F485182

General Info

Members Datasets Scaffolds Average Seq Length
901 653 612 331

Family's Representative Sequence

Representative Sequence 3300041413|Ga0439465_0034236|Ga0439465_0034236_457_1446
Length 329
Sequence MNTAVLFDNVSRHFGAVRAVDRVTLQVAEGEFFAMLGPSGSGKTTCLRLMAGFEQPTTGHIEIFGETAEGVPPYRRSVFQDYALFPHLSILDNVAYGLMVKGIGREERRKAAEDALAMVKLPGYGARRPGQLSGGQRQRVALARALVNKPKVLLLDEPLGALDLKLREQMQEELKSLQKSLGITFVFVTHDQGEALSMADRIAVFNEGRIQQLGRPEDVYNQPKTRFVADFVGSSNVLSAKLCQSLGLNASFASLRPEAVAIAPAANGALSLSGTVAGRSFLGATNRIVVDVDGNRIAVASPAAQAVPAVGSPVTLSFAARDLHPMEDA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
9 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
10 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
11 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
12 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
13 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
14 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
23 2516143018 Ensifer sp. BR816 Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
29 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
30 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
31 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
32 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
33 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
34 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
35 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
36 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
37 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
38 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
39 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
40 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
41 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
42 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
43 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
44 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
45 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
46 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
47 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
48 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
49 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
50 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
51 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
52 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
53 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
54 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
55 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
56 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
57 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
58 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
59 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
60 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
61 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
62 2643221599 Rhizobium sp. Root708 Isolate Unclassified
63 2643221607 Rhizobium sp. Root73 Isolate Unclassified
64 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
65 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
66 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
67 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
68 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
69 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
70 2643221688 Rhizobium sp. Root482 Isolate Unclassified
71 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
72 2643221718 Rhizobium sp. Root268 Isolate Unclassified
73 2643221719 Rhizobium sp. Root274 Isolate Unclassified
74 2643221723 Ensifer sp. Root278 Isolate Unclassified
75 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
76 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
77 2718217882 Rhizobium sp. N741 Isolate Nodule
78 2718217927 Rhizobium sp. N324 Isolate Nodule
79 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
80 2718218009 Rhizobium sp. N561 Isolate Nodule
81 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
82 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
83 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
84 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
85 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
86 2718218363 Rhizobium sp. N113 Isolate Nodule
87 2718218365 Rhizobium sp. N731 Isolate Nodule
88 2718218366 Rhizobium sp. N621 Isolate Nodule
89 2718218423 Rhizobium sp. N941 Isolate Nodule
90 2721755514 Rhizobium sp. N6212 Isolate Nodule
91 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
92 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
93 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
94 2721755809 Rhizobium sp. N541 Isolate Nodule
95 2721755810 Rhizobium sp. N871 Isolate Nodule
96 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
97 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
98 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
99 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
100 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
101 2728369365 Rhizobium sp. N1341 Isolate Nodule
102 2728369397 Rhizobium sp. N1314 Isolate Nodule
103 2738541293 Rhizobium sp. GV031 Isolate Unclassified
104 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
105 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
106 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
107 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
108 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
109 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
110 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
111 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
112 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
113 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
114 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
115 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
116 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
117 2791355256 Rhizobium sp. M10 Isolate Nodule
118 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
119 2791355260 Rhizobium sp. L9 Isolate Nodule
120 2791355261 Rhizobium sp. J15 Isolate Nodule
121 2791355262 Rhizobium sp. M1 Isolate Nodule
122 2791355263 Rhizobium chutanense C5 Isolate Nodule
123 2791355264 Rhizobium sp. S9 Isolate Nodule
124 2791355265 Rhizobium sp. H4 Isolate Nodule
125 2791355266 Rhizobium sp. L43 Isolate Nodule
126 2791355267 Rhizobium sp. L18 Isolate Nodule
127 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
128 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
129 2802429633 Rhizobium anhuiense J3 Isolate Nodule
130 2802429634 Rhizobium anhuiense S10 Isolate Nodule
131 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
132 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
133 2802429637 Rhizobium anhuiense C15 Isolate Nodule
134 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
135 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
136 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
137 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
138 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
139 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
140 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
141 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
142 2838048938 Rhizobium pisi 27/80 Isolate Nodule
143 2838061910 Rhizobium phaseoli L15 Isolate Nodule
144 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
145 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
146 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
147 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
148 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
149 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
150 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
151 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
152 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
153 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
154 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
155 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
156 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
157 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
158 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
159 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
160 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
161 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
162 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
163 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
164 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
165 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
166 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
167 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
168 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
169 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
170 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
171 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
172 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
173 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
174 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
175 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
176 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
177 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
178 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
179 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
180 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
181 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
182 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
183 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
184 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
185 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
186 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
187 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
188 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
189 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
190 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
191 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
192 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
193 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
194 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
195 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
196 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
197 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
198 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
199 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
200 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
201 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
202 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
203 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
204 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
205 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
206 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
207 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
208 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
209 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
210 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
211 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
212 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
213 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
214 2854911287 Brucella lupini LUP21 Isolate Unclassified
215 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
216 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
217 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
218 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
219 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
220 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
221 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
222 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
223 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
224 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
225 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
226 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
227 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
228 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
229 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
230 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
231 2933599457 Rhizobium phaseoli M3 Isolate Nodule
232 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
233 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
234 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
235 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
236 2936381700 Rhizobium chutanense C16 Isolate Unclassified
237 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
238 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
239 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
240 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
241 2996887358 Rhizobium sp. R711 Isolate Nodule
242 2996893221 Rhizobium sp. R635 Isolate Nodule
243 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
244 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
245 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
246 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
247 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
248 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
249 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
250 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
251 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
252 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
253 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
254 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
255 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
256 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
257 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
258 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
259 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
260 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
261 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
262 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
263 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
264 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
265 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
266 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
267 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
268 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
269 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
270 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
271 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
272 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
273 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
274 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
275 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
276 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
277 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
278 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
279 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
280 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
281 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
282 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
283 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
284 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
285 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
286 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
287 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
288 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
289 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
290 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
291 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
292 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
293 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
294 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
295 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
296 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
297 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
298 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
299 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
300 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
301 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
302 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
303 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
304 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
305 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
306 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
307 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
308 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
309 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
310 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
311 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
312 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
313 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
314 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
315 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
316 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
317 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
318 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
319 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
320 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
321 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
322 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
323 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
324 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
325 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
326 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
327 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
328 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
329 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
330 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
331 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
332 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
333 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
334 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
335 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
336 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
337 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
338 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
339 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
340 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
341 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
342 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
343 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
344 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
345 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
346 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
347 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
348 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
349 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
350 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
351 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
352 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
353 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
354 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
355 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
356 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
357 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
358 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
359 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
360 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
361 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
362 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
363 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
364 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
365 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
366 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
367 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
368 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
369 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
370 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
371 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
372 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
373 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
374 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
375 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
376 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
377 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
378 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
379 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
380 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
381 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
382 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
383 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
384 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
385 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
386 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
387 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
388 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
389 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
390 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
391 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
392 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
393 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
394 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
395 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
396 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
397 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
398 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
399 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
400 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
404 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
406 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
408 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
409 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
410 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
411 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
412 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
413 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
445 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
458 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
459 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
462 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
463 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
464 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
465 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
466 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
467 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
468 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
469 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
470 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
471 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
472 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
473 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
474 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
475 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
476 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
477 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
478 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
479 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
480 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
481 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
482 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
483 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
484 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
485 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
486 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
487 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
488 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
489 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
490 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
491 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
492 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
493 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
494 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
495 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
496 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
497 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
498 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
499 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
500 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
501 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
502 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
503 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
504 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
505 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
506 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
507 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
508 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
509 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
510 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
511 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
512 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
515 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
516 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
517 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
518 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
519 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
520 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
521 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
522 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
523 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
524 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
525 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
526 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
527 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
528 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
529 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
530 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
531 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
532 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
533 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
534 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
535 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
536 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
537 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
538 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
539 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
540 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
541 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
542 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
543 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
544 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
545 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
546 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
547 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
548 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
549 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
550 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
551 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
552 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
553 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
554 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
555 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
556 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
557 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
558 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
559 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
560 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
561 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
562 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
563 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
564 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
565 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
566 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
567 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
568 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
570 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
571 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
572 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
573 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
574 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
575 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
576 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
577 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
578 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
579 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
580 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
581 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
582 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
583 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
584 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
585 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
586 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
587 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
588 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
589 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
590 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
591 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
592 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
593 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
594 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
595 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
596 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
597 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
598 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
599 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
600 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
601 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
602 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
603 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
604 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
605 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
606 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
607 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
608 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
610 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
611 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
612 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
613 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
614 8005258706 Rhizobium sp. R693 Isolate Nodule
615 8005275841 Rhizobium sp. N4311 Isolate Nodule
616 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
617 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
618 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
619 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
620 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
621 8005321885 Rhizobium sp. R72 Isolate Nodule
622 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
623 8005382845 Rhizobium sp. R634 Isolate Nodule
624 8005395548 Rhizobium sp. R339 Isolate Nodule
625 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
626 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
627 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
628 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
629 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
630 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
631 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
632 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
633 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
634 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
635 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
636 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
637 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
638 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
639 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
640 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
641 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
642 8018176218 Rhizobium sp. N122 Isolate Nodule
643 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
644 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
645 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
646 8024501048 Rhizobium sp. H4 Isolate Nodule
647 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
648 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
649 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
650 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
651 8056382006 Rhizobium croatiense 13T Isolate Nodule
652 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
653 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 67.48
Metatranscriptomes 0.44
Isolates 32.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.87
Nodule 21.53
Rhizoplane 3.77
Rhizosphere 48.39
Stem 0
Stem Tuber 0
Unclassified 12.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001606 3300002459 Bacteria 4671
2 JGI25155J39150_1000012 3300002704 Bacteria 199435
3 JGI25156J39149_1000036 3300002705 Bacteria 110527
4 JGI25156J39149_1000049 3300002705 Bacteria 91988
5 JGI25162J39368_1000146 3300002737 Bacteria 76858
6 JGI25154J39366_1000033 3300002738 Bacteria 184379
7 JGI25157J39369_1000055 3300002741 Bacteria 107875
8 JGI25152J39213_1001334 3300002773 Bacteria 10889
9 JGI25152J39213_1004215 3300002773 Bacteria 4610
10 JGI25150J39212_1000063 3300002774 Bacteria 64558
11 JGI25150J39212_1003198 3300002774 Bacteria 3881
12 JGI25159J45721_1000073 3300002987 Bacteria 48504
13 JGI25159J45721_1000198 3300002987 Bacteria 27927
14 JGI25159J45721_1002886 3300002987 Bacteria 6282
15 JGI25151J46595_10000140 3300003187 Bacteria 95958
16 JGI25151J46595_10000750 3300003187 Bacteria 26476
17 JGI25151J46595_10034572 3300003187 Bacteria 1931
18 JGI25165J46597_1000451 3300003214 Bacteria 41309
19 JGI25165J46597_1001044 3300003214 Bacteria 18066
20 JGI25153J46596_10003011 3300003215 Bacteria 9532
21 JGI25153J46596_10015475 3300003215 Bacteria 3104
22 JGI25153J46596_10028045 3300003215 Bacteria 1961
23 JGI25160J50197_1000006 3300003354 Bacteria 316247
24 JGI25160J50197_1000020 3300003354 Bacteria 232739
25 JGI25160J50197_1002386 3300003354 Bacteria 8763
26 JGI25161J50226_1000004 3300003374 Bacteria 316212
27 JGI25161J50226_1000103 3300003374 Bacteria 67942
28 JGI25161J50226_1008740 3300003374 Bacteria 1522
29 Ga0006562J51391_1153968 3300003578 Bacteria 1360
30 Ga0006562J51391_1153969 3300003578 Bacteria 1430
31 Ga0055526_1000562 3300003771 Bacteria 29362
32 Ga0055526_1004977 3300003771 Bacteria 7798
33 Ga0055526_1020044 3300003771 Bacteria 2402
34 Ga0055524_1005106 3300003775 Bacteria 5935
35 Ga0055524_1006367 3300003775 Bacteria 5125
36 Ga0055536_1000618 3300003781 Bacteria 24148
37 Ga0055528_1000581 3300003790 Bacteria 27606
38 Ga0055528_1009166 3300003790 Bacteria 4164
39 Ga0055528_1011421 3300003790 Bacteria 3526
40 Ga0055528_1014566 3300003790 Bacteria 2901
41 Ga0055528_1023143 3300003790 Bacteria 1907
42 Ga0055540_1000476 3300003792 Bacteria 30954
43 Ga0055540_1003314 3300003792 Bacteria 7851
44 Ga0055540_1023377 3300003792 Bacteria 1558
45 Ga0055531_10021394 3300003794 Bacteria 2510
46 Ga0055543_1000002 3300004625 Bacteria 390020
47 Ga0055543_1000029 3300004625 Bacteria 131452
48 Ga0055543_1000163 3300004625 Bacteria 55480
49 Ga0055543_1002440 3300004625 Bacteria 6147
50 Ga0065165_1000013 3300005262 Bacteria 301887
51 Ga0065165_1000217 3300005262 Bacteria 100170
52 Ga0065165_1008510 3300005262 Bacteria 4780
53 Ga0065165_1024455 3300005262 Bacteria 2028
54 Ga0065715_10004261 3300005293 Bacteria 4374
55 Ga0070676_10008327 3300005328 Bacteria 5588
56 Ga0070683_100078943 3300005329 Bacteria 3080
57 Ga0070690_100111312 3300005330 Bacteria 1827
58 Ga0070670_100000201 3300005331 Bacteria 55479
59 Ga0070670_100004118 3300005331 Bacteria 12153
60 Ga0070680_100038340 3300005336 Bacteria 3876
61 Ga0070682_100009745 3300005337 Bacteria 5439
62 Ga0070660_100013337 3300005339 Bacteria 5892
63 Ga0070689_100052593 3300005340 Bacteria 3150
64 Ga0070691_10000937 3300005341 Bacteria 11856
65 Ga0070687_100013436 3300005343 Bacteria 3649
66 Ga0070661_100317367 3300005344 Bacteria 1216
67 Ga0070668_100007905 3300005347 Bacteria 7896
68 Ga0070668_100087194 3300005347 Bacteria 2456
69 Ga0070669_100003947 3300005353 Bacteria 10731
70 Ga0070671_100015550 3300005355 Bacteria 6148
71 Ga0070674_100000255 3300005356 Bacteria 26391
72 Ga0070673_100098228 3300005364 Bacteria 2406
73 Ga0070688_100018819 3300005365 Bacteria 3993
74 Ga0070688_100135975 3300005365 Bacteria 1664
75 Ga0070659_100022994 3300005366 Bacteria 4766
76 Ga0070667_100009549 3300005367 Bacteria 8043
77 Ga0070667_100232863 3300005367 Bacteria 1643
78 Ga0070667_100243675 3300005367 Bacteria 1606
79 Ga0070709_10028766 3300005434 Bacteria 3317
80 Ga0070714_100036349 3300005435 Bacteria 4130
81 Ga0070713_100122289 3300005436 Bacteria 2284
82 Ga0070710_10010750 3300005437 Bacteria 4500
83 Ga0070701_10001749 3300005438 Bacteria 8179
84 Ga0070711_100000991 3300005439 Bacteria 15051
85 Ga0070705_100023732 3300005440 Bacteria 3299
86 Ga0070694_100027220 3300005444 Bacteria 3712
87 Ga0070663_100004730 3300005455 Bacteria 8030
88 Ga0070678_100131444 3300005456 Bacteria 1989
89 Ga0070662_100110234 3300005457 Bacteria 2096
90 Ga0070662_100270687 3300005457 Bacteria 1371
91 Ga0068867_100033115 3300005459 Bacteria 3740
92 Ga0068867_100038594 3300005459 Bacteria 3477
93 Ga0070707_100072247 3300005468 Bacteria 3325
94 Ga0070679_100007954 3300005530 Bacteria 9951
95 Ga0070684_100002428 3300005535 Bacteria 13740
96 Ga0070697_100002550 3300005536 Bacteria 14021
97 Ga0068853_100009025 3300005539 Bacteria 8030
98 Ga0070672_100201471 3300005543 Bacteria 1664
99 Ga0070686_100001426 3300005544 Bacteria 13485
100 Ga0070696_100015998 3300005546 Bacteria 5044
101 Ga0070696_100087680 3300005546 Bacteria 2211
102 Ga0070693_100008518 3300005547 Bacteria 5062
103 Ga0070704_100020506 3300005549 Bacteria 4263
104 Ga0070704_100021719 3300005549 Bacteria 4166
105 Ga0068855_100227759 3300005563 Bacteria 2088
106 Ga0070664_100167863 3300005564 Bacteria 1945
107 Ga0068857_100049572 3300005577 Bacteria 3725
108 Ga0068854_100003774 3300005578 Bacteria 9473
109 Ga0068856_100041938 3300005614 Bacteria 4499
110 Ga0068856_100187564 3300005614 Bacteria 2082
111 Ga0070702_100002406 3300005615 Bacteria 8057
112 Ga0068852_100015192 3300005616 Bacteria 5959
113 Ga0068859_100098726 3300005617 Bacteria 2974
114 Ga0068859_100107019 3300005617 Bacteria 2856
115 Ga0068864_100008425 3300005618 Bacteria 8506
116 Ga0068866_10002650 3300005718 Bacteria 7397
117 Ga0068861_100019992 3300005719 Bacteria 4789
118 Ga0068851_10072531 3300005834 Bacteria 1784
119 Ga0068870_10071104 3300005840 Bacteria 1898
120 Ga0068863_100007448 3300005841 Bacteria 10711
121 Ga0068858_100006719 3300005842 Bacteria 11192
122 Ga0068858_100062165 3300005842 Bacteria 3453
123 Ga0068858_100067055 3300005842 Bacteria 3324
124 Ga0068860_100025587 3300005843 Bacteria 5692
125 Ga0068860_100176224 3300005843 Bacteria 2066
126 Ga0068860_100305024 3300005843 Bacteria 1561
127 Ga0068862_100019327 3300005844 Bacteria 5684
128 Ga0068862_100070626 3300005844 Bacteria 3014
129 Ga0081455_10001941 3300005937 Bacteria 24850
130 Ga0081455_10004546 3300005937 Bacteria 15486
131 Ga0075365_10089806 3300006038 Bacteria 2092
132 Ga0070716_100005064 3300006173 Bacteria 6358
133 Ga0075367_10002996 3300006178 Bacteria 7903
134 Ga0075369_10001644 3300006186 Bacteria 7706
135 Ga0075366_10009828 3300006195 Bacteria 5350
136 Ga0097621_100021212 3300006237 Bacteria 5020
137 Ga0075370_10081892 3300006353 Bacteria 1855
138 Ga0075428_100171214 3300006844 Bacteria 2353
139 Ga0075431_100001445 3300006847 Bacteria 21876
140 Ga0075431_100038265 3300006847 Bacteria 4939
141 Ga0075431_100171369 3300006847 Bacteria 2230
142 Ga0075433_10234698 3300006852 Bacteria 1628
143 Ga0075434_100099120 3300006871 Bacteria 2919
144 Ga0068865_100028038 3300006881 Bacteria 3726
145 Ga0068865_100061874 3300006881 Bacteria 2626
146 Ga0075436_100011810 3300006914 Bacteria 5992
147 Ga0097620_100098724 3300006931 Bacteria 2974
148 Ga0097620_100107019 3300006931 Bacteria 2856
149 Ga0075435_100014925 3300007076 Bacteria 5826
150 Ga0105251_10080294 3300009011 Bacteria 1508
151 Ga0105240_10000019 3300009093 Bacteria 406211
152 Ga0105245_10316332 3300009098 Bacteria 1536
153 Ga0105247_10002602 3300009101 Bacteria 12197
154 Ga0105247_10007399 3300009101 Bacteria 6741
155 Ga0114129_10006974 3300009147 Bacteria 16079
156 Ga0105243_10029798 3300009148 Bacteria 4199
157 Ga0105243_10039301 3300009148 Bacteria 3687
158 Ga0105241_10015032 3300009174 Bacteria 5670
159 Ga0105242_10046401 3300009176 Bacteria 3524
160 Ga0105242_10104123 3300009176 Bacteria 2409
161 Ga0105248_10014453 3300009177 Bacteria 8689
162 Ga0105248_10030508 3300009177 Bacteria 6020
163 Ga0105248_10124009 3300009177 Bacteria 2914
164 Ga0105237_10003975 3300009545 Bacteria 17286
165 Ga0105237_10025836 3300009545 Bacteria 6004
166 Ga0105238_10005416 3300009551 Bacteria 12611
167 Ga0105249_10007708 3300009553 Bacteria 9380
168 Ga0105249_10028244 3300009553 Bacteria 5064
169 Ga0105249_10059202 3300009553 Bacteria 3513
170 Ga0105249_10499312 3300009553 Bacteria 1262
171 Ga0123341_1000015 3300009765 Bacteria 86184
172 Ga0123342_1005228 3300009766 Bacteria 19065
173 Ga0105239_10037732 3300010375 Bacteria 5295
174 Ga0105246_10014433 3300011119 Bacteria 4969
175 Ga0157373_10060189 3300013100 Bacteria 2690
176 Ga0157373_10061120 3300013100 Bacteria 2668
177 Ga0157371_10027003 3300013102 Bacteria 4167
178 Ga0157370_10003322 3300013104 Bacteria 18953
179 Ga0157370_10063549 3300013104 Bacteria 3496
180 Ga0157369_10015957 3300013105 Bacteria 8451
181 Ga0157374_10015991 3300013296 Bacteria 6590
182 Ga0157378_10176601 3300013297 Bacteria 2007
183 Ga0163162_10074226 3300013306 Bacteria 3459
184 Ga0163162_10402741 3300013306 Bacteria 1501
185 Ga0157372_10015254 3300013307 Bacteria 8230
186 Ga0157375_10005311 3300013308 Bacteria 11188
187 Ga0157375_10011932 3300013308 Bacteria 7688
188 Ga0157375_10020436 3300013308 Bacteria 6049
189 Ga0163163_10367868 3300014325 Bacteria 1495
190 Ga0157380_10012768 3300014326 Bacteria 6102
191 Ga0157380_10102499 3300014326 Bacteria 2386
192 Ga0157380_10175839 3300014326 Bacteria 1875
193 Ga0182008_10039562 3300014497 Bacteria 2356
194 Ga0157377_10011186 3300014745 Bacteria 4472
195 Ga0157377_10167519 3300014745 Bacteria 1371
196 Ga0157379_10032912 3300014968 Bacteria 4622
197 Ga0157379_10048594 3300014968 Bacteria 3787
198 Ga0157379_10049428 3300014968 Bacteria 3755
199 Ga0157376_10034199 3300014969 Bacteria 4102
200 Ga0157376_10064826 3300014969 Bacteria 3082
201 Ga0182007_10005578 3300015262 Bacteria 5506
202 Ga0182005_1004663 3300015265 Bacteria 4382
203 Ga0214542_1000012 3300021321 Bacteria 235800
204 Ga0214543_1000024 3300021327 Bacteria 235745
205 Ga0209435_100005 3300025206 Bacteria 573745
206 Ga0209436_100026 3300025208 Bacteria 90859
207 Ga0209437_100078 3300025233 Bacteria 278088
208 Ga0209437_100174 3300025233 Bacteria 138811
209 Ga0207425_1000080 3300025245 Bacteria 100578
210 Ga0207425_1008661 3300025245 Bacteria 2584
211 Ga0209646_1000011 3300025246 Bacteria 573745
212 Ga0209026_1000008 3300025250 Bacteria 573745
213 Ga0209677_100679 3300025253 Bacteria 17501
214 Ga0209759_1000004 3300025256 Bacteria 573745
215 Ga0209129_1000195 3300025258 Bacteria 80791
216 Ga0209129_1000568 3300025258 Bacteria 25490
217 Ga0209129_1003030 3300025258 Bacteria 7627
218 Ga0209129_1004354 3300025258 Bacteria 5571
219 Ga0209233_1000163 3300025261 Bacteria 152912
220 Ga0209233_1000299 3300025261 Bacteria 60375
221 Ga0209233_1000305 3300025261 Bacteria 58381
222 Ga0209673_1000320 3300025273 Bacteria 88073
223 Ga0209673_1000924 3300025273 Bacteria 37119
224 Ga0209673_1001284 3300025273 Bacteria 25735
225 Ga0209673_1002385 3300025273 Bacteria 13195
226 Ga0209673_1002545 3300025273 Bacteria 12453
227 Ga0209673_1004988 3300025273 Bacteria 6880
228 Ga0209673_1004993 3300025273 Bacteria 6874
229 Ga0209673_1009073 3300025273 Bacteria 4350
230 Ga0209673_1029885 3300025273 Bacteria 1727
231 Ga0209130_1000030 3300025284 Bacteria 323323
232 Ga0209130_1000032 3300025284 Bacteria 316240
233 Ga0209130_1000034 3300025284 Bacteria 302439
234 Ga0209130_1006815 3300025284 Bacteria 3640
235 Ga0209676_1002327 3300025292 Bacteria 13755
236 Ga0209025_1000332 3300025294 Bacteria 104326
237 Ga0209025_1000354 3300025294 Bacteria 98665
238 Ga0209025_1001057 3300025294 Bacteria 40170
239 Ga0209025_1008742 3300025294 Bacteria 7212
240 Ga0209025_1022156 3300025294 Bacteria 3383
241 Ga0209025_1058003 3300025294 Bacteria 1474
242 Ga0209564_1000013 3300025295 Bacteria 775755
243 Ga0209564_1000207 3300025295 Bacteria 135313
244 Ga0209564_1000345 3300025295 Bacteria 88073
245 Ga0209564_1001668 3300025295 Bacteria 21260
246 Ga0209758_1000263 3300025297 Bacteria 104297
247 Ga0209758_1000561 3300025297 Bacteria 58483
248 Ga0209758_1002596 3300025297 Bacteria 18100
249 Ga0209758_1036053 3300025297 Bacteria 1938
250 Ga0209050_1002550 3300025298 Bacteria 15227
251 Ga0209050_1002635 3300025298 Bacteria 14735
252 Ga0209256_1000343 3300025299 Bacteria 75902
253 Ga0209256_1001503 3300025299 Bacteria 23634
254 Ga0209256_1006057 3300025299 Bacteria 6598
255 Ga0209256_1006227 3300025299 Bacteria 6426
256 Ga0209256_1011929 3300025299 Bacteria 3405
257 Ga0209256_1014279 3300025299 Bacteria 2870
258 Ga0209256_1015466 3300025299 Bacteria 2667
259 Ga0207426_1000006 3300025302 Bacteria 1025969
260 Ga0207426_1000047 3300025302 Bacteria 417011
261 Ga0207426_1000077 3300025302 Bacteria 316246
262 Ga0207426_1000296 3300025302 Bacteria 98032
263 Ga0207426_1005194 3300025302 Bacteria 6049
264 Ga0209051_1000236 3300025303 Bacteria 92738
265 Ga0209051_1002497 3300025303 Bacteria 13112
266 Ga0209051_1003879 3300025303 Bacteria 9552
267 Ga0209257_1001852 3300025304 Bacteria 23002
268 Ga0209257_1004236 3300025304 Bacteria 11334
269 Ga0209257_1022881 3300025304 Bacteria 2215
270 Ga0207692_10009040 3300025898 Bacteria 4148
271 Ga0207642_10003712 3300025899 Bacteria 4855
272 Ga0207710_10006511 3300025900 Bacteria 4980
273 Ga0207688_10005265 3300025901 Bacteria 7027
274 Ga0207647_10001136 3300025904 Bacteria 20506
275 Ga0207685_10000555 3300025905 Bacteria 6460
276 Ga0207699_10005354 3300025906 Bacteria 6150
277 Ga0207699_10036650 3300025906 Bacteria 2798
278 Ga0207654_10018973 3300025911 Bacteria 3618
279 Ga0207695_10000049 3300025913 Bacteria 406233
280 Ga0207671_10000107 3300025914 Bacteria 128950
281 Ga0207671_10019919 3300025914 Bacteria 5118
282 Ga0207693_10000551 3300025915 Bacteria 33845
283 Ga0207663_10006654 3300025916 Bacteria 5941
284 Ga0207660_10134930 3300025917 Bacteria 1882
285 Ga0207662_10015005 3300025918 Bacteria 4352
286 Ga0207657_10004689 3300025919 Bacteria 14434
287 Ga0207649_10013621 3300025920 Bacteria 4543
288 Ga0207652_10178679 3300025921 Bacteria 1906
289 Ga0207681_10004932 3300025923 Bacteria 8201
290 Ga0207681_10172630 3300025923 Bacteria 1640
291 Ga0207694_10094331 3300025924 Bacteria 2365
292 Ga0207650_10004756 3300025925 Bacteria 9277
293 Ga0207650_10043322 3300025925 Bacteria 3303
294 Ga0207687_10086612 3300025927 Bacteria 2275
295 Ga0207700_10372463 3300025928 Bacteria 1247
296 Ga0207664_10010884 3300025929 Bacteria 6442
297 Ga0207644_10025012 3300025931 Bacteria 4102
298 Ga0207644_10038574 3300025931 Bacteria 3366
299 Ga0207690_10008586 3300025932 Bacteria 6062
300 Ga0207706_10001303 3300025933 Bacteria 25092
301 Ga0207706_10154934 3300025933 Bacteria 2015
302 Ga0207686_10014721 3300025934 Bacteria 4362
303 Ga0207709_10117281 3300025935 Bacteria 1791
304 Ga0207670_10090640 3300025936 Bacteria 2160
305 Ga0207669_10018870 3300025937 Bacteria 3578
306 Ga0207669_10073434 3300025937 Bacteria 2158
307 Ga0207669_10097434 3300025937 Bacteria 1934
308 Ga0207704_10024870 3300025938 Bacteria 3257
309 Ga0207704_10229135 3300025938 Bacteria 1380
310 Ga0207665_10000478 3300025939 Bacteria 27104
311 Ga0207691_10084630 3300025940 Bacteria 2847
312 Ga0207711_10019400 3300025941 Bacteria 5663
313 Ga0207711_10109752 3300025941 Bacteria 2452
314 Ga0207689_10027495 3300025942 Bacteria 4760
315 Ga0207661_10059640 3300025944 Bacteria 3076
316 Ga0207679_10164657 3300025945 Bacteria 1819
317 Ga0207667_10090442 3300025949 Bacteria 3163
318 Ga0207651_10011597 3300025960 Bacteria 4941
319 Ga0207712_10035739 3300025961 Bacteria 3378
320 Ga0207712_10117171 3300025961 Bacteria 2008
321 Ga0207712_10155806 3300025961 Bacteria 1769
322 Ga0207668_10020539 3300025972 Bacteria 4199
323 Ga0207668_10051401 3300025972 Bacteria 2846
324 Ga0207668_10100447 3300025972 Bacteria 2148
325 Ga0207640_10043337 3300025981 Bacteria 2875
326 Ga0207658_10040219 3300025986 Bacteria 3378
327 Ga0207677_10028300 3300026023 Bacteria 3542
328 Ga0207703_10012880 3300026035 Bacteria 6522
329 Ga0207639_10050996 3300026041 Bacteria 3145
330 Ga0207678_10001177 3300026067 Bacteria 23961
331 Ga0207708_10001719 3300026075 Bacteria 16202
332 Ga0207708_10146537 3300026075 Bacteria 1856
333 Ga0207702_10024534 3300026078 Bacteria 5004
334 Ga0207641_10009946 3300026088 Bacteria 7827
335 Ga0207648_10023059 3300026089 Bacteria 5583
336 Ga0207648_10034146 3300026089 Bacteria 4486
337 Ga0207648_10158377 3300026089 Bacteria 1999
338 Ga0207648_10393935 3300026089 Bacteria 1254
339 Ga0207676_10051930 3300026095 Bacteria 3202
340 Ga0207674_10017275 3300026116 Bacteria 7872
341 Ga0207675_100096520 3300026118 Bacteria 2783
342 Ga0207675_100284008 3300026118 Bacteria 1609
343 Ga0207683_10002755 3300026121 Bacteria 15350
344 Ga0207683_10348984 3300026121 Bacteria 1358
345 Ga0207698_10483987 3300026142 Bacteria 1201
346 Ga0209371_1009479 3300027312 Bacteria 3091
347 Ga0207428_10032560 3300027907 Bacteria 4286
348 Ga0268265_10059098 3300028380 Bacteria 2931
349 Ga0268264_10025585 3300028381 Bacteria 4822
350 Ga0268264_10046645 3300028381 Bacteria 3599
351 Ga0268264_10064602 3300028381 Bacteria 3081
352 Ga0307515_10000582 3300028794 Bacteria 85700
353 Ga0307515_10066660 3300028794 Bacteria 4982
354 Ga0265330_10057123 3300031235 Bacteria 1703
355 Ga0265339_10032582 3300031249 Bacteria 2938
356 Ga0307513_10025406 3300031456 Bacteria 6863
357 Ga0307408_100088960 3300031548 Bacteria 2327
358 Ga0265314_10117542 3300031711 Bacteria 1679
359 Ga0307516_10040071 3300031730 Bacteria 4665
360 Ga0307405_10002639 3300031731 Bacteria 7966
361 Ga0307413_10019699 3300031824 Bacteria 3572
362 Ga0307410_10044755 3300031852 Bacteria 2943
363 Ga0307406_10001664 3300031901 Bacteria 12223
364 Ga0307416_100222981 3300032002 Bacteria 1810
365 Ga0307414_10009844 3300032004 Bacteria 5511
366 Ga0307414_10223321 3300032004 Bacteria 1548
367 Ga0307411_10041252 3300032005 Bacteria 2935
368 Ga0307415_100031872 3300032126 Bacteria 3402
369 Ga0373930_0003763 3300034816 Bacteria 2432
370 Ga0373948_0008856 3300034817 Bacteria 1724
371 Ga0373926_0049717 3300035083 Bacteria 1510
372 Ga0373940_0017764 3300035088 Bacteria 1776
373 Ga0373932_0020569 3300035112 Bacteria 1732
374 Ga0373943_0061736 3300035170 Bacteria 1874
375 Ga0373962_0004361 3300035242 Bacteria 3418
376 Ga0373935_0016743 3300035692 Bacteria 4437
377 Ga0373927_0051251 3300035695 Bacteria 2669
378 Ga0373947_0008051 3300035725 Bacteria 6079
379 Ga0373937_0072265 3300036401 Bacteria 3182
380 Ga0316584_0148992 3300036712 Bacteria 1743
381 Ga0395900_0105037 3300037418 Bacteria 2902
382 Ga0395898_0011073 3300037466 Bacteria 9393
383 Ga0395905_0003153 3300037471 Bacteria 17758
384 Ga0395901_0538400 3300038443 Bacteria 1184
385 Ga0439466_0072270 3300041411 Bacteria 1097
386 Ga0439465_0024740 3300041413 Bacteria 1893
387 Ga0439465_0034236 3300041413 Bacteria 1626
388 Ga0439465_0078750 3300041413 Bacteria 1114
389 Ga0451833_0783907 3300041491 Bacteria 1583
390 Ga0451837_0908075 3300041494 Bacteria 3186
391 Ga0451841_0354402 3300041498 Bacteria 1815
392 Ga0451847_0031456 3300041503 Bacteria 3015
393 Ga0451849_0196173 3300041505 Bacteria 1583
394 Ga0451843_0055679 3300041509 Bacteria 2984
395 Ga0451853_2888965 3300041512 Bacteria 8115
396 Ga0439462_0046650 3300042015 Bacteria 1161
397 Ga0495603_0000740 3300046455 Bacteria 18651
398 Ga0495629_0000841 3300046459 Bacteria 24882
399 Ga0495638_0000591 3300046460 Bacteria 40915
400 Ga0495641_0029644 3300046461 Bacteria 2635
401 Ga0495580_0004062 3300046472 Bacteria 12353
402 Ga0495582_0000461 3300046473 Bacteria 22212
403 Ga0495605_0053266 3300046474 Bacteria 1963
404 Ga0495639_0003136 3300046475 Bacteria 7182
405 Ga0495585_0009526 3300046492 Bacteria 5816
406 Ga0495585_0074985 3300046492 Bacteria 1840
407 Ga0495594_0004429 3300046499 Bacteria 7226
408 Ga0495583_0047098 3300046506 Bacteria 1985
409 Ga0495606_0007602 3300046507 Bacteria 9640
410 Ga0495606_0118411 3300046507 Bacteria 1588
411 Ga0495610_0033376 3300046512 Bacteria 2662
412 Ga0495610_0038229 3300046512 Bacteria 2437
413 Ga0495620_0047266 3300046515 Bacteria 1853
414 Ga0495620_0091569 3300046515 Bacteria 1219
415 Ga0495631_0018486 3300046518 Bacteria 3279
416 Ga0495632_0008120 3300046519 Bacteria 6494
417 Ga0495632_0045150 3300046519 Bacteria 2196
418 Ga0495643_0028455 3300046522 Bacteria 3133
419 Ga0495643_0047695 3300046522 Bacteria 2318
420 Ga0495643_0110013 3300046522 Bacteria 1402
421 Ga0495654_0013123 3300046530 Bacteria 4437
422 Ga0495668_0032989 3300046616 Bacteria 2911
423 Ga0495634_0042228 3300046642 Bacteria 3094
424 Ga0495625_0013649 3300046660 Bacteria 6516
425 Ga0495635_0113819 3300046663 Bacteria 1847
426 Ga0495588_0001977 3300046674 Bacteria 8764
427 Ga0495647_0002052 3300046681 Bacteria 6301
428 Ga0495613_0000595 3300046689 Bacteria 29139
429 Ga0495624_0190902 3300046690 Bacteria 1246
430 Ga0495649_0092474 3300046694 Bacteria 1611
431 Ga0495649_0125167 3300046694 Bacteria 1358
432 Ga0495589_0071460 3300046794 Bacteria 1696
433 Ga0495660_0021555 3300046810 Bacteria 3690
434 Ga0495660_0096056 3300046810 Bacteria 1532
435 Ga0495581_0022400 3300047315 Bacteria 3661
436 Ga0495676_0023326 3300047321 Bacteria 5373
437 Ga0495686_0062725 3300047472 Bacteria 2304
438 Ga0495686_0066598 3300047472 Bacteria 2225
439 Ga0495686_0095117 3300047472 Bacteria 1804
440 Ga0495686_0144950 3300047472 Bacteria 1399
441 Ga0495593_0006408 3300047673 Bacteria 6901
442 Ga0495614_0003145 3300048089 Bacteria 7365
443 Ga0496100_0103989 3300048903 Bacteria 1961
444 Ga0496101_0008511 3300048904 Bacteria 6706
445 Ga0496101_0062769 3300048904 Bacteria 2702
446 Ga0496101_0092769 3300048904 Bacteria 2248
447 Ga0496102_0042393 3300048905 Bacteria 4123
448 Ga0496102_0118971 3300048905 Bacteria 2466
449 Ga0496102_0120332 3300048905 Bacteria 2452
450 Ga0496102_0470931 3300048905 Bacteria 1177
451 Ga0496103_0015637 3300048906 Bacteria 4521
452 Ga0496103_0072482 3300048906 Bacteria 2157
453 Ga0496104_0015695 3300048907 Bacteria 6869
454 Ga0496104_0024916 3300048907 Bacteria 5510
455 Ga0496104_0028197 3300048907 Bacteria 5203
456 Ga0496105_0041368 3300048908 Bacteria 3798
457 Ga0496105_0097483 3300048908 Bacteria 2428
458 Ga0496106_0081222 3300048909 Bacteria 2490
459 Ga0496106_0136421 3300048909 Bacteria 1927
460 Ga0496107_0023830 3300048910 Bacteria 4326
461 Ga0496107_0024245 3300048910 Bacteria 4291
462 Ga0496107_0029776 3300048910 Bacteria 3887
463 Ga0496107_0197639 3300048910 Bacteria 1494
464 Ga0496109_0186002 3300048912 Bacteria 1951
465 Ga0496109_0480138 3300048912 Bacteria 1173
466 Ga0496110_0110336 3300048913 Bacteria 2472
467 Ga0496111_0104412 3300048914 Bacteria 2084
468 Ga0496113_0007347 3300048916 Bacteria 7077
469 Ga0496114_0015063 3300048917 Bacteria 6217
470 Ga0496114_0022902 3300048917 Bacteria 5091
471 Ga0496114_0032206 3300048917 Bacteria 4314
472 Ga0496115_0041766 3300048918 Bacteria 3651
473 Ga0496116_0002361 3300048919 Bacteria 19961
474 Ga0496116_0037398 3300048919 Bacteria 3385
475 Ga0496116_0095918 3300048919 Bacteria 1788
476 Ga0496117_0014505 3300048920 Bacteria 6783
477 Ga0496118_0013335 3300048921 Bacteria 7783
478 Ga0496118_0101960 3300048921 Bacteria 1936
479 Ga0496118_0127256 3300048921 Bacteria 1644
480 Ga0496121_0003259 3300048924 Bacteria 23331
481 Ga0496121_0010789 3300048924 Bacteria 10239
482 Ga0496121_0159142 3300048924 Bacteria 1653
483 Ga0496122_0000106 3300048925 Bacteria 193672
484 Ga0496122_0001278 3300048925 Bacteria 41879
485 Ga0496122_0019999 3300048925 Bacteria 6084
486 Ga0496122_0037047 3300048925 Bacteria 3934
487 Ga0496122_0063286 3300048925 Bacteria 2701
488 Ga0496122_0070806 3300048925 Bacteria 2488
489 Ga0496122_0147193 3300048925 Bacteria 1461
490 Ga0496123_0000022 3300048926 Bacteria 361832
491 Ga0496123_0001041 3300048926 Bacteria 41987
492 Ga0496123_0013107 3300048926 Bacteria 6994
493 Ga0496123_0067195 3300048926 Bacteria 2265
494 Ga0496123_0071286 3300048926 Bacteria 2168
495 Ga0496123_0110354 3300048926 Bacteria 1574
496 Ga0496124_0002119 3300048927 Bacteria 26718
497 Ga0496124_0005723 3300048927 Bacteria 13845
498 Ga0496124_0034683 3300048927 Bacteria 4424
499 Ga0496124_0055620 3300048927 Bacteria 3343
500 Ga0496124_0106350 3300048927 Bacteria 2265
501 Ga0496124_0140060 3300048927 Bacteria 1910
502 Ga0496125_0000248 3300048928 Bacteria 110840
503 Ga0496125_0048689 3300048928 Bacteria 3531
504 Ga0496125_0206313 3300048928 Bacteria 1281
505 Ga0496126_0001356 3300048929 Bacteria 38810
506 Ga0496126_0175120 3300048929 Bacteria 1825
507 Ga0496126_0394147 3300048929 Bacteria 1124
508 Ga0501031_0014187 3300049568 Bacteria 5185
509 Ga0501031_0022978 3300049568 Bacteria 4067
510 Ga0501032_0048925 3300049569 Bacteria 2854
511 Ga0501034_0000012 3300049571 Bacteria 310504
512 Ga0501034_0012058 3300049571 Bacteria 8935
513 Ga0501034_0076067 3300049571 Bacteria 3364
514 Ga0501034_0124056 3300049571 Bacteria 2568
515 Ga0501036_0023907 3300049572 Bacteria 5150
516 Ga0501036_0160805 3300049572 Bacteria 1893
517 Ga0501038_0044867 3300049574 Bacteria 3839
518 Ga0501038_0046663 3300049574 Bacteria 3755
519 Ga0501039_0003920 3300049575 Bacteria 11180
520 Ga0501039_0018420 3300049575 Bacteria 5359
521 Ga0501039_0160520 3300049575 Bacteria 1767
522 Ga0501040_0024229 3300049576 Bacteria 4072
523 Ga0501040_0130545 3300049576 Bacteria 1766
524 Ga0501040_0171802 3300049576 Bacteria 1535
525 Ga0501041_0069220 3300049577 Bacteria 2164
526 Ga0501042_0004481 3300049578 Bacteria 8910
527 Ga0501042_0022673 3300049578 Bacteria 4386
528 Ga0501042_0134833 3300049578 Bacteria 1780
529 Ga0501042_0345287 3300049578 Bacteria 1076
530 Ga0501043_0073761 3300049579 Bacteria 2680
531 Ga0501043_0221007 3300049579 Bacteria 1465
532 Ga0501046_0015793 3300049580 Bacteria 6335
533 Ga0501046_0038960 3300049580 Bacteria 3810
534 Ga0501048_0000273 3300049582 Bacteria 34673
535 Ga0501068_0046151 3300049584 Bacteria 2627
536 Ga0501071_0023237 3300049587 Bacteria 4329
537 Ga0501071_0029103 3300049587 Bacteria 3896
538 Ga0501072_0006088 3300049588 Bacteria 9205
539 Ga0501072_0053262 3300049588 Bacteria 3187
540 Ga0501072_0054012 3300049588 Bacteria 3164
541 Ga0501073_0140292 3300049589 Bacteria 1675
542 Ga0501074_0014204 3300049590 Bacteria 5792
543 Ga0501074_0038403 3300049590 Bacteria 3470
544 Ga0501074_0060746 3300049590 Bacteria 2723
545 Ga0501075_0023280 3300049591 Bacteria 4534
546 Ga0501075_0036618 3300049591 Bacteria 3662
547 Ga0501075_0044409 3300049591 Bacteria 3334
548 Ga0501075_0187604 3300049591 Bacteria 1577
549 Ga0501076_0002471 3300049592 Bacteria 12697
550 Ga0501076_0043386 3300049592 Bacteria 3543
551 Ga0501076_0082967 3300049592 Bacteria 2573
552 Ga0501077_0008785 3300049593 Bacteria 6271
553 Ga0501077_0022687 3300049593 Bacteria 3978
554 Ga0501077_0044815 3300049593 Bacteria 2809
555 Ga0501077_0074918 3300049593 Bacteria 2143
556 Ga0501079_0019944 3300049741 Bacteria 5122
557 Ga0501079_0026235 3300049741 Bacteria 4466
558 Ga0501080_0139956 3300049742 Bacteria 2238
559 Ga0501081_0037782 3300049743 Bacteria 3295
560 Ga0501081_0154454 3300049743 Bacteria 1650
561 Ga0501081_0219610 3300049743 Bacteria 1382
562 Ga0501083_0114300 3300049744 Bacteria 1773
563 Ga0501083_0127847 3300049744 Bacteria 1665
564 Ga0501035_0157576 3300049822 Bacteria 1967
565 Ga0501035_0178307 3300049822 Bacteria 1832
566 Ga0501045_0017016 3300049824 Bacteria 5163
567 Ga0501045_0031367 3300049824 Bacteria 3849
568 Ga0501045_0139227 3300049824 Bacteria 1805
569 Ga0501045_0169094 3300049824 Bacteria 1628
570 nmdc:mga00v17_123950_c1 3300050491 Bacteria 1647
571 nmdc:mga07m45_135359_c1 3300050496 Bacteria 1426
572 nmdc:mga05p37_11818_c1 3300050507 Bacteria 10407
573 nmdc:mga05p37_63064_c1 3300050507 Bacteria 4562
574 nmdc:mga09592_16186_c1 3300050508 Bacteria 6096
575 nmdc:mga06r32_21646_c1 3300050510 Bacteria 5937
576 nmdc:mga06r32_22935_c1 3300050510 Bacteria 5773
577 nmdc:mga06r32_268650_c1 3300050510 Bacteria 1693
578 nmdc:mga08y16_184327_c1 3300050511 Bacteria 2167
579 nmdc:mga0n895_220711_c1 3300050512 Bacteria 1925
580 nmdc:mga08x19_82159_c1 3300050514 Bacteria 2117
581 nmdc:mga0a205_24382_c1 3300050515 Bacteria 5753
582 Ga0495601_0015971 3300053077 Bacteria 4543
583 Ga0500610_0066512 3300053079 Bacteria 1879
584 Ga0495595_0016186 3300053084 Bacteria 3186
585 Ga0495595_0074900 3300053084 Bacteria 1605
586 Ga0495619_0011845 3300053085 Bacteria 5493
587 Ga0495619_0017554 3300053085 Bacteria 4532
588 Ga0500641_0022550 3300053096 Bacteria 2413
589 Ga0500555_034324 3300053103 Bacteria 1428
590 Ga0500569_002019 3300053109 Bacteria 3943
591 Ga0500569_024058 3300053109 Bacteria 1644
592 Ga0500658_0000514 3300053134 Bacteria 16536
593 Ga0500559_0010416 3300053136 Bacteria 3991
594 Ga0500568_0027958 3300053139 Bacteria 2354
595 Ga0500616_0000944 3300053153 Bacteria 31705
596 Ga0500622_0001277 3300053156 Bacteria 20505
597 Ga0500622_0004917 3300053156 Bacteria 8165
598 Ga0500627_0040319 3300053158 Bacteria 2004
599 Ga0501084_0004163 3300054114 Bacteria 11794
600 Ga0501084_0116761 3300054114 Bacteria 2243
601 Ga0501084_0391958 3300054114 Bacteria 1173
602 Ga0587088_000912 3300059508 Bacteria 2805
603 Ga0587088_007114 3300059508 Bacteria 1535
604 Ga0501082_0007075 3300060353 Bacteria 9684
605 Ga0501082_0030168 3300060353 Bacteria 4673
606 Ga0501082_0107325 3300060353 Bacteria 2416
607 Ga0530510_0018441 3300061734 Bacteria 4948
608 Ga0530510_0058582 3300061734 Bacteria 2785
609 Ga0530510_0068599 3300061734 Bacteria 2572
610 Ga0530510_0071714 3300061734 Bacteria 2514
611 Ga0530510_0085966 3300061734 Bacteria 2291
612 Ga0530510_0119915 3300061734 Bacteria 1930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026089 Ga0207648_10158377 Ga0207648_101583772 309
2 3300005367 Ga0070667_100232863 Ga0070667_1002328632 321
3 3300005842 Ga0068858_100067055 Ga0068858_1000670552 321
4 3300005843 Ga0068860_100305024 Ga0068860_1003050242 321
5 3300006881 Ga0068865_100061874 Ga0068865_1000618742 321
6 3300009101 Ga0105247_10007399 Ga0105247_100073996 321
7 3300013297 Ga0157378_10176601 Ga0157378_101766012 321
8 3300013308 Ga0157375_10020436 Ga0157375_100204362 321
9 3300014326 Ga0157380_10102499 Ga0157380_101024992 321
10 3300025937 Ga0207669_10073434 Ga0207669_100734342 321
11 3300026075 Ga0207708_10146537 Ga0207708_101465372 321
12 3300026142 Ga0207698_10483987 Ga0207698_104839872 321
13 3300035088 Ga0373940_0017764 Ga0373940_0017764_789_1754 321
14 3300048904 Ga0496101_0008511 Ga0496101_0008511_5470_6483 321
15 3300048907 Ga0496104_0024916 Ga0496104_0024916_2637_3650 321
16 3300048908 Ga0496105_0041368 Ga0496105_0041368_1492_2505 321
17 3300048910 Ga0496107_0029776 Ga0496107_0029776_1731_2744 321
18 3300048912 Ga0496109_0480138 Ga0496109_0480138_146_1159 321
19 3300048917 Ga0496114_0015063 Ga0496114_0015063_1262_2275 321
20 3300048918 Ga0496115_0041766 Ga0496115_0041766_1243_2256 321
21 3300048913 Ga0496110_0110336 Ga0496110_0110336_1294_2307 322
22 iso_pu_bacteria 2509276021 2509389768 324
23 iso_pu_bacteria 2509276033 2509447978 324
24 iso_pu_bacteria 2510065019 2510134916 324
25 iso_pu_bacteria 2510461076 2510896327 324
26 iso_pu_bacteria 2510917022 2511136487 324
27 iso_pu_bacteria 2510917028 2511187261 324
28 iso_pu_bacteria 2510917030 2511195961 324
29 iso_pu_bacteria 2513237084 2513573703 324
30 iso_pu_bacteria 2513237085 2513580089 324
31 iso_pu_bacteria 2513237088 2513599833 324
32 iso_pu_bacteria 2513237093 2513631243 324
33 iso_pu_bacteria 2513237103 2513710862 324
34 iso_pu_bacteria 2513237138 2513867041 324
35 iso_pu_bacteria 2513237162 2514023217 324
36 iso_pu_bacteria 2515075009 2515113999 324
37 iso_pu_bacteria 2515154113 2515637172 324
38 iso_pu_bacteria 2515154114 2515642952 324
39 iso_pu_bacteria 2515154116 2515656700 324
40 iso_pu_bacteria 2515154134 2515743643 324
41 iso_pu_bacteria 2516653077 2517037633 324
42 iso_pu_bacteria 2516653085 2517077918 324
43 iso_pu_bacteria 2517093000 2517096716 324
44 iso_pu_bacteria 2517287029 2517410431 324
45 iso_pu_bacteria 2524023209 2524460003 324
46 iso_pu_bacteria 2529292951 2530647027 324
47 iso_pu_bacteria 2534681796 2535519334 324
48 iso_pu_bacteria 2582581294 2585202384 324
49 iso_pu_bacteria 2582581298 2585224703 324
50 iso_pu_bacteria 2582581299 2585227910 324
51 iso_pu_bacteria 2582581304 2585255507 324
52 iso_pu_bacteria 2582581307 2585274354 324
53 iso_pu_bacteria 2582581308 2585280236 324
54 iso_pu_bacteria 2582581315 2585322513 324
55 iso_pu_bacteria 2582581316 2585335126 324
56 iso_pu_bacteria 2582581867 2585402318 324
57 iso_pu_bacteria 2585427526 2585529004 324
58 iso_pu_bacteria 2585427527 2585532465 324
59 iso_pu_bacteria 2585427528 2585540945 324
60 iso_pu_bacteria 2585427529 2585547259 324
61 iso_pu_bacteria 2585427530 2585554518 324
62 iso_pu_bacteria 2585427531 2585560803 324
63 iso_pu_bacteria 2585427590 2585822383 324
64 iso_pu_bacteria 2585427593 2585839707 324
65 iso_pu_bacteria 2585427594 2585845477 324
66 iso_pu_bacteria 2585427608 2585899004 324
67 iso_pu_bacteria 2585427609 2585903402 324
68 iso_pu_bacteria 2585428125 2587981479 324
69 iso_pu_bacteria 2615840624 2616295634 324
70 iso_pu_bacteria 2615840626 2616307464 324
71 iso_pu_bacteria 2615840698 2616555010 324
72 iso_pu_bacteria 2643221599 2644006540 324
73 iso_pu_bacteria 2643221634 2644195984 324
74 iso_pu_bacteria 2643221643 2644241957 324
75 iso_pu_bacteria 2667528174 2671112255 324
76 iso_pu_bacteria 2718217882 2719182668 324
77 iso_pu_bacteria 2718217927 2719387339 324
78 iso_pu_bacteria 2718217997 2719666984 324
79 iso_pu_bacteria 2718218009 2719733386 324
80 iso_pu_bacteria 2718218199 2720493404 324
81 iso_pu_bacteria 2718218232 2720614875 324
82 iso_pu_bacteria 2718218233 2720621648 324
83 iso_pu_bacteria 2718218235 2720632976 324
84 iso_pu_bacteria 2718218269 2720776700 324
85 iso_pu_bacteria 2718218363 2721148781 324
86 iso_pu_bacteria 2718218365 2721160165 324
87 iso_pu_bacteria 2718218366 2721165594 324
88 iso_pu_bacteria 2718218423 2721400974 324
89 iso_pu_bacteria 2721755514 2722841764 324
90 iso_pu_bacteria 2721755556 2723028288 324
91 iso_pu_bacteria 2721755684 2723561916 324
92 iso_pu_bacteria 2721755685 2723568548 324
93 iso_pu_bacteria 2721755809 2724039787 324
94 iso_pu_bacteria 2721755810 2724046142 324
95 iso_pu_bacteria 2721755819 2724091307 324
96 iso_pu_bacteria 2721755822 2724105813 324
97 iso_pu_bacteria 2721755823 2724111639 324
98 iso_pu_bacteria 2724679232 2725950840 324
99 iso_pu_bacteria 2728369352 2730109224 324
100 iso_pu_bacteria 2728369365 2730165903 324
101 iso_pu_bacteria 2728369397 2730299797 324
102 iso_pu_bacteria 2738541293 2738804813 324
103 iso_pu_bacteria 2738541333 2739035502 324
104 iso_pu_bacteria 2765235942 2766065247 324
105 iso_pu_bacteria 2775507266 2778176074 324
106 iso_pu_bacteria 2791355256 2793293551 324
107 iso_pu_bacteria 2791355259 2793313004 324
108 iso_pu_bacteria 2791355260 2793319651 324
109 iso_pu_bacteria 2791355261 2793327850 324
110 iso_pu_bacteria 2791355262 2793333464 324
111 iso_pu_bacteria 2791355263 2793342015 324
112 iso_pu_bacteria 2791355264 2793347442 324
113 iso_pu_bacteria 2791355265 2793353773 324
114 iso_pu_bacteria 2791355266 2793359627 324
115 iso_pu_bacteria 2791355267 2793369377 324
116 iso_pu_bacteria 2802429605 2805929478 324
117 iso_pu_bacteria 2802429606 2805935341 324
118 iso_pu_bacteria 2802429633 2806044488 324
119 iso_pu_bacteria 2802429634 2806052689 324
120 iso_pu_bacteria 2802429635 2806058989 324
121 iso_pu_bacteria 2802429636 2806068348 324
122 iso_pu_bacteria 2802429637 2806074468 324
123 iso_pu_bacteria 2818991448 2819609539 324
124 iso_pu_bacteria 2818991453 2819639635 324
125 iso_pu_bacteria 2838016132 2838019180 324
126 iso_pu_bacteria 2838022645 2838024229 324
127 iso_pu_bacteria 2838029111 2838033195 324
128 iso_pu_bacteria 2838035591 2838040842 324
129 iso_pu_bacteria 2838042994 2838047431 324
130 iso_pu_bacteria 2838048938 2838051101 324
131 iso_pu_bacteria 2838061910 2838063920 324
132 iso_pu_bacteria 2838068647 2838073405 324
133 iso_pu_bacteria 2838661181 2838664767 324
134 iso_pu_bacteria 2838668709 2838674622 324
135 iso_pu_bacteria 2838680041 2838684882 324
136 iso_pu_bacteria 2838686498 2838691246 324
137 iso_pu_bacteria 2838694306 2838699281 324
138 iso_pu_bacteria 2838701080 2838707020 324
139 iso_pu_bacteria 2838707686 2838712762 324
140 iso_pu_bacteria 2838729681 2838735729 324
141 iso_pu_bacteria 2838742623 2838748631 324
142 iso_pu_bacteria 2840878972 2840883643 324
143 iso_pu_bacteria 2841851746 2841853934 324
144 iso_pu_bacteria 2841864319 2841868098 324
145 iso_pu_bacteria 2842077413 2842082239 324
146 iso_pu_bacteria 2842110456 2842113359 324
147 iso_pu_bacteria 2842118031 2842123164 324
148 iso_pu_bacteria 2842146304 2842151710 324
149 iso_pu_bacteria 2842156927 2842162548 324
150 iso_pu_bacteria 2842163707 2842170024 324
151 iso_pu_bacteria 2842180545 2842184985 324
152 iso_pu_bacteria 2842192696 2842198643 324
153 iso_pu_bacteria 2842198810 2842199771 324
154 iso_pu_bacteria 2842205361 2842208389 324
155 iso_pu_bacteria 2842217011 2842220001 324
156 iso_pu_bacteria 2842229732 2842235642 324
157 iso_pu_bacteria 2842237096 2842241936 324
158 iso_pu_bacteria 2842243621 2842249324 324
159 iso_pu_bacteria 2842250916 2842256771 324
160 iso_pu_bacteria 2842257432 2842263539 324
161 iso_pu_bacteria 2842264693 2842266680 324
162 iso_pu_bacteria 2842271015 2842275721 324
163 iso_pu_bacteria 2842278818 2842281602 324
164 iso_pu_bacteria 2842285085 2842288725 324
165 iso_pu_bacteria 2842291075 2842296240 324
166 iso_pu_bacteria 2842298080 2842298773 324
167 iso_pu_bacteria 2842304105 2842308295 324
168 iso_pu_bacteria 2842311132 2842316424 324
169 iso_pu_bacteria 2842317721 2842321311 324
170 iso_pu_bacteria 2842341865 2842345082 324
171 iso_pu_bacteria 2842357229 2842359359 324
172 iso_pu_bacteria 2842363717 2842369198 324
173 iso_pu_bacteria 2842370503 2842375558 324
174 iso_pu_bacteria 2842377471 2842382640 324
175 iso_pu_bacteria 2842384541 2842390041 324
176 iso_pu_bacteria 2842395702 2842398436 324
177 iso_pu_bacteria 2842402390 2842406608 324
178 iso_pu_bacteria 2842409023 2842412965 324
179 iso_pu_bacteria 2842415677 2842419608 324
180 iso_pu_bacteria 2842422224 2842427040 324
181 iso_pu_bacteria 2842428310 2842429999 324
182 iso_pu_bacteria 2842434925 2842436341 324
183 iso_pu_bacteria 2842441272 2842444044 324
184 iso_pu_bacteria 2842447887 2842453650 324
185 iso_pu_bacteria 2842462802 2842464420 324
186 iso_pu_bacteria 2842469257 2842470670 324
187 iso_pu_bacteria 2842475841 2842479928 324
188 iso_pu_bacteria 2842482326 2842483324 324
189 iso_pu_bacteria 2842489311 2842495532 324
190 iso_pu_bacteria 2842495871 2842499077 324
191 iso_pu_bacteria 2842502639 2842507104 324
192 iso_pu_bacteria 2842509118 2842510801 324
193 iso_pu_bacteria 2844454524 2844457420 324
194 iso_pu_bacteria 2852387548 2852391288 324
195 iso_pu_bacteria 2857516855 2857518827 324
196 iso_pu_bacteria 2919100787 2919104645 324
197 iso_pu_bacteria 2919408235 2919410742 324
198 iso_pu_bacteria 2923556063 2923558688 324
199 iso_pu_bacteria 2933570622 2933574744 324
200 iso_pu_bacteria 2933586486 2933589351 324
201 iso_pu_bacteria 2933599457 2933603465 324
202 iso_pu_bacteria 2935894831 2935901207 324
203 iso_pu_bacteria 2935901341 2935907481 324
204 iso_pu_bacteria 2936367885 2936374797 324
205 iso_pu_bacteria 2936375103 2936380489 324
206 iso_pu_bacteria 2936381700 2936382343 324
207 iso_pu_bacteria 2996887358 2996889292 324
208 iso_pu_bacteria 2996893221 2996894660 324
209 iso_pu_bacteria 3005416602 3005418419 324
210 iso_pu_bacteria 3005445848 3005449354 324
211 iso_pu_bacteria 3005452660 3005455658 324
212 iso_pu_bacteria 639633055 639650070 324
213 iso_pu_bacteria 8005258706 8005264129 324
214 iso_pu_bacteria 8005275841 8005282086 324
215 iso_pu_bacteria 8005282627 8005285098 324
216 iso_pu_bacteria 8005289223 8005294193 324
217 iso_pu_bacteria 8005301065 8005306606 324
218 iso_pu_bacteria 8005307578 8005309460 324
219 iso_pu_bacteria 8005314921 8005318689 324
220 iso_pu_bacteria 8005321885 8005323819 324
221 iso_pu_bacteria 8005376324 8005382714 324
222 iso_pu_bacteria 8005382845 8005383771 324
223 iso_pu_bacteria 8005395548 8005401097 324
224 iso_pu_bacteria 8005430974 8005434051 324
225 iso_pu_bacteria 8005460587 8005464688 324
226 iso_pu_bacteria 8005484373 8005488429 324
227 iso_pu_bacteria 8005497431 8005501736 324
228 iso_pu_bacteria 8005542996 8005547012 324
229 iso_pu_bacteria 8005556819 8005559091 324
230 iso_pu_bacteria 8005563573 8005566850 324
231 iso_pu_bacteria 8005570704 8005574874 324
232 iso_pu_bacteria 8005619151 8005623090 324
233 iso_pu_bacteria 8005626139 8005631602 324
234 iso_pu_bacteria 8005645114 8005648899 324
235 iso_pu_bacteria 8005668836 8005673158 324
236 iso_pu_bacteria 8005682033 8005682136 324
237 iso_pu_bacteria 8005688590 8005693698 324
238 iso_pu_bacteria 8005695170 8005700939 324
239 iso_pu_bacteria 8018127388 8018133545 324
240 iso_pu_bacteria 8018163183 8018170293 324
241 iso_pu_bacteria 8018176218 8018178394 324
242 iso_pu_bacteria 8023680758 8023687475 324
243 iso_pu_bacteria 8024479707 8024482023 324
244 iso_pu_bacteria 8024501048 8024505865 324
245 iso_pu_bacteria 8046767195 8046773157 324
246 iso_pu_bacteria 8056375014 8056381659 324
247 iso_pu_bacteria 8056382006 8056387096 324
248 iso_pu_bacteria 8057575449 8057581106 324
249 iso_pu_bacteria 8057874678 8057877065 324
250 iso_pu_bacteria 2510461069 2510841730 325
251 iso_pu_bacteria 2643221653 2644299323 325
252 iso_pu_bacteria 2643221719 2644657551 325
253 iso_pu_bacteria 2818991272 2819243891 325
254 iso_pu_bacteria 2899803654 2899805221 325
255 iso_pu_bacteria 2989776772 2989780428 325
256 iso_pu_bacteria 8005246636 8005249482 325
257 iso_pu_bacteria 8024486573 8024486950 325
258 3300053096 Ga0500641_0022550 Ga0500641_0022550_1034_2086 326
259 iso_pu_bacteria 2891373044 2891373421 326
260 3300005262 Ga0065165_1024455 Ga0065165_10244552 327
261 3300025273 Ga0209673_1029885 Ga0209673_10298852 327
262 3300025284 Ga0209130_1006815 Ga0209130_10068151 327
263 3300048924 Ga0496121_0159142 Ga0496121_0159142_155_1138 327
264 3300048925 Ga0496122_0063286 Ga0496122_0063286_1521_2504 327
265 3300048927 Ga0496124_0140060 Ga0496124_0140060_179_1162 327
266 3300048929 Ga0496126_0394147 Ga0496126_0394147_23_1006 327
267 iso_pu_bacteria 2643221637 2644208961 327
268 iso_pu_bacteria 2643221718 2644652491 327
269 iso_pu_bacteria 2791355082 2792585064 327
270 iso_pu_bacteria 2989349275 2989349752 327
271 iso_pu_bacteria 8049293176 8049295387 327
272 3300002704 JGI25155J39150_1000012 JGI25155J39150_100001292 328
273 3300002705 JGI25156J39149_1000036 JGI25156J39149_100003689 328
274 3300002705 JGI25156J39149_1000049 JGI25156J39149_10000491 328
275 3300002737 JGI25162J39368_1000146 JGI25162J39368_100014645 328
276 3300002738 JGI25154J39366_1000033 JGI25154J39366_100003381 328
277 3300002741 JGI25157J39369_1000055 JGI25157J39369_100005592 328
278 3300002773 JGI25152J39213_1001334 JGI25152J39213_10013344 328
279 3300002773 JGI25152J39213_1004215 JGI25152J39213_10042152 328
280 3300002774 JGI25150J39212_1000063 JGI25150J39212_100006317 328
281 3300002774 JGI25150J39212_1003198 JGI25150J39212_10031981 328
282 3300002987 JGI25159J45721_1000198 JGI25159J45721_100019820 328
283 3300002987 JGI25159J45721_1002886 JGI25159J45721_10028866 328
284 3300003187 JGI25151J46595_10000140 JGI25151J46595_1000014050 328
285 3300003187 JGI25151J46595_10000750 JGI25151J46595_1000075011 328
286 3300003187 JGI25151J46595_10034572 JGI25151J46595_100345722 328
287 3300003214 JGI25165J46597_1000451 JGI25165J46597_10004516 328
288 3300003214 JGI25165J46597_1001044 JGI25165J46597_100104413 328
289 3300003215 JGI25153J46596_10003011 JGI25153J46596_100030113 328
290 3300003215 JGI25153J46596_10015475 JGI25153J46596_100154752 328
291 3300003215 JGI25153J46596_10028045 JGI25153J46596_100280452 328
292 3300003354 JGI25160J50197_1000006 JGI25160J50197_1000006152 328
293 3300003354 JGI25160J50197_1002386 JGI25160J50197_10023869 328
294 3300003374 JGI25161J50226_1000004 JGI25161J50226_1000004152 328
295 3300003374 JGI25161J50226_1000103 JGI25161J50226_100010330 328
296 3300003578 Ga0006562J51391_1153968 Ga0006562J51391_11539682 328
297 3300003578 Ga0006562J51391_1153969 Ga0006562J51391_11539691 328
298 3300003771 Ga0055526_1000562 Ga0055526_100056228 328
299 3300003771 Ga0055526_1020044 Ga0055526_10200442 328
300 3300003775 Ga0055524_1005106 Ga0055524_10051063 328
301 3300003775 Ga0055524_1006367 Ga0055524_10063675 328
302 3300003790 Ga0055528_1000581 Ga0055528_10005815 328
303 3300003790 Ga0055528_1009166 Ga0055528_10091662 328
304 3300003790 Ga0055528_1011421 Ga0055528_10114213 328
305 3300003790 Ga0055528_1014566 Ga0055528_10145662 328
306 3300003790 Ga0055528_1023143 Ga0055528_10231432 328
307 3300003792 Ga0055540_1000476 Ga0055540_100047610 328
308 3300003792 Ga0055540_1003314 Ga0055540_10033146 328
309 3300003792 Ga0055540_1023377 Ga0055540_10233772 328
310 3300003794 Ga0055531_10021394 Ga0055531_100213942 328
311 3300004625 Ga0055543_1000002 Ga0055543_1000002183 328
312 3300004625 Ga0055543_1000029 Ga0055543_100002941 328
313 3300004625 Ga0055543_1002440 Ga0055543_10024405 328
314 3300005262 Ga0065165_1000217 Ga0065165_1000217110 328
315 3300005262 Ga0065165_1008510 Ga0065165_10085102 328
316 3300005347 Ga0070668_100087194 Ga0070668_1000871942 328
317 3300005355 Ga0070671_100015550 Ga0070671_1000155505 328
318 3300005614 Ga0068856_100187564 Ga0068856_1001875642 328
319 3300006038 Ga0075365_10089806 Ga0075365_100898062 328
320 3300006178 Ga0075367_10002996 Ga0075367_100029963 328
321 3300006186 Ga0075369_10001644 Ga0075369_100016444 328
322 3300006195 Ga0075366_10009828 Ga0075366_100098283 328
323 3300006353 Ga0075370_10081892 Ga0075370_100818922 328
324 3300009093 Ga0105240_10000019 Ga0105240_1000001996 328
325 3300009177 Ga0105248_10014453 Ga0105248_100144533 328
326 3300009177 Ga0105248_10124009 Ga0105248_101240092 328
327 3300009545 Ga0105237_10003975 Ga0105237_1000397516 328
328 3300009553 Ga0105249_10059202 Ga0105249_100592023 328
329 3300009765 Ga0123341_1000015 Ga0123341_100001534 328
330 3300009766 Ga0123342_1005228 Ga0123342_10052283 328
331 3300013100 Ga0157373_10060189 Ga0157373_100601892 328
332 3300013104 Ga0157370_10003322 Ga0157370_100033228 328
333 3300014497 Ga0182008_10039562 Ga0182008_100395622 328
334 3300015262 Ga0182007_10005578 Ga0182007_100055782 328
335 3300015265 Ga0182005_1004663 Ga0182005_10046634 328
336 3300025206 Ga0209435_100005 Ga0209435_10000592 328
337 3300025208 Ga0209436_100026 Ga0209436_1000263 328
338 3300025233 Ga0209437_100078 Ga0209437_100078118 328
339 3300025233 Ga0209437_100174 Ga0209437_10017462 328
340 3300025245 Ga0207425_1000080 Ga0207425_100008050 328
341 3300025245 Ga0207425_1008661 Ga0207425_10086612 328
342 3300025246 Ga0209646_1000011 Ga0209646_100001192 328
343 3300025250 Ga0209026_1000008 Ga0209026_100000892 328
344 3300025253 Ga0209677_100679 Ga0209677_10067913 328
345 3300025256 Ga0209759_1000004 Ga0209759_100000492 328
346 3300025258 Ga0209129_1000195 Ga0209129_100019551 328
347 3300025258 Ga0209129_1000568 Ga0209129_10005688 328
348 3300025258 Ga0209129_1003030 Ga0209129_10030305 328
349 3300025258 Ga0209129_1004354 Ga0209129_10043544 328
350 3300025261 Ga0209233_1000163 Ga0209233_1000163118 328
351 3300025261 Ga0209233_1000299 Ga0209233_100029915 328
352 3300025261 Ga0209233_1000305 Ga0209233_100030514 328
353 3300025273 Ga0209673_1000320 Ga0209673_100032033 328
354 3300025273 Ga0209673_1000924 Ga0209673_10009244 328
355 3300025273 Ga0209673_1001284 Ga0209673_100128418 328
356 3300025273 Ga0209673_1002385 Ga0209673_10023859 328
357 3300025273 Ga0209673_1002545 Ga0209673_10025457 328
358 3300025273 Ga0209673_1004988 Ga0209673_10049883 328
359 3300025273 Ga0209673_1004993 Ga0209673_10049933 328
360 3300025273 Ga0209673_1009073 Ga0209673_10090735 328
361 3300025284 Ga0209130_1000030 Ga0209130_100003085 328
362 3300025284 Ga0209130_1000032 Ga0209130_1000032146 328
363 3300025294 Ga0209025_1000332 Ga0209025_100033250 328
364 3300025294 Ga0209025_1000354 Ga0209025_100035436 328
365 3300025294 Ga0209025_1008742 Ga0209025_10087425 328
366 3300025294 Ga0209025_1058003 Ga0209025_10580032 328
367 3300025295 Ga0209564_1000207 Ga0209564_100020744 328
368 3300025295 Ga0209564_1000345 Ga0209564_100034533 328
369 3300025295 Ga0209564_1001668 Ga0209564_10016683 328
370 3300025297 Ga0209758_1000263 Ga0209758_100026350 328
371 3300025297 Ga0209758_1000561 Ga0209758_100056127 328
372 3300025297 Ga0209758_1002596 Ga0209758_10025969 328
373 3300025297 Ga0209758_1036053 Ga0209758_10360532 328
374 3300025298 Ga0209050_1002635 Ga0209050_10026357 328
375 3300025299 Ga0209256_1000343 Ga0209256_100034352 328
376 3300025299 Ga0209256_1006057 Ga0209256_10060573 328
377 3300025299 Ga0209256_1006227 Ga0209256_10062274 328
378 3300025299 Ga0209256_1011929 Ga0209256_10119292 328
379 3300025299 Ga0209256_1014279 Ga0209256_10142793 328
380 3300025299 Ga0209256_1015466 Ga0209256_10154662 328
381 3300025302 Ga0207426_1000047 Ga0207426_1000047315 328
382 3300025302 Ga0207426_1000077 Ga0207426_1000077146 328
383 3300025302 Ga0207426_1000296 Ga0207426_100029636 328
384 3300025302 Ga0207426_1005194 Ga0207426_10051943 328
385 3300025303 Ga0209051_1000236 Ga0209051_100023623 328
386 3300025303 Ga0209051_1002497 Ga0209051_10024978 328
387 3300025303 Ga0209051_1003879 Ga0209051_10038794 328
388 3300025304 Ga0209257_1001852 Ga0209257_10018522 328
389 3300025304 Ga0209257_1022881 Ga0209257_10228812 328
390 3300025913 Ga0207695_10000049 Ga0207695_1000004998 328
391 3300025914 Ga0207671_10000107 Ga0207671_1000010771 328
392 3300025931 Ga0207644_10025012 Ga0207644_100250123 328
393 3300025941 Ga0207711_10109752 Ga0207711_101097521 328
394 3300025961 Ga0207712_10155806 Ga0207712_101558061 328
395 3300025972 Ga0207668_10051401 Ga0207668_100514012 328
396 3300027312 Ga0209371_1009479 Ga0209371_10094794 328
397 3300028794 Ga0307515_10066660 Ga0307515_100666602 328
398 3300031731 Ga0307405_10002639 Ga0307405_100026393 328
399 3300031901 Ga0307406_10001664 Ga0307406_100016643 328
400 3300041413 Ga0439465_0024740 Ga0439465_0024740_468_1454 328
401 3300041491 Ga0451833_0783907 Ga0451833_0783907_133_1119 328
402 3300041494 Ga0451837_0908075 Ga0451837_0908075_1805_2791 328
403 3300041498 Ga0451841_0354402 Ga0451841_0354402_517_1503 328
404 3300041503 Ga0451847_0031456 Ga0451847_0031456_944_1930 328
405 3300041505 Ga0451849_0196173 Ga0451849_0196173_41_1027 328
406 3300041509 Ga0451843_0055679 Ga0451843_0055679_1071_2057 328
407 3300041512 Ga0451853_2888965 Ga0451853_2888965_4531_5517 328
408 3300046460 Ga0495638_0000591 Ga0495638_0000591_1654_2640 328
409 3300046474 Ga0495605_0053266 Ga0495605_0053266_371_1357 328
410 3300046492 Ga0495585_0009526 Ga0495585_0009526_528_1514 328
411 3300046506 Ga0495583_0047098 Ga0495583_0047098_349_1335 328
412 3300046507 Ga0495606_0118411 Ga0495606_0118411_418_1404 328
413 3300046512 Ga0495610_0033376 Ga0495610_0033376_1278_2264 328
414 3300046512 Ga0495610_0038229 Ga0495610_0038229_873_1859 328
415 3300046515 Ga0495620_0047266 Ga0495620_0047266_29_1015 328
416 3300046515 Ga0495620_0091569 Ga0495620_0091569_191_1177 328
417 3300046518 Ga0495631_0018486 Ga0495631_0018486_1682_2668 328
418 3300046519 Ga0495632_0008120 Ga0495632_0008120_1729_2715 328
419 3300046519 Ga0495632_0045150 Ga0495632_0045150_730_1716 328
420 3300046522 Ga0495643_0028455 Ga0495643_0028455_485_1471 328
421 3300046522 Ga0495643_0047695 Ga0495643_0047695_1099_2085 328
422 3300046522 Ga0495643_0110013 Ga0495643_0110013_244_1230 328
423 3300046530 Ga0495654_0013123 Ga0495654_0013123_3077_4063 328
424 3300046616 Ga0495668_0032989 Ga0495668_0032989_1601_2587 328
425 3300046660 Ga0495625_0013649 Ga0495625_0013649_207_1193 328
426 3300046694 Ga0495649_0092474 Ga0495649_0092474_138_1124 328
427 3300046694 Ga0495649_0125167 Ga0495649_0125167_41_1027 328
428 3300046810 Ga0495660_0021555 Ga0495660_0021555_615_1601 328
429 3300046810 Ga0495660_0096056 Ga0495660_0096056_83_1069 328
430 3300047472 Ga0495686_0095117 Ga0495686_0095117_568_1554 328
431 3300047472 Ga0495686_0144950 Ga0495686_0144950_186_1172 328
432 3300048905 Ga0496102_0118971 Ga0496102_0118971_1106_2092 328
433 3300048906 Ga0496103_0072482 Ga0496103_0072482_790_1776 328
434 3300048909 Ga0496106_0136421 Ga0496106_0136421_445_1431 328
435 3300048919 Ga0496116_0002361 Ga0496116_0002361_2461_3447 328
436 3300048919 Ga0496116_0037398 Ga0496116_0037398_669_1655 328
437 3300048919 Ga0496116_0095918 Ga0496116_0095918_481_1467 328
438 3300048921 Ga0496118_0013335 Ga0496118_0013335_6204_7190 328
439 3300048921 Ga0496118_0101960 Ga0496118_0101960_565_1551 328
440 3300048921 Ga0496118_0127256 Ga0496118_0127256_488_1474 328
441 3300048924 Ga0496121_0003259 Ga0496121_0003259_21689_22675 328
442 3300048924 Ga0496121_0010789 Ga0496121_0010789_2450_3436 328
443 3300048925 Ga0496122_0000106 Ga0496122_0000106_23084_24070 328
444 3300048925 Ga0496122_0019999 Ga0496122_0019999_2450_3436 328
445 3300048925 Ga0496122_0037047 Ga0496122_0037047_689_1675 328
446 3300048925 Ga0496122_0070806 Ga0496122_0070806_1045_2031 328
447 3300048925 Ga0496122_0147193 Ga0496122_0147193_123_1109 328
448 3300048926 Ga0496123_0000022 Ga0496123_0000022_338087_339073 328
449 3300048926 Ga0496123_0013107 Ga0496123_0013107_3796_4782 328
450 3300048926 Ga0496123_0067195 Ga0496123_0067195_448_1434 328
451 3300048926 Ga0496123_0071286 Ga0496123_0071286_627_1613 328
452 3300048926 Ga0496123_0110354 Ga0496123_0110354_209_1195 328
453 3300048927 Ga0496124_0002119 Ga0496124_0002119_17051_18037 328
454 3300048927 Ga0496124_0005723 Ga0496124_0005723_2485_3471 328
455 3300048927 Ga0496124_0034683 Ga0496124_0034683_3175_4161 328
456 3300048927 Ga0496124_0055620 Ga0496124_0055620_917_1903 328
457 3300048927 Ga0496124_0106350 Ga0496124_0106350_383_1369 328
458 3300048928 Ga0496125_0048689 Ga0496125_0048689_579_1565 328
459 3300049571 Ga0501034_0000012 Ga0501034_0000012_115063_116049 328
460 3300049744 Ga0501083_0127847 Ga0501083_0127847_328_1314 328
461 3300050496 nmdc:mga07m45_135359_c1 nmdc:mga07m45_135359_c1_17_1003 328
462 3300053079 Ga0500610_0066512 Ga0500610_0066512_842_1828 328
463 3300053109 Ga0500569_002019 Ga0500569_002019_2706_3692 328
464 3300053109 Ga0500569_024058 Ga0500569_024058_78_1064 328
465 3300053134 Ga0500658_0000514 Ga0500658_0000514_11975_12961 328
466 3300053139 Ga0500568_0027958 Ga0500568_0027958_404_1390 328
467 3300053153 Ga0500616_0000944 Ga0500616_0000944_22605_23591 328
468 3300053156 Ga0500622_0004917 Ga0500622_0004917_4615_5601 328
469 3300053158 Ga0500627_0040319 Ga0500627_0040319_412_1398 328
470 3300059508 Ga0587088_000912 Ga0587088_000912_353_1339 328
471 3300059508 Ga0587088_007114 Ga0587088_007114_152_1138 328
472 iso_pu_bacteria 2513237146 2513927020 328
473 iso_pu_bacteria 2513237159 2514001434 328
474 iso_pu_bacteria 2516143018 2516204208 328
475 iso_pu_bacteria 2582581283 2585169706 328
476 iso_pu_bacteria 2582581306 2585267345 328
477 iso_pu_bacteria 2582581865 2585386413 328
478 iso_pu_bacteria 2582581866 2585393322 328
479 iso_pu_bacteria 2599185156 2599335938 328
480 iso_pu_bacteria 2599185170 2599420486 328
481 iso_pu_bacteria 2643221607 2644050447 328
482 iso_pu_bacteria 2643221636 2644205675 328
483 iso_pu_bacteria 2643221686 2644483365 328
484 iso_pu_bacteria 2643221688 2644492093 328
485 iso_pu_bacteria 2643221689 2644499574 328
486 iso_pu_bacteria 2643221723 2644675972 328
487 iso_pu_bacteria 2690316117 2692315479 328
488 iso_pu_bacteria 2751185821 2753462084 328
489 iso_pu_bacteria 2791355091 2792620707 328
490 iso_pu_bacteria 2791355092 2792626067 328
491 iso_pu_bacteria 2791355094 2792639010 328
492 iso_pu_bacteria 2838074704 2838076782 328
493 iso_pu_bacteria 2840764183 2840770648 328
494 iso_pu_bacteria 2842521101 2842521886 328
495 iso_pu_bacteria 2842922631 2842926908 328
496 iso_pu_bacteria 2847417321 2847419461 328
497 iso_pu_bacteria 2848992105 2848994488 328
498 iso_pu_bacteria 2854911287 2854915800 328
499 iso_pu_bacteria 2855872281 2855872463 328
500 iso_pu_bacteria 2896384573 2896392311 328
501 iso_pu_bacteria 2913295892 2913299246 328
502 iso_pu_bacteria 2920822456 2920825322 328
503 iso_pu_bacteria 2933016740 2933019900 328
504 iso_pu_bacteria 2937843397 2937847197 328
505 iso_pu_bacteria 643692032 643826367 328
506 iso_pu_bacteria 8054558443 8054562568 328
507 3300005331 Ga0070670_100000201 Ga0070670_1000002012 329
508 3300005834 Ga0068851_10072531 Ga0068851_100725311 329
509 3300025925 Ga0207650_10004756 Ga0207650_100047562 329
510 3300031730 Ga0307516_10040071 Ga0307516_100400713 329
511 3300041413 Ga0439465_0034236 Ga0439465_0034236_457_1446 329
512 3300046507 Ga0495606_0007602 Ga0495606_0007602_1105_2094 329
513 3300047472 Ga0495686_0062725 Ga0495686_0062725_504_1493 329
514 3300047472 Ga0495686_0066598 Ga0495686_0066598_537_1526 329
515 iso_pu_bacteria 2765235802 2765469139 329
516 iso_pu_bacteria 2767802442 2770196381 329
517 iso_pu_bacteria 2775506902 2776268504 329
518 iso_pu_bacteria 2775506904 2776285415 329
519 iso_pu_bacteria 2839993093 2839997563 329
520 iso_pu_bacteria 2894652903 2894657063 329
521 iso_pu_bacteria 2904578770 2904584062 329
522 iso_pu_bacteria 2919119836 2919124962 329
523 iso_pu_bacteria 2989771324 2989774379 329
524 iso_pu_bacteria 3003930520 3003934152 329
525 3300025294 Ga0209025_1001057 Ga0209025_10010572 330
526 3300048920 Ga0496117_0014505 Ga0496117_0014505_3578_4570 330
527 3300048925 Ga0496122_0001278 Ga0496122_0001278_31025_32017 330
528 3300048926 Ga0496123_0001041 Ga0496123_0001041_31025_32017 330
529 3300048928 Ga0496125_0000248 Ga0496125_0000248_12153_13145 330
530 3300048928 Ga0496125_0206313 Ga0496125_0206313_71_1063 330
531 3300048929 Ga0496126_0001356 Ga0496126_0001356_34859_35851 330
532 3300032004 Ga0307414_10009844 Ga0307414_100098445 331
533 3300032004 Ga0307414_10223321 Ga0307414_102233212 331
534 3300036712 Ga0316584_0148992 Ga0316584_0148992_627_1622 331
535 3300049571 Ga0501034_0124056 Ga0501034_0124056_285_1280 331
536 3300049579 Ga0501043_0073761 Ga0501043_0073761_1597_2592 331
537 3300002987 JGI25159J45721_1000073 JGI25159J45721_10000731 332
538 3300003354 JGI25160J50197_1000020 JGI25160J50197_1000020164 332
539 3300003374 JGI25161J50226_1008740 JGI25161J50226_10087401 332
540 3300003771 Ga0055526_1004977 Ga0055526_10049775 332
541 3300003781 Ga0055536_1000618 Ga0055536_10006184 332
542 3300004625 Ga0055543_1000163 Ga0055543_100016321 332
543 3300005262 Ga0065165_1000013 Ga0065165_100001353 332
544 3300021321 Ga0214542_1000012 Ga0214542_100001224 332
545 3300021327 Ga0214543_1000024 Ga0214543_100002425 332
546 3300025284 Ga0209130_1000034 Ga0209130_100003452 332
547 3300025292 Ga0209676_1002327 Ga0209676_10023274 332
548 3300025294 Ga0209025_1022156 Ga0209025_10221563 332
549 3300025295 Ga0209564_1000013 Ga0209564_100001353 332
550 3300025298 Ga0209050_1002550 Ga0209050_10025508 332
551 3300025299 Ga0209256_1001503 Ga0209256_10015039 332
552 3300025302 Ga0207426_1000006 Ga0207426_1000006426 332
553 3300025304 Ga0209257_1004236 Ga0209257_10042364 332
554 3300028794 Ga0307515_10000582 Ga0307515_1000058236 332
555 3300031456 Ga0307513_10025406 Ga0307513_100254069 332
556 3300031548 Ga0307408_100088960 Ga0307408_1000889603 332
557 3300032005 Ga0307411_10041252 Ga0307411_100412523 332
558 3300041411 Ga0439466_0072270 Ga0439466_0072270_13_1011 332
559 3300041413 Ga0439465_0078750 Ga0439465_0078750_58_1056 332
560 3300042015 Ga0439462_0046650 Ga0439462_0046650_68_1066 332
561 3300048929 Ga0496126_0175120 Ga0496126_0175120_93_1091 332
562 3300031235 Ga0265330_10057123 Ga0265330_100571232 333
563 3300031249 Ga0265339_10032582 Ga0265339_100325822 333
564 3300031711 Ga0265314_10117542 Ga0265314_101175422 333
565 3300053136 Ga0500559_0010416 Ga0500559_0010416_2207_3208 333
566 3300053156 Ga0500622_0001277 Ga0500622_0001277_3183_4184 333
567 iso_pu_bacteria 2523231067 2523466234 333
568 iso_pu_bacteria 2738543031 2739347043 333
569 3300031824 Ga0307413_10019699 Ga0307413_100196993 334
570 3300031852 Ga0307410_10044755 Ga0307410_100447553 334
571 3300032002 Ga0307416_100222981 Ga0307416_1002229812 334
572 3300032126 Ga0307415_100031872 Ga0307415_1000318722 334
573 3300049575 Ga0501039_0160520 Ga0501039_0160520_602_1744 334
574 3300013100 Ga0157373_10061120 Ga0157373_100611202 335
575 3300050491 nmdc:mga00v17_123950_c1 nmdc:mga00v17_123950_c1_65_1084 335
576 3300005293 Ga0065715_10004261 Ga0065715_100042612 336
577 3300005365 Ga0070688_100135975 Ga0070688_1001359751 336
578 3300005367 Ga0070667_100243675 Ga0070667_1002436752 336
579 3300005457 Ga0070662_100110234 Ga0070662_1001102342 336
580 3300005459 Ga0068867_100038594 Ga0068867_1000385944 336
581 3300005617 Ga0068859_100107019 Ga0068859_1001070193 336
582 3300005719 Ga0068861_100019992 Ga0068861_1000199924 336
583 3300005842 Ga0068858_100062165 Ga0068858_1000621654 336
584 3300005844 Ga0068862_100070626 Ga0068862_1000706262 336
585 3300005937 Ga0081455_10001941 Ga0081455_1000194114 336
586 3300006931 Ga0097620_100107019 Ga0097620_1001070193 336
587 3300009553 Ga0105249_10007708 Ga0105249_100077083 336
588 3300009553 Ga0105249_10499312 Ga0105249_104993122 336
589 3300013306 Ga0163162_10402741 Ga0163162_104027411 336
590 3300013308 Ga0157375_10011932 Ga0157375_100119323 336
591 3300014326 Ga0157380_10175839 Ga0157380_101758392 336
592 3300014745 Ga0157377_10167519 Ga0157377_101675192 336
593 3300014968 Ga0157379_10048594 Ga0157379_100485944 336
594 3300014969 Ga0157376_10034199 Ga0157376_100341993 336
595 3300025923 Ga0207681_10172630 Ga0207681_101726302 336
596 3300025933 Ga0207706_10154934 Ga0207706_101549342 336
597 3300025937 Ga0207669_10097434 Ga0207669_100974342 336
598 3300025938 Ga0207704_10024870 Ga0207704_100248702 336
599 3300025961 Ga0207712_10117171 Ga0207712_101171711 336
600 3300025972 Ga0207668_10020539 Ga0207668_100205392 336
601 3300026089 Ga0207648_10034146 Ga0207648_100341462 336
602 3300026121 Ga0207683_10348984 Ga0207683_103489842 336
603 3300028381 Ga0268264_10025585 Ga0268264_100255852 336
604 3300046794 Ga0495589_0071460 Ga0495589_0071460_652_1662 336
605 3300048904 Ga0496101_0062769 Ga0496101_0062769_866_1876 336
606 3300048905 Ga0496102_0470931 Ga0496102_0470931_142_1152 336
607 3300048909 Ga0496106_0081222 Ga0496106_0081222_48_1058 336
608 3300048910 Ga0496107_0023830 Ga0496107_0023830_599_1609 336
609 3300048917 Ga0496114_0032206 Ga0496114_0032206_118_1128 336
610 3300049582 Ga0501048_0000273 Ga0501048_0000273_21639_22667 336
611 3300053103 Ga0500555_034324 Ga0500555_034324_30_1040 336
612 3300002459 JGI24751J29686_10001606 JGI24751J29686_100016064 337
613 3300005328 Ga0070676_10008327 Ga0070676_100083272 337
614 3300005329 Ga0070683_100078943 Ga0070683_1000789432 337
615 3300005330 Ga0070690_100111312 Ga0070690_1001113122 337
616 3300005331 Ga0070670_100004118 Ga0070670_1000041185 337
617 3300005336 Ga0070680_100038340 Ga0070680_1000383404 337
618 3300005337 Ga0070682_100009745 Ga0070682_1000097452 337
619 3300005339 Ga0070660_100013337 Ga0070660_1000133373 337
620 3300005340 Ga0070689_100052593 Ga0070689_1000525932 337
621 3300005341 Ga0070691_10000937 Ga0070691_100009374 337
622 3300005343 Ga0070687_100013436 Ga0070687_1000134363 337
623 3300005344 Ga0070661_100317367 Ga0070661_1003173672 337
624 3300005347 Ga0070668_100007905 Ga0070668_1000079052 337
625 3300005353 Ga0070669_100003947 Ga0070669_1000039477 337
626 3300005356 Ga0070674_100000255 Ga0070674_10000025520 337
627 3300005364 Ga0070673_100098228 Ga0070673_1000982282 337
628 3300005365 Ga0070688_100018819 Ga0070688_1000188192 337
629 3300005366 Ga0070659_100022994 Ga0070659_1000229942 337
630 3300005367 Ga0070667_100009549 Ga0070667_1000095497 337
631 3300005434 Ga0070709_10028766 Ga0070709_100287662 337
632 3300005435 Ga0070714_100036349 Ga0070714_1000363492 337
633 3300005436 Ga0070713_100122289 Ga0070713_1001222892 337
634 3300005437 Ga0070710_10010750 Ga0070710_100107503 337
635 3300005438 Ga0070701_10001749 Ga0070701_100017493 337
636 3300005439 Ga0070711_100000991 Ga0070711_1000009911 337
637 3300005440 Ga0070705_100023732 Ga0070705_1000237322 337
638 3300005444 Ga0070694_100027220 Ga0070694_1000272203 337
639 3300005455 Ga0070663_100004730 Ga0070663_1000047302 337
640 3300005456 Ga0070678_100131444 Ga0070678_1001314442 337
641 3300005457 Ga0070662_100270687 Ga0070662_1002706871 337
642 3300005459 Ga0068867_100033115 Ga0068867_1000331152 337
643 3300005468 Ga0070707_100072247 Ga0070707_1000722473 337
644 3300005530 Ga0070679_100007954 Ga0070679_1000079546 337
645 3300005535 Ga0070684_100002428 Ga0070684_1000024285 337
646 3300005536 Ga0070697_100002550 Ga0070697_1000025506 337
647 3300005539 Ga0068853_100009025 Ga0068853_1000090252 337
648 3300005543 Ga0070672_100201471 Ga0070672_1002014712 337
649 3300005544 Ga0070686_100001426 Ga0070686_1000014268 337
650 3300005546 Ga0070696_100015998 Ga0070696_1000159983 337
651 3300005546 Ga0070696_100087680 Ga0070696_1000876802 337
652 3300005547 Ga0070693_100008518 Ga0070693_1000085182 337
653 3300005549 Ga0070704_100020506 Ga0070704_1000205063 337
654 3300005549 Ga0070704_100021719 Ga0070704_1000217192 337
655 3300005563 Ga0068855_100227759 Ga0068855_1002277592 337
656 3300005564 Ga0070664_100167863 Ga0070664_1001678632 337
657 3300005577 Ga0068857_100049572 Ga0068857_1000495723 337
658 3300005578 Ga0068854_100003774 Ga0068854_1000037748 337
659 3300005614 Ga0068856_100041938 Ga0068856_1000419383 337
660 3300005615 Ga0070702_100002406 Ga0070702_1000024062 337
661 3300005616 Ga0068852_100015192 Ga0068852_1000151924 337
662 3300005617 Ga0068859_100098726 Ga0068859_1000987263 337
663 3300005618 Ga0068864_100008425 Ga0068864_1000084252 337
664 3300005718 Ga0068866_10002650 Ga0068866_100026506 337
665 3300005840 Ga0068870_10071104 Ga0068870_100711042 337
666 3300005841 Ga0068863_100007448 Ga0068863_1000074483 337
667 3300005842 Ga0068858_100006719 Ga0068858_1000067193 337
668 3300005843 Ga0068860_100025587 Ga0068860_1000255873 337
669 3300005843 Ga0068860_100176224 Ga0068860_1001762242 337
670 3300005844 Ga0068862_100019327 Ga0068862_1000193276 337
671 3300005937 Ga0081455_10004546 Ga0081455_100045466 337
672 3300006173 Ga0070716_100005064 Ga0070716_1000050644 337
673 3300006237 Ga0097621_100021212 Ga0097621_1000212124 337
674 3300006844 Ga0075428_100171214 Ga0075428_1001712142 337
675 3300006847 Ga0075431_100001445 Ga0075431_10000144514 337
676 3300006847 Ga0075431_100038265 Ga0075431_1000382654 337
677 3300006847 Ga0075431_100171369 Ga0075431_1001713692 337
678 3300006852 Ga0075433_10234698 Ga0075433_102346981 337
679 3300006871 Ga0075434_100099120 Ga0075434_1000991202 337
680 3300006881 Ga0068865_100028038 Ga0068865_1000280382 337
681 3300006914 Ga0075436_100011810 Ga0075436_1000118105 337
682 3300006931 Ga0097620_100098724 Ga0097620_1000987243 337
683 3300007076 Ga0075435_100014925 Ga0075435_1000149253 337
684 3300009011 Ga0105251_10080294 Ga0105251_100802942 337
685 3300009098 Ga0105245_10316332 Ga0105245_103163321 337
686 3300009101 Ga0105247_10002602 Ga0105247_100026024 337
687 3300009147 Ga0114129_10006974 Ga0114129_100069745 337
688 3300009148 Ga0105243_10029798 Ga0105243_100297984 337
689 3300009148 Ga0105243_10039301 Ga0105243_100393013 337
690 3300009174 Ga0105241_10015032 Ga0105241_100150322 337
691 3300009176 Ga0105242_10046401 Ga0105242_100464012 337
692 3300009176 Ga0105242_10104123 Ga0105242_101041232 337
693 3300009177 Ga0105248_10030508 Ga0105248_100305084 337
694 3300009545 Ga0105237_10025836 Ga0105237_100258364 337
695 3300009551 Ga0105238_10005416 Ga0105238_100054163 337
696 3300009553 Ga0105249_10028244 Ga0105249_100282445 337
697 3300010375 Ga0105239_10037732 Ga0105239_100377322 337
698 3300011119 Ga0105246_10014433 Ga0105246_100144334 337
699 3300013102 Ga0157371_10027003 Ga0157371_100270032 337
700 3300013104 Ga0157370_10063549 Ga0157370_100635493 337
701 3300013105 Ga0157369_10015957 Ga0157369_100159574 337
702 3300013296 Ga0157374_10015991 Ga0157374_100159912 337
703 3300013306 Ga0163162_10074226 Ga0163162_100742262 337
704 3300013307 Ga0157372_10015254 Ga0157372_100152543 337
705 3300013308 Ga0157375_10005311 Ga0157375_100053115 337
706 3300014325 Ga0163163_10367868 Ga0163163_103678681 337
707 3300014326 Ga0157380_10012768 Ga0157380_100127683 337
708 3300014745 Ga0157377_10011186 Ga0157377_100111862 337
709 3300014968 Ga0157379_10032912 Ga0157379_100329122 337
710 3300014968 Ga0157379_10049428 Ga0157379_100494282 337
711 3300014969 Ga0157376_10064826 Ga0157376_100648262 337
712 3300025898 Ga0207692_10009040 Ga0207692_100090404 337
713 3300025899 Ga0207642_10003712 Ga0207642_100037123 337
714 3300025900 Ga0207710_10006511 Ga0207710_100065115 337
715 3300025901 Ga0207688_10005265 Ga0207688_100052651 337
716 3300025904 Ga0207647_10001136 Ga0207647_100011363 337
717 3300025905 Ga0207685_10000555 Ga0207685_100005555 337
718 3300025906 Ga0207699_10005354 Ga0207699_100053543 337
719 3300025906 Ga0207699_10036650 Ga0207699_100366502 337
720 3300025911 Ga0207654_10018973 Ga0207654_100189733 337
721 3300025914 Ga0207671_10019919 Ga0207671_100199192 337
722 3300025915 Ga0207693_10000551 Ga0207693_1000055117 337
723 3300025916 Ga0207663_10006654 Ga0207663_100066542 337
724 3300025917 Ga0207660_10134930 Ga0207660_101349302 337
725 3300025918 Ga0207662_10015005 Ga0207662_100150052 337
726 3300025919 Ga0207657_10004689 Ga0207657_100046898 337
727 3300025920 Ga0207649_10013621 Ga0207649_100136213 337
728 3300025921 Ga0207652_10178679 Ga0207652_101786792 337
729 3300025923 Ga0207681_10004932 Ga0207681_100049326 337
730 3300025924 Ga0207694_10094331 Ga0207694_100943312 337
731 3300025925 Ga0207650_10043322 Ga0207650_100433223 337
732 3300025927 Ga0207687_10086612 Ga0207687_100866122 337
733 3300025928 Ga0207700_10372463 Ga0207700_103724631 337
734 3300025929 Ga0207664_10010884 Ga0207664_100108845 337
735 3300025931 Ga0207644_10038574 Ga0207644_100385743 337
736 3300025932 Ga0207690_10008586 Ga0207690_100085865 337
737 3300025933 Ga0207706_10001303 Ga0207706_1000130319 337
738 3300025934 Ga0207686_10014721 Ga0207686_100147214 337
739 3300025935 Ga0207709_10117281 Ga0207709_101172812 337
740 3300025936 Ga0207670_10090640 Ga0207670_100906402 337
741 3300025937 Ga0207669_10018870 Ga0207669_100188702 337
742 3300025938 Ga0207704_10229135 Ga0207704_102291351 337
743 3300025939 Ga0207665_10000478 Ga0207665_1000047813 337
744 3300025940 Ga0207691_10084630 Ga0207691_100846302 337
745 3300025941 Ga0207711_10019400 Ga0207711_100194003 337
746 3300025942 Ga0207689_10027495 Ga0207689_100274951 337
747 3300025944 Ga0207661_10059640 Ga0207661_100596402 337
748 3300025945 Ga0207679_10164657 Ga0207679_101646572 337
749 3300025949 Ga0207667_10090442 Ga0207667_100904422 337
750 3300025960 Ga0207651_10011597 Ga0207651_100115974 337
751 3300025961 Ga0207712_10035739 Ga0207712_100357391 337
752 3300025972 Ga0207668_10100447 Ga0207668_101004472 337
753 3300025981 Ga0207640_10043337 Ga0207640_100433372 337
754 3300025986 Ga0207658_10040219 Ga0207658_100402193 337
755 3300026023 Ga0207677_10028300 Ga0207677_100283002 337
756 3300026035 Ga0207703_10012880 Ga0207703_100128802 337
757 3300026041 Ga0207639_10050996 Ga0207639_100509962 337
758 3300026067 Ga0207678_10001177 Ga0207678_100011779 337
759 3300026075 Ga0207708_10001719 Ga0207708_1000171914 337
760 3300026078 Ga0207702_10024534 Ga0207702_100245343 337
761 3300026088 Ga0207641_10009946 Ga0207641_100099462 337
762 3300026089 Ga0207648_10023059 Ga0207648_100230593 337
763 3300026089 Ga0207648_10393935 Ga0207648_103939352 337
764 3300026095 Ga0207676_10051930 Ga0207676_100519302 337
765 3300026116 Ga0207674_10017275 Ga0207674_100172753 337
766 3300026118 Ga0207675_100096520 Ga0207675_1000965202 337
767 3300026118 Ga0207675_100284008 Ga0207675_1002840082 337
768 3300026121 Ga0207683_10002755 Ga0207683_100027553 337
769 3300027907 Ga0207428_10032560 Ga0207428_100325602 337
770 3300028380 Ga0268265_10059098 Ga0268265_100590982 337
771 3300028381 Ga0268264_10046645 Ga0268264_100466453 337
772 3300028381 Ga0268264_10064602 Ga0268264_100646023 337
773 3300034816 Ga0373930_0003763 Ga0373930_0003763_1021_2034 337
774 3300034817 Ga0373948_0008856 Ga0373948_0008856_682_1695 337
775 3300035083 Ga0373926_0049717 Ga0373926_0049717_404_1432 337
776 3300035112 Ga0373932_0020569 Ga0373932_0020569_417_1442 337
777 3300035170 Ga0373943_0061736 Ga0373943_0061736_679_1707 337
778 3300035242 Ga0373962_0004361 Ga0373962_0004361_1035_2048 337
779 3300035692 Ga0373935_0016743 Ga0373935_0016743_2034_3062 337
780 3300035695 Ga0373927_0051251 Ga0373927_0051251_1552_2580 337
781 3300035725 Ga0373947_0008051 Ga0373947_0008051_633_1661 337
782 3300036401 Ga0373937_0072265 Ga0373937_0072265_2047_3075 337
783 3300037418 Ga0395900_0105037 Ga0395900_0105037_71_1084 337
784 3300037466 Ga0395898_0011073 Ga0395898_0011073_6725_7738 337
785 3300037471 Ga0395905_0003153 Ga0395905_0003153_6434_7447 337
786 3300038443 Ga0395901_0538400 Ga0395901_0538400_46_1059 337
787 3300046455 Ga0495603_0000740 Ga0495603_0000740_3213_4241 337
788 3300046459 Ga0495629_0000841 Ga0495629_0000841_19376_20404 337
789 3300046461 Ga0495641_0029644 Ga0495641_0029644_1425_2453 337
790 3300046472 Ga0495580_0004062 Ga0495580_0004062_8009_9037 337
791 3300046473 Ga0495582_0000461 Ga0495582_0000461_8005_9033 337
792 3300046475 Ga0495639_0003136 Ga0495639_0003136_3140_4168 337
793 3300046492 Ga0495585_0074985 Ga0495585_0074985_58_1083 337
794 3300046499 Ga0495594_0004429 Ga0495594_0004429_3294_4322 337
795 3300046642 Ga0495634_0042228 Ga0495634_0042228_1927_2955 337
796 3300046663 Ga0495635_0113819 Ga0495635_0113819_522_1550 337
797 3300046674 Ga0495588_0001977 Ga0495588_0001977_2873_3901 337
798 3300046681 Ga0495647_0002052 Ga0495647_0002052_1734_2762 337
799 3300046689 Ga0495613_0000595 Ga0495613_0000595_3738_4766 337
800 3300046690 Ga0495624_0190902 Ga0495624_0190902_196_1224 337
801 3300047315 Ga0495581_0022400 Ga0495581_0022400_2582_3610 337
802 3300047321 Ga0495676_0023326 Ga0495676_0023326_3159_4187 337
803 3300047673 Ga0495593_0006408 Ga0495593_0006408_3995_5023 337
804 3300048089 Ga0495614_0003145 Ga0495614_0003145_3686_4714 337
805 3300048903 Ga0496100_0103989 Ga0496100_0103989_354_1367 337
806 3300048904 Ga0496101_0092769 Ga0496101_0092769_1050_2063 337
807 3300048905 Ga0496102_0042393 Ga0496102_0042393_2576_3589 337
808 3300048905 Ga0496102_0120332 Ga0496102_0120332_777_1790 337
809 3300048906 Ga0496103_0015637 Ga0496103_0015637_22_1035 337
810 3300048907 Ga0496104_0015695 Ga0496104_0015695_3263_4276 337
811 3300048907 Ga0496104_0028197 Ga0496104_0028197_952_1965 337
812 3300048908 Ga0496105_0097483 Ga0496105_0097483_1394_2407 337
813 3300048910 Ga0496107_0024245 Ga0496107_0024245_2229_3242 337
814 3300048910 Ga0496107_0197639 Ga0496107_0197639_205_1230 337
815 3300048912 Ga0496109_0186002 Ga0496109_0186002_22_1035 337
816 3300048914 Ga0496111_0104412 Ga0496111_0104412_1050_2063 337
817 3300048916 Ga0496113_0007347 Ga0496113_0007347_5015_6028 337
818 3300048917 Ga0496114_0022902 Ga0496114_0022902_1529_2542 337
819 3300049568 Ga0501031_0014187 Ga0501031_0014187_3773_4786 337
820 3300049568 Ga0501031_0022978 Ga0501031_0022978_329_1342 337
821 3300049569 Ga0501032_0048925 Ga0501032_0048925_1610_2623 337
822 3300049571 Ga0501034_0012058 Ga0501034_0012058_3646_4680 337
823 3300049571 Ga0501034_0076067 Ga0501034_0076067_630_1664 337
824 3300049572 Ga0501036_0023907 Ga0501036_0023907_55_1068 337
825 3300049572 Ga0501036_0160805 Ga0501036_0160805_815_1828 337
826 3300049574 Ga0501038_0044867 Ga0501038_0044867_2333_3358 337
827 3300049574 Ga0501038_0046663 Ga0501038_0046663_51_1064 337
828 3300049575 Ga0501039_0003920 Ga0501039_0003920_5903_6916 337
829 3300049575 Ga0501039_0018420 Ga0501039_0018420_2555_3568 337
830 3300049576 Ga0501040_0024229 Ga0501040_0024229_276_1289 337
831 3300049576 Ga0501040_0130545 Ga0501040_0130545_214_1239 337
832 3300049576 Ga0501040_0171802 Ga0501040_0171802_491_1504 337
833 3300049577 Ga0501041_0069220 Ga0501041_0069220_215_1228 337
834 3300049578 Ga0501042_0004481 Ga0501042_0004481_2843_3856 337
835 3300049578 Ga0501042_0022673 Ga0501042_0022673_733_1746 337
836 3300049578 Ga0501042_0134833 Ga0501042_0134833_197_1210 337
837 3300049578 Ga0501042_0345287 Ga0501042_0345287_45_1058 337
838 3300049579 Ga0501043_0221007 Ga0501043_0221007_39_1064 337
839 3300049580 Ga0501046_0015793 Ga0501046_0015793_2752_3765 337
840 3300049580 Ga0501046_0038960 Ga0501046_0038960_551_1576 337
841 3300049584 Ga0501068_0046151 Ga0501068_0046151_640_1653 337
842 3300049587 Ga0501071_0023237 Ga0501071_0023237_2793_3806 337
843 3300049587 Ga0501071_0029103 Ga0501071_0029103_1858_2871 337
844 3300049588 Ga0501072_0006088 Ga0501072_0006088_6407_7441 337
845 3300049588 Ga0501072_0053262 Ga0501072_0053262_1230_2243 337
846 3300049588 Ga0501072_0054012 Ga0501072_0054012_1725_2738 337
847 3300049589 Ga0501073_0140292 Ga0501073_0140292_227_1240 337
848 3300049590 Ga0501074_0014204 Ga0501074_0014204_2862_3875 337
849 3300049590 Ga0501074_0038403 Ga0501074_0038403_405_1418 337
850 3300049590 Ga0501074_0060746 Ga0501074_0060746_684_1697 337
851 3300049591 Ga0501075_0023280 Ga0501075_0023280_1392_2405 337
852 3300049591 Ga0501075_0036618 Ga0501075_0036618_2418_3431 337
853 3300049591 Ga0501075_0044409 Ga0501075_0044409_1657_2670 337
854 3300049591 Ga0501075_0187604 Ga0501075_0187604_157_1170 337
855 3300049592 Ga0501076_0002471 Ga0501076_0002471_6898_7911 337
856 3300049592 Ga0501076_0043386 Ga0501076_0043386_1924_2937 337
857 3300049592 Ga0501076_0082967 Ga0501076_0082967_1513_2526 337
858 3300049593 Ga0501077_0008785 Ga0501077_0008785_1682_2695 337
859 3300049593 Ga0501077_0022687 Ga0501077_0022687_2890_3903 337
860 3300049593 Ga0501077_0044815 Ga0501077_0044815_455_1480 337
861 3300049593 Ga0501077_0074918 Ga0501077_0074918_854_1867 337
862 3300049741 Ga0501079_0019944 Ga0501079_0019944_3010_4023 337
863 3300049741 Ga0501079_0026235 Ga0501079_0026235_1672_2685 337
864 3300049742 Ga0501080_0139956 Ga0501080_0139956_629_1642 337
865 3300049743 Ga0501081_0037782 Ga0501081_0037782_257_1270 337
866 3300049743 Ga0501081_0154454 Ga0501081_0154454_442_1455 337
867 3300049743 Ga0501081_0219610 Ga0501081_0219610_255_1268 337
868 3300049744 Ga0501083_0114300 Ga0501083_0114300_264_1277 337
869 3300049822 Ga0501035_0157576 Ga0501035_0157576_106_1176 337
870 3300049822 Ga0501035_0178307 Ga0501035_0178307_26_1051 337
871 3300049824 Ga0501045_0017016 Ga0501045_0017016_415_1428 337
872 3300049824 Ga0501045_0031367 Ga0501045_0031367_1716_2729 337
873 3300049824 Ga0501045_0139227 Ga0501045_0139227_436_1509 337
874 3300049824 Ga0501045_0169094 Ga0501045_0169094_509_1522 337
875 3300050507 nmdc:mga05p37_11818_c1 nmdc:mga05p37_11818_c1_2745_3761 337
876 3300050507 nmdc:mga05p37_63064_c1 nmdc:mga05p37_63064_c1_1155_2168 337
877 3300050508 nmdc:mga09592_16186_c1 nmdc:mga09592_16186_c1_3866_4879 337
878 3300050510 nmdc:mga06r32_21646_c1 nmdc:mga06r32_21646_c1_4411_5427 337
879 3300050510 nmdc:mga06r32_22935_c1 nmdc:mga06r32_22935_c1_2196_3209 337
880 3300050510 nmdc:mga06r32_268650_c1 nmdc:mga06r32_268650_c1_84_1097 337
881 3300050511 nmdc:mga08y16_184327_c1 nmdc:mga08y16_184327_c1_492_1505 337
882 3300050512 nmdc:mga0n895_220711_c1 nmdc:mga0n895_220711_c1_701_1714 337
883 3300050514 nmdc:mga08x19_82159_c1 nmdc:mga08x19_82159_c1_387_1400 337
884 3300050515 nmdc:mga0a205_24382_c1 nmdc:mga0a205_24382_c1_2370_3383 337
885 3300053077 Ga0495601_0015971 Ga0495601_0015971_2039_3052 337
886 3300053084 Ga0495595_0016186 Ga0495595_0016186_703_1716 337
887 3300053084 Ga0495595_0074900 Ga0495595_0074900_93_1121 337
888 3300053085 Ga0495619_0011845 Ga0495619_0011845_2402_3415 337
889 3300053085 Ga0495619_0017554 Ga0495619_0017554_1445_2473 337
890 3300054114 Ga0501084_0004163 Ga0501084_0004163_8900_9913 337
891 3300054114 Ga0501084_0116761 Ga0501084_0116761_69_1082 337
892 3300054114 Ga0501084_0391958 Ga0501084_0391958_75_1088 337
893 3300060353 Ga0501082_0007075 Ga0501082_0007075_5646_6659 337
894 3300060353 Ga0501082_0030168 Ga0501082_0030168_3428_4441 337
895 3300060353 Ga0501082_0107325 Ga0501082_0107325_921_1934 337
896 3300061734 Ga0530510_0018441 Ga0530510_0018441_3889_4902 337
897 3300061734 Ga0530510_0058582 Ga0530510_0058582_936_2009 337
898 3300061734 Ga0530510_0068599 Ga0530510_0068599_648_1661 337
899 3300061734 Ga0530510_0071714 Ga0530510_0071714_1453_2466 337
900 3300061734 Ga0530510_0085966 Ga0530510_0085966_827_1840 337
901 3300061734 Ga0530510_0119915 Ga0530510_0119915_457_1470 337

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

160

0.94

PF08402

TOBE_2

TOBE domain

253

326

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9473 4 234
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9437 5 218
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9411 2 218
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9396 2 217
8bmp-assembly1.cif.gz_A cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp 0.9385 2 224
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9942 1 218 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9896 1 218 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9785 5 217 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9725 5 236 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9619 5 234 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.9716 5 222 GO:0005524
GO:0016887
GO:0055052
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9692 1 187 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A7X9BG07-F1-model_v4 ABC transporter ATP-binding protein 0.9591 1 187 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9572 76 216 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A832FKS4-F1-model_v4 ABC transporter ATP-binding protein 0.9571 3 199 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
92.31 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map