F485158

General Info

Members Datasets Scaffolds Average Seq Length
900 705 1800 269

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221653|2644297905
Length 271
Sequence GGRFGLVNSLRIAVMAVVLFLVSIVLIPLQLLALRFDWRLRRRLPRTWHRIALYCLGIRVHAHGALDPRRPLMIAANHASWKDIVVLGSLADVVFIAKTEVSSWPVFGTLARLQKTIFVVREEKRRTGDQVNEIAGRMADGEVVVLFPEGTTSDGNRVLSVKSSLFGAAAAALPKDAEDAVVHVQPVAIAYTRVQGMPMGRYYRPIAGWPGDIGLVPHLLGVLRAGALDVDVTFGETADFRPGDNRKSLAEKVESRLRGMLLAHLRGRHRP

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
36 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
40 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
47 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
48 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
49 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
50 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
51 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
52 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
53 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
54 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
55 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
56 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
61 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
72 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
76 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
80 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
81 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
82 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
83 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
84 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
85 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
86 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
87 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
88 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
89 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
90 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
91 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
92 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
93 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
94 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
95 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
96 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
97 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
98 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
99 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
100 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
106 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
107 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
108 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
109 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
110 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
115 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
116 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
117 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
118 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
119 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
124 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
125 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
129 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
138 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
139 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
146 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
166 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
167 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
176 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
177 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
178 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
179 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
180 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
181 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
182 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
183 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
196 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
197 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
198 2509276019 Ensifer aridi TW10 Isolate Nodule
199 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
200 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
201 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
202 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
203 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
204 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
205 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
206 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
207 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
208 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
209 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
210 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
211 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
212 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
213 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
214 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
215 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
216 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
217 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
218 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
219 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
220 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
221 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
222 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
223 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
224 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
225 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
226 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
227 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
228 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
229 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
230 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
231 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
232 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
233 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
234 2516143018 Ensifer sp. BR816 Isolate Nodule
235 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
236 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
237 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
238 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
239 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
240 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
241 2519899620 Rhizobium sp. Pop5 Isolate Nodule
242 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
243 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
244 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
245 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
246 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
247 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
248 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
249 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
250 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
251 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
252 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
253 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
254 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
255 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
256 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
257 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
258 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
259 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
260 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
261 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
262 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
263 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
264 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
265 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
266 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
267 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
268 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
269 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
270 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
271 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
272 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
273 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
274 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
275 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
276 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
277 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
278 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
279 2643221557 Ensifer sp. Root558 Isolate Unclassified
280 2643221558 Rhizobium sp. Root149 Isolate Unclassified
281 2643221568 Rhizobium sp. Root564 Isolate Unclassified
282 2643221599 Rhizobium sp. Root708 Isolate Unclassified
283 2643221607 Rhizobium sp. Root73 Isolate Unclassified
284 2643221610 Ensifer sp. Root74 Isolate Unclassified
285 2643221618 Ensifer sp. Root231 Isolate Unclassified
286 2643221626 Ensifer sp. Root31 Isolate Unclassified
287 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
288 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
289 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
290 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
291 2643221655 Ensifer sp. Root1252 Isolate Unclassified
292 2643221659 Ensifer sp. Root127 Isolate Unclassified
293 2643221668 Ensifer sp. Root423 Isolate Unclassified
294 2643221675 Ensifer sp. Root1298 Isolate Unclassified
295 2643221680 Ensifer sp. Root1312 Isolate Unclassified
296 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
297 2643221688 Rhizobium sp. Root482 Isolate Unclassified
298 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
299 2643221698 Ensifer sp. Root142 Isolate Unclassified
300 2643221712 Ensifer sp. Root258 Isolate Unclassified
301 2643221718 Rhizobium sp. Root268 Isolate Unclassified
302 2643221719 Rhizobium sp. Root274 Isolate Unclassified
303 2643221723 Ensifer sp. Root278 Isolate Unclassified
304 2643221726 Ensifer sp. Root954 Isolate Unclassified
305 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
306 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
307 2718217882 Rhizobium sp. N741 Isolate Nodule
308 2718217927 Rhizobium sp. N324 Isolate Nodule
309 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
310 2718218009 Rhizobium sp. N561 Isolate Nodule
311 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
312 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
313 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
314 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
315 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
316 2718218363 Rhizobium sp. N113 Isolate Nodule
317 2718218365 Rhizobium sp. N731 Isolate Nodule
318 2718218366 Rhizobium sp. N621 Isolate Nodule
319 2718218423 Rhizobium sp. N941 Isolate Nodule
320 2721755514 Rhizobium sp. N6212 Isolate Nodule
321 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
322 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
323 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
324 2721755809 Rhizobium sp. N541 Isolate Nodule
325 2721755810 Rhizobium sp. N871 Isolate Nodule
326 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
327 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
328 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
329 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
330 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
331 2728369365 Rhizobium sp. N1341 Isolate Nodule
332 2728369397 Rhizobium sp. N1314 Isolate Nodule
333 2738541293 Rhizobium sp. GV031 Isolate Unclassified
334 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
335 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
336 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
337 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
338 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
339 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
340 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
341 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
342 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
343 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
344 2791355256 Rhizobium sp. M10 Isolate Nodule
345 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
346 2791355260 Rhizobium sp. L9 Isolate Nodule
347 2791355261 Rhizobium sp. J15 Isolate Nodule
348 2791355262 Rhizobium sp. M1 Isolate Nodule
349 2791355263 Rhizobium chutanense C5 Isolate Nodule
350 2791355264 Rhizobium sp. S9 Isolate Nodule
351 2791355265 Rhizobium sp. H4 Isolate Nodule
352 2791355266 Rhizobium sp. L43 Isolate Nodule
353 2791355267 Rhizobium sp. L18 Isolate Nodule
354 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
355 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
356 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
357 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
358 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
359 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
360 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
361 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
362 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
363 2802429633 Rhizobium anhuiense J3 Isolate Nodule
364 2802429634 Rhizobium anhuiense S10 Isolate Nodule
365 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
366 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
367 2802429637 Rhizobium anhuiense C15 Isolate Nodule
368 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
369 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
370 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
371 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
372 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
373 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
374 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
375 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
376 2838048938 Rhizobium pisi 27/80 Isolate Nodule
377 2838061910 Rhizobium phaseoli L15 Isolate Nodule
378 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
379 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
380 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
381 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
382 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
383 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
384 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
385 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
386 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
387 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
388 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
389 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
390 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
391 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
392 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
393 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
394 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
395 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
396 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
397 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
398 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
399 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
400 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
401 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
402 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
403 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
404 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
405 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
406 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
407 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
408 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
409 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
410 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
411 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
412 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
413 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
414 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
415 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
416 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
417 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
418 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
419 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
420 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
421 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
422 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
423 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
424 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
425 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
426 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
427 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
428 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
429 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
430 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
431 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
432 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
433 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
434 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
435 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
436 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
437 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
438 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
439 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
440 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
441 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
442 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
443 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
444 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
445 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
446 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
447 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
448 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
449 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
450 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
451 2844163670 Ensifer sp. 1H6 Isolate Unclassified
452 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
453 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
454 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
455 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
456 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
457 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
458 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
459 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
460 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
461 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
462 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
463 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
464 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
465 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
466 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
467 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
468 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
469 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
470 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
471 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
472 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
473 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
474 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
475 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
476 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
477 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
478 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
479 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
480 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
481 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
482 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
483 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
484 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
485 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
486 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
487 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
488 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
489 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
490 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
491 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
492 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
493 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
494 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
495 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
496 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
497 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
498 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
499 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
500 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
501 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
502 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
503 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
504 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
505 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
506 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
507 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
508 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
509 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
510 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
511 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
512 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
513 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
514 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
515 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
516 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
517 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
518 2933599457 Rhizobium phaseoli M3 Isolate Nodule
519 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
520 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
521 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
522 2936381700 Rhizobium chutanense C16 Isolate Unclassified
523 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
524 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
525 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
526 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
527 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
528 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
529 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
530 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
531 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
532 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
533 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
534 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
535 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
536 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
537 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
538 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
539 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
540 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
541 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
542 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
543 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
544 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
545 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
546 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
547 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
548 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
549 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
550 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
551 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
552 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
553 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
554 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
555 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
556 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
557 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
558 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
559 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
560 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
561 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
562 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
563 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
564 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
565 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
566 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
567 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
568 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
569 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
570 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
571 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
572 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
573 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
574 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
575 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
576 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
577 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
578 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
579 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
580 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
581 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
582 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
583 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
584 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
585 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
586 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
587 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
588 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
589 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
590 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
591 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
592 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
593 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
594 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
595 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
596 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
597 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
598 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
599 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
600 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
601 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
602 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
603 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
604 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
605 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
606 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
607 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
608 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
609 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
610 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
611 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
612 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
613 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
614 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
615 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
616 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
617 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
618 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
619 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
620 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
621 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
622 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
623 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
624 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
625 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
626 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
627 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
628 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
629 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
630 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
631 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
632 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
633 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
634 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
635 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
636 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
637 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
638 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
639 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
640 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
641 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
642 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
643 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
644 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
645 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
646 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
647 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
648 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
649 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
650 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
651 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
652 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
653 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
654 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
655 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
656 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
657 2996887358 Rhizobium sp. R711 Isolate Nodule
658 2996893221 Rhizobium sp. R635 Isolate Nodule
659 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
660 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
661 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
662 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
663 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
664 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
665 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
666 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
667 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
668 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
669 8005258706 Rhizobium sp. R693 Isolate Nodule
670 8005275841 Rhizobium sp. N4311 Isolate Nodule
671 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
672 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
673 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
674 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
675 8005321885 Rhizobium sp. R72 Isolate Nodule
676 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
677 8005382845 Rhizobium sp. R634 Isolate Nodule
678 8005395548 Rhizobium sp. R339 Isolate Nodule
679 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
680 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
681 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
682 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
683 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
684 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
685 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
686 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
687 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
688 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
689 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
690 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
691 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
692 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
693 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
694 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
695 8018176218 Rhizobium sp. N122 Isolate Nodule
696 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
697 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
698 8024501048 Rhizobium sp. H4 Isolate Nodule
699 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
700 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
701 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
702 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
703 8056382006 Rhizobium croatiense 13T Isolate Nodule
704 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
705 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.33
Metatranscriptomes 0
Isolates 56.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.11
Bulb 0
Endosphere 19
Nodule 46.11
Rhizoplane 1.22
Rhizosphere 17.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000443 3300002773 Bacteria 24608
2 JGI25152J39213_1001837 3300002773 Bacteria 8570
3 JGI25152J39213_1009461 3300002773 Bacteria 2314
4 JGI25150J39212_1000178 3300002774 Bacteria 35657
5 JGI25150J39212_1006689 3300002774 Bacteria 2360
6 JGI25159J45721_1000003 3300002987 Bacteria 274069
7 JGI25151J46595_10000529 3300003187 Bacteria 35657
8 JGI25151J46595_10001346 3300003187 Bacteria 17063
9 JGI25151J46595_10010196 3300003187 Bacteria 4384
10 JGI25151J46595_10016005 3300003187 Bacteria 3290
11 JGI25153J46596_10000720 3300003215 Bacteria 20263
12 JGI25153J46596_10001665 3300003215 Bacteria 13177
13 JGI25153J46596_10009987 3300003215 Bacteria 4337
14 JGI25153J46596_10010899 3300003215 Bacteria 4064
15 JGI25153J46596_10027253 3300003215 Bacteria 2006
16 JGI25153J46596_10038283 3300003215 Bacteria 1514
17 rootH1_10092577 3300003316 Bacteria 1106
18 rootL2_10217477 3300003322 Bacteria 1177
19 JGI25160J50197_1000003 3300003354 Bacteria 482719
20 JGI25161J50226_1000168 3300003374 Bacteria 45114
21 JGI25161J50226_1001586 3300003374 Bacteria 6644
22 Ga0055526_1001274 3300003771 Bacteria 18065
23 Ga0055526_1002520 3300003771 Bacteria 12314
24 Ga0055526_1004138 3300003771 Bacteria 8847
25 Ga0055526_1010240 3300003771 Bacteria 4385
26 Ga0055526_1010301 3300003771 Bacteria 4369
27 Ga0055524_1001329 3300003775 Bacteria 14416
28 Ga0055524_1001591 3300003775 Bacteria 12733
29 Ga0055524_1004482 3300003775 Bacteria 6438
30 Ga0055524_1008196 3300003775 Bacteria 4360
31 Ga0055524_1011555 3300003775 Bacteria 3448
32 Ga0055524_1019816 3300003775 Bacteria 2287
33 Ga0055536_1005792 3300003781 Bacteria 5952
34 Ga0055528_1000285 3300003790 Bacteria 43196
35 Ga0055528_1002290 3300003790 Bacteria 10372
36 Ga0055528_1008623 3300003790 Bacteria 4339
37 Ga0055528_1025807 3300003790 Bacteria 1711
38 Ga0055530_10007683 3300003791 Bacteria 4488
39 Ga0055540_1000356 3300003792 Bacteria 38898
40 Ga0055540_1002718 3300003792 Bacteria 9110
41 Ga0055540_1011721 3300003792 Bacteria 2804
42 Ga0055540_1016836 3300003792 Bacteria 2061
43 Ga0055540_1026189 3300003792 Bacteria 1414
44 Ga0055531_10003221 3300003794 Bacteria 10466
45 Ga0058692_1002338 3300003856 Bacteria 6402
46 Ga0055543_1000043 3300004625 Bacteria 116599
47 Ga0055543_1000073 3300004625 Bacteria 88583
48 Ga0055543_1008325 3300004625 Bacteria 2304
49 Ga0065165_1000025 3300005262 Bacteria 246909
50 Ga0065165_1002996 3300005262 Bacteria 12800
51 Ga0065165_1004647 3300005262 Bacteria 8320
52 Ga0065165_1009344 3300005262 Bacteria 4409
53 Ga0070670_100000416 3300005331 Bacteria 35091
54 Ga0070668_100047879 3300005347 Bacteria 3287
55 Ga0070669_100015810 3300005353 Bacteria 5380
56 Ga0070671_100010088 3300005355 Bacteria 7586
57 Ga0070667_100045936 3300005367 Bacteria 3674
58 Ga0070663_100109841 3300005455 Bacteria 2071
59 Ga0070665_100251782 3300005548 Bacteria 1767
60 Ga0075365_10001020 3300006038 Bacteria 12027
61 Ga0075365_10014795 3300006038 Bacteria 4702
62 Ga0075365_10112234 3300006038 Bacteria 1874
63 Ga0075363_100163076 3300006048 Bacteria 1263
64 Ga0075364_10008609 3300006051 Bacteria 6101
65 Ga0075362_10084232 3300006177 Bacteria 1469
66 Ga0075367_10032880 3300006178 Bacteria 2987
67 Ga0075367_10106473 3300006178 Bacteria 1718
68 Ga0075367_10147579 3300006178 Bacteria 1459
69 Ga0075369_10002436 3300006186 Bacteria 6631
70 Ga0075369_10029353 3300006186 Bacteria 2309
71 Ga0075369_10036642 3300006186 Bacteria 2088
72 Ga0075366_10001595 3300006195 Bacteria 11349
73 Ga0075366_10174467 3300006195 Bacteria 1305
74 Ga0075370_10004588 3300006353 Bacteria 6735
75 Ga0079104_1000033 3300006946 Bacteria 202636
76 Ga0099826_10107316 3300006948 Bacteria 1671
77 Ga0105251_10006336 3300009011 Bacteria 7564
78 Ga0105248_10014648 3300009177 Bacteria 8629
79 Ga0123341_1000036 3300009765 Bacteria 61619
80 Ga0123342_1042137 3300009766 Bacteria 1622
81 Ga0105246_10314232 3300011119 Bacteria 1270
82 Ga0157373_10107718 3300013100 Bacteria 1959
83 Ga0157373_10145086 3300013100 Bacteria 1669
84 Ga0157371_10014181 3300013102 Bacteria 6025
85 Ga0157370_10004075 3300013104 Bacteria 16934
86 Ga0157369_10088220 3300013105 Bacteria 3311
87 Ga0171463_1001 3300013249 Bacteria 1406070
88 Ga0182008_10058519 3300014497 Bacteria 1902
89 Ga0183363_1103 3300015690 Bacteria 24173
90 Ga0214544_1000105 3300021320 Bacteria 114109
91 Ga0214542_1000029 3300021321 Bacteria 174097
92 Ga0214542_1015933 3300021321 Bacteria 7555
93 Ga0214543_1000027 3300021327 Bacteria 215065
94 Ga0214543_1000040 3300021327 Bacteria 174142
95 Ga0228711_1000013 3300022739 Bacteria 132585
96 Ga0228710_1000008 3300022740 Bacteria 174306
97 Ga0209436_100048 3300025208 Bacteria 66177
98 Ga0209436_101786 3300025208 Bacteria 7027
99 Ga0207425_1000305 3300025245 Bacteria 35759
100 Ga0207425_1001993 3300025245 Bacteria 7632
101 Ga0207425_1002482 3300025245 Bacteria 6480
102 Ga0209129_1000192 3300025258 Bacteria 83041
103 Ga0209129_1000381 3300025258 Bacteria 35759
104 Ga0209129_1000500 3300025258 Bacteria 28495
105 Ga0209129_1000789 3300025258 Bacteria 19973
106 Ga0209129_1004128 3300025258 Bacteria 5889
107 Ga0209673_1000024 3300025273 Bacteria 409632
108 Ga0209673_1000135 3300025273 Bacteria 160333
109 Ga0209673_1000677 3300025273 Bacteria 49184
110 Ga0209673_1001830 3300025273 Bacteria 17406
111 Ga0209673_1002029 3300025273 Bacteria 15412
112 Ga0209673_1005790 3300025273 Bacteria 6142
113 Ga0209673_1012911 3300025273 Bacteria 3331
114 Ga0209130_1000002 3300025284 Bacteria 722648
115 Ga0209130_1000005 3300025284 Bacteria 599620
116 Ga0209130_1019272 3300025284 Bacteria 1585
117 Ga0209130_1026757 3300025284 Bacteria 1233
118 Ga0209676_1006567 3300025292 Bacteria 5702
119 Ga0209676_1007831 3300025292 Bacteria 4915
120 Ga0209025_1000037 3300025294 Bacteria 383429
121 Ga0209025_1000105 3300025294 Bacteria 224157
122 Ga0209025_1000235 3300025294 Bacteria 129981
123 Ga0209025_1000748 3300025294 Bacteria 54646
124 Ga0209025_1001229 3300025294 Bacteria 35759
125 Ga0209025_1003357 3300025294 Bacteria 15337
126 Ga0209025_1007673 3300025294 Bacteria 7971
127 Ga0209025_1011777 3300025294 Bacteria 5703
128 Ga0209025_1059698 3300025294 Bacteria 1437
129 Ga0209564_1000138 3300025295 Bacteria 181512
130 Ga0209564_1000217 3300025295 Bacteria 131090
131 Ga0209564_1000746 3300025295 Bacteria 46142
132 Ga0209564_1001016 3300025295 Bacteria 34616
133 Ga0209564_1003467 3300025295 Bacteria 10754
134 Ga0209564_1009669 3300025295 Bacteria 4552
135 Ga0209758_1000170 3300025297 Bacteria 149476
136 Ga0209758_1001066 3300025297 Bacteria 35697
137 Ga0209758_1001253 3300025297 Bacteria 31421
138 Ga0209758_1001373 3300025297 Bacteria 29051
139 Ga0209758_1001628 3300025297 Bacteria 25562
140 Ga0209758_1003903 3300025297 Bacteria 13020
141 Ga0209758_1004403 3300025297 Bacteria 11752
142 Ga0209758_1007856 3300025297 Bacteria 7104
143 Ga0209758_1030176 3300025297 Bacteria 2251
144 Ga0209758_1051303 3300025297 Bacteria 1437
145 Ga0209758_1059782 3300025297 Bacteria 1266
146 Ga0209050_1004607 3300025298 Bacteria 9215
147 Ga0209256_1000027 3300025299 Bacteria 423283
148 Ga0209256_1001094 3300025299 Bacteria 31181
149 Ga0209256_1001547 3300025299 Bacteria 22929
150 Ga0209256_1001774 3300025299 Bacteria 20482
151 Ga0209256_1004946 3300025299 Bacteria 7985
152 Ga0209256_1006230 3300025299 Bacteria 6425
153 Ga0209256_1009888 3300025299 Bacteria 4098
154 Ga0209256_1016605 3300025299 Bacteria 2497
155 Ga0207426_1000013 3300025302 Bacteria 721897
156 Ga0207426_1000015 3300025302 Bacteria 599316
157 Ga0207426_1000070 3300025302 Bacteria 331559
158 Ga0207426_1001155 3300025302 Bacteria 23701
159 Ga0209051_1000197 3300025303 Bacteria 106822
160 Ga0209051_1001552 3300025303 Bacteria 19016
161 Ga0209051_1008327 3300025303 Bacteria 5501
162 Ga0209051_1050312 3300025303 Bacteria 1396
163 Ga0209051_1051126 3300025303 Bacteria 1377
164 Ga0209257_1001770 3300025304 Bacteria 23909
165 Ga0209257_1002467 3300025304 Bacteria 18307
166 Ga0209257_1005021 3300025304 Bacteria 9636
167 Ga0209257_1008444 3300025304 Bacteria 5853
168 Ga0207650_10001503 3300025925 Bacteria 16688
169 Ga0207668_10351289 3300025972 Bacteria 1233
170 Ga0207658_10069506 3300025986 Bacteria 2661
171 Ga0209281_1000043 3300027111 Bacteria 341543
172 Ga0209281_1000134 3300027111 Bacteria 185406
173 Ga0209281_1000319 3300027111 Bacteria 84764
174 Ga0209282_1000029 3300027666 Bacteria 157883
175 Ga0268266_10044913 3300028379 Bacteria 3778
176 Ga0268265_10476831 3300028380 Bacteria 1171
177 Ga0307515_10000029 3300028794 Bacteria 365410
178 Ga0307515_10026735 3300028794 Bacteria 9911
179 Ga0307515_10035723 3300028794 Bacteria 8070
180 Ga0307515_10335301 3300028794 Bacteria 1168
181 Ga0307513_10000338 3300031456 Bacteria 67781
182 Ga0307408_100056854 3300031548 Bacteria 2838
183 Ga0307408_100320317 3300031548 Bacteria 1306
184 Ga0307405_10028251 3300031731 Bacteria 3265
185 Ga0307412_10030503 3300031911 Bacteria 3395
186 Ga0307412_10032470 3300031911 Bacteria 3309
187 Ga0315914_1000021 3300031967 Bacteria 119592
188 Ga0307416_100560913 3300032002 Bacteria 1217
189 Ga0307414_10100829 3300032004 Bacteria 2172
190 Ga0307414_10139106 3300032004 Bacteria 1898
191 Ga0307414_10256879 3300032004 Bacteria 1456
192 Ga0307411_10089418 3300032005 Bacteria 2145
193 Ga0315913_1000014 3300033430 Bacteria 120114
194 Ga0315915_1000003 3300033464 Bacteria 407996
195 Ga0395905_0000872 3300037471 Bacteria 39336
196 Ga0439436_0017497 3300041404 Bacteria 2144
197 Ga0439438_038460 3300041405 Bacteria 1249
198 Ga0439465_0004625 3300041413 Bacteria 4442
199 Ga0439465_0013484 3300041413 Bacteria 2547
200 Ga0439465_0033558 3300041413 Bacteria 1641
201 Ga0439465_0040626 3300041413 Bacteria 1504
202 Ga0451789_0254019 3300041443 Bacteria 2237
203 Ga0451791_0838639 3300041451 Bacteria 1424
204 Ga0451795_0437821 3300041456 Bacteria 1079
205 Ga0451833_0862883 3300041491 Bacteria 992
206 Ga0451839_0060444 3300041496 Bacteria 1625
207 Ga0451845_0458386 3300041501 Bacteria 1840
208 Ga0451847_0363052 3300041503 Bacteria 2218
209 Ga0451847_0395144 3300041503 Bacteria 2465
210 Ga0451843_0245664 3300041509 Bacteria 1330
211 Ga0451843_0514734 3300041509 Bacteria 1680
212 Ga0451853_3733563 3300041512 Bacteria 1181
213 Ga0439431_0001771 3300041997 Bacteria 4777
214 Ga0439432_125387 3300042006 Bacteria 759
215 Ga0439449_0001267 3300042007 Bacteria 9897
216 Ga0439462_0062454 3300042015 Bacteria 1008
217 Ga0450920_003479 3300042122 Bacteria 2729
218 Ga0439434_0092661 3300042435 Bacteria 967
219 Ga0439434_0115541 3300042435 Bacteria 872
220 Ga0450918_002659 3300042531 Bacteria 3366
221 Ga0495617_071709 3300046452 Bacteria 1139
222 Ga0495627_067771 3300046453 Bacteria 1046
223 Ga0495590_0065581 3300046457 Bacteria 1271
224 Ga0495638_0000467 3300046460 Bacteria 48587
225 Ga0495650_0090914 3300046471 Bacteria 1161
226 Ga0495605_0037794 3300046474 Bacteria 2425
227 Ga0495585_0060034 3300046492 Bacteria 2094
228 Ga0495585_0094659 3300046492 Bacteria 1605
229 Ga0495585_0169761 3300046492 Bacteria 1127
230 Ga0495607_0137947 3300046501 Bacteria 1261
231 Ga0495583_0011489 3300046506 Bacteria 5080
232 Ga0495583_0098144 3300046506 Bacteria 1253
233 Ga0495606_0016432 3300046507 Bacteria 5641
234 Ga0495606_0029546 3300046507 Bacteria 3845
235 Ga0495606_0181773 3300046507 Bacteria 1212
236 Ga0495606_0278720 3300046507 Bacteria 915
237 Ga0495610_0006233 3300046512 Bacteria 8267
238 Ga0495610_0009075 3300046512 Bacteria 6339
239 Ga0495616_0012553 3300046513 Bacteria 4805
240 Ga0495616_0140940 3300046513 Bacteria 1097
241 Ga0495620_0011009 3300046515 Bacteria 4740
242 Ga0495620_0043291 3300046515 Bacteria 1962
243 Ga0495620_0058931 3300046515 Bacteria 1606
244 Ga0495631_0002599 3300046518 Bacteria 10101
245 Ga0495631_0108348 3300046518 Bacteria 1194
246 Ga0495632_0013123 3300046519 Bacteria 4744
247 Ga0495632_0030771 3300046519 Bacteria 2782
248 Ga0495632_0039612 3300046519 Bacteria 2377
249 Ga0495643_0093950 3300046522 Bacteria 1544
250 Ga0495643_0134830 3300046522 Bacteria 1236
251 Ga0495648_0043322 3300046524 Bacteria 2823
252 Ga0495648_0059874 3300046524 Bacteria 2269
253 Ga0495654_0000392 3300046530 Bacteria 37521
254 Ga0495609_0010530 3300046538 Bacteria 4434
255 Ga0495609_0041987 3300046538 Bacteria 2054
256 Ga0495597_0095622 3300046542 Bacteria 1257
257 Ga0495622_0155489 3300046557 Bacteria 1033
258 Ga0495633_0061361 3300046558 Bacteria 1760
259 Ga0495668_0022145 3300046616 Bacteria 3634
260 Ga0495668_0092715 3300046616 Bacteria 1654
261 Ga0495668_0117354 3300046616 Bacteria 1455
262 Ga0495611_0081949 3300046648 Bacteria 1485
263 Ga0495625_0002334 3300046660 Bacteria 20741
264 Ga0495625_0143699 3300046660 Bacteria 1608
265 Ga0495588_0002139 3300046674 Bacteria 8466
266 Ga0495660_0062970 3300046810 Bacteria 1987
267 Ga0495660_0070849 3300046810 Bacteria 1849
268 Ga0495636_0075797 3300047318 Bacteria 1442
269 Ga0495672_0019329 3300047320 Bacteria 4496
270 Ga0495683_0024111 3300047323 Bacteria 3124
271 Ga0495687_038487 3300047443 Bacteria 2122
272 Ga0495679_046431 3300047446 Bacteria 1322
273 Ga0495673_0015180 3300047469 Bacteria 3978
274 Ga0495686_0126983 3300047472 Bacteria 1516
275 Ga0495626_0049150 3300048091 Bacteria 1954
276 Ga0496106_0003296 3300048909 Bacteria 12054
277 Ga0496106_0397090 3300048909 Bacteria 1108
278 Ga0496111_0002122 3300048914 Bacteria 11849
279 Ga0496116_0000240 3300048919 Bacteria 100232
280 Ga0496116_0006264 3300048919 Bacteria 10846
281 Ga0496116_0037451 3300048919 Bacteria 3382
282 Ga0496116_0099995 3300048919 Bacteria 1735
283 Ga0496117_0001876 3300048920 Bacteria 28300
284 Ga0496117_0043553 3300048920 Bacteria 3262
285 Ga0496117_0055794 3300048920 Bacteria 2757
286 Ga0496117_0086348 3300048920 Bacteria 2039
287 Ga0496117_0116147 3300048920 Bacteria 1654
288 Ga0496118_0040348 3300048921 Bacteria 3713
289 Ga0496118_0070979 3300048921 Bacteria 2510
290 Ga0496118_0176089 3300048921 Bacteria 1299
291 Ga0496118_0209999 3300048921 Bacteria 1143
292 Ga0496119_0061062 3300048922 Bacteria 2253
293 Ga0496119_0114138 3300048922 Bacteria 1495
294 Ga0496121_0000806 3300048924 Bacteria 57063
295 Ga0496121_0011185 3300048924 Bacteria 10004
296 Ga0496121_0076774 3300048924 Bacteria 2662
297 Ga0496121_0175048 3300048924 Bacteria 1554
298 Ga0496121_0300101 3300048924 Bacteria 1090
299 Ga0496122_0000018 3300048925 Bacteria 426350
300 Ga0496122_0000309 3300048925 Bacteria 107844
301 Ga0496122_0094133 3300048925 Bacteria 2029
302 Ga0496122_0136015 3300048925 Bacteria 1548
303 Ga0496122_0175980 3300048925 Bacteria 1282
304 Ga0496122_0249917 3300048925 Bacteria 992
305 Ga0496123_0000015 3300048926 Bacteria 426088
306 Ga0496123_0000396 3300048926 Bacteria 81106
307 Ga0496123_0015634 3300048926 Bacteria 6210
308 Ga0496123_0017519 3300048926 Bacteria 5757
309 Ga0496123_0055634 3300048926 Bacteria 2593
310 Ga0496123_0061113 3300048926 Bacteria 2424
311 Ga0496124_0000532 3300048927 Bacteria 64777
312 Ga0496124_0017080 3300048927 Bacteria 6861
313 Ga0496124_0025690 3300048927 Bacteria 5328
314 Ga0496124_0051175 3300048927 Bacteria 3516
315 Ga0496124_0084757 3300048927 Bacteria 2597
316 Ga0496124_0121881 3300048927 Bacteria 2082
317 Ga0496124_0126952 3300048927 Bacteria 2030
318 Ga0496124_0145743 3300048927 Bacteria 1863
319 Ga0496124_0149975 3300048927 Bacteria 1830
320 Ga0496125_0000393 3300048928 Bacteria 81258
321 Ga0496125_0009230 3300048928 Bacteria 10189
322 Ga0496125_0020703 3300048928 Bacteria 6168
323 Ga0496125_0183574 3300048928 Bacteria 1390
324 Ga0496125_0317403 3300048928 Bacteria 946
325 Ga0496126_0000322 3300048929 Bacteria 102330
326 Ga0496126_0000923 3300048929 Bacteria 50791
327 Ga0496126_0081257 3300048929 Bacteria 2865
328 Ga0496126_0275507 3300048929 Bacteria 1395
329 Ga0496126_0656058 3300048929 Bacteria 820
330 Ga0495678_010749 3300049459 Bacteria 4423
331 Ga0495678_044685 3300049459 Bacteria 1751
332 Ga0495678_130747 3300049459 Bacteria 832
333 Ga0501032_0063620 3300049569 Bacteria 2470
334 Ga0501033_0169495 3300049570 Bacteria 1568
335 Ga0501034_0097422 3300049571 Bacteria 2937
336 Ga0501034_0138366 3300049571 Bacteria 2415
337 Ga0501036_0032284 3300049572 Bacteria 4424
338 Ga0501036_0502836 3300049572 Bacteria 1008
339 Ga0501037_0243350 3300049573 Bacteria 1260
340 Ga0501038_0100334 3300049574 Bacteria 2412
341 Ga0501043_0054600 3300049579 Bacteria 3137
342 Ga0501046_0189347 3300049580 Bacteria 1535
343 Ga0501046_0269485 3300049580 Bacteria 1249
344 Ga0501047_0093374 3300049581 Bacteria 2888
345 Ga0501047_0291907 3300049581 Bacteria 1474
346 Ga0501068_0034220 3300049584 Bacteria 3030
347 Ga0501068_0261033 3300049584 Bacteria 1105
348 Ga0501080_0038020 3300049742 Bacteria 4495
349 Ga0501241_004865 3300049758 Bacteria 2508
350 Ga0501280_000882 3300049776 Bacteria 6423
351 Ga0501035_0347127 3300049822 Bacteria 1242
352 Ga0501035_0579750 3300049822 Bacteria 916
353 Ga0501044_0112371 3300049823 Bacteria 2731
354 Ga0501044_0313903 3300049823 Bacteria 1494
355 nmdc:mga03683_130814_c1 3300050489 Bacteria 1123
356 nmdc:mga00v17_100_c1 3300050491 Bacteria 50846
357 nmdc:mga0yw44_13662_c1 3300050492 Bacteria 4283
358 nmdc:mga0yw44_14108_c2 3300050492 Bacteria 3059
359 nmdc:mga0k408_108315_c1 3300050493 Bacteria 1641
360 nmdc:mga0k408_5138_c2 3300050493 Bacteria 2935
361 nmdc:mga06z11_183842_c1 3300050494 Bacteria 1207
362 nmdc:mga07m45_13855_c1 3300050496 Bacteria 4285
363 nmdc:mga07m45_282936_c1 3300050496 Bacteria 964
364 nmdc:mga0sz30_94797_c1 3300050516 Bacteria 1301
365 Ga0500610_0111479 3300053079 Bacteria 1406
366 Ga0500643_028942 3300053087 Bacteria 1709
367 Ga0500646_0118848 3300053090 Bacteria 848
368 Ga0500651_0210776 3300053093 Bacteria 1143
369 Ga0500557_021925 3300053105 Bacteria 1838
370 Ga0500560_050600 3300053107 Bacteria 1332
371 Ga0500569_008995 3300053109 Bacteria 2305
372 Ga0500594_0033276 3300053118 Bacteria 1370
373 Ga0500594_0042951 3300053118 Bacteria 1244
374 Ga0500608_007642 3300053122 Bacteria 4488
375 Ga0500618_001925 3300053125 Bacteria 8554
376 Ga0500618_002289 3300053125 Bacteria 7373
377 Ga0500642_0175864 3300053130 Bacteria 1001
378 Ga0500658_0001624 3300053134 Bacteria 8973
379 Ga0500658_0016610 3300053134 Bacteria 2743
380 Ga0500561_0001593 3300053137 Bacteria 3711
381 Ga0500568_0007190 3300053139 Bacteria 5488
382 Ga0500568_0019562 3300053139 Bacteria 2940
383 Ga0500568_0062363 3300053139 Bacteria 1440
384 Ga0500573_0035519 3300053140 Bacteria 2876
385 Ga0500604_0057532 3300053151 Bacteria 1214
386 Ga0500616_0000657 3300053153 Bacteria 41493
387 Ga0500622_0002119 3300053156 Bacteria 14769
388 Ga0500627_0015496 3300053158 Bacteria 2948
389 Ga0500627_0159980 3300053158 Bacteria 1016
390 Ga0500633_0009745 3300053160 Bacteria 2539
391 2644297905 2643221653 Bacteria 4569637
392 2509108971 2508501122 Bacteria 6292184
393 2509375307 2509276019 Bacteria 6802256
394 2509388809 2509276021 Bacteria 7634384
395 2509444396 2509276033 Bacteria 7180565
396 2510131038 2510065019 Bacteria 6903379
397 2510307191 2510065057 Bacteria 6649661
398 2510839038 2510461069 Bacteria 5505000
399 2510897346 2510461076 Bacteria 8618824
400 2511169906 2510917026 Bacteria 7046020
401 2511182215 2510917028 Bacteria 6185411
402 2511194769 2510917030 Bacteria 7460662
403 2511499016 2511231052 Bacteria 6974333
404 2512531614 2512047086 Bacteria 6850303
405 2512973032 2512875026 Bacteria 6861065
406 2513571031 2513237084 Bacteria 7231967
407 2513574766 2513237085 Bacteria 7695351
408 2513582422 2513237086 Bacteria 7265287
409 2513595331 2513237088 Bacteria 6927906
410 2513604386 2513237089 Bacteria 6553624
411 2513616127 2513237091 Bacteria 6900273
412 2513634016 2513237093 Bacteria 7545552
413 2513707385 2513237103 Bacteria 7647401
414 2513866574 2513237138 Bacteria 7368160
415 2513884672 2513237140 Bacteria 7076289
416 2513905067 2513237143 Bacteria 6664116
417 2513911320 2513237144 Bacteria 7530820
418 2513924481 2513237146 Bacteria 7166346
419 2513983094 2513237156 Bacteria 6402557
420 2513996457 2513237159 Bacteria 6810126
421 2514007086 2513237160 Bacteria 6650282
422 2514022147 2513237162 Bacteria 7468464
423 2515109971 2515075009 Bacteria 7288508
424 2515607436 2515154107 Bacteria 6795637
425 2515633965 2515154113 Bacteria 7807172
426 2515641215 2515154114 Bacteria 7848616
427 2515659778 2515154116 Bacteria 7552979
428 2515740953 2515154134 Bacteria 7220242
429 2516204615 2516143018 Bacteria 6951533
430 2516895291 2516653046 Bacteria 6989037
431 2517038662 2516653077 Bacteria 7555578
432 2517078915 2516653085 Bacteria 7346596
433 2517097715 2517093000 Bacteria 7412387
434 2517409135 2517287029 Bacteria 6905599
435 2517568350 2517487022 Bacteria 7227575
436 2520379066 2519899620 Bacteria 6499161
437 2524450826 2524023207 Bacteria 6813453
438 2530648167 2529292951 Bacteria 6916614
439 2535514770 2534681796 Bacteria 7146037
440 2551679965 2551306084 Bacteria 8942552
441 2551683680 2551306085 Bacteria 7347181
442 2551692220 2551306086 Bacteria 6843938
443 2551701062 2551306087 Bacteria 7351905
444 2551710561 2551306089 Bacteria 7162724
445 2551718559 2551306090 Bacteria 7953713
446 2551730264 2551306091 Bacteria 7086830
447 2551735428 2551306092 Bacteria 6992595
448 2551742789 2551306093 Bacteria 7064773
449 2558866395 2558860100 Bacteria 8458965
450 2561466683 2558860983 Bacteria 4133860
451 2585164606 2582581283 Bacteria 6030556
452 2585201087 2582581294 Bacteria 6626667
453 2585223451 2582581298 Bacteria 7315509
454 2585232465 2582581299 Bacteria 6518058
455 2585256217 2582581304 Bacteria 5831370
456 2585264951 2582581306 Bacteria 6450535
457 2585385991 2582581865 Bacteria 6644329
458 2585394605 2582581866 Bacteria 6859583
459 2585398890 2582581867 Bacteria 7184437
460 2585523752 2585427526 Bacteria 7258840
461 2585541851 2585427528 Bacteria 6842387
462 2585545953 2585427529 Bacteria 7395659
463 2585818990 2585427590 Bacteria 6824633
464 2585840501 2585427593 Bacteria 7141551
465 2585843907 2585427594 Bacteria 6180594
466 2585994138 2585427633 Bacteria 6413184
467 2585998661 2585427634 Bacteria 6455027
468 2599332757 2599185156 Bacteria 5403036
469 2599419556 2599185170 Bacteria 7295545
470 2599718980 2599185236 Bacteria 6875203
471 2600195022 2599185352 Bacteria 7228948
472 2600376588 2600254933 Bacteria 4750527
473 2616293767 2615840624 Bacteria 6557588
474 2643805996 2643221557 Bacteria 7184309
475 2643812677 2643221558 Bacteria 5460675
476 2643857378 2643221568 Bacteria 5187270
477 2644004604 2643221599 Bacteria 6292121
478 2644051446 2643221607 Bacteria 6314006
479 2644066172 2643221610 Bacteria 7480339
480 2644103585 2643221618 Bacteria 7717186
481 2644144464 2643221626 Bacteria 8069654
482 2644196886 2643221634 Bacteria 6705461
483 2644199943 2643221636 Bacteria 6583769
484 2644207118 2643221637 Bacteria 5345260
485 2644237487 2643221643 Bacteria 5749658
486 2644306515 2643221655 Bacteria 7722067
487 2644330705 2643221659 Bacteria 7890716
488 2644377256 2643221668 Bacteria 7306521
489 2644417503 2643221675 Bacteria 7473456
490 2644450899 2643221680 Bacteria 7473610
491 2644480315 2643221686 Bacteria 6310811
492 2644495561 2643221688 Bacteria 5260751
493 2644498941 2643221689 Bacteria 6042950
494 2644542490 2643221698 Bacteria 7756764
495 2644612126 2643221712 Bacteria 7729434
496 2644650766 2643221718 Bacteria 5345506
497 2644656158 2643221719 Bacteria 4568197
498 2644671680 2643221723 Bacteria 7095460
499 2644692678 2643221726 Bacteria 7455827
500 2657682945 2657244999 Bacteria 5946535
501 2692317569 2690316117 Bacteria 6800650
502 2719179207 2718217882 Bacteria 6556348
503 2719383774 2718217927 Bacteria 6972593
504 2719663569 2718217997 Bacteria 6740740
505 2719729877 2718218009 Bacteria 6478651
506 2720489988 2718218199 Bacteria 6740745
507 2720611364 2718218232 Bacteria 6720332
508 2720618214 2718218233 Bacteria 6662049
509 2720629617 2718218235 Bacteria 6630699
510 2720773313 2718218269 Bacteria 6906114
511 2721145300 2718218363 Bacteria 6524337
512 2721156815 2718218365 Bacteria 6274507
513 2721162195 2718218366 Bacteria 6425255
514 2721397532 2718218423 Bacteria 6438183
515 2722838365 2721755514 Bacteria 6424414
516 2723024992 2721755556 Bacteria 6745503
517 2723558570 2721755684 Bacteria 6859907
518 2723565139 2721755685 Bacteria 6704835
519 2724036342 2721755809 Bacteria 6438790
520 2724042633 2721755810 Bacteria 6479005
521 2724087920 2721755819 Bacteria 6906405
522 2724102404 2721755822 Bacteria 6726041
523 2724108308 2721755823 Bacteria 6752556
524 2725946651 2724679232 Bacteria 7646494
525 2730105928 2728369352 Bacteria 6745171
526 2730162444 2728369365 Bacteria 6555560
527 2730296447 2728369397 Bacteria 6274511
528 2738805787 2738541293 Bacteria 7065685
529 2738948680 2738541317 Bacteria 5340176
530 2739036924 2738541333 Bacteria 7106503
531 2753459770 2751185821 Bacteria 6189929
532 2766063362 2765235942 Bacteria 7445910
533 2776911718 2775507049 Bacteria 6284736
534 2792583177 2791355082 Bacteria 5973319
535 2792621144 2791355091 Bacteria 6135441
536 2792625358 2791355092 Bacteria 6248105
537 2792637789 2791355094 Bacteria 7011481
538 2793282911 2791355253 Bacteria 5171699
539 2793296799 2791355256 Bacteria 6798008
540 2793314031 2791355259 Bacteria 7254731
541 2793322316 2791355260 Bacteria 6598818
542 2793328977 2791355261 Bacteria 6661293
543 2793336277 2791355262 Bacteria 6774204
544 2793343890 2791355263 Bacteria 6872478
545 2793349481 2791355264 Bacteria 6429314
546 2793352664 2791355265 Bacteria 6539969
547 2793358327 2791355266 Bacteria 7116587
548 2793365522 2791355267 Bacteria 7222458
549 2802718599 2802428858 Bacteria 6636079
550 2802724280 2802428859 Bacteria 6667919
551 2802730058 2802428860 Bacteria 6525526
552 2802737401 2802428861 Bacteria 6534206
553 2802742317 2802428862 Bacteria 6633353
554 2802749000 2802428863 Bacteria 6410669
555 2804750663 2802429268 Bacteria 6094027
556 2805928180 2802429605 Bacteria 6875453
557 2805935531 2802429606 Bacteria 6346811
558 2806046664 2802429633 Bacteria 7341974
559 2806051425 2802429634 Bacteria 7083200
560 2806059414 2802429635 Bacteria 7650140
561 2806066621 2802429636 Bacteria 7597525
562 2806073679 2802429637 Bacteria 7067217
563 2819245152 2818991272 Bacteria 4622173
564 2819686002 2818991461 Bacteria 7026071
565 2821123405 2821123053 Bacteria 7836056
566 2837651608 2837651117 Bacteria 3772164
567 2838020628 2838016132 Bacteria 6577831
568 2838026401 2838022645 Bacteria 6494267
569 2838039909 2838035591 Bacteria 7166484
570 2838048490 2838042994 Bacteria 6046894
571 2838053136 2838048938 Bacteria 6044578
572 2838065850 2838061910 Bacteria 6794874
573 2838070718 2838068647 Bacteria 6208656
574 2838075060 2838074704 Bacteria 6785777
575 2838664193 2838661181 Bacteria 7385261
576 2838674374 2838668709 Bacteria 6671819
577 2838677430 2838675328 Bacteria 4909118
578 2838680215 2838680041 Bacteria 6545511
579 2838689653 2838686498 Bacteria 7807632
580 2838695754 2838694306 Bacteria 6853137
581 2838706716 2838701080 Bacteria 6669771
582 2838709129 2838707686 Bacteria 6619912
583 2838716318 2838714209 Bacteria 5525906
584 2838719882 2838719591 Bacteria 5523910
585 2838727070 2838724970 Bacteria 4908691
586 2838731652 2838729681 Bacteria 7400765
587 2838739572 2838736955 Bacteria 5760694
588 2838744593 2838742623 Bacteria 7396178
589 2841844304 2841840854 Bacteria 5761912
590 2841846813 2841846520 Bacteria 5345850
591 2841853134 2841851746 Bacteria 7532261
592 2841868925 2841864319 Bacteria 6742987
593 2842079635 2842077413 Bacteria 6508645
594 2842112550 2842110456 Bacteria 7656360
595 2842120253 2842118031 Bacteria 7033875
596 2842127158 2842124991 Bacteria 5346824
597 2842132323 2842130223 Bacteria 4909145
598 2842144025 2842140634 Bacteria 5759631
599 2842151369 2842146304 Bacteria 5957337
600 2842152508 2842152218 Bacteria 4908957
601 2842160460 2842156927 Bacteria 6894975
602 2842165560 2842163707 Bacteria 6916235
603 2842172563 2842170452 Bacteria 5525737
604 2842176127 2842175837 Bacteria 4908771
605 2842183874 2842180545 Bacteria 6888678
606 2842189425 2842187318 Bacteria 5524014
607 2842198179 2842192696 Bacteria 6147454
608 2842202162 2842198810 Bacteria 6608673
609 2842211198 2842205361 Bacteria 6340321
610 2842213739 2842211629 Bacteria 5523832
611 2842219224 2842217011 Bacteria 7497767
612 2842224643 2842224351 Bacteria 5524473
613 2842231455 2842229732 Bacteria 7475766
614 2842238540 2842237096 Bacteria 6620661
615 2842246075 2842243621 Bacteria 7421798
616 2842256507 2842250916 Bacteria 6579627
617 2842260453 2842257432 Bacteria 7401195
618 2842268344 2842264693 Bacteria 6472963
619 2842273863 2842271015 Bacteria 7807131
620 2842284651 2842278818 Bacteria 6340002
621 2842286464 2842285085 Bacteria 6011953
622 2842293296 2842291075 Bacteria 7076806
623 2842308909 2842304105 Bacteria 7023636
624 2842312415 2842311132 Bacteria 6616990
625 2842321993 2842317721 Bacteria 6793725
626 2842344455 2842341865 Bacteria 7003929
627 2842367497 2842363717 Bacteria 6844742
628 2842370677 2842370503 Bacteria 7038661
629 2842379693 2842377471 Bacteria 7140707
630 2842386764 2842384541 Bacteria 7057858
631 2842397657 2842395702 Bacteria 6780583
632 2842403983 2842402390 Bacteria 6681310
633 2842410314 2842409023 Bacteria 6687331
634 2842416962 2842415677 Bacteria 6596907
635 2842424333 2842422224 Bacteria 6239196
636 2842432316 2842428310 Bacteria 6767288
637 2842438620 2842434925 Bacteria 6502746
638 2842445250 2842441272 Bacteria 6769273
639 2842452836 2842447887 Bacteria 6754142
640 2842466349 2842462802 Bacteria 6588055
641 2842473169 2842469257 Bacteria 6752936
642 2842494642 2842489311 Bacteria 6620893
643 2842499899 2842495871 Bacteria 6820686
644 2842521380 2842521101 Bacteria 6569494
645 2842923032 2842922631 Bacteria 5824079
646 2844170142 2844163670 Bacteria 7266046
647 2844456400 2844454524 Bacteria 7952546
648 2847417361 2847417321 Bacteria 6913799
649 2848992147 2848992105 Bacteria 6810864
650 2850079628 2850079185 Bacteria 6848280
651 2854897977 2854896431 Bacteria 5869725
652 2854919677 2854916844 Bacteria 5725939
653 2855827928 2855825444 Bacteria 6785811
654 2855839685 2855839649 Bacteria 7135830
655 2855875213 2855872281 Bacteria 6964271
656 2857521994 2857516855 Bacteria 7787325
657 2857533645 2857531043 Bacteria 6754041
658 2858803024 2858800743 Bacteria 6603254
659 2891375275 2891373044 Bacteria 5202277
660 2896384770 2896384573 Bacteria 7700774
661 2899805612 2899803654 Bacteria 5577784
662 2913298247 2913295892 Bacteria 6333755
663 2913311505 2913308742 Bacteria 5350706
664 2915986524 2915980308 Bacteria 6624279
665 2915993184 2915986958 Bacteria 6739310
666 2915997291 2915993759 Bacteria 7016183
667 2916004829 2916000859 Bacteria 6865702
668 2916008232 2916007675 Bacteria 6898660
669 2916015692 2916014648 Bacteria 6946486
670 2916027681 2916021584 Bacteria 6854472
671 2916031540 2916028427 Bacteria 6748433
672 2916036018 2916035215 Bacteria 6755766
673 2916044622 2916041962 Bacteria 6820487
674 2916051998 2916048683 Bacteria 6543552
675 2916057091 2916055098 Bacteria 6758838
676 2916068496 2916061851 Bacteria 6737736
677 2916070799 2916068649 Bacteria 6943657
678 2916079440 2916076590 Bacteria 6596108
679 2919101671 2919100787 Bacteria 7710546
680 2919166645 2919166419 Bacteria 4952238
681 2919172298 2919171160 Bacteria 6499771
682 2920763684 2920760137 Bacteria 7427611
683 2920823033 2920822456 Bacteria 6897201
684 2921207431 2921201388 Bacteria 6926299
685 2921212331 2921208531 Bacteria 6745326
686 2921243229 2921237296 Bacteria 6876710
687 2921248495 2921244191 Bacteria 6568419
688 2921252628 2921250672 Bacteria 6677771
689 2921259900 2921257292 Bacteria 6808382
690 2921267394 2921263974 Bacteria 6864552
691 2921287837 2921282425 Bacteria 6826397
692 2921292211 2921289301 Bacteria 7316391
693 2921296979 2921296804 Bacteria 7176999
694 2923556382 2923556063 Bacteria 6793593
695 2924146219 2924144063 Bacteria 6883928
696 2924156372 2924150972 Bacteria 7169444
697 2924164622 2924158325 Bacteria 7188855
698 2924172220 2924165586 Bacteria 7260590
699 2924177144 2924172951 Bacteria 6749356
700 2924181151 2924179722 Bacteria 6843264
701 2924189414 2924186466 Bacteria 6876637
702 2924200211 2924193448 Bacteria 6955718
703 2924202530 2924200457 Bacteria 6757188
704 2924209541 2924207177 Bacteria 6917007
705 2924218012 2924214083 Bacteria 7080103
706 2924227858 2924221636 Bacteria 7113495
707 2924230062 2924228884 Bacteria 6633132
708 2926754544 2926754445 Bacteria 5964435
709 2933007155 2933006813 Bacteria 4912075
710 2933023441 2933016740 Bacteria 6355406
711 2933575353 2933570622 Bacteria 7023390
712 2933588561 2933586486 Bacteria 7667493
713 2933601522 2933599457 Bacteria 5858799
714 2935896274 2935894831 Bacteria 6620579
715 2936369321 2936367885 Bacteria 7324495
716 2936380017 2936375103 Bacteria 6652732
717 2936385740 2936381700 Bacteria 7006523
718 2936998578 2936996657 Bacteria 6298727
719 2937008686 2937002841 Bacteria 6934057
720 2937011759 2937009748 Bacteria 6746052
721 2937018465 2937016420 Bacteria 6782579
722 2937023495 2937023124 Bacteria 6815156
723 2937031617 2937029754 Bacteria 6424026
724 2937037699 2937036028 Bacteria 6846469
725 2937048806 2937042894 Bacteria 6741576
726 2937050182 2937049772 Bacteria 6757901
727 2937062375 2937056579 Bacteria 7107896
728 2937066754 2937063883 Bacteria 7199456
729 2937072950 2937071275 Bacteria 6984483
730 2937081694 2937078374 Bacteria 6610289
731 2937089436 2937084907 Bacteria 6618516
732 2937097040 2937091812 Bacteria 6979387
733 2937105553 2937098957 Bacteria 7249374
734 2937106537 2937106411 Bacteria 6947143
735 2937116411 2937113482 Bacteria 6505872
736 2937124722 2937119839 Bacteria 6597547
737 2937131863 2937126314 Bacteria 6771275
738 2941501009 2941499720 Bacteria 7599444
739 2954014373 2954011201 Bacteria 4762601
740 2957377830 2957375807 Bacteria 6425588
741 2957384410 2957382221 Bacteria 6737050
742 2957393258 2957388812 Bacteria 6778072
743 2957396743 2957395598 Bacteria 6822399
744 2957403423 2957402308 Bacteria 6741770
745 2957413444 2957408893 Bacteria 6558585
746 2957417381 2957415311 Bacteria 6991633
747 2957429939 2957422303 Bacteria 7172205
748 2957436424 2957430029 Bacteria 7022557
749 2957443304 2957437181 Bacteria 6568994
750 2957446796 2957443900 Bacteria 6869977
751 2957452903 2957450854 Bacteria 6765715
752 2957463824 2957457609 Bacteria 6967680
753 2957467243 2957464669 Bacteria 6568877
754 2957476136 2957471148 Bacteria 6797643
755 2957481196 2957478035 Bacteria 6756658
756 2957486648 2957484790 Bacteria 6703082
757 2957494007 2957491536 Bacteria 6695180
758 2957504574 2957498199 Bacteria 7126688
759 2957512452 2957505466 Bacteria 7253085
760 2960588652 2960584000 Bacteria 6864594
761 2960593337 2960591022 Bacteria 6622873
762 2960600827 2960597568 Bacteria 6550735
763 2960604373 2960603979 Bacteria 6898737
764 2960613780 2960610863 Bacteria 6691244
765 2960620428 2960617483 Bacteria 6727748
766 2960627050 2960624210 Bacteria 6875384
767 2960637123 2960631154 Bacteria 6732508
768 2960644815 2960637947 Bacteria 7296468
769 2960652286 2960645483 Bacteria 7211087
770 2960657605 2960652885 Bacteria 7083688
771 2960660703 2960660292 Bacteria 7041660
772 2960670252 2960667422 Bacteria 6763020
773 2960679434 2960674078 Bacteria 6609048
774 2960684582 2960680706 Bacteria 6624464
775 2960687379 2960687367 Bacteria 6535474
776 2960697448 2960693952 Bacteria 6749742
777 2964613423 2964607997 Bacteria 7101408
778 2964618306 2964615318 Bacteria 6809089
779 2964627535 2964621998 Bacteria 6834995
780 2964635154 2964628898 Bacteria 7083044
781 2964639983 2964636051 Bacteria 7091832
782 2964645039 2964643177 Bacteria 6820887
783 2964650024 2964649959 Bacteria 6675118
784 2964659558 2964656573 Bacteria 7100150
785 2964670270 2964663802 Bacteria 7019362
786 2964671831 2964670856 Bacteria 6851364
787 2964684233 2964678106 Bacteria 6792020
788 2964685269 2964685014 Bacteria 6839111
789 2964698185 2964691889 Bacteria 6802758
790 2964704637 2964698721 Bacteria 6765331
791 2964708244 2964705432 Bacteria 7114648
792 2964712965 2964712639 Bacteria 6695970
793 2964719906 2964719344 Bacteria 7286602
794 2967664843 2967664464 Bacteria 6948836
795 2967677439 2967671571 Bacteria 7021409
796 2967682108 2967678726 Bacteria 7264382
797 2967688098 2967686174 Bacteria 6678622
798 2967695360 2967693043 Bacteria 6804451
799 2967701085 2967699805 Bacteria 6854538
800 2967709877 2967706974 Bacteria 7186053
801 2967717922 2967714385 Bacteria 7000047
802 2967723697 2967721400 Bacteria 7073753
803 2967731108 2967728569 Bacteria 6641507
804 2967738151 2967735183 Bacteria 6827012
805 2967744281 2967742019 Bacteria 6794534
806 2967749518 2967748971 Bacteria 6733771
807 2967757268 2967755722 Bacteria 6814706
808 2967768753 2967762386 Bacteria 6923502
809 2967771331 2967769361 Bacteria 6587838
810 2967781560 2967775926 Bacteria 6738189
811 2970021212 2970019648 Bacteria 7072033
812 2970027350 2970026789 Bacteria 6785236
813 2970040437 2970033650 Bacteria 7118744
814 2970040973 2970040964 Bacteria 6731123
815 2970050914 2970047711 Bacteria 7088379
816 2970058311 2970054988 Bacteria 6611507
817 2970068289 2970061556 Bacteria 7099761
818 2970072502 2970068827 Bacteria 7123112
819 2970079361 2970076120 Bacteria 6697332
820 2970088064 2970082768 Bacteria 6183754
821 2970092258 2970088815 Bacteria 6933825
822 2970099379 2970095765 Bacteria 6936963
823 2970106107 2970102677 Bacteria 6812532
824 2970111565 2970109326 Bacteria 6863976
825 2970121873 2970116247 Bacteria 6501857
826 2970126163 2970122695 Bacteria 6625855
827 2970131277 2970129317 Bacteria 6806560
828 2970143054 2970136068 Bacteria 7207982
829 2970146347 2970143518 Bacteria 6446480
830 2970151902 2970149975 Bacteria 6779706
831 2970162577 2970156795 Bacteria 7168044
832 2970169597 2970164137 Bacteria 6861252
833 2970173683 2970170962 Bacteria 6876229
834 2970179410 2970177841 Bacteria 6768001
835 2970187768 2970184632 Bacteria 7054431
836 2970194924 2970191845 Bacteria 7032787
837 2977522796 2977516862 Bacteria 6940108
838 2977529430 2977523885 Bacteria 6960446
839 2977531069 2977530762 Bacteria 6951399
840 2977538537 2977537788 Bacteria 6929320
841 2977545811 2977544691 Bacteria 6875412
842 2977554135 2977551784 Bacteria 7125765
843 2977559446 2977558990 Bacteria 6863948
844 2977570048 2977565890 Bacteria 6901543
845 2977575606 2977572785 Bacteria 6763888
846 2977584102 2977579622 Bacteria 6772100
847 2978973034 2978969890 Bacteria 5400756
848 2984591280 2984587000 Bacteria 5263363
849 2989351741 2989349275 Bacteria 6349068
850 2989772554 2989771324 Bacteria 5605128
851 2989777144 2989776772 Bacteria 4843317
852 2996888184 2996887358 Bacteria 5795980
853 2996897786 2996893221 Bacteria 5823108
854 3003931644 3003930520 Bacteria 5667563
855 3005410835 3005409236 Bacteria 7188837
856 3005445870 3005445848 Bacteria 6906074
857 3005456560 3005452660 Bacteria 5889319
858 639646266 639633055 Bacteria 7751309
859 643824249 643692032 Bacteria 6891900
860 648736752 648276728 Bacteria 6968865
861 8003992154 8003992118 Bacteria 7266902
862 8003999432 8003999396 Bacteria 7063185
863 8005247705 8005246636 Bacteria 4933972
864 8005261265 8005258706 Bacteria 6184835
865 8005278476 8005275841 Bacteria 6929066
866 8005282980 8005282627 Bacteria 6675747
867 8005291459 8005289223 Bacteria 6634003
868 8005305659 8005301065 Bacteria 6614431
869 8005310446 8005307578 Bacteria 7395396
870 8005322711 8005321885 Bacteria 5795980
871 8005377828 8005376324 Bacteria 6590079
872 8005385124 8005382845 Bacteria 6732062
873 8005399796 8005395548 Bacteria 6806915
874 8005432583 8005430974 Bacteria 6689030
875 8005460608 8005460587 Bacteria 7157962
876 8005498304 8005497431 Bacteria 6477605
877 8005543440 8005542996 Bacteria 7077758
878 8005560220 8005556819 Bacteria 6908598
879 8005564324 8005563573 Bacteria 7153261
880 8005573882 8005570704 Bacteria 6957481
881 8005619497 8005619151 Bacteria 7030230
882 8005628064 8005626139 Bacteria 6534237
883 8005662645 8005658619 Bacteria 4500593
884 8005669713 8005668836 Bacteria 6953162
885 8005692587 8005688590 Bacteria 6610080
886 8005699662 8005695170 Bacteria 6912330
887 8018132750 8018127388 Bacteria 7351159
888 8018155099 8018150411 Bacteria 5549903
889 8018167402 8018163183 Bacteria 7277977
890 8018181872 8018176218 Bacteria 6896178
891 8023684647 8023680758 Bacteria 7729763
892 8024479895 8024479707 Bacteria 6954785
893 8024502174 8024501048 Bacteria 6427847
894 8049293212 8049293176 Bacteria 6128433
895 8054563258 8054558443 Bacteria 5204801
896 8055433632 8055431914 Bacteria 4551896
897 8056376113 8056375014 Bacteria 7006639
898 8056384144 8056382006 Bacteria 6408074
899 8056878825 8056875544 Bacteria 4355797
900 8057877552 8057874678 Bacteria 7494653
901 JGI25152J39213_1000443
902 JGI25152J39213_1001837
903 JGI25152J39213_1009461
904 JGI25150J39212_1000178
905 JGI25150J39212_1006689
906 JGI25159J45721_1000003
907 JGI25151J46595_10000529
908 JGI25151J46595_10001346
909 JGI25151J46595_10010196
910 JGI25151J46595_10016005
911 JGI25153J46596_10000720
912 JGI25153J46596_10001665
913 JGI25153J46596_10009987
914 JGI25153J46596_10010899
915 JGI25153J46596_10027253
916 JGI25153J46596_10038283
917 rootH1_10092577
918 rootL2_10217477
919 JGI25160J50197_1000003
920 JGI25161J50226_1000168
921 JGI25161J50226_1001586
922 Ga0055526_1001274
923 Ga0055526_1002520
924 Ga0055526_1004138
925 Ga0055526_1010240
926 Ga0055526_1010301
927 Ga0055524_1001329
928 Ga0055524_1001591
929 Ga0055524_1004482
930 Ga0055524_1008196
931 Ga0055524_1011555
932 Ga0055524_1019816
933 Ga0055536_1005792
934 Ga0055528_1000285
935 Ga0055528_1002290
936 Ga0055528_1008623
937 Ga0055528_1025807
938 Ga0055530_10007683
939 Ga0055540_1000356
940 Ga0055540_1002718
941 Ga0055540_1011721
942 Ga0055540_1016836
943 Ga0055540_1026189
944 Ga0055531_10003221
945 Ga0058692_1002338
946 Ga0055543_1000043
947 Ga0055543_1000073
948 Ga0055543_1008325
949 Ga0065165_1000025
950 Ga0065165_1002996
951 Ga0065165_1004647
952 Ga0065165_1009344
953 Ga0070670_100000416
954 Ga0070668_100047879
955 Ga0070669_100015810
956 Ga0070671_100010088
957 Ga0070667_100045936
958 Ga0070663_100109841
959 Ga0070665_100251782
960 Ga0075365_10001020
961 Ga0075365_10014795
962 Ga0075365_10112234
963 Ga0075363_100163076
964 Ga0075364_10008609
965 Ga0075362_10084232
966 Ga0075367_10032880
967 Ga0075367_10106473
968 Ga0075367_10147579
969 Ga0075369_10002436
970 Ga0075369_10029353
971 Ga0075369_10036642
972 Ga0075366_10001595
973 Ga0075366_10174467
974 Ga0075370_10004588
975 Ga0079104_1000033
976 Ga0099826_10107316
977 Ga0105251_10006336
978 Ga0105248_10014648
979 Ga0123341_1000036
980 Ga0123342_1042137
981 Ga0105246_10314232
982 Ga0157373_10107718
983 Ga0157373_10145086
984 Ga0157371_10014181
985 Ga0157370_10004075
986 Ga0157369_10088220
987 Ga0171463_1001
988 Ga0182008_10058519
989 Ga0183363_1103
990 Ga0214544_1000105
991 Ga0214542_1000029
992 Ga0214542_1015933
993 Ga0214543_1000027
994 Ga0214543_1000040
995 Ga0228711_1000013
996 Ga0228710_1000008
997 Ga0209436_100048
998 Ga0209436_101786
999 Ga0207425_1000305
1000 Ga0207425_1001993
1001 Ga0207425_1002482
1002 Ga0209129_1000192
1003 Ga0209129_1000381
1004 Ga0209129_1000500
1005 Ga0209129_1000789
1006 Ga0209129_1004128
1007 Ga0209673_1000024
1008 Ga0209673_1000135
1009 Ga0209673_1000677
1010 Ga0209673_1001830
1011 Ga0209673_1002029
1012 Ga0209673_1005790
1013 Ga0209673_1012911
1014 Ga0209130_1000002
1015 Ga0209130_1000005
1016 Ga0209130_1019272
1017 Ga0209130_1026757
1018 Ga0209676_1006567
1019 Ga0209676_1007831
1020 Ga0209025_1000037
1021 Ga0209025_1000105
1022 Ga0209025_1000235
1023 Ga0209025_1000748
1024 Ga0209025_1001229
1025 Ga0209025_1003357
1026 Ga0209025_1007673
1027 Ga0209025_1011777
1028 Ga0209025_1059698
1029 Ga0209564_1000138
1030 Ga0209564_1000217
1031 Ga0209564_1000746
1032 Ga0209564_1001016
1033 Ga0209564_1003467
1034 Ga0209564_1009669
1035 Ga0209758_1000170
1036 Ga0209758_1001066
1037 Ga0209758_1001253
1038 Ga0209758_1001373
1039 Ga0209758_1001628
1040 Ga0209758_1003903
1041 Ga0209758_1004403
1042 Ga0209758_1007856
1043 Ga0209758_1030176
1044 Ga0209758_1051303
1045 Ga0209758_1059782
1046 Ga0209050_1004607
1047 Ga0209256_1000027
1048 Ga0209256_1001094
1049 Ga0209256_1001547
1050 Ga0209256_1001774
1051 Ga0209256_1004946
1052 Ga0209256_1006230
1053 Ga0209256_1009888
1054 Ga0209256_1016605
1055 Ga0207426_1000013
1056 Ga0207426_1000015
1057 Ga0207426_1000070
1058 Ga0207426_1001155
1059 Ga0209051_1000197
1060 Ga0209051_1001552
1061 Ga0209051_1008327
1062 Ga0209051_1050312
1063 Ga0209051_1051126
1064 Ga0209257_1001770
1065 Ga0209257_1002467
1066 Ga0209257_1005021
1067 Ga0209257_1008444
1068 Ga0207650_10001503
1069 Ga0207668_10351289
1070 Ga0207658_10069506
1071 Ga0209281_1000043
1072 Ga0209281_1000134
1073 Ga0209281_1000319
1074 Ga0209282_1000029
1075 Ga0268266_10044913
1076 Ga0268265_10476831
1077 Ga0307515_10000029
1078 Ga0307515_10026735
1079 Ga0307515_10035723
1080 Ga0307515_10335301
1081 Ga0307513_10000338
1082 Ga0307408_100056854
1083 Ga0307408_100320317
1084 Ga0307405_10028251
1085 Ga0307412_10030503
1086 Ga0307412_10032470
1087 Ga0315914_1000021
1088 Ga0307416_100560913
1089 Ga0307414_10100829
1090 Ga0307414_10139106
1091 Ga0307414_10256879
1092 Ga0307411_10089418
1093 Ga0315913_1000014
1094 Ga0315915_1000003
1095 Ga0395905_0000872
1096 Ga0439436_0017497
1097 Ga0439438_038460
1098 Ga0439465_0004625
1099 Ga0439465_0013484
1100 Ga0439465_0033558
1101 Ga0439465_0040626
1102 Ga0451789_0254019
1103 Ga0451791_0838639
1104 Ga0451795_0437821
1105 Ga0451833_0862883
1106 Ga0451839_0060444
1107 Ga0451845_0458386
1108 Ga0451847_0363052
1109 Ga0451847_0395144
1110 Ga0451843_0245664
1111 Ga0451843_0514734
1112 Ga0451853_3733563
1113 Ga0439431_0001771
1114 Ga0439432_125387
1115 Ga0439449_0001267
1116 Ga0439462_0062454
1117 Ga0450920_003479
1118 Ga0439434_0092661
1119 Ga0439434_0115541
1120 Ga0450918_002659
1121 Ga0495617_071709
1122 Ga0495627_067771
1123 Ga0495590_0065581
1124 Ga0495638_0000467
1125 Ga0495650_0090914
1126 Ga0495605_0037794
1127 Ga0495585_0060034
1128 Ga0495585_0094659
1129 Ga0495585_0169761
1130 Ga0495607_0137947
1131 Ga0495583_0011489
1132 Ga0495583_0098144
1133 Ga0495606_0016432
1134 Ga0495606_0029546
1135 Ga0495606_0181773
1136 Ga0495606_0278720
1137 Ga0495610_0006233
1138 Ga0495610_0009075
1139 Ga0495616_0012553
1140 Ga0495616_0140940
1141 Ga0495620_0011009
1142 Ga0495620_0043291
1143 Ga0495620_0058931
1144 Ga0495631_0002599
1145 Ga0495631_0108348
1146 Ga0495632_0013123
1147 Ga0495632_0030771
1148 Ga0495632_0039612
1149 Ga0495643_0093950
1150 Ga0495643_0134830
1151 Ga0495648_0043322
1152 Ga0495648_0059874
1153 Ga0495654_0000392
1154 Ga0495609_0010530
1155 Ga0495609_0041987
1156 Ga0495597_0095622
1157 Ga0495622_0155489
1158 Ga0495633_0061361
1159 Ga0495668_0022145
1160 Ga0495668_0092715
1161 Ga0495668_0117354
1162 Ga0495611_0081949
1163 Ga0495625_0002334
1164 Ga0495625_0143699
1165 Ga0495588_0002139
1166 Ga0495660_0062970
1167 Ga0495660_0070849
1168 Ga0495636_0075797
1169 Ga0495672_0019329
1170 Ga0495683_0024111
1171 Ga0495687_038487
1172 Ga0495679_046431
1173 Ga0495673_0015180
1174 Ga0495686_0126983
1175 Ga0495626_0049150
1176 Ga0496106_0003296
1177 Ga0496106_0397090
1178 Ga0496111_0002122
1179 Ga0496116_0000240
1180 Ga0496116_0006264
1181 Ga0496116_0037451
1182 Ga0496116_0099995
1183 Ga0496117_0001876
1184 Ga0496117_0043553
1185 Ga0496117_0055794
1186 Ga0496117_0086348
1187 Ga0496117_0116147
1188 Ga0496118_0040348
1189 Ga0496118_0070979
1190 Ga0496118_0176089
1191 Ga0496118_0209999
1192 Ga0496119_0061062
1193 Ga0496119_0114138
1194 Ga0496121_0000806
1195 Ga0496121_0011185
1196 Ga0496121_0076774
1197 Ga0496121_0175048
1198 Ga0496121_0300101
1199 Ga0496122_0000018
1200 Ga0496122_0000309
1201 Ga0496122_0094133
1202 Ga0496122_0136015
1203 Ga0496122_0175980
1204 Ga0496122_0249917
1205 Ga0496123_0000015
1206 Ga0496123_0000396
1207 Ga0496123_0015634
1208 Ga0496123_0017519
1209 Ga0496123_0055634
1210 Ga0496123_0061113
1211 Ga0496124_0000532
1212 Ga0496124_0017080
1213 Ga0496124_0025690
1214 Ga0496124_0051175
1215 Ga0496124_0084757
1216 Ga0496124_0121881
1217 Ga0496124_0126952
1218 Ga0496124_0145743
1219 Ga0496124_0149975
1220 Ga0496125_0000393
1221 Ga0496125_0009230
1222 Ga0496125_0020703
1223 Ga0496125_0183574
1224 Ga0496125_0317403
1225 Ga0496126_0000322
1226 Ga0496126_0000923
1227 Ga0496126_0081257
1228 Ga0496126_0275507
1229 Ga0496126_0656058
1230 Ga0495678_010749
1231 Ga0495678_044685
1232 Ga0495678_130747
1233 Ga0501032_0063620
1234 Ga0501033_0169495
1235 Ga0501034_0097422
1236 Ga0501034_0138366
1237 Ga0501036_0032284
1238 Ga0501036_0502836
1239 Ga0501037_0243350
1240 Ga0501038_0100334
1241 Ga0501043_0054600
1242 Ga0501046_0189347
1243 Ga0501046_0269485
1244 Ga0501047_0093374
1245 Ga0501047_0291907
1246 Ga0501068_0034220
1247 Ga0501068_0261033
1248 Ga0501080_0038020
1249 Ga0501241_004865
1250 Ga0501280_000882
1251 Ga0501035_0347127
1252 Ga0501035_0579750
1253 Ga0501044_0112371
1254 Ga0501044_0313903
1255 nmdc:mga03683_130814_c1
1256 nmdc:mga00v17_100_c1
1257 nmdc:mga0yw44_13662_c1
1258 nmdc:mga0yw44_14108_c2
1259 nmdc:mga0k408_108315_c1
1260 nmdc:mga0k408_5138_c2
1261 nmdc:mga06z11_183842_c1
1262 nmdc:mga07m45_13855_c1
1263 nmdc:mga07m45_282936_c1
1264 nmdc:mga0sz30_94797_c1
1265 Ga0500610_0111479
1266 Ga0500643_028942
1267 Ga0500646_0118848
1268 Ga0500651_0210776
1269 Ga0500557_021925
1270 Ga0500560_050600
1271 Ga0500569_008995
1272 Ga0500594_0033276
1273 Ga0500594_0042951
1274 Ga0500608_007642
1275 Ga0500618_001925
1276 Ga0500618_002289
1277 Ga0500642_0175864
1278 Ga0500658_0001624
1279 Ga0500658_0016610
1280 Ga0500561_0001593
1281 Ga0500568_0007190
1282 Ga0500568_0019562
1283 Ga0500568_0062363
1284 Ga0500573_0035519
1285 Ga0500604_0057532
1286 Ga0500616_0000657
1287 Ga0500622_0002119
1288 Ga0500627_0015496
1289 Ga0500627_0159980
1290 Ga0500633_0009745
1291 2644297905
1292 2509108971
1293 2509375307
1294 2509388809
1295 2509444396
1296 2510131038
1297 2510307191
1298 2510839038
1299 2510897346
1300 2511169906
1301 2511182215
1302 2511194769
1303 2511499016
1304 2512531614
1305 2512973032
1306 2513571031
1307 2513574766
1308 2513582422
1309 2513595331
1310 2513604386
1311 2513616127
1312 2513634016
1313 2513707385
1314 2513866574
1315 2513884672
1316 2513905067
1317 2513911320
1318 2513924481
1319 2513983094
1320 2513996457
1321 2514007086
1322 2514022147
1323 2515109971
1324 2515607436
1325 2515633965
1326 2515641215
1327 2515659778
1328 2515740953
1329 2516204615
1330 2516895291
1331 2517038662
1332 2517078915
1333 2517097715
1334 2517409135
1335 2517568350
1336 2520379066
1337 2524450826
1338 2530648167
1339 2535514770
1340 2551679965
1341 2551683680
1342 2551692220
1343 2551701062
1344 2551710561
1345 2551718559
1346 2551730264
1347 2551735428
1348 2551742789
1349 2558866395
1350 2561466683
1351 2585164606
1352 2585201087
1353 2585223451
1354 2585232465
1355 2585256217
1356 2585264951
1357 2585385991
1358 2585394605
1359 2585398890
1360 2585523752
1361 2585541851
1362 2585545953
1363 2585818990
1364 2585840501
1365 2585843907
1366 2585994138
1367 2585998661
1368 2599332757
1369 2599419556
1370 2599718980
1371 2600195022
1372 2600376588
1373 2616293767
1374 2643805996
1375 2643812677
1376 2643857378
1377 2644004604
1378 2644051446
1379 2644066172
1380 2644103585
1381 2644144464
1382 2644196886
1383 2644199943
1384 2644207118
1385 2644237487
1386 2644306515
1387 2644330705
1388 2644377256
1389 2644417503
1390 2644450899
1391 2644480315
1392 2644495561
1393 2644498941
1394 2644542490
1395 2644612126
1396 2644650766
1397 2644656158
1398 2644671680
1399 2644692678
1400 2657682945
1401 2692317569
1402 2719179207
1403 2719383774
1404 2719663569
1405 2719729877
1406 2720489988
1407 2720611364
1408 2720618214
1409 2720629617
1410 2720773313
1411 2721145300
1412 2721156815
1413 2721162195
1414 2721397532
1415 2722838365
1416 2723024992
1417 2723558570
1418 2723565139
1419 2724036342
1420 2724042633
1421 2724087920
1422 2724102404
1423 2724108308
1424 2725946651
1425 2730105928
1426 2730162444
1427 2730296447
1428 2738805787
1429 2738948680
1430 2739036924
1431 2753459770
1432 2766063362
1433 2776911718
1434 2792583177
1435 2792621144
1436 2792625358
1437 2792637789
1438 2793282911
1439 2793296799
1440 2793314031
1441 2793322316
1442 2793328977
1443 2793336277
1444 2793343890
1445 2793349481
1446 2793352664
1447 2793358327
1448 2793365522
1449 2802718599
1450 2802724280
1451 2802730058
1452 2802737401
1453 2802742317
1454 2802749000
1455 2804750663
1456 2805928180
1457 2805935531
1458 2806046664
1459 2806051425
1460 2806059414
1461 2806066621
1462 2806073679
1463 2819245152
1464 2819686002
1465 2821123405
1466 2837651608
1467 2838020628
1468 2838026401
1469 2838039909
1470 2838048490
1471 2838053136
1472 2838065850
1473 2838070718
1474 2838075060
1475 2838664193
1476 2838674374
1477 2838677430
1478 2838680215
1479 2838689653
1480 2838695754
1481 2838706716
1482 2838709129
1483 2838716318
1484 2838719882
1485 2838727070
1486 2838731652
1487 2838739572
1488 2838744593
1489 2841844304
1490 2841846813
1491 2841853134
1492 2841868925
1493 2842079635
1494 2842112550
1495 2842120253
1496 2842127158
1497 2842132323
1498 2842144025
1499 2842151369
1500 2842152508
1501 2842160460
1502 2842165560
1503 2842172563
1504 2842176127
1505 2842183874
1506 2842189425
1507 2842198179
1508 2842202162
1509 2842211198
1510 2842213739
1511 2842219224
1512 2842224643
1513 2842231455
1514 2842238540
1515 2842246075
1516 2842256507
1517 2842260453
1518 2842268344
1519 2842273863
1520 2842284651
1521 2842286464
1522 2842293296
1523 2842308909
1524 2842312415
1525 2842321993
1526 2842344455
1527 2842367497
1528 2842370677
1529 2842379693
1530 2842386764
1531 2842397657
1532 2842403983
1533 2842410314
1534 2842416962
1535 2842424333
1536 2842432316
1537 2842438620
1538 2842445250
1539 2842452836
1540 2842466349
1541 2842473169
1542 2842494642
1543 2842499899
1544 2842521380
1545 2842923032
1546 2844170142
1547 2844456400
1548 2847417361
1549 2848992147
1550 2850079628
1551 2854897977
1552 2854919677
1553 2855827928
1554 2855839685
1555 2855875213
1556 2857521994
1557 2857533645
1558 2858803024
1559 2891375275
1560 2896384770
1561 2899805612
1562 2913298247
1563 2913311505
1564 2915986524
1565 2915993184
1566 2915997291
1567 2916004829
1568 2916008232
1569 2916015692
1570 2916027681
1571 2916031540
1572 2916036018
1573 2916044622
1574 2916051998
1575 2916057091
1576 2916068496
1577 2916070799
1578 2916079440
1579 2919101671
1580 2919166645
1581 2919172298
1582 2920763684
1583 2920823033
1584 2921207431
1585 2921212331
1586 2921243229
1587 2921248495
1588 2921252628
1589 2921259900
1590 2921267394
1591 2921287837
1592 2921292211
1593 2921296979
1594 2923556382
1595 2924146219
1596 2924156372
1597 2924164622
1598 2924172220
1599 2924177144
1600 2924181151
1601 2924189414
1602 2924200211
1603 2924202530
1604 2924209541
1605 2924218012
1606 2924227858
1607 2924230062
1608 2926754544
1609 2933007155
1610 2933023441
1611 2933575353
1612 2933588561
1613 2933601522
1614 2935896274
1615 2936369321
1616 2936380017
1617 2936385740
1618 2936998578
1619 2937008686
1620 2937011759
1621 2937018465
1622 2937023495
1623 2937031617
1624 2937037699
1625 2937048806
1626 2937050182
1627 2937062375
1628 2937066754
1629 2937072950
1630 2937081694
1631 2937089436
1632 2937097040
1633 2937105553
1634 2937106537
1635 2937116411
1636 2937124722
1637 2937131863
1638 2941501009
1639 2954014373
1640 2957377830
1641 2957384410
1642 2957393258
1643 2957396743
1644 2957403423
1645 2957413444
1646 2957417381
1647 2957429939
1648 2957436424
1649 2957443304
1650 2957446796
1651 2957452903
1652 2957463824
1653 2957467243
1654 2957476136
1655 2957481196
1656 2957486648
1657 2957494007
1658 2957504574
1659 2957512452
1660 2960588652
1661 2960593337
1662 2960600827
1663 2960604373
1664 2960613780
1665 2960620428
1666 2960627050
1667 2960637123
1668 2960644815
1669 2960652286
1670 2960657605
1671 2960660703
1672 2960670252
1673 2960679434
1674 2960684582
1675 2960687379
1676 2960697448
1677 2964613423
1678 2964618306
1679 2964627535
1680 2964635154
1681 2964639983
1682 2964645039
1683 2964650024
1684 2964659558
1685 2964670270
1686 2964671831
1687 2964684233
1688 2964685269
1689 2964698185
1690 2964704637
1691 2964708244
1692 2964712965
1693 2964719906
1694 2967664843
1695 2967677439
1696 2967682108
1697 2967688098
1698 2967695360
1699 2967701085
1700 2967709877
1701 2967717922
1702 2967723697
1703 2967731108
1704 2967738151
1705 2967744281
1706 2967749518
1707 2967757268
1708 2967768753
1709 2967771331
1710 2967781560
1711 2970021212
1712 2970027350
1713 2970040437
1714 2970040973
1715 2970050914
1716 2970058311
1717 2970068289
1718 2970072502
1719 2970079361
1720 2970088064
1721 2970092258
1722 2970099379
1723 2970106107
1724 2970111565
1725 2970121873
1726 2970126163
1727 2970131277
1728 2970143054
1729 2970146347
1730 2970151902
1731 2970162577
1732 2970169597
1733 2970173683
1734 2970179410
1735 2970187768
1736 2970194924
1737 2977522796
1738 2977529430
1739 2977531069
1740 2977538537
1741 2977545811
1742 2977554135
1743 2977559446
1744 2977570048
1745 2977575606
1746 2977584102
1747 2978973034
1748 2984591280
1749 2989351741
1750 2989772554
1751 2989777144
1752 2996888184
1753 2996897786
1754 3003931644
1755 3005410835
1756 3005445870
1757 3005456560
1758 639646266
1759 643824249
1760 648736752
1761 8003992154
1762 8003999432
1763 8005247705
1764 8005261265
1765 8005278476
1766 8005282980
1767 8005291459
1768 8005305659
1769 8005310446
1770 8005322711
1771 8005377828
1772 8005385124
1773 8005399796
1774 8005432583
1775 8005460608
1776 8005498304
1777 8005543440
1778 8005560220
1779 8005564324
1780 8005573882
1781 8005619497
1782 8005628064
1783 8005662645
1784 8005669713
1785 8005692587
1786 8005699662
1787 8018132750
1788 8018155099
1789 8018167402
1790 8018181872
1791 8023684647
1792 8024479895
1793 8024502174
1794 8049293212
1795 8054563258
1796 8055433632
1797 8056376113
1798 8056384144
1799 8056878825
1800 8057877552

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

57

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7357 2 258
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.7316 2 256
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6989 2 258
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6958 2 256
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6644 43 246
ID Description Score Start End Superfamily
af_Q9HCL2_203_355_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8094 65 182 3.40.50.620
af_P0A7A7_281_425_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7994 63 182 3.40.50.620
af_Q4DRS8_153_366_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7837 67 182 3.40.50.2000
af_Q54I12_580_724_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7818 65 182 3.40.50.620
af_Q8I5S7_22_233_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7688 60 182 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7W5T2R4-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) 0.9619 1 263 GO:0003841
GO:0006629
GO:0016020
AF-A0A2A5KU73-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase 0.9607 1 263 GO:0006629
GO:0016020
GO:0016746
AF-A0A1M3ATN4-F1-model_v4 deleted 0.9537 1 265
AF-A0A1Q9A8Q1-F1-model_v4 1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51) (Acyl-phosphate glycerol 3-phosphate acyltransferase) 0.9498 3 263 GO:0003841
GO:0006629
GO:0016020
AF-A0A285XFC9-F1-model_v4 deleted 0.9454 1 260

Map