F485092

General Info

Members Datasets Scaffolds Average Seq Length
899 377 1798 44

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10020075|JGI25404J52841_100200752
Length 52
Sequence MSYRKPGTKAVAIGNDVIRQSASPFAGSSLVPMLVIGLVLTFAGMIAALALS

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
72 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
73 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
176 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
179 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
180 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
199 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
200 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
201 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
202 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
203 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
204 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
205 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
206 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
207 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
210 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
213 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
216 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
225 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
226 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
236 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
237 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
238 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
243 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
251 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
270 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
273 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
274 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
277 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
278 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
279 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
280 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
281 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
286 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
287 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
288 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
289 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
290 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
293 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
301 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
309 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
310 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
311 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
312 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
318 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
321 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
322 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
323 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
327 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
328 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
329 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
330 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
331 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
332 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
336 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
337 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
338 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
339 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
340 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
341 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
342 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
343 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
344 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
345 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
346 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
347 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
348 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
349 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
350 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
353 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
354 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
355 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
356 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
357 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
358 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
359 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
360 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
361 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
362 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
363 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
364 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
365 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
366 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
367 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
368 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
369 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
370 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
371 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
374 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
375 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
376 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
377 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.44
Metatranscriptomes 0
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.12
Nodule 0.33
Rhizoplane 6.67
Rhizosphere 76.97
Stem 0
Stem Tuber 0
Unclassified 0.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10020075 3300003659 Bacteria 1448
2 JGI24750J21931_1063716 3300002070 Bacteria 593
3 JGI25404J52841_10086732 3300003659 Bacteria 654
4 JGI25404J52841_10089819 3300003659 Bacteria 642
5 JGI25405J52794_10053409 3300003911 Bacteria 868
6 Ga0065704_10291389 3300005289 Bacteria 903
7 Ga0070676_10254546 3300005328 Bacteria 1173
8 Ga0070676_10885810 3300005328 Bacteria 664
9 Ga0070670_101255782 3300005331 Bacteria 678
10 Ga0070670_101616771 3300005331 Bacteria 596
11 Ga0070677_10329297 3300005333 Bacteria 785
12 Ga0068869_100022457 3300005334 Bacteria 4348
13 Ga0068869_100234483 3300005334 Bacteria 1459
14 Ga0068869_100325443 3300005334 Bacteria 1247
15 Ga0068869_100645955 3300005334 Bacteria 898
16 Ga0068869_101156041 3300005334 Bacteria 679
17 Ga0068869_101498523 3300005334 Bacteria 599
18 Ga0070666_10576734 3300005335 Bacteria 820
19 Ga0070666_11001583 3300005335 Bacteria 620
20 Ga0070680_100143353 3300005336 Bacteria 2003
21 Ga0070682_100148048 3300005337 Bacteria 1608
22 Ga0070682_100231959 3300005337 Bacteria 1320
23 Ga0070682_101373420 3300005337 Bacteria 603
24 Ga0068868_100025242 3300005338 Bacteria 4517
25 Ga0068868_100342519 3300005338 Bacteria 1279
26 Ga0068868_100408876 3300005338 Bacteria 1172
27 Ga0068868_101026390 3300005338 Unclassified 756
28 Ga0070660_100528569 3300005339 Bacteria 983
29 Ga0070660_100724166 3300005339 Bacteria 835
30 Ga0070661_100075544 3300005344 Bacteria 2483
31 Ga0070661_100280876 3300005344 Bacteria 1292
32 Ga0070661_100628896 3300005344 Bacteria 870
33 Ga0070661_101910385 3300005344 Bacteria 505
34 Ga0070692_10137216 3300005345 Bacteria 1381
35 Ga0070668_100106814 3300005347 Bacteria 2224
36 Ga0070668_100184180 3300005347 Bacteria 1707
37 Ga0070668_100243510 3300005347 Bacteria 1490
38 Ga0070668_100358763 3300005347 Bacteria 1235
39 Ga0070668_100634126 3300005347 Bacteria 938
40 Ga0070668_100976079 3300005347 Bacteria 760
41 Ga0070668_101532733 3300005347 Bacteria 610
42 Ga0070668_101776976 3300005347 Bacteria 567
43 Ga0070669_100192217 3300005353 Bacteria 1601
44 Ga0070669_100343077 3300005353 Bacteria 1211
45 Ga0070675_100115054 3300005354 Bacteria 2279
46 Ga0070671_100152319 3300005355 Bacteria 1953
47 Ga0070671_100214030 3300005355 Bacteria 1635
48 Ga0070671_100681684 3300005355 Bacteria 891
49 Ga0070674_100047450 3300005356 Bacteria 2943
50 Ga0070674_101810759 3300005356 Bacteria 554
51 Ga0070674_102040281 3300005356 Bacteria 522
52 Ga0070673_100262197 3300005364 Bacteria 1510
53 Ga0070673_100457493 3300005364 Bacteria 1149
54 Ga0070673_101290513 3300005364 Bacteria 685
55 Ga0070688_100333542 3300005365 Bacteria 1106
56 Ga0070688_100524655 3300005365 Bacteria 897
57 Ga0070688_101132787 3300005365 Bacteria 626
58 Ga0070688_101426362 3300005365 Bacteria 562
59 Ga0070688_101488297 3300005365 Bacteria 551
60 Ga0070667_100122574 3300005367 Bacteria 2263
61 Ga0070667_100222701 3300005367 Bacteria 1680
62 Ga0070667_100974103 3300005367 Bacteria 791
63 Ga0070667_101245515 3300005367 Bacteria 697
64 Ga0070667_101987902 3300005367 Bacteria 548
65 Ga0070713_101439385 3300005436 Bacteria 668
66 Ga0070710_11454091 3300005437 Bacteria 514
67 Ga0070701_10600053 3300005438 Bacteria 729
68 Ga0070705_101241216 3300005440 Bacteria 616
69 Ga0070700_100140348 3300005441 Bacteria 1641
70 Ga0070700_100250694 3300005441 Bacteria 1270
71 Ga0070700_100707362 3300005441 Bacteria 802
72 Ga0070694_100575193 3300005444 Bacteria 905
73 Ga0070708_100565092 3300005445 Bacteria 1073
74 Ga0070663_100032177 3300005455 Bacteria 3612
75 Ga0070663_100056770 3300005455 Bacteria 2807
76 Ga0070663_100059318 3300005455 Bacteria 2750
77 Ga0070663_100247633 3300005455 Bacteria 1409
78 Ga0070663_100352015 3300005455 Bacteria 1193
79 Ga0070663_100453029 3300005455 Bacteria 1058
80 Ga0070663_100837840 3300005455 Bacteria 791
81 Ga0070678_100456063 3300005456 Bacteria 1120
82 Ga0070678_101252814 3300005456 Bacteria 689
83 Ga0070678_101666803 3300005456 Bacteria 600
84 Ga0070662_100029629 3300005457 Bacteria 3821
85 Ga0070662_100039118 3300005457 Bacteria 3373
86 Ga0070662_100156041 3300005457 Bacteria 1782
87 Ga0068867_100749189 3300005459 Bacteria 866
88 Ga0068867_102238852 3300005459 Bacteria 519
89 Ga0070685_10167204 3300005466 Bacteria 1407
90 Ga0070706_101510350 3300005467 Bacteria 614
91 Ga0070698_102194006 3300005471 Bacteria 506
92 Ga0070699_100080931 3300005518 Bacteria 2831
93 Ga0070699_101931067 3300005518 Bacteria 540
94 Ga0070679_100020630 3300005530 Bacteria 6426
95 Ga0070684_100402251 3300005535 Bacteria 1262
96 Ga0070684_101183682 3300005535 Bacteria 719
97 Ga0068853_100525878 3300005539 Bacteria 1118
98 Ga0068853_100672379 3300005539 Bacteria 986
99 Ga0068853_101022919 3300005539 Bacteria 796
100 Ga0068853_101035842 3300005539 Bacteria 790
101 Ga0068853_101846570 3300005539 Bacteria 586
102 Ga0070672_100293279 3300005543 Bacteria 1377
103 Ga0070672_100524122 3300005543 Bacteria 1027
104 Ga0070672_101674946 3300005543 Bacteria 571
105 Ga0070672_102053987 3300005543 Bacteria 515
106 Ga0070686_100525692 3300005544 Bacteria 922
107 Ga0070686_100780349 3300005544 Bacteria 769
108 Ga0070695_100114704 3300005545 Bacteria 1835
109 Ga0070696_100063359 3300005546 Bacteria 2589
110 Ga0070693_100046497 3300005547 Bacteria 2465
111 Ga0070693_100139380 3300005547 Bacteria 1525
112 Ga0070693_100794388 3300005547 Bacteria 701
113 Ga0070665_100038703 3300005548 Bacteria 4794
114 Ga0070665_100226329 3300005548 Bacteria 1870
115 Ga0070665_100385760 3300005548 Bacteria 1408
116 Ga0070665_100414491 3300005548 Bacteria 1356
117 Ga0070665_100623255 3300005548 Bacteria 1092
118 Ga0070665_100845118 3300005548 Bacteria 928
119 Ga0070665_100939182 3300005548 Bacteria 877
120 Ga0070665_101366900 3300005548 Bacteria 717
121 Ga0070665_102134373 3300005548 Bacteria 564
122 Ga0070665_102546763 3300005548 Bacteria 513
123 Ga0070665_102630934 3300005548 Bacteria 504
124 Ga0070704_100252626 3300005549 Bacteria 1449
125 Ga0070704_100591969 3300005549 Bacteria 974
126 Ga0068855_100051184 3300005563 Bacteria 4865
127 Ga0070664_100456578 3300005564 Bacteria 1173
128 Ga0070664_100672832 3300005564 Bacteria 963
129 Ga0068857_100096764 3300005577 Bacteria 2645
130 Ga0068857_101491799 3300005577 Bacteria 659
131 Ga0068857_102365128 3300005577 Bacteria 522
132 Ga0068854_101033528 3300005578 Bacteria 729
133 Ga0068854_101618028 3300005578 Bacteria 590
134 Ga0068854_102107076 3300005578 Bacteria 521
135 Ga0068856_100102808 3300005614 Bacteria 2851
136 Ga0068856_101296636 3300005614 Bacteria 744
137 Ga0070702_100164980 3300005615 Bacteria 1435
138 Ga0070702_100280141 3300005615 Bacteria 1144
139 Ga0068852_100339414 3300005616 Bacteria 1464
140 Ga0068852_100557679 3300005616 Bacteria 1146
141 Ga0068852_101328146 3300005616 Bacteria 741
142 Ga0068859_100431216 3300005617 Bacteria 1415
143 Ga0068859_100480800 3300005617 Bacteria 1337
144 Ga0068859_101165099 3300005617 Bacteria 848
145 Ga0068864_100299886 3300005618 Bacteria 1504
146 Ga0068864_100612111 3300005618 Bacteria 1058
147 Ga0068864_101552507 3300005618 Bacteria 665
148 Ga0068866_10239733 3300005718 Bacteria 1104
149 Ga0068866_10273947 3300005718 Bacteria 1043
150 Ga0068866_10327473 3300005718 Bacteria 966
151 Ga0068866_10407552 3300005718 Bacteria 878
152 Ga0068861_100047496 3300005719 Bacteria 3240
153 Ga0068861_100054038 3300005719 Bacteria 3058
154 Ga0068861_100298459 3300005719 Bacteria 1394
155 Ga0068861_100745095 3300005719 Bacteria 914
156 Ga0068861_101267079 3300005719 Bacteria 715
157 Ga0068861_102284420 3300005719 Bacteria 543
158 Ga0068870_10192423 3300005840 Bacteria 1232
159 Ga0068863_100243017 3300005841 Bacteria 1738
160 Ga0068863_100543550 3300005841 Bacteria 1147
161 Ga0068863_100703317 3300005841 Bacteria 1005
162 Ga0068858_100167069 3300005842 Bacteria 2074
163 Ga0068858_100182359 3300005842 Bacteria 1982
164 Ga0068858_100813791 3300005842 Bacteria 912
165 Ga0068858_100899214 3300005842 Bacteria 866
166 Ga0068858_101245211 3300005842 Bacteria 732
167 Ga0068858_101791553 3300005842 Bacteria 607
168 Ga0068860_100077074 3300005843 Bacteria 3170
169 Ga0068860_100090881 3300005843 Bacteria 2908
170 Ga0068860_100316697 3300005843 Bacteria 1531
171 Ga0068860_101051773 3300005843 Bacteria 833
172 Ga0068862_100103920 3300005844 Bacteria 2488
173 Ga0068862_100363372 3300005844 Bacteria 1346
174 Ga0068862_100511353 3300005844 Bacteria 1141
175 Ga0068862_101037297 3300005844 Bacteria 812
176 Ga0068862_101703658 3300005844 Bacteria 639
177 Ga0081455_10003995 3300005937 Bacteria 16746
178 Ga0081455_10019965 3300005937 Bacteria 6325
179 Ga0081455_10064244 3300005937 Bacteria 3075
180 Ga0081538_10041272 3300005981 Bacteria 2931
181 Ga0081538_10162220 3300005981 Bacteria 991
182 Ga0081540_1002099 3300005983 Bacteria 16594
183 Ga0081540_1006105 3300005983 Bacteria 8852
184 Ga0081540_1006738 3300005983 Bacteria 8307
185 Ga0081540_1009970 3300005983 Bacteria 6477
186 Ga0081540_1017433 3300005983 Bacteria 4447
187 Ga0081540_1050424 3300005983 Bacteria 2067
188 Ga0081540_1116574 3300005983 Bacteria 1117
189 Ga0081540_1271657 3300005983 Bacteria 587
190 Ga0081539_10023891 3300005985 Bacteria 3987
191 Ga0081539_10335508 3300005985 Bacteria 639
192 Ga0070717_11916094 3300006028 Bacteria 535
193 Ga0075365_10025630 3300006038 Bacteria 3734
194 Ga0075365_10113102 3300006038 Bacteria 1867
195 Ga0075365_10128086 3300006038 Bacteria 1755
196 Ga0075365_10158995 3300006038 Bacteria 1573
197 Ga0075365_10805512 3300006038 Bacteria 663
198 Ga0075365_10964595 3300006038 Bacteria 601
199 Ga0075368_10022671 3300006042 Bacteria 2391
200 Ga0075368_10159657 3300006042 Bacteria 944
201 Ga0075368_10272832 3300006042 Bacteria 726
202 Ga0075368_10308691 3300006042 Bacteria 683
203 Ga0075363_100046039 3300006048 Bacteria 2313
204 Ga0075363_100080606 3300006048 Bacteria 1780
205 Ga0075363_100117239 3300006048 Bacteria 1484
206 Ga0075363_100541528 3300006048 Bacteria 694
207 Ga0075363_100860077 3300006048 Bacteria 554
208 Ga0075363_101026821 3300006048 Bacteria 509
209 Ga0075364_10080844 3300006051 Bacteria 2148
210 Ga0075364_10647712 3300006051 Bacteria 721
211 Ga0075362_10105284 3300006177 Bacteria 1323
212 Ga0075362_10292131 3300006177 Bacteria 808
213 Ga0075367_10015463 3300006178 Bacteria 4149
214 Ga0075367_10043099 3300006178 Bacteria 2643
215 Ga0075367_10112960 3300006178 Bacteria 1669
216 Ga0075367_10243595 3300006178 Bacteria 1127
217 Ga0075367_10440174 3300006178 Bacteria 826
218 Ga0075367_10513379 3300006178 Bacteria 761
219 Ga0075369_10053175 3300006186 Bacteria 1757
220 Ga0075369_10185589 3300006186 Bacteria 957
221 Ga0075369_10333852 3300006186 Bacteria 710
222 Ga0075369_10388016 3300006186 Bacteria 657
223 Ga0075427_10056118 3300006194 Bacteria 684
224 Ga0075366_10015050 3300006195 Bacteria 4425
225 Ga0075366_10046842 3300006195 Bacteria 2562
226 Ga0075366_10197681 3300006195 Bacteria 1222
227 Ga0075366_10221433 3300006195 Bacteria 1153
228 Ga0075366_10611261 3300006195 Bacteria 676
229 Ga0075366_10639888 3300006195 Bacteria 660
230 Ga0097621_100098212 3300006237 Bacteria 2460
231 Ga0075370_10030613 3300006353 Bacteria 3003
232 Ga0075370_10094913 3300006353 Bacteria 1722
233 Ga0075370_10249667 3300006353 Bacteria 1051
234 Ga0068871_100047302 3300006358 Bacteria 3469
235 Ga0068871_100937039 3300006358 Bacteria 804
236 Ga0068871_102086265 3300006358 Bacteria 540
237 Ga0075428_100589376 3300006844 Bacteria 1188
238 Ga0075428_100971543 3300006844 Bacteria 900
239 Ga0075428_102360152 3300006844 Bacteria 547
240 Ga0068865_100050123 3300006881 Bacteria 2882
241 Ga0068865_100480430 3300006881 Bacteria 1033
242 Ga0068865_101078415 3300006881 Bacteria 706
243 Ga0075436_100959167 3300006914 Bacteria 641
244 Ga0097620_100431218 3300006931 Bacteria 1415
245 Ga0097620_100480757 3300006931 Bacteria 1337
246 Ga0097620_100759179 3300006931 Bacteria 1058
247 Ga0097620_101165121 3300006931 Bacteria 848
248 Ga0075435_100219365 3300007076 Bacteria 1615
249 Ga0105250_10180349 3300009092 Bacteria 886
250 Ga0105250_10213179 3300009092 Bacteria 817
251 Ga0105250_10284044 3300009092 Bacteria 713
252 Ga0105240_10015803 3300009093 Bacteria 10241
253 Ga0111539_10232467 3300009094 Bacteria 2147
254 Ga0111539_11145731 3300009094 Bacteria 904
255 Ga0111539_11827474 3300009094 Bacteria 704
256 Ga0111539_13538147 3300009094 Bacteria 501
257 Ga0105245_10017277 3300009098 Bacteria 6296
258 Ga0105245_10025876 3300009098 Bacteria 5161
259 Ga0105245_10410492 3300009098 Bacteria 1355
260 Ga0105245_10528901 3300009098 Bacteria 1199
261 Ga0105245_11510157 3300009098 Bacteria 723
262 Ga0105245_11739388 3300009098 Bacteria 676
263 Ga0105245_12148937 3300009098 Bacteria 612
264 Ga0105247_10083942 3300009101 Bacteria 2012
265 Ga0105247_10182625 3300009101 Bacteria 1401
266 Ga0105247_11008634 3300009101 Bacteria 651
267 Ga0105247_11359690 3300009101 Bacteria 573
268 Ga0105247_11771792 3300009101 Bacteria 513
269 Ga0114129_10036995 3300009147 Bacteria 6891
270 Ga0105243_10055909 3300009148 Bacteria 3136
271 Ga0105243_10199341 3300009148 Bacteria 1754
272 Ga0105243_12956694 3300009148 Bacteria 515
273 Ga0105241_10016103 3300009174 Bacteria 5480
274 Ga0105241_10307345 3300009174 Bacteria 1363
275 Ga0105241_11810040 3300009174 Bacteria 596
276 Ga0105241_12104652 3300009174 Bacteria 558
277 Ga0105242_10077045 3300009176 Bacteria 2781
278 Ga0105242_10728358 3300009176 Bacteria 974
279 Ga0105242_13052211 3300009176 Bacteria 519
280 Ga0105248_10010641 3300009177 Bacteria 10144
281 Ga0105248_10655583 3300009177 Bacteria 1184
282 Ga0105248_11581983 3300009177 Bacteria 742
283 Ga0105248_11740456 3300009177 Bacteria 707
284 Ga0105237_10195796 3300009545 Bacteria 2021
285 Ga0105237_10513708 3300009545 Bacteria 1204
286 Ga0105237_10538371 3300009545 Bacteria 1174
287 Ga0105237_11339246 3300009545 Bacteria 722
288 Ga0105238_10967443 3300009551 Bacteria 871
289 Ga0105249_10082231 3300009553 Bacteria 2996
290 Ga0105249_10429612 3300009553 Bacteria 1356
291 Ga0105249_10450935 3300009553 Bacteria 1325
292 Ga0105249_11211510 3300009553 Bacteria 826
293 Ga0105249_11656056 3300009553 Bacteria 712
294 Ga0105249_12044066 3300009553 Bacteria 646
295 Ga0105239_10040125 3300010375 Bacteria 5129
296 Ga0105239_10671255 3300010375 Bacteria 1184
297 Ga0105239_10761082 3300010375 Bacteria 1109
298 Ga0105239_10775025 3300010375 Bacteria 1098
299 Ga0105239_11872113 3300010375 Bacteria 696
300 Ga0105246_10411560 3300011119 Bacteria 1126
301 Ga0105246_10871835 3300011119 Bacteria 805
302 Ga0105246_11428033 3300011119 Bacteria 647
303 Ga0105246_11703801 3300011119 Bacteria 599
304 Ga0105246_11957788 3300011119 Bacteria 564
305 Ga0157316_1041606 3300012510 Bacteria 601
306 Ga0157373_10904221 3300013100 Bacteria 655
307 Ga0157370_10013913 3300013104 Bacteria 8262
308 Ga0157374_10091309 3300013296 Bacteria 2904
309 Ga0157374_10956249 3300013296 Bacteria 875
310 Ga0157374_11969054 3300013296 Bacteria 610
311 Ga0157378_10012035 3300013297 Bacteria 7573
312 Ga0157378_10463462 3300013297 Bacteria 1260
313 Ga0157378_11034925 3300013297 Bacteria 856
314 Ga0157378_11075558 3300013297 Bacteria 841
315 Ga0157378_13024096 3300013297 Bacteria 522
316 Ga0163162_10137630 3300013306 Bacteria 2553
317 Ga0163162_10700040 3300013306 Bacteria 1135
318 Ga0163162_10765325 3300013306 Bacteria 1084
319 Ga0163162_10873623 3300013306 Bacteria 1013
320 Ga0163162_10881257 3300013306 Bacteria 1009
321 Ga0163162_11510975 3300013306 Bacteria 765
322 Ga0157372_12161229 3300013307 Bacteria 639
323 Ga0157375_10410646 3300013308 Bacteria 1520
324 Ga0157375_10784399 3300013308 Bacteria 1102
325 Ga0157375_10804621 3300013308 Bacteria 1088
326 Ga0157375_10990532 3300013308 Bacteria 981
327 Ga0157375_11050399 3300013308 Bacteria 952
328 Ga0157375_12268264 3300013308 Bacteria 647
329 Ga0163163_10083521 3300014325 Bacteria 3199
330 Ga0163163_10232278 3300014325 Bacteria 1893
331 Ga0163163_11516834 3300014325 Bacteria 731
332 Ga0163163_11858301 3300014325 Bacteria 662
333 Ga0157380_10012550 3300014326 Bacteria 6148
334 Ga0157380_10137534 3300014326 Bacteria 2093
335 Ga0157380_11026820 3300014326 Bacteria 859
336 Ga0157380_11271942 3300014326 Bacteria 782
337 Ga0157380_11501288 3300014326 Bacteria 727
338 Ga0157380_11594277 3300014326 Bacteria 708
339 Ga0157380_11795523 3300014326 Bacteria 672
340 Ga0157377_10048461 3300014745 Bacteria 2384
341 Ga0157377_10283469 3300014745 Bacteria 1087
342 Ga0157377_10678866 3300014745 Bacteria 745
343 Ga0157379_10359698 3300014968 Bacteria 1334
344 Ga0157379_10417491 3300014968 Bacteria 1235
345 Ga0157379_10897059 3300014968 Bacteria 841
346 Ga0157379_11047476 3300014968 Bacteria 779
347 Ga0157379_11264222 3300014968 Bacteria 712
348 Ga0157379_12392540 3300014968 Bacteria 527
349 Ga0157376_10012146 3300014969 Bacteria 6381
350 Ga0157376_10838083 3300014969 Bacteria 934
351 Ga0182007_10346764 3300015262 Bacteria 556
352 Ga0163161_10356501 3300017792 Bacteria 1164
353 Ga0163161_10534156 3300017792 Bacteria 959
354 Ga0163161_11119148 3300017792 Bacteria 678
355 Ga0209758_1005746 3300025297 Bacteria 9340
356 Ga0207642_10201314 3300025899 Bacteria 1100
357 Ga0207642_10202079 3300025899 Bacteria 1098
358 Ga0207642_10268988 3300025899 Bacteria 975
359 Ga0207642_10375008 3300025899 Bacteria 845
360 Ga0207710_10733667 3300025900 Bacteria 519
361 Ga0207688_10089754 3300025901 Bacteria 1764
362 Ga0207688_10812362 3300025901 Bacteria 592
363 Ga0207680_10082079 3300025903 Bacteria 2028
364 Ga0207647_10373631 3300025904 Bacteria 805
365 Ga0207645_10090974 3300025907 Bacteria 1962
366 Ga0207645_10159554 3300025907 Bacteria 1475
367 Ga0207645_10199479 3300025907 Bacteria 1316
368 Ga0207654_10123514 3300025911 Bacteria 1629
369 Ga0207654_11299350 3300025911 Bacteria 530
370 Ga0207695_10070992 3300025913 Bacteria 3557
371 Ga0207671_10154582 3300025914 Bacteria 1774
372 Ga0207671_10234906 3300025914 Bacteria 1439
373 Ga0207671_10956735 3300025914 Bacteria 676
374 Ga0207671_10959907 3300025914 Bacteria 674
375 Ga0207660_10794030 3300025917 Bacteria 772
376 Ga0207660_11079082 3300025917 Bacteria 654
377 Ga0207662_11235552 3300025918 Bacteria 531
378 Ga0207657_10270599 3300025919 Bacteria 1350
379 Ga0207657_10454916 3300025919 Bacteria 1004
380 Ga0207657_10763017 3300025919 Bacteria 749
381 Ga0207649_10112627 3300025920 Bacteria 1821
382 Ga0207649_10349868 3300025920 Bacteria 1093
383 Ga0207649_11284721 3300025920 Bacteria 579
384 Ga0207652_11378853 3300025921 Bacteria 608
385 Ga0207681_10219202 3300025923 Bacteria 1471
386 Ga0207681_10304229 3300025923 Bacteria 1263
387 Ga0207681_10391697 3300025923 Bacteria 1120
388 Ga0207681_10846419 3300025923 Bacteria 765
389 Ga0207681_10927658 3300025923 Bacteria 730
390 Ga0207694_10725015 3300025924 Bacteria 839
391 Ga0207694_11263988 3300025924 Bacteria 624
392 Ga0207650_10252449 3300025925 Bacteria 1428
393 Ga0207650_11501945 3300025925 Bacteria 573
394 Ga0207659_10854660 3300025926 Bacteria 782
395 Ga0207659_11746348 3300025926 Bacteria 529
396 Ga0207687_10009640 3300025927 Bacteria 6312
397 Ga0207687_10041544 3300025927 Bacteria 3158
398 Ga0207687_10443853 3300025927 Bacteria 1075
399 Ga0207687_10450684 3300025927 Bacteria 1067
400 Ga0207687_10529265 3300025927 Bacteria 987
401 Ga0207644_10178001 3300025931 Bacteria 1665
402 Ga0207644_10256680 3300025931 Bacteria 1396
403 Ga0207644_10607087 3300025931 Bacteria 909
404 Ga0207690_10865642 3300025932 Bacteria 748
405 Ga0207706_10031987 3300025933 Bacteria 4687
406 Ga0207706_10087328 3300025933 Bacteria 2742
407 Ga0207706_10178730 3300025933 Bacteria 1864
408 Ga0207686_10276830 3300025934 Bacteria 1237
409 Ga0207709_10082988 3300025935 Bacteria 2071
410 Ga0207709_10465142 3300025935 Bacteria 980
411 Ga0207709_10529068 3300025935 Bacteria 924
412 Ga0207670_10276866 3300025936 Bacteria 1306
413 Ga0207670_10375033 3300025936 Bacteria 1132
414 Ga0207670_11731676 3300025936 Bacteria 532
415 Ga0207669_10009063 3300025937 Bacteria 4715
416 Ga0207704_10258500 3300025938 Bacteria 1312
417 Ga0207704_10522848 3300025938 Bacteria 960
418 Ga0207691_10303419 3300025940 Bacteria 1371
419 Ga0207691_10432241 3300025940 Bacteria 1121
420 Ga0207691_10710904 3300025940 Bacteria 847
421 Ga0207691_11611962 3300025940 Bacteria 528
422 Ga0207711_10087575 3300025941 Bacteria 2732
423 Ga0207711_11124915 3300025941 Bacteria 726
424 Ga0207711_11277611 3300025941 Bacteria 676
425 Ga0207711_11592254 3300025941 Bacteria 597
426 Ga0207689_10039747 3300025942 Bacteria 3894
427 Ga0207689_10437870 3300025942 Bacteria 1092
428 Ga0207689_10697738 3300025942 Bacteria 856
429 Ga0207689_11382108 3300025942 Bacteria 590
430 Ga0207689_11420073 3300025942 Bacteria 581
431 Ga0207689_11795764 3300025942 Bacteria 506
432 Ga0207679_10143432 3300025945 Bacteria 1934
433 Ga0207679_10447914 3300025945 Bacteria 1144
434 Ga0207679_10594044 3300025945 Bacteria 997
435 Ga0207679_10786901 3300025945 Bacteria 867
436 Ga0207667_10275684 3300025949 Bacteria 1719
437 Ga0207667_11216481 3300025949 Bacteria 732
438 Ga0207651_11130857 3300025960 Bacteria 702
439 Ga0207712_10070979 3300025961 Bacteria 2504
440 Ga0207712_10423930 3300025961 Bacteria 1123
441 Ga0207712_10722670 3300025961 Bacteria 871
442 Ga0207712_11373362 3300025961 Bacteria 632
443 Ga0207712_12108884 3300025961 Bacteria 504
444 Ga0207668_10172530 3300025972 Bacteria 1697
445 Ga0207668_10338299 3300025972 Bacteria 1254
446 Ga0207668_10342443 3300025972 Bacteria 1247
447 Ga0207668_10629413 3300025972 Bacteria 937
448 Ga0207668_10637679 3300025972 Bacteria 931
449 Ga0207668_11386302 3300025972 Bacteria 633
450 Ga0207640_11770737 3300025981 Bacteria 558
451 Ga0207658_10243757 3300025986 Bacteria 1524
452 Ga0207658_10660801 3300025986 Bacteria 943
453 Ga0207658_11352071 3300025986 Bacteria 651
454 Ga0207658_11406909 3300025986 Bacteria 638
455 Ga0207677_10232251 3300026023 Bacteria 1487
456 Ga0207677_10282751 3300026023 Bacteria 1363
457 Ga0207677_10291482 3300026023 Bacteria 1344
458 Ga0207703_10639810 3300026035 Bacteria 1008
459 Ga0207703_10881995 3300026035 Bacteria 856
460 Ga0207703_11245827 3300026035 Bacteria 715
461 Ga0207703_11508921 3300026035 Bacteria 647
462 Ga0207703_11575542 3300026035 Bacteria 632
463 Ga0207639_10447956 3300026041 Bacteria 1171
464 Ga0207639_10678459 3300026041 Bacteria 955
465 Ga0207639_10812879 3300026041 Bacteria 871
466 Ga0207678_10051444 3300026067 Bacteria 3557
467 Ga0207678_10063387 3300026067 Bacteria 3176
468 Ga0207678_10092171 3300026067 Bacteria 2590
469 Ga0207678_10147209 3300026067 Bacteria 2010
470 Ga0207678_10180089 3300026067 Bacteria 1805
471 Ga0207678_10214716 3300026067 Bacteria 1646
472 Ga0207678_10669982 3300026067 Bacteria 912
473 Ga0207708_10174930 3300026075 Bacteria 1702
474 Ga0207708_10394433 3300026075 Bacteria 1143
475 Ga0207702_10102473 3300026078 Bacteria 2529
476 Ga0207702_11073086 3300026078 Bacteria 799
477 Ga0207641_10473595 3300026088 Bacteria 1213
478 Ga0207641_11015842 3300026088 Bacteria 826
479 Ga0207641_12290164 3300026088 Bacteria 540
480 Ga0207641_12377408 3300026088 Bacteria 529
481 Ga0207648_10112121 3300026089 Bacteria 2395
482 Ga0207648_11030275 3300026089 Bacteria 771
483 Ga0207676_10609705 3300026095 Bacteria 1049
484 Ga0207676_10611027 3300026095 Bacteria 1048
485 Ga0207676_11031665 3300026095 Bacteria 811
486 Ga0207676_11930264 3300026095 Bacteria 589
487 Ga0207674_10314585 3300026116 Bacteria 1515
488 Ga0207674_10590070 3300026116 Bacteria 1073
489 Ga0207674_11282155 3300026116 Bacteria 702
490 Ga0207674_11546411 3300026116 Bacteria 632
491 Ga0207675_100034357 3300026118 Bacteria 4727
492 Ga0207675_100069403 3300026118 Bacteria 3294
493 Ga0207675_100413405 3300026118 Bacteria 1331
494 Ga0207675_100432368 3300026118 Bacteria 1302
495 Ga0207675_100763838 3300026118 Bacteria 978
496 Ga0207675_100938726 3300026118 Bacteria 882
497 Ga0207683_10113245 3300026121 Bacteria 2430
498 Ga0207683_10196753 3300026121 Bacteria 1831
499 Ga0207683_10449054 3300026121 Bacteria 1189
500 Ga0207683_10764672 3300026121 Bacteria 896
501 Ga0207683_10921190 3300026121 Bacteria 811
502 Ga0207683_11029509 3300026121 Bacteria 764
503 Ga0207683_11161755 3300026121 Bacteria 716
504 Ga0207683_11277276 3300026121 Bacteria 680
505 Ga0207683_11691975 3300026121 Bacteria 582
506 Ga0207683_11966733 3300026121 Bacteria 533
507 Ga0207698_10737249 3300026142 Bacteria 983
508 Ga0207698_11481625 3300026142 Bacteria 694
509 Ga0207698_12281828 3300026142 Bacteria 553
510 Ga0209813_10176540 3300027866 Bacteria 779
511 Ga0209813_10197810 3300027866 Bacteria 743
512 Ga0207428_10526484 3300027907 Bacteria 857
513 Ga0268266_10009936 3300028379 Bacteria 8357
514 Ga0268266_10011388 3300028379 Bacteria 7733
515 Ga0268266_10041009 3300028379 Bacteria 3947
516 Ga0268266_10206372 3300028379 Bacteria 1800
517 Ga0268266_10253514 3300028379 Bacteria 1628
518 Ga0268266_10594948 3300028379 Bacteria 1062
519 Ga0268266_11123193 3300028379 Bacteria 760
520 Ga0268266_11232348 3300028379 Bacteria 723
521 Ga0268266_11304839 3300028379 Bacteria 701
522 Ga0268266_11772707 3300028379 Bacteria 592
523 Ga0268265_10121523 3300028380 Bacteria 2152
524 Ga0268265_10141099 3300028380 Bacteria 2017
525 Ga0268265_10295028 3300028380 Bacteria 1457
526 Ga0268265_10412044 3300028380 Bacteria 1252
527 Ga0268265_11112738 3300028380 Bacteria 784
528 Ga0268265_11488041 3300028380 Bacteria 680
529 Ga0268264_10047902 3300028381 Bacteria 3554
530 Ga0268264_10231416 3300028381 Bacteria 1707
531 Ga0268264_10257732 3300028381 Bacteria 1623
532 Ga0268264_12063577 3300028381 Bacteria 579
533 Ga0268264_12657901 3300028381 Bacteria 505
534 Ga0307517_10226441 3300028786 Bacteria 1129
535 Ga0307517_10404598 3300028786 Bacteria 721
536 Ga0307517_10469614 3300028786 Bacteria 647
537 Ga0307515_10329175 3300028794 Bacteria 1188
538 Ga0307515_10371718 3300028794 Bacteria 1066
539 Ga0307513_10661701 3300031456 Bacteria 751
540 Ga0307509_10502101 3300031507 Bacteria 897
541 Ga0307408_100460628 3300031548 Bacteria 1105
542 Ga0307508_10814183 3300031616 Bacteria 552
543 Ga0307405_10143234 3300031731 Bacteria 1670
544 Ga0307405_10324623 3300031731 Bacteria 1177
545 Ga0307413_10075340 3300031824 Bacteria 2141
546 Ga0307413_10185431 3300031824 Bacteria 1488
547 Ga0307410_10104856 3300031852 Bacteria 2034
548 Ga0307410_10578577 3300031852 Bacteria 934
549 Ga0307412_10148175 3300031911 Bacteria 1728
550 Ga0307409_101079452 3300031995 Bacteria 823
551 Ga0307409_102560358 3300031995 Bacteria 539
552 Ga0307416_100466605 3300032002 Bacteria 1319
553 Ga0307416_100500057 3300032002 Bacteria 1280
554 Ga0307414_10775625 3300032004 Bacteria 873
555 Ga0307411_10478120 3300032005 Bacteria 1048
556 Ga0307411_10499662 3300032005 Bacteria 1028
557 Ga0307411_11867438 3300032005 Bacteria 559
558 Ga0307415_100209972 3300032126 Bacteria 1552
559 Ga0307415_101325347 3300032126 Bacteria 683
560 Ga0307415_101403552 3300032126 Bacteria 665
561 Ga0373959_0021634 3300034820 Bacteria 1237
562 Ga0373940_0238350 3300035088 Bacteria 610
563 Ga0373936_0366631 3300035113 Bacteria 658
564 Ga0373943_0818177 3300035170 Bacteria 555
565 Ga0373947_1042988 3300035725 Bacteria 558
566 Ga0373937_0350723 3300036401 Bacteria 1398
567 Ga0373925_0318763 3300037068 Bacteria 1258
568 Ga0373925_0609747 3300037068 Bacteria 899
569 Ga0395900_0125097 3300037418 Bacteria 2637
570 Ga0395898_0530060 3300037466 Bacteria 1119
571 Ga0395901_1040948 3300038443 Bacteria 792
572 Ga0439465_0136530 3300041413 Bacteria 869
573 Ga0439465_0361627 3300041413 Bacteria 549
574 Ga0451789_0132707 3300041443 Bacteria 510
575 Ga0451789_1337304 3300041443 Bacteria 566
576 Ga0451791_0723520 3300041451 Bacteria 1112
577 Ga0451797_0326280 3300041453 Bacteria 577
578 Ga0451797_1396665 3300041453 Bacteria 535
579 Ga0451800_0257958 3300041459 Bacteria 660
580 Ga0451802_0865917 3300041460 Bacteria 624
581 Ga0451807_2035663 3300041486 Bacteria 670
582 Ga0451833_0086428 3300041491 Bacteria 661
583 Ga0451837_1552806 3300041494 Bacteria 578
584 Ga0439431_0271191 3300041997 Bacteria 507
585 Ga0439432_122460 3300042006 Bacteria 770
586 Ga0439432_245977 3300042006 Bacteria 513
587 Ga0439455_0216883 3300042012 Bacteria 556
588 Ga0439458_0006326 3300042157 Bacteria 2642
589 Ga0439459_0016638 3300042438 Bacteria 1361
590 Ga0495617_145691 3300046452 Bacteria 754
591 Ga0495617_150450 3300046452 Bacteria 740
592 Ga0495627_186131 3300046453 Bacteria 574
593 Ga0495592_0057556 3300046454 Bacteria 2869
594 Ga0495603_0039874 3300046455 Bacteria 2812
595 Ga0495603_0118114 3300046455 Bacteria 1546
596 Ga0495603_0345112 3300046455 Bacteria 854
597 Ga0495603_0440470 3300046455 Bacteria 746
598 Ga0495603_0457443 3300046455 Bacteria 731
599 Ga0495590_0025430 3300046457 Bacteria 2081
600 Ga0495629_0020761 3300046459 Bacteria 4689
601 Ga0495629_0190983 3300046459 Bacteria 1418
602 Ga0495638_0081554 3300046460 Bacteria 1963
603 Ga0495638_0367911 3300046460 Bacteria 754
604 Ga0495638_0460730 3300046460 Bacteria 647
605 Ga0495638_0483190 3300046460 Bacteria 627
606 Ga0495638_0668854 3300046460 Bacteria 503
607 Ga0495641_0054725 3300046461 Bacteria 1813
608 Ga0495651_0008596 3300046462 Bacteria 7826
609 Ga0495653_0011458 3300046463 Bacteria 7248
610 Ga0495605_0204487 3300046474 Bacteria 859
611 Ga0495605_0346504 3300046474 Bacteria 623
612 Ga0495639_0025648 3300046475 Bacteria 2601
613 Ga0495639_0135753 3300046475 Bacteria 1180
614 Ga0495639_0199919 3300046475 Bacteria 978
615 Ga0495662_0162971 3300046476 Bacteria 1099
616 Ga0495584_0073198 3300046491 Bacteria 1722
617 Ga0495584_0258183 3300046491 Bacteria 886
618 Ga0495584_0289011 3300046491 Bacteria 833
619 Ga0495584_0381139 3300046491 Bacteria 716
620 Ga0495584_0483958 3300046491 Bacteria 630
621 Ga0495585_0112290 3300046492 Bacteria 1448
622 Ga0495585_0178391 3300046492 Bacteria 1093
623 Ga0495585_0202707 3300046492 Bacteria 1009
624 Ga0495585_0397616 3300046492 Bacteria 664
625 Ga0495585_0496927 3300046492 Bacteria 580
626 Ga0495585_0585245 3300046492 Bacteria 526
627 Ga0495594_0078615 3300046499 Bacteria 1841
628 Ga0495594_0181820 3300046499 Bacteria 1197
629 Ga0495596_0176392 3300046500 Bacteria 831
630 Ga0495607_0247350 3300046501 Bacteria 860
631 Ga0495583_0158787 3300046506 Bacteria 934
632 Ga0495606_0239455 3300046507 Bacteria 1013
633 Ga0495608_0053059 3300046511 Bacteria 2682
634 Ga0495616_0053771 3300046513 Bacteria 2000
635 Ga0495616_0165665 3300046513 Bacteria 991
636 Ga0495620_0243584 3300046515 Bacteria 686
637 Ga0495620_0279637 3300046515 Bacteria 635
638 Ga0495628_0028732 3300046516 Bacteria 4516
639 Ga0495628_1188561 3300046516 Bacteria 518
640 Ga0495630_1074256 3300046517 Bacteria 611
641 Ga0495630_1081299 3300046517 Bacteria 608
642 Ga0495631_0155404 3300046518 Bacteria 981
643 Ga0495631_0239687 3300046518 Bacteria 773
644 Ga0495632_0160574 3300046519 Bacteria 1035
645 Ga0495632_0176930 3300046519 Bacteria 978
646 Ga0495632_0424480 3300046519 Bacteria 579
647 Ga0495643_0423054 3300046522 Bacteria 584
648 Ga0495644_0106937 3300046523 Bacteria 1060
649 Ga0495644_0141567 3300046523 Bacteria 919
650 Ga0495644_0261308 3300046523 Bacteria 673
651 Ga0495648_0464139 3300046524 Bacteria 551
652 Ga0495663_0373436 3300046525 Bacteria 522
653 Ga0495663_0375278 3300046525 Bacteria 521
654 Ga0495642_0312781 3300046528 Bacteria 689
655 Ga0495665_0339538 3300046531 Bacteria 766
656 Ga0495640_0042188 3300046533 Bacteria 3185
657 Ga0495587_0012371 3300046536 Bacteria 5374
658 Ga0495598_0004434 3300046537 Bacteria 3039
659 Ga0495598_0174484 3300046537 Bacteria 764
660 Ga0495609_0070712 3300046538 Bacteria 1534
661 Ga0495609_0266634 3300046538 Bacteria 703
662 Ga0495609_0271793 3300046538 Bacteria 694
663 Ga0495621_0016074 3300046539 Bacteria 2396
664 Ga0495621_0369533 3300046539 Bacteria 604
665 Ga0495597_0357348 3300046542 Bacteria 560
666 Ga0495645_0010840 3300046543 Bacteria 6404
667 Ga0495622_0275439 3300046557 Bacteria 737
668 Ga0495622_0390466 3300046557 Bacteria 600
669 Ga0495633_0126144 3300046558 Bacteria 1184
670 Ga0495667_0024237 3300046559 Bacteria 4086
671 Ga0495656_0055503 3300046615 Bacteria 1708
672 Ga0495656_0271785 3300046615 Bacteria 861
673 Ga0495656_0792937 3300046615 Bacteria 512
674 Ga0495668_0721987 3300046616 Bacteria 551
675 Ga0495634_0168770 3300046642 Bacteria 1376
676 Ga0495611_0105738 3300046648 Bacteria 1309
677 Ga0495611_0254611 3300046648 Bacteria 813
678 Ga0495611_0582773 3300046648 Bacteria 506
679 Ga0495625_0427600 3300046660 Bacteria 822
680 Ga0495625_0431554 3300046660 Bacteria 817
681 Ga0495625_0541184 3300046660 Bacteria 706
682 Ga0495625_0741104 3300046660 Bacteria 577
683 Ga0495635_0347664 3300046663 Bacteria 989
684 Ga0495635_0406884 3300046663 Bacteria 903
685 Ga0495659_0041415 3300046664 Bacteria 1645
686 Ga0495659_0151620 3300046664 Bacteria 931
687 Ga0495661_0090327 3300046665 Bacteria 1744
688 Ga0495661_0231827 3300046665 Bacteria 952
689 Ga0495588_0141656 3300046674 Bacteria 1270
690 Ga0495588_0397237 3300046674 Bacteria 724
691 Ga0495657_0007252 3300046675 Bacteria 8588
692 Ga0495599_0002825 3300046678 Bacteria 10116
693 Ga0495623_0015241 3300046679 Bacteria 4968
694 Ga0495646_0033961 3300046680 Bacteria 3171
695 Ga0495647_0198985 3300046681 Bacteria 878
696 Ga0495647_0387704 3300046681 Bacteria 640
697 Ga0495669_0148103 3300046684 Bacteria 1110
698 Ga0495669_0240662 3300046684 Bacteria 869
699 Ga0495613_0073541 3300046689 Bacteria 2490
700 Ga0495624_0627969 3300046690 Bacteria 640
701 Ga0495670_0030985 3300046691 Bacteria 2657
702 Ga0495670_0108591 3300046691 Bacteria 1434
703 Ga0495670_0451177 3300046691 Bacteria 697
704 Ga0495671_0202386 3300046692 Bacteria 963
705 Ga0495671_0379939 3300046692 Bacteria 677
706 Ga0495671_0523763 3300046692 Bacteria 565
707 Ga0495649_0449899 3300046694 Bacteria 643
708 Ga0495589_0111956 3300046794 Bacteria 1317
709 Ga0495600_0003921 3300046809 Bacteria 8839
710 Ga0495660_0181812 3300046810 Bacteria 1017
711 Ga0495581_0058882 3300047315 Bacteria 2219
712 Ga0495581_0122573 3300047315 Bacteria 1513
713 Ga0495581_0315785 3300047315 Bacteria 913
714 Ga0495604_0005861 3300047317 Bacteria 9740
715 Ga0495604_0616890 3300047317 Bacteria 694
716 Ga0495636_0129559 3300047318 Bacteria 1121
717 Ga0495674_0082073 3300047319 Bacteria 2764
718 Ga0495674_0824366 3300047319 Bacteria 720
719 Ga0495672_0375925 3300047320 Bacteria 654
720 Ga0495672_0461462 3300047320 Bacteria 571
721 Ga0495676_0201194 3300047321 Bacteria 1384
722 Ga0495680_0001522 3300047322 Bacteria 24794
723 Ga0495680_0377854 3300047322 Bacteria 982
724 Ga0495683_0420265 3300047323 Bacteria 553
725 Ga0495675_0006723 3300047444 Bacteria 7049
726 Ga0495677_0181089 3300047445 Bacteria 817
727 Ga0495677_0230312 3300047445 Bacteria 723
728 Ga0495685_057865 3300047447 Bacteria 1309
729 Ga0495673_0234741 3300047469 Bacteria 674
730 Ga0495684_0074166 3300047471 Bacteria 2585
731 Ga0495602_0001750 3300048088 Bacteria 21663
732 Ga0495615_0126364 3300048090 Bacteria 744
733 Ga0495626_0337125 3300048091 Bacteria 590
734 Ga0495626_0381127 3300048091 Bacteria 547
735 Ga0496100_0381915 3300048903 Bacteria 1070
736 Ga0496100_0458312 3300048903 Bacteria 978
737 Ga0496100_0635636 3300048903 Bacteria 830
738 Ga0496100_1119100 3300048903 Bacteria 621
739 Ga0496100_1226856 3300048903 Bacteria 592
740 Ga0496101_0495424 3300048904 Bacteria 965
741 Ga0496101_0730099 3300048904 Bacteria 782
742 Ga0496101_1364437 3300048904 Bacteria 553
743 Ga0496102_0079460 3300048905 Bacteria 3021
744 Ga0496102_0350735 3300048905 Bacteria 1389
745 Ga0496102_0417472 3300048905 Bacteria 1260
746 Ga0496102_0662696 3300048905 Bacteria 967
747 Ga0496103_0186452 3300048906 Bacteria 1334
748 Ga0496103_0861930 3300048906 Bacteria 569
749 Ga0496103_1037723 3300048906 Bacteria 509
750 Ga0496104_0334621 3300048907 Bacteria 1427
751 Ga0496104_0521419 3300048907 Bacteria 1099
752 Ga0496104_0808724 3300048907 Bacteria 843
753 Ga0496105_0684186 3300048908 Bacteria 789
754 Ga0496105_1006191 3300048908 Bacteria 623
755 Ga0496106_0139359 3300048909 Bacteria 1907
756 Ga0496106_0403720 3300048909 Bacteria 1098
757 Ga0496106_0556350 3300048909 Bacteria 920
758 Ga0496107_0060688 3300048910 Bacteria 2737
759 Ga0496107_0135556 3300048910 Bacteria 1819
760 Ga0496107_0328977 3300048910 Bacteria 1137
761 Ga0496107_0337220 3300048910 Bacteria 1122
762 Ga0496107_0393331 3300048910 Bacteria 1031
763 Ga0496107_0753291 3300048910 Bacteria 715
764 Ga0496108_0503338 3300048911 Bacteria 1058
765 Ga0496108_0672172 3300048911 Bacteria 899
766 Ga0496108_1101983 3300048911 Bacteria 675
767 Ga0496109_0080056 3300048912 Bacteria 3010
768 Ga0496109_0410851 3300048912 Bacteria 1279
769 Ga0496109_0442118 3300048912 Bacteria 1228
770 Ga0496109_1439735 3300048912 Bacteria 624
771 Ga0496110_0105390 3300048913 Bacteria 2530
772 Ga0496110_0276788 3300048913 Bacteria 1528
773 Ga0496110_0700606 3300048913 Bacteria 914
774 Ga0496111_0126160 3300048914 Bacteria 1892
775 Ga0496111_0443515 3300048914 Bacteria 958
776 Ga0496111_0553262 3300048914 Bacteria 845
777 Ga0496112_0015821 3300048915 Bacteria 7050
778 Ga0496113_0110981 3300048916 Bacteria 2135
779 Ga0496113_0633948 3300048916 Bacteria 855
780 Ga0496114_0106665 3300048917 Bacteria 2397
781 Ga0496114_0293135 3300048917 Bacteria 1436
782 Ga0496114_0424078 3300048917 Bacteria 1178
783 Ga0496114_1183151 3300048917 Bacteria 650
784 Ga0496115_0087110 3300048918 Bacteria 2548
785 Ga0496115_0464430 3300048918 Bacteria 1021
786 Ga0496115_1101547 3300048918 Bacteria 602
787 Ga0496117_0338331 3300048920 Bacteria 782
788 Ga0496117_0516645 3300048920 Bacteria 576
789 Ga0496118_0238172 3300048921 Bacteria 1044
790 Ga0496118_0310414 3300048921 Bacteria 861
791 Ga0496118_0501983 3300048921 Bacteria 603
792 Ga0496121_0042723 3300048924 Bacteria 3938
793 Ga0496121_0078242 3300048924 Bacteria 2630
794 Ga0496121_0099226 3300048924 Bacteria 2251
795 Ga0496121_0233269 3300048924 Bacteria 1287
796 Ga0496124_0187296 3300048927 Bacteria 1587
797 Ga0496124_0306926 3300048927 Bacteria 1143
798 Ga0496124_0532062 3300048927 Bacteria 780
799 Ga0496124_0902349 3300048927 Bacteria 536
800 Ga0496125_0073110 3300048928 Bacteria 2668
801 Ga0496125_0079566 3300048928 Bacteria 2514
802 Ga0496125_0086249 3300048928 Bacteria 2375
803 Ga0496126_0118734 3300048929 Bacteria 2295
804 Ga0496126_0132628 3300048929 Bacteria 2151
805 Ga0496126_0139501 3300048929 Bacteria 2088
806 Ga0496126_0146983 3300048929 Bacteria 2023
807 Ga0496126_0682233 3300048929 Bacteria 800
808 Ga0496126_0876728 3300048929 Bacteria 682
809 Ga0496126_0960872 3300048929 Bacteria 644
810 Ga0495678_194411 3300049459 Bacteria 629
811 Ga0495678_237866 3300049459 Bacteria 546
812 Ga0495682_0050200 3300049460 Bacteria 1519
813 Ga0495682_0369512 3300049460 Bacteria 505
814 Ga0501041_0521119 3300049577 Bacteria 757
815 Ga0501042_1265434 3300049578 Bacteria 538
816 Ga0501067_0045663 3300049583 Bacteria 2432
817 Ga0501067_0352762 3300049583 Bacteria 820
818 Ga0501070_0462619 3300049586 Bacteria 1022
819 Ga0501076_1212260 3300049592 Bacteria 621
820 nmdc:mga03683_480212_c1 3300050489 Bacteria 600
821 nmdc:mga03n38_1067_c1 3300050490 Bacteria 7562
822 nmdc:mga03n38_322482_c1 3300050490 Bacteria 834
823 nmdc:mga03n38_623034_c1 3300050490 Bacteria 616
824 nmdc:mga03n38_767608_c1 3300050490 Bacteria 559
825 nmdc:mga00v17_1070399_c1 3300050491 Bacteria 506
826 nmdc:mga00v17_64900_c1 3300050491 Bacteria 2251
827 nmdc:mga0yw44_1175725_c1 3300050492 Bacteria 518
828 nmdc:mga0yw44_257717_c1 3300050492 Bacteria 1162
829 nmdc:mga0yw44_854354_c1 3300050492 Bacteria 618
830 nmdc:mga0k408_100728_c1 3300050493 Bacteria 1703
831 nmdc:mga0k408_329096_c1 3300050493 Bacteria 911
832 nmdc:mga0k408_369536_c1 3300050493 Bacteria 855
833 nmdc:mga06z11_120553_c1 3300050494 Bacteria 1463
834 nmdc:mga06z11_20863_c1 3300050494 Bacteria 3035
835 nmdc:mga06z11_293434_c1 3300050494 Bacteria 965
836 nmdc:mga06z11_386337_c1 3300050494 Bacteria 841
837 nmdc:mga06z11_696733_c1 3300050494 Bacteria 619
838 nmdc:mga06z11_78800_c1 3300050494 Bacteria 1762
839 nmdc:mga04h51_125614_c1 3300050495 Bacteria 960
840 nmdc:mga07m45_16937_c1 3300050496 Bacteria 3907
841 nmdc:mga07m45_21740_c2 3300050496 Bacteria 3072
842 nmdc:mga07m45_341618_c1 3300050496 Bacteria 870
843 nmdc:mga05p37_143726_c1 3300050507 Bacteria 2922
844 nmdc:mga0qj67_332577_c1 3300050509 Bacteria 1229
845 nmdc:mga08y16_1794101_c1 3300050511 Bacteria 567
846 nmdc:mga08y16_436020_c1 3300050511 Bacteria 1338
847 nmdc:mga0n895_505352_c1 3300050512 Bacteria 1217
848 nmdc:mga0sz30_143972_c1 3300050516 Bacteria 1053
849 nmdc:mga0sz30_147995_c1 3300050516 Bacteria 1038
850 Ga0500635_0233802 3300053080 Bacteria 719
851 Ga0495619_0094058 3300053085 Bacteria 2033
852 Ga0500578_0532144 3300053086 Bacteria 656
853 Ga0500643_033895 3300053087 Bacteria 1541
854 Ga0500644_0333573 3300053088 Bacteria 654
855 Ga0500644_0477634 3300053088 Bacteria 548
856 Ga0500581_383852 3300053089 Bacteria 517
857 Ga0500646_0163014 3300053090 Bacteria 745
858 Ga0500583_0102572 3300053092 Bacteria 1403
859 Ga0500583_0331307 3300053092 Bacteria 740
860 Ga0500566_0160646 3300053094 Bacteria 1171
861 Ga0500641_0039046 3300053096 Bacteria 1910
862 Ga0500641_0266252 3300053096 Unclassified 714
863 Ga0500650_0157523 3300053098 Bacteria 1048
864 Ga0500650_0518770 3300053098 Bacteria 505
865 Ga0500554_003538 3300053102 Bacteria 3213
866 Ga0500555_046099 3300053103 Bacteria 1203
867 Ga0500569_005357 3300053109 Bacteria 2755
868 Ga0500594_0267308 3300053118 Bacteria 571
869 Ga0500595_002860 3300053119 Bacteria 8295
870 Ga0500595_037030 3300053119 Bacteria 1594
871 Ga0500595_085627 3300053119 Unclassified 918
872 Ga0500617_194072 3300053124 Bacteria 752
873 Ga0500642_0130394 3300053130 Bacteria 1178
874 Ga0500652_393304 3300053131 Bacteria 515
875 Ga0500655_021840 3300053133 Bacteria 1202
876 Ga0500658_0395752 3300053134 Bacteria 632
877 Ga0500561_0040549 3300053137 Bacteria 1227
878 Ga0500568_0147634 3300053139 Bacteria 871
879 Ga0500589_239843 3300053147 Bacteria 671
880 Ga0500590_171531 3300053148 Bacteria 953
881 Ga0500604_0070167 3300053151 Bacteria 1116
882 Ga0500622_0147805 3300053156 Bacteria 1114
883 Ga0500627_0258138 3300053158 Bacteria 770
884 Ga0500627_0310427 3300053158 Bacteria 687
885 Ga0500633_0181184 3300053160 Bacteria 790
886 Ga0500638_119127 3300053162 Bacteria 1209
887 Ga0500638_287726 3300053162 Bacteria 641
888 Ga0500636_0447704 3300053177 Bacteria 585
889 Ga0500637_0000062 3300053178 Bacteria 38276
890 Ga0500645_019135 3300053730 Bacteria 2133
891 Ga0500609_003893 3300053731 Bacteria 2081
892 Ga0501084_0616355 3300054114 Bacteria 917
893 Ga0500661_051289 3300055283 Bacteria 737
894 Ga0501082_0904658 3300060353 Bacteria 772
895 2513922262 2513237145 Bacteria 8979722
896 2517893965 2517572143 Bacteria 9484767
897 2524536229 2524023228 Bacteria 10118060
898 2885377708 2885374607 Bacteria 8927485
899 2906661650 2906660503 Bacteria 8595048
900 JGI25404J52841_10020075
901 JGI24750J21931_1063716
902 JGI25404J52841_10086732
903 JGI25404J52841_10089819
904 JGI25405J52794_10053409
905 Ga0065704_10291389
906 Ga0070676_10254546
907 Ga0070676_10885810
908 Ga0070670_101255782
909 Ga0070670_101616771
910 Ga0070677_10329297
911 Ga0068869_100022457
912 Ga0068869_100234483
913 Ga0068869_100325443
914 Ga0068869_100645955
915 Ga0068869_101156041
916 Ga0068869_101498523
917 Ga0070666_10576734
918 Ga0070666_11001583
919 Ga0070680_100143353
920 Ga0070682_100148048
921 Ga0070682_100231959
922 Ga0070682_101373420
923 Ga0068868_100025242
924 Ga0068868_100342519
925 Ga0068868_100408876
926 Ga0068868_101026390
927 Ga0070660_100528569
928 Ga0070660_100724166
929 Ga0070661_100075544
930 Ga0070661_100280876
931 Ga0070661_100628896
932 Ga0070661_101910385
933 Ga0070692_10137216
934 Ga0070668_100106814
935 Ga0070668_100184180
936 Ga0070668_100243510
937 Ga0070668_100358763
938 Ga0070668_100634126
939 Ga0070668_100976079
940 Ga0070668_101532733
941 Ga0070668_101776976
942 Ga0070669_100192217
943 Ga0070669_100343077
944 Ga0070675_100115054
945 Ga0070671_100152319
946 Ga0070671_100214030
947 Ga0070671_100681684
948 Ga0070674_100047450
949 Ga0070674_101810759
950 Ga0070674_102040281
951 Ga0070673_100262197
952 Ga0070673_100457493
953 Ga0070673_101290513
954 Ga0070688_100333542
955 Ga0070688_100524655
956 Ga0070688_101132787
957 Ga0070688_101426362
958 Ga0070688_101488297
959 Ga0070667_100122574
960 Ga0070667_100222701
961 Ga0070667_100974103
962 Ga0070667_101245515
963 Ga0070667_101987902
964 Ga0070713_101439385
965 Ga0070710_11454091
966 Ga0070701_10600053
967 Ga0070705_101241216
968 Ga0070700_100140348
969 Ga0070700_100250694
970 Ga0070700_100707362
971 Ga0070694_100575193
972 Ga0070708_100565092
973 Ga0070663_100032177
974 Ga0070663_100056770
975 Ga0070663_100059318
976 Ga0070663_100247633
977 Ga0070663_100352015
978 Ga0070663_100453029
979 Ga0070663_100837840
980 Ga0070678_100456063
981 Ga0070678_101252814
982 Ga0070678_101666803
983 Ga0070662_100029629
984 Ga0070662_100039118
985 Ga0070662_100156041
986 Ga0068867_100749189
987 Ga0068867_102238852
988 Ga0070685_10167204
989 Ga0070706_101510350
990 Ga0070698_102194006
991 Ga0070699_100080931
992 Ga0070699_101931067
993 Ga0070679_100020630
994 Ga0070684_100402251
995 Ga0070684_101183682
996 Ga0068853_100525878
997 Ga0068853_100672379
998 Ga0068853_101022919
999 Ga0068853_101035842
1000 Ga0068853_101846570
1001 Ga0070672_100293279
1002 Ga0070672_100524122
1003 Ga0070672_101674946
1004 Ga0070672_102053987
1005 Ga0070686_100525692
1006 Ga0070686_100780349
1007 Ga0070695_100114704
1008 Ga0070696_100063359
1009 Ga0070693_100046497
1010 Ga0070693_100139380
1011 Ga0070693_100794388
1012 Ga0070665_100038703
1013 Ga0070665_100226329
1014 Ga0070665_100385760
1015 Ga0070665_100414491
1016 Ga0070665_100623255
1017 Ga0070665_100845118
1018 Ga0070665_100939182
1019 Ga0070665_101366900
1020 Ga0070665_102134373
1021 Ga0070665_102546763
1022 Ga0070665_102630934
1023 Ga0070704_100252626
1024 Ga0070704_100591969
1025 Ga0068855_100051184
1026 Ga0070664_100456578
1027 Ga0070664_100672832
1028 Ga0068857_100096764
1029 Ga0068857_101491799
1030 Ga0068857_102365128
1031 Ga0068854_101033528
1032 Ga0068854_101618028
1033 Ga0068854_102107076
1034 Ga0068856_100102808
1035 Ga0068856_101296636
1036 Ga0070702_100164980
1037 Ga0070702_100280141
1038 Ga0068852_100339414
1039 Ga0068852_100557679
1040 Ga0068852_101328146
1041 Ga0068859_100431216
1042 Ga0068859_100480800
1043 Ga0068859_101165099
1044 Ga0068864_100299886
1045 Ga0068864_100612111
1046 Ga0068864_101552507
1047 Ga0068866_10239733
1048 Ga0068866_10273947
1049 Ga0068866_10327473
1050 Ga0068866_10407552
1051 Ga0068861_100047496
1052 Ga0068861_100054038
1053 Ga0068861_100298459
1054 Ga0068861_100745095
1055 Ga0068861_101267079
1056 Ga0068861_102284420
1057 Ga0068870_10192423
1058 Ga0068863_100243017
1059 Ga0068863_100543550
1060 Ga0068863_100703317
1061 Ga0068858_100167069
1062 Ga0068858_100182359
1063 Ga0068858_100813791
1064 Ga0068858_100899214
1065 Ga0068858_101245211
1066 Ga0068858_101791553
1067 Ga0068860_100077074
1068 Ga0068860_100090881
1069 Ga0068860_100316697
1070 Ga0068860_101051773
1071 Ga0068862_100103920
1072 Ga0068862_100363372
1073 Ga0068862_100511353
1074 Ga0068862_101037297
1075 Ga0068862_101703658
1076 Ga0081455_10003995
1077 Ga0081455_10019965
1078 Ga0081455_10064244
1079 Ga0081538_10041272
1080 Ga0081538_10162220
1081 Ga0081540_1002099
1082 Ga0081540_1006105
1083 Ga0081540_1006738
1084 Ga0081540_1009970
1085 Ga0081540_1017433
1086 Ga0081540_1050424
1087 Ga0081540_1116574
1088 Ga0081540_1271657
1089 Ga0081539_10023891
1090 Ga0081539_10335508
1091 Ga0070717_11916094
1092 Ga0075365_10025630
1093 Ga0075365_10113102
1094 Ga0075365_10128086
1095 Ga0075365_10158995
1096 Ga0075365_10805512
1097 Ga0075365_10964595
1098 Ga0075368_10022671
1099 Ga0075368_10159657
1100 Ga0075368_10272832
1101 Ga0075368_10308691
1102 Ga0075363_100046039
1103 Ga0075363_100080606
1104 Ga0075363_100117239
1105 Ga0075363_100541528
1106 Ga0075363_100860077
1107 Ga0075363_101026821
1108 Ga0075364_10080844
1109 Ga0075364_10647712
1110 Ga0075362_10105284
1111 Ga0075362_10292131
1112 Ga0075367_10015463
1113 Ga0075367_10043099
1114 Ga0075367_10112960
1115 Ga0075367_10243595
1116 Ga0075367_10440174
1117 Ga0075367_10513379
1118 Ga0075369_10053175
1119 Ga0075369_10185589
1120 Ga0075369_10333852
1121 Ga0075369_10388016
1122 Ga0075427_10056118
1123 Ga0075366_10015050
1124 Ga0075366_10046842
1125 Ga0075366_10197681
1126 Ga0075366_10221433
1127 Ga0075366_10611261
1128 Ga0075366_10639888
1129 Ga0097621_100098212
1130 Ga0075370_10030613
1131 Ga0075370_10094913
1132 Ga0075370_10249667
1133 Ga0068871_100047302
1134 Ga0068871_100937039
1135 Ga0068871_102086265
1136 Ga0075428_100589376
1137 Ga0075428_100971543
1138 Ga0075428_102360152
1139 Ga0068865_100050123
1140 Ga0068865_100480430
1141 Ga0068865_101078415
1142 Ga0075436_100959167
1143 Ga0097620_100431218
1144 Ga0097620_100480757
1145 Ga0097620_100759179
1146 Ga0097620_101165121
1147 Ga0075435_100219365
1148 Ga0105250_10180349
1149 Ga0105250_10213179
1150 Ga0105250_10284044
1151 Ga0105240_10015803
1152 Ga0111539_10232467
1153 Ga0111539_11145731
1154 Ga0111539_11827474
1155 Ga0111539_13538147
1156 Ga0105245_10017277
1157 Ga0105245_10025876
1158 Ga0105245_10410492
1159 Ga0105245_10528901
1160 Ga0105245_11510157
1161 Ga0105245_11739388
1162 Ga0105245_12148937
1163 Ga0105247_10083942
1164 Ga0105247_10182625
1165 Ga0105247_11008634
1166 Ga0105247_11359690
1167 Ga0105247_11771792
1168 Ga0114129_10036995
1169 Ga0105243_10055909
1170 Ga0105243_10199341
1171 Ga0105243_12956694
1172 Ga0105241_10016103
1173 Ga0105241_10307345
1174 Ga0105241_11810040
1175 Ga0105241_12104652
1176 Ga0105242_10077045
1177 Ga0105242_10728358
1178 Ga0105242_13052211
1179 Ga0105248_10010641
1180 Ga0105248_10655583
1181 Ga0105248_11581983
1182 Ga0105248_11740456
1183 Ga0105237_10195796
1184 Ga0105237_10513708
1185 Ga0105237_10538371
1186 Ga0105237_11339246
1187 Ga0105238_10967443
1188 Ga0105249_10082231
1189 Ga0105249_10429612
1190 Ga0105249_10450935
1191 Ga0105249_11211510
1192 Ga0105249_11656056
1193 Ga0105249_12044066
1194 Ga0105239_10040125
1195 Ga0105239_10671255
1196 Ga0105239_10761082
1197 Ga0105239_10775025
1198 Ga0105239_11872113
1199 Ga0105246_10411560
1200 Ga0105246_10871835
1201 Ga0105246_11428033
1202 Ga0105246_11703801
1203 Ga0105246_11957788
1204 Ga0157316_1041606
1205 Ga0157373_10904221
1206 Ga0157370_10013913
1207 Ga0157374_10091309
1208 Ga0157374_10956249
1209 Ga0157374_11969054
1210 Ga0157378_10012035
1211 Ga0157378_10463462
1212 Ga0157378_11034925
1213 Ga0157378_11075558
1214 Ga0157378_13024096
1215 Ga0163162_10137630
1216 Ga0163162_10700040
1217 Ga0163162_10765325
1218 Ga0163162_10873623
1219 Ga0163162_10881257
1220 Ga0163162_11510975
1221 Ga0157372_12161229
1222 Ga0157375_10410646
1223 Ga0157375_10784399
1224 Ga0157375_10804621
1225 Ga0157375_10990532
1226 Ga0157375_11050399
1227 Ga0157375_12268264
1228 Ga0163163_10083521
1229 Ga0163163_10232278
1230 Ga0163163_11516834
1231 Ga0163163_11858301
1232 Ga0157380_10012550
1233 Ga0157380_10137534
1234 Ga0157380_11026820
1235 Ga0157380_11271942
1236 Ga0157380_11501288
1237 Ga0157380_11594277
1238 Ga0157380_11795523
1239 Ga0157377_10048461
1240 Ga0157377_10283469
1241 Ga0157377_10678866
1242 Ga0157379_10359698
1243 Ga0157379_10417491
1244 Ga0157379_10897059
1245 Ga0157379_11047476
1246 Ga0157379_11264222
1247 Ga0157379_12392540
1248 Ga0157376_10012146
1249 Ga0157376_10838083
1250 Ga0182007_10346764
1251 Ga0163161_10356501
1252 Ga0163161_10534156
1253 Ga0163161_11119148
1254 Ga0209758_1005746
1255 Ga0207642_10201314
1256 Ga0207642_10202079
1257 Ga0207642_10268988
1258 Ga0207642_10375008
1259 Ga0207710_10733667
1260 Ga0207688_10089754
1261 Ga0207688_10812362
1262 Ga0207680_10082079
1263 Ga0207647_10373631
1264 Ga0207645_10090974
1265 Ga0207645_10159554
1266 Ga0207645_10199479
1267 Ga0207654_10123514
1268 Ga0207654_11299350
1269 Ga0207695_10070992
1270 Ga0207671_10154582
1271 Ga0207671_10234906
1272 Ga0207671_10956735
1273 Ga0207671_10959907
1274 Ga0207660_10794030
1275 Ga0207660_11079082
1276 Ga0207662_11235552
1277 Ga0207657_10270599
1278 Ga0207657_10454916
1279 Ga0207657_10763017
1280 Ga0207649_10112627
1281 Ga0207649_10349868
1282 Ga0207649_11284721
1283 Ga0207652_11378853
1284 Ga0207681_10219202
1285 Ga0207681_10304229
1286 Ga0207681_10391697
1287 Ga0207681_10846419
1288 Ga0207681_10927658
1289 Ga0207694_10725015
1290 Ga0207694_11263988
1291 Ga0207650_10252449
1292 Ga0207650_11501945
1293 Ga0207659_10854660
1294 Ga0207659_11746348
1295 Ga0207687_10009640
1296 Ga0207687_10041544
1297 Ga0207687_10443853
1298 Ga0207687_10450684
1299 Ga0207687_10529265
1300 Ga0207644_10178001
1301 Ga0207644_10256680
1302 Ga0207644_10607087
1303 Ga0207690_10865642
1304 Ga0207706_10031987
1305 Ga0207706_10087328
1306 Ga0207706_10178730
1307 Ga0207686_10276830
1308 Ga0207709_10082988
1309 Ga0207709_10465142
1310 Ga0207709_10529068
1311 Ga0207670_10276866
1312 Ga0207670_10375033
1313 Ga0207670_11731676
1314 Ga0207669_10009063
1315 Ga0207704_10258500
1316 Ga0207704_10522848
1317 Ga0207691_10303419
1318 Ga0207691_10432241
1319 Ga0207691_10710904
1320 Ga0207691_11611962
1321 Ga0207711_10087575
1322 Ga0207711_11124915
1323 Ga0207711_11277611
1324 Ga0207711_11592254
1325 Ga0207689_10039747
1326 Ga0207689_10437870
1327 Ga0207689_10697738
1328 Ga0207689_11382108
1329 Ga0207689_11420073
1330 Ga0207689_11795764
1331 Ga0207679_10143432
1332 Ga0207679_10447914
1333 Ga0207679_10594044
1334 Ga0207679_10786901
1335 Ga0207667_10275684
1336 Ga0207667_11216481
1337 Ga0207651_11130857
1338 Ga0207712_10070979
1339 Ga0207712_10423930
1340 Ga0207712_10722670
1341 Ga0207712_11373362
1342 Ga0207712_12108884
1343 Ga0207668_10172530
1344 Ga0207668_10338299
1345 Ga0207668_10342443
1346 Ga0207668_10629413
1347 Ga0207668_10637679
1348 Ga0207668_11386302
1349 Ga0207640_11770737
1350 Ga0207658_10243757
1351 Ga0207658_10660801
1352 Ga0207658_11352071
1353 Ga0207658_11406909
1354 Ga0207677_10232251
1355 Ga0207677_10282751
1356 Ga0207677_10291482
1357 Ga0207703_10639810
1358 Ga0207703_10881995
1359 Ga0207703_11245827
1360 Ga0207703_11508921
1361 Ga0207703_11575542
1362 Ga0207639_10447956
1363 Ga0207639_10678459
1364 Ga0207639_10812879
1365 Ga0207678_10051444
1366 Ga0207678_10063387
1367 Ga0207678_10092171
1368 Ga0207678_10147209
1369 Ga0207678_10180089
1370 Ga0207678_10214716
1371 Ga0207678_10669982
1372 Ga0207708_10174930
1373 Ga0207708_10394433
1374 Ga0207702_10102473
1375 Ga0207702_11073086
1376 Ga0207641_10473595
1377 Ga0207641_11015842
1378 Ga0207641_12290164
1379 Ga0207641_12377408
1380 Ga0207648_10112121
1381 Ga0207648_11030275
1382 Ga0207676_10609705
1383 Ga0207676_10611027
1384 Ga0207676_11031665
1385 Ga0207676_11930264
1386 Ga0207674_10314585
1387 Ga0207674_10590070
1388 Ga0207674_11282155
1389 Ga0207674_11546411
1390 Ga0207675_100034357
1391 Ga0207675_100069403
1392 Ga0207675_100413405
1393 Ga0207675_100432368
1394 Ga0207675_100763838
1395 Ga0207675_100938726
1396 Ga0207683_10113245
1397 Ga0207683_10196753
1398 Ga0207683_10449054
1399 Ga0207683_10764672
1400 Ga0207683_10921190
1401 Ga0207683_11029509
1402 Ga0207683_11161755
1403 Ga0207683_11277276
1404 Ga0207683_11691975
1405 Ga0207683_11966733
1406 Ga0207698_10737249
1407 Ga0207698_11481625
1408 Ga0207698_12281828
1409 Ga0209813_10176540
1410 Ga0209813_10197810
1411 Ga0207428_10526484
1412 Ga0268266_10009936
1413 Ga0268266_10011388
1414 Ga0268266_10041009
1415 Ga0268266_10206372
1416 Ga0268266_10253514
1417 Ga0268266_10594948
1418 Ga0268266_11123193
1419 Ga0268266_11232348
1420 Ga0268266_11304839
1421 Ga0268266_11772707
1422 Ga0268265_10121523
1423 Ga0268265_10141099
1424 Ga0268265_10295028
1425 Ga0268265_10412044
1426 Ga0268265_11112738
1427 Ga0268265_11488041
1428 Ga0268264_10047902
1429 Ga0268264_10231416
1430 Ga0268264_10257732
1431 Ga0268264_12063577
1432 Ga0268264_12657901
1433 Ga0307517_10226441
1434 Ga0307517_10404598
1435 Ga0307517_10469614
1436 Ga0307515_10329175
1437 Ga0307515_10371718
1438 Ga0307513_10661701
1439 Ga0307509_10502101
1440 Ga0307408_100460628
1441 Ga0307508_10814183
1442 Ga0307405_10143234
1443 Ga0307405_10324623
1444 Ga0307413_10075340
1445 Ga0307413_10185431
1446 Ga0307410_10104856
1447 Ga0307410_10578577
1448 Ga0307412_10148175
1449 Ga0307409_101079452
1450 Ga0307409_102560358
1451 Ga0307416_100466605
1452 Ga0307416_100500057
1453 Ga0307414_10775625
1454 Ga0307411_10478120
1455 Ga0307411_10499662
1456 Ga0307411_11867438
1457 Ga0307415_100209972
1458 Ga0307415_101325347
1459 Ga0307415_101403552
1460 Ga0373959_0021634
1461 Ga0373940_0238350
1462 Ga0373936_0366631
1463 Ga0373943_0818177
1464 Ga0373947_1042988
1465 Ga0373937_0350723
1466 Ga0373925_0318763
1467 Ga0373925_0609747
1468 Ga0395900_0125097
1469 Ga0395898_0530060
1470 Ga0395901_1040948
1471 Ga0439465_0136530
1472 Ga0439465_0361627
1473 Ga0451789_0132707
1474 Ga0451789_1337304
1475 Ga0451791_0723520
1476 Ga0451797_0326280
1477 Ga0451797_1396665
1478 Ga0451800_0257958
1479 Ga0451802_0865917
1480 Ga0451807_2035663
1481 Ga0451833_0086428
1482 Ga0451837_1552806
1483 Ga0439431_0271191
1484 Ga0439432_122460
1485 Ga0439432_245977
1486 Ga0439455_0216883
1487 Ga0439458_0006326
1488 Ga0439459_0016638
1489 Ga0495617_145691
1490 Ga0495617_150450
1491 Ga0495627_186131
1492 Ga0495592_0057556
1493 Ga0495603_0039874
1494 Ga0495603_0118114
1495 Ga0495603_0345112
1496 Ga0495603_0440470
1497 Ga0495603_0457443
1498 Ga0495590_0025430
1499 Ga0495629_0020761
1500 Ga0495629_0190983
1501 Ga0495638_0081554
1502 Ga0495638_0367911
1503 Ga0495638_0460730
1504 Ga0495638_0483190
1505 Ga0495638_0668854
1506 Ga0495641_0054725
1507 Ga0495651_0008596
1508 Ga0495653_0011458
1509 Ga0495605_0204487
1510 Ga0495605_0346504
1511 Ga0495639_0025648
1512 Ga0495639_0135753
1513 Ga0495639_0199919
1514 Ga0495662_0162971
1515 Ga0495584_0073198
1516 Ga0495584_0258183
1517 Ga0495584_0289011
1518 Ga0495584_0381139
1519 Ga0495584_0483958
1520 Ga0495585_0112290
1521 Ga0495585_0178391
1522 Ga0495585_0202707
1523 Ga0495585_0397616
1524 Ga0495585_0496927
1525 Ga0495585_0585245
1526 Ga0495594_0078615
1527 Ga0495594_0181820
1528 Ga0495596_0176392
1529 Ga0495607_0247350
1530 Ga0495583_0158787
1531 Ga0495606_0239455
1532 Ga0495608_0053059
1533 Ga0495616_0053771
1534 Ga0495616_0165665
1535 Ga0495620_0243584
1536 Ga0495620_0279637
1537 Ga0495628_0028732
1538 Ga0495628_1188561
1539 Ga0495630_1074256
1540 Ga0495630_1081299
1541 Ga0495631_0155404
1542 Ga0495631_0239687
1543 Ga0495632_0160574
1544 Ga0495632_0176930
1545 Ga0495632_0424480
1546 Ga0495643_0423054
1547 Ga0495644_0106937
1548 Ga0495644_0141567
1549 Ga0495644_0261308
1550 Ga0495648_0464139
1551 Ga0495663_0373436
1552 Ga0495663_0375278
1553 Ga0495642_0312781
1554 Ga0495665_0339538
1555 Ga0495640_0042188
1556 Ga0495587_0012371
1557 Ga0495598_0004434
1558 Ga0495598_0174484
1559 Ga0495609_0070712
1560 Ga0495609_0266634
1561 Ga0495609_0271793
1562 Ga0495621_0016074
1563 Ga0495621_0369533
1564 Ga0495597_0357348
1565 Ga0495645_0010840
1566 Ga0495622_0275439
1567 Ga0495622_0390466
1568 Ga0495633_0126144
1569 Ga0495667_0024237
1570 Ga0495656_0055503
1571 Ga0495656_0271785
1572 Ga0495656_0792937
1573 Ga0495668_0721987
1574 Ga0495634_0168770
1575 Ga0495611_0105738
1576 Ga0495611_0254611
1577 Ga0495611_0582773
1578 Ga0495625_0427600
1579 Ga0495625_0431554
1580 Ga0495625_0541184
1581 Ga0495625_0741104
1582 Ga0495635_0347664
1583 Ga0495635_0406884
1584 Ga0495659_0041415
1585 Ga0495659_0151620
1586 Ga0495661_0090327
1587 Ga0495661_0231827
1588 Ga0495588_0141656
1589 Ga0495588_0397237
1590 Ga0495657_0007252
1591 Ga0495599_0002825
1592 Ga0495623_0015241
1593 Ga0495646_0033961
1594 Ga0495647_0198985
1595 Ga0495647_0387704
1596 Ga0495669_0148103
1597 Ga0495669_0240662
1598 Ga0495613_0073541
1599 Ga0495624_0627969
1600 Ga0495670_0030985
1601 Ga0495670_0108591
1602 Ga0495670_0451177
1603 Ga0495671_0202386
1604 Ga0495671_0379939
1605 Ga0495671_0523763
1606 Ga0495649_0449899
1607 Ga0495589_0111956
1608 Ga0495600_0003921
1609 Ga0495660_0181812
1610 Ga0495581_0058882
1611 Ga0495581_0122573
1612 Ga0495581_0315785
1613 Ga0495604_0005861
1614 Ga0495604_0616890
1615 Ga0495636_0129559
1616 Ga0495674_0082073
1617 Ga0495674_0824366
1618 Ga0495672_0375925
1619 Ga0495672_0461462
1620 Ga0495676_0201194
1621 Ga0495680_0001522
1622 Ga0495680_0377854
1623 Ga0495683_0420265
1624 Ga0495675_0006723
1625 Ga0495677_0181089
1626 Ga0495677_0230312
1627 Ga0495685_057865
1628 Ga0495673_0234741
1629 Ga0495684_0074166
1630 Ga0495602_0001750
1631 Ga0495615_0126364
1632 Ga0495626_0337125
1633 Ga0495626_0381127
1634 Ga0496100_0381915
1635 Ga0496100_0458312
1636 Ga0496100_0635636
1637 Ga0496100_1119100
1638 Ga0496100_1226856
1639 Ga0496101_0495424
1640 Ga0496101_0730099
1641 Ga0496101_1364437
1642 Ga0496102_0079460
1643 Ga0496102_0350735
1644 Ga0496102_0417472
1645 Ga0496102_0662696
1646 Ga0496103_0186452
1647 Ga0496103_0861930
1648 Ga0496103_1037723
1649 Ga0496104_0334621
1650 Ga0496104_0521419
1651 Ga0496104_0808724
1652 Ga0496105_0684186
1653 Ga0496105_1006191
1654 Ga0496106_0139359
1655 Ga0496106_0403720
1656 Ga0496106_0556350
1657 Ga0496107_0060688
1658 Ga0496107_0135556
1659 Ga0496107_0328977
1660 Ga0496107_0337220
1661 Ga0496107_0393331
1662 Ga0496107_0753291
1663 Ga0496108_0503338
1664 Ga0496108_0672172
1665 Ga0496108_1101983
1666 Ga0496109_0080056
1667 Ga0496109_0410851
1668 Ga0496109_0442118
1669 Ga0496109_1439735
1670 Ga0496110_0105390
1671 Ga0496110_0276788
1672 Ga0496110_0700606
1673 Ga0496111_0126160
1674 Ga0496111_0443515
1675 Ga0496111_0553262
1676 Ga0496112_0015821
1677 Ga0496113_0110981
1678 Ga0496113_0633948
1679 Ga0496114_0106665
1680 Ga0496114_0293135
1681 Ga0496114_0424078
1682 Ga0496114_1183151
1683 Ga0496115_0087110
1684 Ga0496115_0464430
1685 Ga0496115_1101547
1686 Ga0496117_0338331
1687 Ga0496117_0516645
1688 Ga0496118_0238172
1689 Ga0496118_0310414
1690 Ga0496118_0501983
1691 Ga0496121_0042723
1692 Ga0496121_0078242
1693 Ga0496121_0099226
1694 Ga0496121_0233269
1695 Ga0496124_0187296
1696 Ga0496124_0306926
1697 Ga0496124_0532062
1698 Ga0496124_0902349
1699 Ga0496125_0073110
1700 Ga0496125_0079566
1701 Ga0496125_0086249
1702 Ga0496126_0118734
1703 Ga0496126_0132628
1704 Ga0496126_0139501
1705 Ga0496126_0146983
1706 Ga0496126_0682233
1707 Ga0496126_0876728
1708 Ga0496126_0960872
1709 Ga0495678_194411
1710 Ga0495678_237866
1711 Ga0495682_0050200
1712 Ga0495682_0369512
1713 Ga0501041_0521119
1714 Ga0501042_1265434
1715 Ga0501067_0045663
1716 Ga0501067_0352762
1717 Ga0501070_0462619
1718 Ga0501076_1212260
1719 nmdc:mga03683_480212_c1
1720 nmdc:mga03n38_1067_c1
1721 nmdc:mga03n38_322482_c1
1722 nmdc:mga03n38_623034_c1
1723 nmdc:mga03n38_767608_c1
1724 nmdc:mga00v17_1070399_c1
1725 nmdc:mga00v17_64900_c1
1726 nmdc:mga0yw44_1175725_c1
1727 nmdc:mga0yw44_257717_c1
1728 nmdc:mga0yw44_854354_c1
1729 nmdc:mga0k408_100728_c1
1730 nmdc:mga0k408_329096_c1
1731 nmdc:mga0k408_369536_c1
1732 nmdc:mga06z11_120553_c1
1733 nmdc:mga06z11_20863_c1
1734 nmdc:mga06z11_293434_c1
1735 nmdc:mga06z11_386337_c1
1736 nmdc:mga06z11_696733_c1
1737 nmdc:mga06z11_78800_c1
1738 nmdc:mga04h51_125614_c1
1739 nmdc:mga07m45_16937_c1
1740 nmdc:mga07m45_21740_c2
1741 nmdc:mga07m45_341618_c1
1742 nmdc:mga05p37_143726_c1
1743 nmdc:mga0qj67_332577_c1
1744 nmdc:mga08y16_1794101_c1
1745 nmdc:mga08y16_436020_c1
1746 nmdc:mga0n895_505352_c1
1747 nmdc:mga0sz30_143972_c1
1748 nmdc:mga0sz30_147995_c1
1749 Ga0500635_0233802
1750 Ga0495619_0094058
1751 Ga0500578_0532144
1752 Ga0500643_033895
1753 Ga0500644_0333573
1754 Ga0500644_0477634
1755 Ga0500581_383852
1756 Ga0500646_0163014
1757 Ga0500583_0102572
1758 Ga0500583_0331307
1759 Ga0500566_0160646
1760 Ga0500641_0039046
1761 Ga0500641_0266252
1762 Ga0500650_0157523
1763 Ga0500650_0518770
1764 Ga0500554_003538
1765 Ga0500555_046099
1766 Ga0500569_005357
1767 Ga0500594_0267308
1768 Ga0500595_002860
1769 Ga0500595_037030
1770 Ga0500595_085627
1771 Ga0500617_194072
1772 Ga0500642_0130394
1773 Ga0500652_393304
1774 Ga0500655_021840
1775 Ga0500658_0395752
1776 Ga0500561_0040549
1777 Ga0500568_0147634
1778 Ga0500589_239843
1779 Ga0500590_171531
1780 Ga0500604_0070167
1781 Ga0500622_0147805
1782 Ga0500627_0258138
1783 Ga0500627_0310427
1784 Ga0500633_0181184
1785 Ga0500638_119127
1786 Ga0500638_287726
1787 Ga0500636_0447704
1788 Ga0500637_0000062
1789 Ga0500645_019135
1790 Ga0500609_003893
1791 Ga0501084_0616355
1792 Ga0500661_051289
1793 Ga0501082_0904658
1794 2513922262
1795 2517893965
1796 2524536229
1797 2885377708
1798 2906661650

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map