448 | Ga0495582_0106181 | |||
| 1449 | Ga0495582_0151341 | |||
| 1450 | Ga0495605_0068460 | |||
| 1451 | Ga0495639_0003603 | |||
| 1452 | Ga0495662_0015110 | |||
| 1453 | Ga0495662_0058719 | |||
| 1454 | Ga0495662_0572808 | |||
| 1455 | Ga0495664_0111202 | |||
| 1456 | Ga0495584_0123605 | |||
| 1457 | Ga0495584_0303429 | |||
| 1458 | Ga0495608_0012356 | |||
| 1459 | Ga0495608_0263552 | |||
| 1460 | Ga0495618_0218025 | |||
| 1461 | Ga0495628_0580398 | |||
| 1462 | Ga0495630_0005694 | |||
| 1463 | Ga0495630_0297650 | |||
| 1464 | Ga0495663_0100296 | |||
| 1465 | Ga0495666_0041659 | |||
| 1466 | Ga0495666_0223944 | |||
| 1467 | Ga0495652_0215186 | |||
| 1468 | Ga0495665_0000910 | |||
| 1469 | Ga0495665_0360023 | |||
| 1470 | Ga0495665_0395869 | |||
| 1471 | Ga0495640_0017849 | |||
| 1472 | Ga0495640_0074570 | |||
| 1473 | Ga0495587_0115628 | |||
| 1474 | Ga0495609_0215392 | |||
| 1475 | Ga0495645_0390316 | |||
| 1476 | Ga0495645_0489058 | |||
| 1477 | Ga0495667_0047005 | |||
| 1478 | Ga0495667_0228023 | |||
| 1479 | Ga0495656_0020716 | |||
| 1480 | Ga0495656_0069782 | |||
| 1481 | Ga0495668_0843772 | |||
| 1482 | Ga0495634_0026999 | |||
| 1483 | Ga0495634_0059917 | |||
| 1484 | Ga0495634_0129034 | |||
| 1485 | Ga0495634_0293268 | |||
| 1486 | Ga0495635_0062901 | |||
| 1487 | Ga0495635_0068001 | |||
| 1488 | Ga0495661_0506470 | |||
| 1489 | Ga0495657_0141611 | |||
| 1490 | Ga0495657_0419244 | |||
| 1491 | Ga0495599_0472628 | |||
| 1492 | Ga0495646_0176412 | |||
| 1493 | Ga0495647_0036946 | |||
| 1494 | Ga0495647_0039362 | |||
| 1495 | Ga0495658_0000204 | |||
| 1496 | Ga0495658_0023753 | |||
| 1497 | Ga0495658_0656960 | |||
| 1498 | Ga0495613_0000401 | |||
| 1499 | Ga0495613_0028490 | |||
| 1500 | Ga0495613_0142879 | |||
| 1501 | Ga0495624_0006658 | |||
| 1502 | Ga0495624_0596970 | |||
| 1503 | Ga0495589_0297348 | |||
| 1504 | Ga0495600_0030104 | |||
| 1505 | Ga0495600_0344849 | |||
| 1506 | Ga0495600_0957011 | |||
| 1507 | Ga0495581_0000517 | |||
| 1508 | Ga0495581_0009359 | |||
| 1509 | Ga0495581_0213008 | |||
| 1510 | Ga0495604_0074351 | |||
| 1511 | Ga0495604_0148497 | |||
| 1512 | Ga0495674_0029603 | |||
| 1513 | Ga0495674_1054872 | |||
| 1514 | Ga0495676_0010912 | |||
| 1515 | Ga0495676_0026584 | |||
| 1516 | Ga0495676_0027069 | |||
| 1517 | Ga0495680_0004651 | |||
| 1518 | Ga0495680_0008870 | |||
| 1519 | Ga0495680_0019712 | |||
| 1520 | Ga0495680_0317005 | |||
| 1521 | Ga0495675_0260164 | |||
| 1522 | Ga0495684_0020222 | |||
| 1523 | Ga0495684_0233497 | |||
| 1524 | Ga0495684_0834263 | |||
| 1525 | Ga0495593_0001987 | |||
| 1526 | Ga0495593_0099580 | |||
| 1527 | Ga0495614_0026119 | |||
| 1528 | Ga0496100_0002141 | |||
| 1529 | Ga0496100_0044261 | |||
| 1530 | Ga0496100_0048104 | |||
| 1531 | Ga0496100_0068131 | |||
| 1532 | Ga0496100_0081240 | |||
| 1533 | Ga0496100_0791936 | |||
| 1534 | Ga0496101_0018182 | |||
| 1535 | Ga0496101_0029430 | |||
| 1536 | Ga0496101_0074736 | |||
| 1537 | Ga0496101_0121800 | |||
| 1538 | Ga0496101_0133624 | |||
| 1539 | Ga0496101_0154321 | |||
| 1540 | Ga0496101_0158421 | |||
| 1541 | Ga0496101_0178505 | |||
| 1542 | Ga0496101_0326361 | |||
| 1543 | Ga0496101_0764501 | |||
| 1544 | Ga0496102_0015240 | |||
| 1545 | Ga0496102_0023826 | |||
| 1546 | Ga0496102_0081453 | |||
| 1547 | Ga0496102_0172819 | |||
| 1548 | Ga0496102_0225713 | |||
| 1549 | Ga0496102_0337572 | |||
| 1550 | Ga0496102_0610899 | |||
| 1551 | Ga0496102_0646653 | |||
| 1552 | Ga0496102_1549033 | |||
| 1553 | Ga0496103_0009328 | |||
| 1554 | Ga0496103_0081294 | |||
| 1555 | Ga0496103_0103250 | |||
| 1556 | Ga0496103_0143006 | |||
| 1557 | Ga0496103_0147150 | |||
| 1558 | Ga0496104_0000571 | |||
| 1559 | Ga0496104_0004078 | |||
| 1560 | Ga0496104_0013102 | |||
| 1561 | Ga0496104_0063550 | |||
| 1562 | Ga0496104_0477178 | |||
| 1563 | Ga0496105_0019907 | |||
| 1564 | Ga0496105_0021402 | |||
| 1565 | Ga0496105_0102434 | |||
| 1566 | Ga0496105_0240795 | |||
| 1567 | Ga0496105_0340463 | |||
| 1568 | Ga0496105_0582406 | |||
| 1569 | Ga0496105_0660240 | |||
| 1570 | Ga0496106_0001809 | |||
| 1571 | Ga0496106_0061267 | |||
| 1572 | Ga0496106_0212736 | |||
| 1573 | Ga0496106_0249434 | |||
| 1574 | Ga0496106_0268126 | |||
| 1575 | Ga0496107_0029831 | |||
| 1576 | Ga0496107_0053635 | |||
| 1577 | Ga0496107_0180795 | |||
| 1578 | Ga0496107_0198279 | |||
| 1579 | Ga0496107_0491331 | |||
| 1580 | Ga0496107_0570107 | |||
| 1581 | Ga0496108_0006700 | |||
| 1582 | Ga0496108_0015055 | |||
| 1583 | Ga0496108_0037194 | |||
| 1584 | Ga0496108_0098939 | |||
| 1585 | Ga0496108_0213516 | |||
| 1586 | Ga0496108_0286532 | |||
| 1587 | Ga0496108_0602890 | |||
| 1588 | Ga0496108_0913356 | |||
| 1589 | Ga0496109_0000638 | |||
| 1590 | Ga0496109_0000992 | |||
| 1591 | Ga0496109_0017313 | |||
| 1592 | Ga0496109_0236587 | |||
| 1593 | Ga0496109_0255488 | |||
| 1594 | Ga0496109_0292057 | |||
| 1595 | Ga0496109_0834842 | |||
| 1596 | Ga0496109_0882527 | |||
| 1597 | Ga0496109_1794561 | |||
| 1598 | Ga0496110_0001697 | |||
| 1599 | Ga0496110_0004437 | |||
| 1600 | Ga0496110_0030272 | |||
| 1601 | Ga0496110_0163250 | |||
| 1602 | Ga0496110_0280503 | |||
| 1603 | Ga0496110_0601741 | |||
| 1604 | Ga0496110_0635728 | |||
| 1605 | Ga0496110_0883451 | |||
| 1606 | Ga0496111_0000025 | |||
| 1607 | Ga0496111_0000598 | |||
| 1608 | Ga0496111_0019783 | |||
| 1609 | Ga0496111_0027978 | |||
| 1610 | Ga0496111_0058238 | |||
| 1611 | Ga0496111_0194638 | |||
| 1612 | Ga0496111_0265303 | |||
| 1613 | Ga0496111_0347061 | |||
| 1614 | Ga0496112_0001024 | |||
| 1615 | Ga0496112_0185421 | |||
| 1616 | Ga0496112_0253100 | |||
| 1617 | Ga0496112_0488967 | |||
| 1618 | Ga0496112_0530166 | |||
| 1619 | Ga0496112_0717772 | |||
| 1620 | Ga0496112_0818207 | |||
| 1621 | Ga0496113_0207636 | |||
| 1622 | Ga0496113_0418151 | |||
| 1623 | Ga0496114_0001903 | |||
| 1624 | Ga0496114_0019534 | |||
| 1625 | Ga0496114_0039807 | |||
| 1626 | Ga0496114_0045742 | |||
| 1627 | Ga0496114_0093503 | |||
| 1628 | Ga0496114_0094560 | |||
| 1629 | Ga0496114_0116801 | |||
| 1630 | Ga0496114_0147736 | |||
| 1631 | Ga0496114_0429351 | |||
| 1632 | Ga0496114_0555414 | |||
| 1633 | Ga0496115_0005415 | |||
| 1634 | Ga0496115_0035750 | |||
| 1635 | Ga0496115_0298254 | |||
| 1636 | Ga0496115_0546724 | |||
| 1637 | Ga0501031_0002836 | |||
| 1638 | Ga0501031_0215861 | |||
| 1639 | Ga0501032_0023044 | |||
| 1640 | Ga0501032_0590662 | |||
| 1641 | Ga0501034_0064118 | |||
| 1642 | Ga0501036_0006773 | |||
| 1643 | Ga0501036_0073602 | |||
| 1644 | Ga0501036_0301277 | |||
| 1645 | Ga0501036_0764951 | |||
| 1646 | Ga0501036_0992622 | |||
| 1647 | Ga0501036_1314319 | |||
| 1648 | Ga0501037_0103140 | |||
| 1649 | Ga0501037_0228977 | |||
| 1650 | Ga0501038_0024691 | |||
| 1651 | Ga0501038_0129474 | |||
| 1652 | Ga0501038_0401156 | |||
| 1653 | Ga0501039_0004746 | |||
| 1654 | Ga0501039_0181537 | |||
| 1655 | Ga0501039_0394550 | |||
| 1656 | Ga0501040_0004225 | |||
| 1657 | Ga0501040_0052394 | |||
| 1658 | Ga0501041_0004653 | |||
| 1659 | Ga0501041_0089853 | |||
| 1660 | Ga0501042_0008074 | |||
| 1661 | Ga0501042_0009416 | |||
| 1662 | Ga0501042_0090944 | |||
| 1663 | Ga0501042_0184233 | |||
| 1664 | Ga0501042_0573871 | |||
| 1665 | Ga0501043_0049092 | |||
| 1666 | Ga0501043_0784959 | |||
| 1667 | Ga0501046_0001448 | |||
| 1668 | Ga0501046_0132061 | |||
| 1669 | Ga0501046_0328974 | |||
| 1670 | Ga0501046_0708062 | |||
| 1671 | Ga0501047_0230687 | |||
| 1672 | Ga0501047_0502347 | |||
| 1673 | Ga0501047_0646821 | |||
| 1674 | Ga0501047_0742354 | |||
| 1675 | Ga0501048_0003992 | |||
| 1676 | Ga0501048_0119455 | |||
| 1677 | Ga0501048_0236980 | |||
| 1678 | Ga0501067_0086276 | |||
| 1679 | Ga0501067_0223945 | |||
| 1680 | Ga0501067_0224914 | |||
| 1681 | Ga0501067_0231389 | |||
| 1682 | Ga0501068_0377105 | |||
| 1683 | Ga0501068_0600260 | |||
| 1684 | Ga0501069_0059219 | |||
| 1685 | Ga0501069_0075565 | |||
| 1686 | Ga0501069_0128744 | |||
| 1687 | Ga0501069_0149679 | |||
| 1688 | Ga0501069_0257508 | |||
| 1689 | Ga0501069_0638757 | |||
| 1690 | Ga0501070_0003866 | |||
| 1691 | Ga0501070_0128150 | |||
| 1692 | Ga0501070_0273348 | |||
| 1693 | Ga0501070_0315070 | |||
| 1694 | Ga0501070_0517461 | |||
| 1695 | Ga0501070_0697168 | |||
| 1696 | Ga0501071_0026636 | |||
| 1697 | Ga0501071_1021160 | |||
| 1698 | Ga0501071_1115318 | |||
| 1699 | Ga0501072_0011874 | |||
| 1700 | Ga0501072_0026024 | |||
| 1701 | Ga0501072_0034638 | |||
| 1702 | Ga0501073_0006969 | |||
| 1703 | Ga0501073_0020460 | |||
| 1704 | Ga0501074_0018234 | |||
| 1705 | Ga0501074_0035342 | |||
| 1706 | Ga0501074_0063116 | |||
| 1707 | Ga0501075_0006432 | |||
| 1708 | Ga0501075_0027647 | |||
| 1709 | Ga0501075_0260221 | |||
| 1710 | Ga0501075_0787888 | |||
| 1711 | Ga0501076_0008714 | |||
| 1712 | Ga0501076_0124959 | |||
| 1713 | Ga0501076_0674294 | |||
| 1714 | Ga0501077_0010250 | |||
| 1715 | Ga0501077_0989404 | |||
| 1716 | Ga0501242_029051 | |||
| 1717 | Ga0501243_066454 | |||
| 1718 | Ga0501079_0010771 | |||
| 1719 | Ga0501079_0109663 | |||
| 1720 | Ga0501079_0145539 | |||
| 1721 | Ga0501079_1569962 | |||
| 1722 | Ga0501080_0007957 | |||
| 1723 | Ga0501080_0070880 | |||
| 1724 | Ga0501080_0209697 | |||
| 1725 | Ga0501081_0011195 | |||
| 1726 | Ga0501081_0035504 | |||
| 1727 | Ga0501081_0036002 | |||
| 1728 | Ga0501081_0047344 | |||
| 1729 | Ga0501083_0033307 | |||
| 1730 | Ga0501283_098101 | |||
| 1731 | Ga0501035_0008623 | |||
| 1732 | Ga0501035_0014191 | |||
| 1733 | Ga0501035_0458567 | |||
| 1734 | Ga0501035_0734223 | |||
| 1735 | Ga0501044_0078509 | |||
| 1736 | Ga0501044_0162808 | |||
| 1737 | Ga0501044_0808063 | |||
| 1738 | Ga0501045_0005742 | |||
| 1739 | Ga0501045_0033361 | |||
| 1740 | Ga0501045_0047826 | |||
| 1741 | nmdc:mga03n38_844024_c1 | |||
| 1742 | nmdc:mga00v17_127916_c1 | |||
| 1743 | nmdc:mga00v17_144754_c1 | |||
| 1744 | nmdc:mga00v17_259255_c1 | |||
| 1745 | nmdc:mga00v17_632437_c1 | |||
| 1746 | nmdc:mga0yw44_273301_c1 | |||
| 1747 | nmdc:mga0yw44_328455_c1 | |||
| 1748 | nmdc:mga0yw44_47913_c1 | |||
| 1749 | nmdc:mga0yw44_946406_c1 | |||
| 1750 | nmdc:mga0yw44_996418_c1 | |||
| 1751 | nmdc:mga06z11_156255_c1 | |||
| 1752 | nmdc:mga06z11_187276_c1 | |||
| 1753 | nmdc:mga06z11_200348_c1 | |||
| 1754 | nmdc:mga05p37_205574_c1 | |||
| 1755 | nmdc:mga05p37_206353_c1 | |||
| 1756 | nmdc:mga05p37_59740_c1 | |||
| 1757 | nmdc:mga05p37_718187_c1 | |||
| 1758 | nmdc:mga06r32_125637_c1 | |||
| 1759 | nmdc:mga06r32_289020_c1 | |||
| 1760 | nmdc:mga08y16_77841_c1 | |||
| 1761 | nmdc:mga0n895_11302_c1 | |||
| 1762 | nmdc:mga0n895_1512414_c1 | |||
| 1763 | nmdc:mga0n895_418012_c1 | |||
| 1764 | nmdc:mga0n895_77600_c1 | |||
| 1765 | nmdc:mga0n895_91185_c1 | |||
| 1766 | nmdc:mga0n895_99622_c1 | |||
| 1767 | nmdc:mga0rr50_101254_c1 | |||
| 1768 | nmdc:mga0rr50_328964_c1 | |||
| 1769 | nmdc:mga0rr50_4672_c1 | |||
| 1770 | nmdc:mga0rr50_468178_c1 | |||
| 1771 | nmdc:mga0rr50_702115_c1 | |||
| 1772 | nmdc:mga08x19_59131_c1 | |||
| 1773 | nmdc:mga0a205_22729_c1 | |||
| 1774 | nmdc:mga0a205_39954_c1 | |||
| 1775 | nmdc:mga0a205_50115_c1 | |||
| 1776 | nmdc:mga0a205_758204_c1 | |||
| 1777 | Ga0495601_0101811 | |||
| 1778 | Ga0495601_0151594 | |||
| 1779 | Ga0495601_0175373 | |||
| 1780 | Ga0495601_0459364 | |||
| 1781 | Ga0495601_0991394 | |||
| 1782 | Ga0495612_0055292 | |||
| 1783 | Ga0495595_0009175 | |||
| 1784 | Ga0495595_0023650 | |||
| 1785 | Ga0495619_0001914 | |||
| 1786 | Ga0495619_0008233 | |||
| 1787 | Ga0495619_0019321 | |||
| 1788 | Ga0495619_0063338 | |||
| 1789 | Ga0495619_0075685 | |||
| 1790 | Ga0501084_0013416 | |||
| 1791 | Ga0501084_0072442 | |||
| 1792 | Ga0501084_0219343 | |||
| 1793 | Ga0501084_0776493 | |||
| 1794 | Ga0501084_0892034 | |||
| 1795 | Ga0587070_135859 | |||
| 1796 | Ga0587073_0218009 | |||
| 1797 | Ga0587077_196937 | |||
| 1798 | Ga0587067_179603 | |||
| 1799 | Ga0501082_0037616 | |||
| 1800 | Ga0466962_0367385 | |||
| 1801 | Ga0530510_0018249 | |||
| 1802 | Ga0530510_0171003 | |||
| 1803 | Ga0530510_0519490 | |||
| 1804 | Ga0530510_0605013 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9913 | 6 | 130 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.98 | 11 | 130 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9712 | 6 | 130 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9681 | 6 | 131 |
| 3a7a-assembly2.cif.gz_D | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9621 | 6 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9851 | 10 | 127 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9791 | 11 | 130 | 2.40.50.100 |
| af_K7TZ76_31_128_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9654 | 41 | 131 | 2.40.50.100 |
| af_A4IC11_1_107_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9599 | 25 | 128 | 2.40.50.100 |
| 3a8jE00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9512 | 8 | 129 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A534S1C2-F1-model_v4 | Glycine cleavage system H protein | 0.9998 | 12 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A538FZ14-F1-model_v4 | Glycine cleavage system H protein | 0.9967 | 1 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A7W0RC94-F1-model_v4 | Glycine cleavage system H protein | 0.9964 | 3 | 128 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A532DA06-F1-model_v4 | Glycine cleavage system H protein | 0.9955 | 6 | 131 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A2K3NJQ1-F1-model_v4 | Glycine cleavage system H protein | 0.9952 | 9 | 130 |
GO:0005739
GO:0005960 GO:0019464 |