F485035
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 897 | 326 | 882 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300003771|Ga0055526_1000107|Ga0055526_100010755 |
| Length | 222 |
| Sequence | MSAEPETPADHAPHARYQHPPGAPDGSIVLPLPPNVPRVKRSRLAQWTGRAILRLGGWRMVGQFPDIPRAVLIGIPHSSNWDGVWAFAAKAAMGLNVNIIAKESLFKVPVVGFMLRRFGVIPINRSAAHGVIDQAVAMMKGAEKLWLGIAPEGTRKRVEKWKAGFWKIAKNADVPVVLAYFHYPDKVIGIGPAFHLGDDMDADMRRIREYCRPFIGKNRGTV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2537561836 | Rhodanobacter spathiphylli B39 | Isolate | Unclassified |
| 2 | 2643221562 | Rhodanobacter sp. Root561 | Isolate | Unclassified |
| 3 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 4 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 5 | 2718218334 | Luteibacter rhizovicinus LJ96 | Isolate | Rhizosphere |
| 6 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 7 | 2739367700 | Dyella sp. YR388 | Isolate | Unclassified |
| 8 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 9 | 2884338543 | Luteibacter pinisoli MAH-14 | Isolate | Rhizosphere |
| 10 | 2884411467 | Dyella sp. AD56 | Isolate | Rhizosphere |
| 11 | 2895395659 | Rhodanobacter sp. T12-5 | Isolate | Unclassified |
| 12 | 2928963466 | Dyella japonica 1073 | Isolate | Unclassified |
| 13 | 2939611941 | Rhodanobacter soli 1757 | Isolate | Rhizosphere |
| 14 | 2941489479 | Lysobacter enzymogenes 2943 | Isolate | Rhizosphere |
| 15 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 16 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 17 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 18 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 19 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 20 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 21 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 22 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 23 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 24 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 25 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 27 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 28 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 29 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 30 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 31 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 32 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 33 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 34 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 35 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 37 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 38 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 39 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 40 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 41 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 42 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 43 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 44 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 45 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 69 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 70 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 71 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 72 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 76 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 78 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 79 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 80 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 81 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 82 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 103 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 104 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 116 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 117 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 119 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 120 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 122 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 136 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 146 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 189 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 190 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 191 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 192 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 193 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 194 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 200 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 201 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 202 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 209 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 210 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 211 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 212 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 213 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 214 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 215 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 216 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 217 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 218 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 219 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 220 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 221 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 222 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 223 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 266 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 267 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 268 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 274 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 275 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 276 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 277 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 278 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 279 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 280 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 309 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 320 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 321 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 323 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 324 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.66 |
| Metatranscriptomes | 0.67 |
| Isolates | 1.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.15 |
| Nodule | 0 |
| Rhizoplane | 2.79 |
| Rhizosphere | 72.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10017269 | 3300001979 | Bacteria | 2584 |
| 2 | JGI24739J22299_10083624 | 3300001989 | Bacteria | 977 |
| 3 | JGI24737J22298_10000503 | 3300001990 | Bacteria | 13631 |
| 4 | JGI24737J22298_10109933 | 3300001990 | Bacteria | 816 |
| 5 | JGI24735J21928_10023462 | 3300002067 | Bacteria | 1871 |
| 6 | JGI24738J21930_10000020 | 3300002075 | Bacteria | 30020 |
| 7 | JGI25156J39149_1000480 | 3300002705 | Bacteria | 24063 |
| 8 | JGI25156J39149_1004347 | 3300002705 | Bacteria | 4346 |
| 9 | JGI25156J39149_1006967 | 3300002705 | Bacteria | 3028 |
| 10 | JGI25156J39149_1012327 | 3300002705 | Bacteria | 1886 |
| 11 | JGI25162J39368_1000454 | 3300002737 | Bacteria | 32144 |
| 12 | JGI25162J39368_1000657 | 3300002737 | Bacteria | 24439 |
| 13 | JGI25162J39368_1000792 | 3300002737 | Bacteria | 21140 |
| 14 | JGI25162J39368_1001661 | 3300002737 | Bacteria | 10994 |
| 15 | JGI25162J39368_1002289 | 3300002737 | Bacteria | 7698 |
| 16 | JGI25157J39369_1000300 | 3300002741 | Bacteria | 35735 |
| 17 | JGI25157J39369_1000525 | 3300002741 | Bacteria | 23385 |
| 18 | JGI25157J39369_1001263 | 3300002741 | Bacteria | 10336 |
| 19 | JGI25157J39369_1003690 | 3300002741 | Bacteria | 3028 |
| 20 | JGI25163J39215_1000882 | 3300002771 | Bacteria | 6984 |
| 21 | JGI25164J39214_1000112 | 3300002772 | Bacteria | 78116 |
| 22 | JGI25164J39214_1000295 | 3300002772 | Bacteria | 34610 |
| 23 | JGI25164J39214_1000451 | 3300002772 | Bacteria | 21436 |
| 24 | JGI25164J39214_1000454 | 3300002772 | Bacteria | 21300 |
| 25 | JGI25164J39214_1008953 | 3300002772 | Bacteria | 991 |
| 26 | JGI25165J46597_1000229 | 3300003214 | Bacteria | 78116 |
| 27 | JGI25165J46597_1000527 | 3300003214 | Bacteria | 35739 |
| 28 | JGI25165J46597_1000872 | 3300003214 | Bacteria | 21444 |
| 29 | JGI25165J46597_1006555 | 3300003214 | Bacteria | 2053 |
| 30 | rootH1_10006421 | 3300003316 | Bacteria | 3652 |
| 31 | rootH1_10124382 | 3300003316 | Bacteria | 1390 |
| 32 | rootH2_10047639 | 3300003320 | Bacteria | 15276 |
| 33 | rootH2_10082323 | 3300003320 | Bacteria | 1260 |
| 34 | rootL2_10011264 | 3300003322 | Bacteria | 2277 |
| 35 | rootH1_10034785 | 3300003323 | Bacteria | 1263 |
| 36 | rootH1_10183402 | 3300003323 | Bacteria | 1300 |
| 37 | rootH1_10236681 | 3300003323 | Bacteria | 2848 |
| 38 | Ga0006562J51391_1017349 | 3300003578 | Bacteria | 5332 |
| 39 | Ga0006562J51391_1201163 | 3300003578 | Bacteria | 2364 |
| 40 | Ga0006562J51391_1201164 | 3300003578 | Bacteria | 2270 |
| 41 | Ga0055538_1001138 | 3300003751 | Bacteria | 5697 |
| 42 | Ga0055539_1005663 | 3300003752 | Bacteria | 1616 |
| 43 | Ga0055539_1019428 | 3300003752 | Bacteria | 814 |
| 44 | Ga0055533_1000581 | 3300003756 | Bacteria | 12805 |
| 45 | Ga0055533_1003055 | 3300003756 | Bacteria | 3543 |
| 46 | Ga0055525_1000082 | 3300003759 | Bacteria | 159396 |
| 47 | Ga0055527_1000072 | 3300003760 | Bacteria | 83753 |
| 48 | Ga0055527_1000080 | 3300003760 | Bacteria | 78211 |
| 49 | Ga0055527_1003188 | 3300003760 | Bacteria | 2510 |
| 50 | Ga0055527_1011228 | 3300003760 | Bacteria | 1026 |
| 51 | Ga0055535_1000162 | 3300003761 | Bacteria | 71868 |
| 52 | Ga0055535_1000189 | 3300003761 | Bacteria | 65570 |
| 53 | Ga0055535_1000491 | 3300003761 | Bacteria | 35499 |
| 54 | Ga0055535_1000611 | 3300003761 | Bacteria | 29412 |
| 55 | Ga0055535_1001129 | 3300003761 | Bacteria | 15988 |
| 56 | Ga0055542_1000105 | 3300003762 | Bacteria | 113278 |
| 57 | Ga0055542_1000163 | 3300003762 | Bacteria | 83753 |
| 58 | Ga0055542_1000181 | 3300003762 | Bacteria | 78147 |
| 59 | Ga0055542_1000188 | 3300003762 | Bacteria | 75366 |
| 60 | Ga0055542_1000254 | 3300003762 | Bacteria | 60473 |
| 61 | Ga0055542_1000573 | 3300003762 | Bacteria | 32144 |
| 62 | Ga0055529_1000205 | 3300003763 | Bacteria | 78219 |
| 63 | Ga0055529_1000209 | 3300003763 | Bacteria | 77662 |
| 64 | Ga0055529_1000336 | 3300003763 | Bacteria | 52511 |
| 65 | Ga0055529_1000496 | 3300003763 | Bacteria | 35739 |
| 66 | Ga0055529_1023381 | 3300003763 | Bacteria | 765 |
| 67 | Ga0055526_1000107 | 3300003771 | Bacteria | 72819 |
| 68 | Ga0055537_1000125 | 3300003773 | Bacteria | 58650 |
| 69 | Ga0055524_1000176 | 3300003775 | Bacteria | 72819 |
| 70 | Ga0055534_1000090 | 3300003784 | Bacteria | 71465 |
| 71 | Ga0055528_1000088 | 3300003790 | Bacteria | 72819 |
| 72 | Ga0070658_10005032 | 3300005327 | Bacteria | 10757 |
| 73 | Ga0070658_10035840 | 3300005327 | Bacteria | 3997 |
| 74 | Ga0070658_10873277 | 3300005327 | Bacteria | 782 |
| 75 | Ga0070670_100132781 | 3300005331 | Bacteria | 2150 |
| 76 | Ga0070670_100255716 | 3300005331 | Bacteria | 1526 |
| 77 | Ga0068869_100244555 | 3300005334 | Bacteria | 1430 |
| 78 | Ga0070666_10000020 | 3300005335 | Bacteria | 177564 |
| 79 | Ga0070682_100006648 | 3300005337 | Bacteria | 6483 |
| 80 | Ga0070682_100467750 | 3300005337 | Bacteria | 969 |
| 81 | Ga0068868_100462320 | 3300005338 | Bacteria | 1105 |
| 82 | Ga0070660_100011111 | 3300005339 | Bacteria | 6386 |
| 83 | Ga0070660_100105322 | 3300005339 | Bacteria | 2238 |
| 84 | Ga0070660_100120618 | 3300005339 | Bacteria | 2092 |
| 85 | Ga0070660_100205709 | 3300005339 | Bacteria | 1597 |
| 86 | Ga0070689_100004873 | 3300005340 | Bacteria | 9113 |
| 87 | Ga0070691_10122135 | 3300005341 | Bacteria | 1312 |
| 88 | Ga0070661_100004622 | 3300005344 | Bacteria | 9475 |
| 89 | Ga0070661_100007423 | 3300005344 | Bacteria | 7557 |
| 90 | Ga0070661_100028888 | 3300005344 | Bacteria | 4002 |
| 91 | Ga0070661_100029522 | 3300005344 | Bacteria | 3958 |
| 92 | Ga0070661_100055463 | 3300005344 | Bacteria | 2902 |
| 93 | Ga0070661_100095087 | 3300005344 | Unclassified | 2210 |
| 94 | Ga0070692_10023906 | 3300005345 | Bacteria | 2998 |
| 95 | Ga0070692_10085847 | 3300005345 | Bacteria | 1703 |
| 96 | Ga0070668_100001704 | 3300005347 | Bacteria | 15947 |
| 97 | Ga0070668_100834439 | 3300005347 | Bacteria | 821 |
| 98 | Ga0070669_100511960 | 3300005353 | Bacteria | 997 |
| 99 | Ga0070671_100025842 | 3300005355 | Bacteria | 4821 |
| 100 | Ga0070673_100220277 | 3300005364 | Bacteria | 1642 |
| 101 | Ga0070659_100003695 | 3300005366 | Bacteria | 10914 |
| 102 | Ga0070659_100043342 | 3300005366 | Bacteria | 3519 |
| 103 | Ga0070659_100127110 | 3300005366 | Bacteria | 2069 |
| 104 | Ga0070659_100519562 | 3300005366 | Bacteria | 1016 |
| 105 | Ga0070667_100000040 | 3300005367 | Bacteria | 170222 |
| 106 | Ga0070667_100010566 | 3300005367 | Bacteria | 7620 |
| 107 | Ga0070667_100031091 | 3300005367 | Bacteria | 4451 |
| 108 | Ga0070667_100062316 | 3300005367 | Bacteria | 3159 |
| 109 | Ga0070667_100073758 | 3300005367 | Bacteria | 2910 |
| 110 | Ga0070667_100309147 | 3300005367 | Bacteria | 1424 |
| 111 | Ga0070667_100620417 | 3300005367 | Bacteria | 997 |
| 112 | Ga0070714_100000207 | 3300005435 | Bacteria | 47558 |
| 113 | Ga0070714_100001217 | 3300005435 | Bacteria | 18571 |
| 114 | Ga0070711_100015114 | 3300005439 | Bacteria | 4880 |
| 115 | Ga0070711_100536123 | 3300005439 | Bacteria | 969 |
| 116 | Ga0070694_100076914 | 3300005444 | Bacteria | 2311 |
| 117 | Ga0070663_100001131 | 3300005455 | Bacteria | 14691 |
| 118 | Ga0070663_100012632 | 3300005455 | Bacteria | 5352 |
| 119 | Ga0070663_100029842 | 3300005455 | Bacteria | 3731 |
| 120 | Ga0070663_100039344 | 3300005455 | Bacteria | 3303 |
| 121 | Ga0070663_100107997 | 3300005455 | Bacteria | 2087 |
| 122 | Ga0070663_100197199 | 3300005455 | Bacteria | 1569 |
| 123 | Ga0070663_100226213 | 3300005455 | Bacteria | 1471 |
| 124 | Ga0070663_100299657 | 3300005455 | Bacteria | 1286 |
| 125 | Ga0070663_100933358 | 3300005455 | Bacteria | 751 |
| 126 | Ga0070662_100218434 | 3300005457 | Bacteria | 1520 |
| 127 | Ga0070681_10013694 | 3300005458 | Bacteria | 8072 |
| 128 | Ga0070681_10023056 | 3300005458 | Bacteria | 6259 |
| 129 | Ga0068867_100219122 | 3300005459 | Bacteria | 1533 |
| 130 | Ga0070685_10009321 | 3300005466 | Bacteria | 5067 |
| 131 | Ga0070685_10010980 | 3300005466 | Bacteria | 4724 |
| 132 | Ga0070679_100059614 | 3300005530 | Bacteria | 3804 |
| 133 | Ga0070679_100090918 | 3300005530 | Bacteria | 3040 |
| 134 | Ga0068853_100038222 | 3300005539 | Bacteria | 4087 |
| 135 | Ga0068853_100041046 | 3300005539 | Bacteria | 3950 |
| 136 | Ga0068853_100049856 | 3300005539 | Bacteria | 3599 |
| 137 | Ga0068853_100181559 | 3300005539 | Bacteria | 1908 |
| 138 | Ga0068853_100195727 | 3300005539 | Bacteria | 1838 |
| 139 | Ga0068853_100276154 | 3300005539 | Bacteria | 1548 |
| 140 | Ga0068853_100358905 | 3300005539 | Bacteria | 1357 |
| 141 | Ga0070696_100004108 | 3300005546 | Bacteria | 9703 |
| 142 | Ga0070696_100010225 | 3300005546 | Bacteria | 6280 |
| 143 | Ga0070696_100124104 | 3300005546 | Bacteria | 1872 |
| 144 | Ga0070693_100019491 | 3300005547 | Bacteria | 3557 |
| 145 | Ga0070693_100046384 | 3300005547 | Bacteria | 2468 |
| 146 | Ga0070665_100000097 | 3300005548 | Bacteria | 166302 |
| 147 | Ga0070665_100001328 | 3300005548 | Bacteria | 29401 |
| 148 | Ga0070665_100013315 | 3300005548 | Bacteria | 8280 |
| 149 | Ga0070665_100020995 | 3300005548 | Bacteria | 6565 |
| 150 | Ga0070665_100025880 | 3300005548 | Bacteria | 5907 |
| 151 | Ga0070665_100033651 | 3300005548 | Bacteria | 5156 |
| 152 | Ga0070665_100161102 | 3300005548 | Bacteria | 2246 |
| 153 | Ga0070665_100349215 | 3300005548 | Bacteria | 1484 |
| 154 | Ga0068855_100007368 | 3300005563 | Bacteria | 13321 |
| 155 | Ga0068855_100041031 | 3300005563 | Bacteria | 5487 |
| 156 | Ga0068855_100058503 | 3300005563 | Bacteria | 4513 |
| 157 | Ga0068855_100141160 | 3300005563 | Bacteria | 2746 |
| 158 | Ga0068855_100412537 | 3300005563 | Bacteria | 1478 |
| 159 | Ga0068855_100501717 | 3300005563 | Bacteria | 1318 |
| 160 | Ga0068855_100523970 | 3300005563 | Bacteria | 1285 |
| 161 | Ga0068855_100732842 | 3300005563 | Bacteria | 1055 |
| 162 | Ga0070664_100762991 | 3300005564 | Bacteria | 903 |
| 163 | Ga0068857_100016650 | 3300005577 | Bacteria | 6440 |
| 164 | Ga0068857_100032832 | 3300005577 | Bacteria | 4588 |
| 165 | Ga0068857_100075732 | 3300005577 | Bacteria | 3000 |
| 166 | Ga0068857_100086711 | 3300005577 | Bacteria | 2800 |
| 167 | Ga0068857_100108570 | 3300005577 | Bacteria | 2493 |
| 168 | Ga0068857_100141891 | 3300005577 | Bacteria | 2172 |
| 169 | Ga0068857_100193289 | 3300005577 | Bacteria | 1854 |
| 170 | Ga0068854_100001262 | 3300005578 | Bacteria | 15194 |
| 171 | Ga0068854_100045364 | 3300005578 | Bacteria | 3125 |
| 172 | Ga0068856_100000184 | 3300005614 | Bacteria | 65002 |
| 173 | Ga0068856_100007251 | 3300005614 | Bacteria | 10814 |
| 174 | Ga0068856_100028084 | 3300005614 | Bacteria | 5491 |
| 175 | Ga0068856_100771812 | 3300005614 | Bacteria | 981 |
| 176 | Ga0068852_100001204 | 3300005616 | Bacteria | 17171 |
| 177 | Ga0068852_100014289 | 3300005616 | Bacteria | 6106 |
| 178 | Ga0068852_100092432 | 3300005616 | Bacteria | 2709 |
| 179 | Ga0068852_100221594 | 3300005616 | Bacteria | 1799 |
| 180 | Ga0068852_101047322 | 3300005616 | Bacteria | 835 |
| 181 | Ga0068859_100007515 | 3300005617 | Bacteria | 11061 |
| 182 | Ga0068851_10023176 | 3300005834 | Bacteria | 3031 |
| 183 | Ga0068863_100113735 | 3300005841 | Bacteria | 2578 |
| 184 | Ga0068863_100685759 | 3300005841 | Bacteria | 1018 |
| 185 | Ga0068858_100078324 | 3300005842 | Bacteria | 3072 |
| 186 | Ga0068858_100120194 | 3300005842 | Bacteria | 2456 |
| 187 | Ga0068860_100145004 | 3300005843 | Bacteria | 2284 |
| 188 | Ga0068860_100162836 | 3300005843 | Bacteria | 2151 |
| 189 | Ga0068860_100412916 | 3300005843 | Bacteria | 1337 |
| 190 | Ga0068862_100000224 | 3300005844 | Bacteria | 62869 |
| 191 | Ga0068862_100059714 | 3300005844 | Bacteria | 3275 |
| 192 | Ga0068862_100104837 | 3300005844 | Bacteria | 2477 |
| 193 | Ga0070712_100027163 | 3300006175 | Bacteria | 3820 |
| 194 | Ga0097621_100017790 | 3300006237 | Bacteria | 5410 |
| 195 | Ga0097621_100081890 | 3300006237 | Bacteria | 2687 |
| 196 | Ga0068871_100069947 | 3300006358 | Bacteria | 2884 |
| 197 | Ga0068871_100195291 | 3300006358 | Bacteria | 1745 |
| 198 | Ga0068865_100199275 | 3300006881 | Bacteria | 1553 |
| 199 | Ga0097620_100007515 | 3300006931 | Bacteria | 11061 |
| 200 | Ga0105250_10095931 | 3300009092 | Bacteria | 1209 |
| 201 | Ga0105240_10006212 | 3300009093 | Bacteria | 17569 |
| 202 | Ga0105240_10006230 | 3300009093 | Bacteria | 17547 |
| 203 | Ga0105240_10006360 | 3300009093 | Bacteria | 17388 |
| 204 | Ga0105240_10007835 | 3300009093 | Bacteria | 15418 |
| 205 | Ga0105240_10031364 | 3300009093 | Bacteria | 6894 |
| 206 | Ga0105240_10055146 | 3300009093 | Bacteria | 4977 |
| 207 | Ga0105240_10057256 | 3300009093 | Bacteria | 4871 |
| 208 | Ga0105240_10084657 | 3300009093 | Bacteria | 3887 |
| 209 | Ga0105240_10464558 | 3300009093 | Bacteria | 1413 |
| 210 | Ga0105240_10975403 | 3300009093 | Bacteria | 908 |
| 211 | Ga0105247_10002045 | 3300009101 | Bacteria | 13966 |
| 212 | Ga0105247_10025236 | 3300009101 | Bacteria | 3586 |
| 213 | Ga0105247_10630510 | 3300009101 | Bacteria | 798 |
| 214 | Ga0105241_10017425 | 3300009174 | Bacteria | 5280 |
| 215 | Ga0105241_10417655 | 3300009174 | Bacteria | 1180 |
| 216 | Ga0105241_10473819 | 3300009174 | Bacteria | 1112 |
| 217 | Ga0105248_10028291 | 3300009177 | Bacteria | 6244 |
| 218 | Ga0105248_10346591 | 3300009177 | Bacteria | 1672 |
| 219 | Ga0105237_10000022 | 3300009545 | Bacteria | 228427 |
| 220 | Ga0105237_10000036 | 3300009545 | Bacteria | 191142 |
| 221 | Ga0105237_10063098 | 3300009545 | Bacteria | 3703 |
| 222 | Ga0105237_10093406 | 3300009545 | Bacteria | 2997 |
| 223 | Ga0105237_10118792 | 3300009545 | Bacteria | 2638 |
| 224 | Ga0105237_10137559 | 3300009545 | Bacteria | 2437 |
| 225 | Ga0105237_11107800 | 3300009545 | Bacteria | 798 |
| 226 | Ga0105238_10001023 | 3300009551 | Bacteria | 28434 |
| 227 | Ga0105238_10015508 | 3300009551 | Bacteria | 7713 |
| 228 | Ga0105238_10022715 | 3300009551 | Bacteria | 6393 |
| 229 | Ga0105238_10051301 | 3300009551 | Bacteria | 4150 |
| 230 | Ga0105238_10099966 | 3300009551 | Bacteria | 2884 |
| 231 | Ga0105238_10162538 | 3300009551 | Bacteria | 2209 |
| 232 | Ga0105238_10208703 | 3300009551 | Bacteria | 1929 |
| 233 | Ga0105238_10326233 | 3300009551 | Bacteria | 1521 |
| 234 | Ga0105238_10326569 | 3300009551 | Bacteria | 1520 |
| 235 | Ga0105238_11203240 | 3300009551 | Bacteria | 782 |
| 236 | Ga0105238_11240976 | 3300009551 | Bacteria | 770 |
| 237 | Ga0105249_10000193 | 3300009553 | Bacteria | 69963 |
| 238 | Ga0105147_100668 | 3300009982 | Bacteria | 2754 |
| 239 | Ga0105239_10000192 | 3300010375 | Bacteria | 88793 |
| 240 | Ga0105239_10004724 | 3300010375 | Bacteria | 16174 |
| 241 | Ga0105239_10012311 | 3300010375 | Bacteria | 9527 |
| 242 | Ga0105239_10025642 | 3300010375 | Bacteria | 6491 |
| 243 | Ga0105239_10103323 | 3300010375 | Bacteria | 3154 |
| 244 | Ga0105239_10119105 | 3300010375 | Bacteria | 2930 |
| 245 | Ga0105239_10399618 | 3300010375 | Bacteria | 1555 |
| 246 | Ga0105239_10421240 | 3300010375 | Bacteria | 1513 |
| 247 | Ga0105239_10550070 | 3300010375 | Bacteria | 1314 |
| 248 | Ga0157314_1000060 | 3300012500 | Bacteria | 11549 |
| 249 | Ga0157347_1001512 | 3300012502 | Bacteria | 1837 |
| 250 | Ga0157373_10012271 | 3300013100 | Bacteria | 6299 |
| 251 | Ga0157373_10019943 | 3300013100 | Bacteria | 4878 |
| 252 | Ga0157373_10299074 | 3300013100 | Bacteria | 1142 |
| 253 | Ga0157373_10327469 | 3300013100 | Bacteria | 1090 |
| 254 | Ga0157371_10004318 | 3300013102 | Bacteria | 12463 |
| 255 | Ga0157371_10021258 | 3300013102 | Bacteria | 4766 |
| 256 | Ga0157370_10001178 | 3300013104 | Bacteria | 32634 |
| 257 | Ga0157370_10015371 | 3300013104 | Bacteria | 7780 |
| 258 | Ga0157370_10021645 | 3300013104 | Bacteria | 6407 |
| 259 | Ga0157370_10132571 | 3300013104 | Bacteria | 2324 |
| 260 | Ga0157370_10145090 | 3300013104 | Bacteria | 2210 |
| 261 | Ga0157370_10162156 | 3300013104 | Bacteria | 2080 |
| 262 | Ga0157369_10008532 | 3300013105 | Bacteria | 11753 |
| 263 | Ga0157369_10102041 | 3300013105 | Bacteria | 3057 |
| 264 | Ga0157369_10132720 | 3300013105 | Bacteria | 2638 |
| 265 | Ga0157369_10298142 | 3300013105 | Bacteria | 1677 |
| 266 | Ga0163162_10083015 | 3300013306 | Bacteria | 3277 |
| 267 | Ga0163162_11669365 | 3300013306 | Unclassified | 727 |
| 268 | Ga0157372_10010508 | 3300013307 | Bacteria | 9854 |
| 269 | Ga0157372_10092695 | 3300013307 | Bacteria | 3437 |
| 270 | Ga0157372_10096496 | 3300013307 | Bacteria | 3369 |
| 271 | Ga0157372_10104820 | 3300013307 | Bacteria | 3233 |
| 272 | Ga0157372_10649018 | 3300013307 | Bacteria | 1229 |
| 273 | Ga0157375_10205673 | 3300013308 | Bacteria | 2125 |
| 274 | Ga0163163_10083520 | 3300014325 | Bacteria | 3199 |
| 275 | Ga0182008_10014259 | 3300014497 | Bacteria | 4165 |
| 276 | Ga0157379_10090031 | 3300014968 | Bacteria | 2753 |
| 277 | Ga0157379_10275778 | 3300014968 | Bacteria | 1530 |
| 278 | Ga0157376_10105080 | 3300014969 | Bacteria | 2476 |
| 279 | Ga0157376_10963307 | 3300014969 | Bacteria | 874 |
| 280 | Ga0182006_1000065 | 3300015261 | Bacteria | 152292 |
| 281 | Ga0182006_1073793 | 3300015261 | Bacteria | 1259 |
| 282 | Ga0182007_10005217 | 3300015262 | Bacteria | 5743 |
| 283 | Ga0182007_10018151 | 3300015262 | Bacteria | 2555 |
| 284 | Ga0182007_10043001 | 3300015262 | Bacteria | 1503 |
| 285 | Ga0182007_10103943 | 3300015262 | Bacteria | 942 |
| 286 | Ga0182005_1001497 | 3300015265 | Bacteria | 9321 |
| 287 | Ga0182005_1008021 | 3300015265 | Bacteria | 3133 |
| 288 | Ga0183368_1002 | 3300015687 | Bacteria | 1865598 |
| 289 | Ga0183360_10004 | 3300015689 | Bacteria | 289992 |
| 290 | Ga0163161_10002563 | 3300017792 | Bacteria | 12983 |
| 291 | Ga0163161_10097349 | 3300017792 | Bacteria | 2186 |
| 292 | Ga0206356_11612961 | 3300020070 | Bacteria | 2056 |
| 293 | Ga0206354_10499166 | 3300020081 | Bacteria | 722 |
| 294 | Ga0206353_11908525 | 3300020082 | Bacteria | 3476 |
| 295 | Ga0209435_104672 | 3300025206 | Bacteria | 1543 |
| 296 | Ga0209760_100417 | 3300025207 | Bacteria | 10203 |
| 297 | Ga0209784_100053 | 3300025224 | Bacteria | 182075 |
| 298 | Ga0209566_101751 | 3300025225 | Bacteria | 5170 |
| 299 | Ga0209674_100014 | 3300025226 | Bacteria | 704989 |
| 300 | Ga0209674_100234 | 3300025226 | Bacteria | 48788 |
| 301 | Ga0209674_100413 | 3300025226 | Bacteria | 21057 |
| 302 | Ga0209674_102618 | 3300025226 | Bacteria | 3745 |
| 303 | Ga0209672_100004 | 3300025228 | Bacteria | 1467504 |
| 304 | Ga0209672_100008 | 3300025228 | Bacteria | 946876 |
| 305 | Ga0209672_100089 | 3300025228 | Bacteria | 120658 |
| 306 | Ga0209672_101247 | 3300025228 | Bacteria | 10176 |
| 307 | Ga0209672_101845 | 3300025228 | Bacteria | 6341 |
| 308 | Ga0209672_103546 | 3300025228 | Bacteria | 3187 |
| 309 | Ga0209147_108813 | 3300025229 | Bacteria | 1230 |
| 310 | Ga0209563_100097 | 3300025230 | Bacteria | 159453 |
| 311 | Ga0207427_100044 | 3300025231 | Bacteria | 242623 |
| 312 | Ga0207427_100051 | 3300025231 | Bacteria | 218792 |
| 313 | Ga0207427_100061 | 3300025231 | Bacteria | 182815 |
| 314 | Ga0207427_100088 | 3300025231 | Bacteria | 137220 |
| 315 | Ga0207427_103025 | 3300025231 | Bacteria | 3877 |
| 316 | Ga0207427_112494 | 3300025231 | Bacteria | 848 |
| 317 | Ga0209437_100005 | 3300025233 | Bacteria | 1071596 |
| 318 | Ga0209437_100037 | 3300025233 | Bacteria | 459730 |
| 319 | Ga0209437_100152 | 3300025233 | Bacteria | 154551 |
| 320 | Ga0209437_100167 | 3300025233 | Bacteria | 144661 |
| 321 | Ga0209437_100279 | 3300025233 | Bacteria | 75208 |
| 322 | Ga0209437_102261 | 3300025233 | Bacteria | 3807 |
| 323 | Ga0209258_100003 | 3300025242 | Bacteria | 1467504 |
| 324 | Ga0209258_100004 | 3300025242 | Bacteria | 1376422 |
| 325 | Ga0209258_100008 | 3300025242 | Bacteria | 1009355 |
| 326 | Ga0209258_100090 | 3300025242 | Bacteria | 232619 |
| 327 | Ga0209258_100173 | 3300025242 | Bacteria | 144525 |
| 328 | Ga0209258_100541 | 3300025242 | Bacteria | 34852 |
| 329 | Ga0209258_101149 | 3300025242 | Bacteria | 10836 |
| 330 | Ga0209258_102841 | 3300025242 | Bacteria | 4132 |
| 331 | Ga0209646_1000700 | 3300025246 | Bacteria | 12031 |
| 332 | Ga0209646_1000900 | 3300025246 | Bacteria | 9648 |
| 333 | Ga0209026_1000010 | 3300025250 | Bacteria | 511986 |
| 334 | Ga0209026_1000064 | 3300025250 | Bacteria | 211303 |
| 335 | Ga0209026_1000104 | 3300025250 | Bacteria | 152614 |
| 336 | Ga0209026_1000407 | 3300025250 | Bacteria | 37955 |
| 337 | Ga0209026_1000660 | 3300025250 | Bacteria | 21079 |
| 338 | Ga0209026_1003591 | 3300025250 | Bacteria | 5002 |
| 339 | Ga0209677_101838 | 3300025253 | Bacteria | 8651 |
| 340 | Ga0209677_112023 | 3300025253 | Bacteria | 1309 |
| 341 | Ga0209148_1000001 | 3300025254 | Bacteria | 2545271 |
| 342 | Ga0209148_1000002 | 3300025254 | Bacteria | 2399500 |
| 343 | Ga0209148_1000016 | 3300025254 | Bacteria | 804369 |
| 344 | Ga0209148_1000065 | 3300025254 | Bacteria | 344489 |
| 345 | Ga0209148_1000079 | 3300025254 | Bacteria | 288992 |
| 346 | Ga0209148_1000279 | 3300025254 | Bacteria | 79426 |
| 347 | Ga0209759_1000165 | 3300025256 | Bacteria | 113117 |
| 348 | Ga0209759_1000544 | 3300025256 | Bacteria | 39139 |
| 349 | Ga0209759_1000762 | 3300025256 | Bacteria | 27542 |
| 350 | Ga0209759_1001342 | 3300025256 | Bacteria | 14350 |
| 351 | Ga0209759_1002477 | 3300025256 | Bacteria | 8071 |
| 352 | Ga0209759_1012013 | 3300025256 | Bacteria | 2423 |
| 353 | Ga0209233_1000002 | 3300025261 | Bacteria | 2501366 |
| 354 | Ga0209233_1000011 | 3300025261 | Bacteria | 1071611 |
| 355 | Ga0209233_1000046 | 3300025261 | Bacteria | 470971 |
| 356 | Ga0209233_1000099 | 3300025261 | Bacteria | 293995 |
| 357 | Ga0209233_1000759 | 3300025261 | Bacteria | 14553 |
| 358 | Ga0209233_1007681 | 3300025261 | Bacteria | 3397 |
| 359 | Ga0209233_1027747 | 3300025261 | Bacteria | 1367 |
| 360 | Ga0209565_1000002 | 3300025263 | Bacteria | 1423083 |
| 361 | Ga0209455_1000004 | 3300025272 | Bacteria | 1467504 |
| 362 | Ga0209455_1000007 | 3300025272 | Bacteria | 1157983 |
| 363 | Ga0209455_1000016 | 3300025272 | Bacteria | 753097 |
| 364 | Ga0209455_1000079 | 3300025272 | Bacteria | 268778 |
| 365 | Ga0209455_1000295 | 3300025272 | Bacteria | 52412 |
| 366 | Ga0209673_1000002 | 3300025273 | Bacteria | 1423083 |
| 367 | Ga0209675_1000002 | 3300025291 | Bacteria | 1423083 |
| 368 | Ga0209564_1000004 | 3300025295 | Bacteria | 1424639 |
| 369 | Ga0209758_1000452 | 3300025297 | Bacteria | 68495 |
| 370 | Ga0209256_1000004 | 3300025299 | Bacteria | 1424643 |
| 371 | Ga0207656_10035314 | 3300025321 | Bacteria | 2092 |
| 372 | Ga0207696_1149757 | 3300025711 | Bacteria | 623 |
| 373 | Ga0207710_10042402 | 3300025900 | Bacteria | 2021 |
| 374 | Ga0207680_10000001 | 3300025903 | Bacteria | 1091453 |
| 375 | Ga0207647_10000014 | 3300025904 | Bacteria | 143525 |
| 376 | Ga0207647_10001935 | 3300025904 | Bacteria | 15822 |
| 377 | Ga0207647_10017313 | 3300025904 | Bacteria | 4899 |
| 378 | Ga0207647_10054333 | 3300025904 | Bacteria | 2464 |
| 379 | Ga0207647_10064530 | 3300025904 | Bacteria | 2225 |
| 380 | Ga0207647_10296206 | 3300025904 | Bacteria | 922 |
| 381 | Ga0207705_10003986 | 3300025909 | Bacteria | 11232 |
| 382 | Ga0207705_10005837 | 3300025909 | Bacteria | 9167 |
| 383 | Ga0207654_10341553 | 3300025911 | Bacteria | 1029 |
| 384 | Ga0207707_10038371 | 3300025912 | Bacteria | 4185 |
| 385 | Ga0207707_10047400 | 3300025912 | Bacteria | 3742 |
| 386 | Ga0207707_10161188 | 3300025912 | Bacteria | 1961 |
| 387 | Ga0207707_10535118 | 3300025912 | Bacteria | 997 |
| 388 | Ga0207695_10000040 | 3300025913 | Bacteria | 452787 |
| 389 | Ga0207695_10000291 | 3300025913 | Bacteria | 124555 |
| 390 | Ga0207695_10000362 | 3300025913 | Bacteria | 104132 |
| 391 | Ga0207695_10001147 | 3300025913 | Bacteria | 45960 |
| 392 | Ga0207695_10002008 | 3300025913 | Bacteria | 31403 |
| 393 | Ga0207695_10024317 | 3300025913 | Bacteria | 6819 |
| 394 | Ga0207695_10042674 | 3300025913 | Bacteria | 4840 |
| 395 | Ga0207695_10057571 | 3300025913 | Bacteria | 4037 |
| 396 | Ga0207671_10000009 | 3300025914 | Bacteria | 724862 |
| 397 | Ga0207671_10000135 | 3300025914 | Bacteria | 112401 |
| 398 | Ga0207671_10004793 | 3300025914 | Bacteria | 12744 |
| 399 | Ga0207671_10156614 | 3300025914 | Bacteria | 1762 |
| 400 | Ga0207671_10210818 | 3300025914 | Bacteria | 1520 |
| 401 | Ga0207657_10012203 | 3300025919 | Bacteria | 8490 |
| 402 | Ga0207657_10106355 | 3300025919 | Bacteria | 2322 |
| 403 | Ga0207657_10122356 | 3300025919 | Bacteria | 2140 |
| 404 | Ga0207649_10003075 | 3300025920 | Bacteria | 9164 |
| 405 | Ga0207649_10006684 | 3300025920 | Bacteria | 6268 |
| 406 | Ga0207649_10021106 | 3300025920 | Bacteria | 3743 |
| 407 | Ga0207649_10023263 | 3300025920 | Bacteria | 3586 |
| 408 | Ga0207649_10126431 | 3300025920 | Bacteria | 1731 |
| 409 | Ga0207652_10143154 | 3300025921 | Bacteria | 2138 |
| 410 | Ga0207652_10220312 | 3300025921 | Bacteria | 1710 |
| 411 | Ga0207694_10002190 | 3300025924 | Bacteria | 16057 |
| 412 | Ga0207694_10005245 | 3300025924 | Bacteria | 9997 |
| 413 | Ga0207694_10006615 | 3300025924 | Bacteria | 8812 |
| 414 | Ga0207694_10023988 | 3300025924 | Bacteria | 4633 |
| 415 | Ga0207694_10039266 | 3300025924 | Bacteria | 3642 |
| 416 | Ga0207694_10050959 | 3300025924 | Bacteria | 3208 |
| 417 | Ga0207694_10179994 | 3300025924 | Bacteria | 1714 |
| 418 | Ga0207694_10434103 | 3300025924 | Bacteria | 1095 |
| 419 | Ga0207694_10569775 | 3300025924 | Bacteria | 951 |
| 420 | Ga0207650_10217151 | 3300025925 | Bacteria | 1538 |
| 421 | Ga0207700_10023446 | 3300025928 | Bacteria | 4254 |
| 422 | Ga0207700_10455654 | 3300025928 | Bacteria | 1128 |
| 423 | Ga0207664_10000092 | 3300025929 | Bacteria | 83276 |
| 424 | Ga0207664_10000929 | 3300025929 | Bacteria | 19672 |
| 425 | Ga0207664_10039255 | 3300025929 | Bacteria | 3675 |
| 426 | Ga0207690_10018537 | 3300025932 | Bacteria | 4269 |
| 427 | Ga0207690_10018739 | 3300025932 | Bacteria | 4248 |
| 428 | Ga0207690_10024493 | 3300025932 | Bacteria | 3780 |
| 429 | Ga0207690_10031438 | 3300025932 | Bacteria | 3396 |
| 430 | Ga0207706_10033243 | 3300025933 | Bacteria | 4591 |
| 431 | Ga0207706_10076489 | 3300025933 | Bacteria | 2944 |
| 432 | Ga0207706_10084528 | 3300025933 | Bacteria | 2790 |
| 433 | Ga0207670_10008997 | 3300025936 | Bacteria | 5667 |
| 434 | Ga0207691_10096278 | 3300025940 | Bacteria | 2646 |
| 435 | Ga0207689_10047201 | 3300025942 | Bacteria | 3558 |
| 436 | Ga0207679_10036264 | 3300025945 | Bacteria | 3496 |
| 437 | Ga0207679_10227486 | 3300025945 | Bacteria | 1573 |
| 438 | Ga0207679_10291168 | 3300025945 | Bacteria | 1404 |
| 439 | Ga0207679_10725760 | 3300025945 | Bacteria | 903 |
| 440 | Ga0207667_10000262 | 3300025949 | Bacteria | 73170 |
| 441 | Ga0207667_10000329 | 3300025949 | Bacteria | 65667 |
| 442 | Ga0207667_10002131 | 3300025949 | Bacteria | 24808 |
| 443 | Ga0207667_10012894 | 3300025949 | Bacteria | 9603 |
| 444 | Ga0207667_10027480 | 3300025949 | Bacteria | 6192 |
| 445 | Ga0207667_10133995 | 3300025949 | Bacteria | 2551 |
| 446 | Ga0207667_10229349 | 3300025949 | Bacteria | 1902 |
| 447 | Ga0207651_10072042 | 3300025960 | Bacteria | 2452 |
| 448 | Ga0207712_10000498 | 3300025961 | Bacteria | 32444 |
| 449 | Ga0207668_10239745 | 3300025972 | Bacteria | 1466 |
| 450 | Ga0207668_10497029 | 3300025972 | Unclassified | 1049 |
| 451 | Ga0207640_10000116 | 3300025981 | Bacteria | 60174 |
| 452 | Ga0207640_10003397 | 3300025981 | Bacteria | 8579 |
| 453 | Ga0207640_10013585 | 3300025981 | Bacteria | 4672 |
| 454 | Ga0207640_10543140 | 3300025981 | Bacteria | 975 |
| 455 | Ga0207658_10000289 | 3300025986 | Bacteria | 52614 |
| 456 | Ga0207658_10099716 | 3300025986 | Bacteria | 2272 |
| 457 | Ga0207658_10112606 | 3300025986 | Bacteria | 2154 |
| 458 | Ga0207658_10532337 | 3300025986 | Bacteria | 1050 |
| 459 | Ga0207658_10614275 | 3300025986 | Bacteria | 977 |
| 460 | Ga0207703_10088824 | 3300026035 | Bacteria | 2595 |
| 461 | Ga0207703_10401961 | 3300026035 | Bacteria | 1271 |
| 462 | Ga0207639_10009617 | 3300026041 | Bacteria | 6677 |
| 463 | Ga0207639_10021122 | 3300026041 | Bacteria | 4671 |
| 464 | Ga0207639_10026892 | 3300026041 | Bacteria | 4184 |
| 465 | Ga0207639_10038222 | 3300026041 | Bacteria | 3569 |
| 466 | Ga0207639_10225944 | 3300026041 | Bacteria | 1620 |
| 467 | Ga0207639_10287545 | 3300026041 | Bacteria | 1448 |
| 468 | Ga0207639_10499748 | 3300026041 | Bacteria | 1111 |
| 469 | Ga0207678_10001533 | 3300026067 | Bacteria | 21214 |
| 470 | Ga0207678_10006482 | 3300026067 | Bacteria | 10383 |
| 471 | Ga0207678_10007650 | 3300026067 | Bacteria | 9542 |
| 472 | Ga0207678_10026742 | 3300026067 | Bacteria | 5033 |
| 473 | Ga0207678_10050032 | 3300026067 | Bacteria | 3611 |
| 474 | Ga0207678_10053454 | 3300026067 | Bacteria | 3480 |
| 475 | Ga0207678_10054822 | 3300026067 | Bacteria | 3434 |
| 476 | Ga0207678_10082252 | 3300026067 | Bacteria | 2755 |
| 477 | Ga0207678_10152847 | 3300026067 | Bacteria | 1971 |
| 478 | Ga0207678_10185207 | 3300026067 | Bacteria | 1778 |
| 479 | Ga0207678_10238262 | 3300026067 | Bacteria | 1558 |
| 480 | Ga0207678_10468406 | 3300026067 | Bacteria | 1096 |
| 481 | Ga0207702_10000037 | 3300026078 | Bacteria | 153366 |
| 482 | Ga0207702_10000960 | 3300026078 | Bacteria | 29644 |
| 483 | Ga0207702_10005837 | 3300026078 | Bacteria | 10705 |
| 484 | Ga0207702_10741481 | 3300026078 | Bacteria | 969 |
| 485 | Ga0207641_10940351 | 3300026088 | Bacteria | 859 |
| 486 | Ga0207648_10186602 | 3300026089 | Bacteria | 1837 |
| 487 | Ga0207674_10010758 | 3300026116 | Bacteria | 10324 |
| 488 | Ga0207674_10032637 | 3300026116 | Bacteria | 5459 |
| 489 | Ga0207674_10095686 | 3300026116 | Bacteria | 2955 |
| 490 | Ga0207674_10100269 | 3300026116 | Bacteria | 2877 |
| 491 | Ga0207674_10105110 | 3300026116 | Bacteria | 2802 |
| 492 | Ga0207674_10137452 | 3300026116 | Bacteria | 2404 |
| 493 | Ga0207674_10144148 | 3300026116 | Bacteria | 2341 |
| 494 | Ga0207674_10188092 | 3300026116 | Bacteria | 2015 |
| 495 | Ga0207698_10009393 | 3300026142 | Bacteria | 6235 |
| 496 | Ga0207698_10145111 | 3300026142 | Bacteria | 2051 |
| 497 | Ga0207698_10277718 | 3300026142 | Bacteria | 1548 |
| 498 | Ga0207698_10552041 | 3300026142 | Bacteria | 1129 |
| 499 | Ga0268266_10000067 | 3300028379 | Bacteria | 241577 |
| 500 | Ga0268266_10000101 | 3300028379 | Bacteria | 180443 |
| 501 | Ga0268266_10011365 | 3300028379 | Bacteria | 7742 |
| 502 | Ga0268266_10023757 | 3300028379 | Bacteria | 5217 |
| 503 | Ga0268266_10106346 | 3300028379 | Bacteria | 2480 |
| 504 | Ga0268266_10121872 | 3300028379 | Bacteria | 2321 |
| 505 | Ga0268266_10304927 | 3300028379 | Bacteria | 1487 |
| 506 | Ga0268265_10000054 | 3300028380 | Bacteria | 165504 |
| 507 | Ga0268265_10062614 | 3300028380 | Bacteria | 2859 |
| 508 | Ga0268264_10333291 | 3300028381 | Bacteria | 1439 |
| 509 | Ga0268264_10399613 | 3300028381 | Bacteria | 1320 |
| 510 | Ga0268264_10767696 | 3300028381 | Bacteria | 961 |
| 511 | Ga0307517_10102780 | 3300028786 | Bacteria | 2237 |
| 512 | Ga0265338_10673318 | 3300028800 | Bacteria | 716 |
| 513 | Ga0265332_10077822 | 3300031238 | Bacteria | 1408 |
| 514 | Ga0307508_10449642 | 3300031616 | Bacteria | 881 |
| 515 | Ga0316575_10051705 | 3300031665 | Bacteria | 1636 |
| 516 | Ga0316575_10064821 | 3300031665 | Bacteria | 1463 |
| 517 | Ga0307507_10176250 | 3300033179 | Bacteria | 1540 |
| 518 | Ga0307510_10018630 | 3300033180 | Bacteria | 8164 |
| 519 | Ga0307510_10040472 | 3300033180 | Bacteria | 5116 |
| 520 | Ga0395899_0000189 | 3300037312 | Bacteria | 90438 |
| 521 | Ga0395899_0001468 | 3300037312 | Bacteria | 20067 |
| 522 | Ga0395899_0002467 | 3300037312 | Bacteria | 15012 |
| 523 | Ga0395899_0010653 | 3300037312 | Bacteria | 7045 |
| 524 | Ga0395899_0032747 | 3300037312 | Bacteria | 3906 |
| 525 | Ga0395900_0000011 | 3300037418 | Bacteria | 421926 |
| 526 | Ga0395900_0000733 | 3300037418 | Bacteria | 43644 |
| 527 | Ga0395900_0002500 | 3300037418 | Bacteria | 20203 |
| 528 | Ga0395900_0023472 | 3300037418 | Bacteria | 6312 |
| 529 | Ga0395900_0112130 | 3300037418 | Bacteria | 2801 |
| 530 | Ga0395900_0181739 | 3300037418 | Bacteria | 2137 |
| 531 | Ga0395898_0000013 | 3300037466 | Bacteria | 458788 |
| 532 | Ga0395898_0000058 | 3300037466 | Bacteria | 277701 |
| 533 | Ga0395898_0019179 | 3300037466 | Bacteria | 6962 |
| 534 | Ga0395898_0025108 | 3300037466 | Bacteria | 6008 |
| 535 | Ga0395898_0031713 | 3300037466 | Bacteria | 5278 |
| 536 | Ga0395898_0043523 | 3300037466 | Bacteria | 4424 |
| 537 | Ga0395898_0122504 | 3300037466 | Bacteria | 2491 |
| 538 | Ga0395898_0123055 | 3300037466 | Bacteria | 2486 |
| 539 | Ga0395905_0257375 | 3300037471 | Bacteria | 1630 |
| 540 | Ga0436364_1417079 | 3300037853 | Bacteria | 1546 |
| 541 | Ga0395901_0000961 | 3300038443 | Bacteria | 31360 |
| 542 | Ga0395901_0002045 | 3300038443 | Bacteria | 20694 |
| 543 | Ga0395901_0018477 | 3300038443 | Bacteria | 7116 |
| 544 | Ga0395901_0038039 | 3300038443 | Bacteria | 4977 |
| 545 | Ga0395901_0134373 | 3300038443 | Bacteria | 2600 |
| 546 | Ga0395901_0140291 | 3300038443 | Bacteria | 2540 |
| 547 | Ga0395901_0142535 | 3300038443 | Bacteria | 2518 |
| 548 | Ga0395901_0176825 | 3300038443 | Bacteria | 2238 |
| 549 | Ga0395901_0311716 | 3300038443 | Bacteria | 1629 |
| 550 | Ga0439466_0055399 | 3300041411 | Bacteria | 1289 |
| 551 | Ga0451791_1402863 | 3300041451 | Bacteria | 1125 |
| 552 | Ga0451793_1096456 | 3300041452 | Bacteria | 2302 |
| 553 | Ga0451797_0845396 | 3300041453 | Bacteria | 1406 |
| 554 | Ga0451800_0536604 | 3300041459 | Bacteria | 1206 |
| 555 | Ga0451802_0271155 | 3300041460 | Bacteria | 1535 |
| 556 | Ga0451807_1337181 | 3300041486 | Bacteria | 1222 |
| 557 | Ga0451807_1964740 | 3300041486 | Bacteria | 1315 |
| 558 | Ga0451833_1330051 | 3300041491 | Bacteria | 1166 |
| 559 | Ga0451837_0571727 | 3300041494 | Bacteria | 4974 |
| 560 | Ga0451837_1034586 | 3300041494 | Bacteria | 2204 |
| 561 | Ga0451837_1245730 | 3300041494 | Bacteria | 898 |
| 562 | Ga0451837_1427531 | 3300041494 | Bacteria | 2203 |
| 563 | Ga0451843_0143886 | 3300041509 | Bacteria | 1032 |
| 564 | Ga0451843_1235005 | 3300041509 | Bacteria | 1958 |
| 565 | Ga0451853_1120445 | 3300041512 | Bacteria | 1637 |
| 566 | Ga0451853_2151927 | 3300041512 | Bacteria | 934 |
| 567 | Ga0439448_0012270 | 3300042005 | Bacteria | 2562 |
| 568 | Ga0439448_0023023 | 3300042005 | Bacteria | 1940 |
| 569 | Ga0439448_0182303 | 3300042005 | Bacteria | 734 |
| 570 | Ga0439459_0003827 | 3300042438 | Bacteria | 2406 |
| 571 | Ga0466988_0289744 | 3300044536 | Bacteria | 890 |
| 572 | Ga0466969_0003545 | 3300044656 | Bacteria | 8300 |
| 573 | Ga0466969_0028054 | 3300044656 | Bacteria | 2879 |
| 574 | Ga0466969_0048569 | 3300044656 | Bacteria | 2097 |
| 575 | Ga0466972_0005270 | 3300044658 | Bacteria | 6474 |
| 576 | Ga0466972_0048682 | 3300044658 | Bacteria | 2047 |
| 577 | Ga0466982_0000001 | 3300044672 | Bacteria | 514662 |
| 578 | Ga0466965_0003322 | 3300044683 | Bacteria | 7038 |
| 579 | Ga0466965_0039831 | 3300044683 | Bacteria | 2310 |
| 580 | Ga0466966_0007089 | 3300044684 | Bacteria | 7429 |
| 581 | Ga0466966_0012332 | 3300044684 | Bacteria | 5662 |
| 582 | Ga0466966_0014647 | 3300044684 | Bacteria | 5190 |
| 583 | Ga0466961_0000349 | 3300044693 | Bacteria | 30070 |
| 584 | Ga0466961_0000378 | 3300044693 | Bacteria | 28652 |
| 585 | Ga0466961_0000794 | 3300044693 | Bacteria | 19749 |
| 586 | Ga0466961_0002114 | 3300044693 | Bacteria | 12365 |
| 587 | Ga0466963_0092187 | 3300044694 | Bacteria | 2064 |
| 588 | Ga0466963_0299782 | 3300044694 | Bacteria | 1130 |
| 589 | Ga0466964_0055064 | 3300044706 | Bacteria | 1641 |
| 590 | Ga0466964_0056523 | 3300044706 | Bacteria | 1622 |
| 591 | Ga0466971_0007188 | 3300044719 | Bacteria | 4847 |
| 592 | Ga0466971_0016413 | 3300044719 | Bacteria | 3268 |
| 593 | Ga0466971_0045006 | 3300044719 | Bacteria | 1982 |
| 594 | Ga0466971_0098167 | 3300044719 | Bacteria | 1345 |
| 595 | Ga0466968_0000075 | 3300044735 | Bacteria | 29240 |
| 596 | Ga0466970_0001508 | 3300044765 | Bacteria | 11209 |
| 597 | Ga0466970_0001565 | 3300044765 | Bacteria | 11046 |
| 598 | Ga0466970_0007450 | 3300044765 | Bacteria | 5485 |
| 599 | Ga0466970_0013456 | 3300044765 | Bacteria | 4193 |
| 600 | Ga0466970_0030479 | 3300044765 | Bacteria | 2844 |
| 601 | Ga0466957_0001666 | 3300044842 | Bacteria | 11668 |
| 602 | Ga0466957_0020866 | 3300044842 | Bacteria | 3854 |
| 603 | Ga0466957_0076440 | 3300044842 | Bacteria | 2079 |
| 604 | Ga0466957_0101706 | 3300044842 | Bacteria | 1812 |
| 605 | Ga0466957_0462041 | 3300044842 | Bacteria | 876 |
| 606 | Ga0466960_0007010 | 3300044901 | Bacteria | 4551 |
| 607 | Ga0466959_0002024 | 3300045049 | Bacteria | 12808 |
| 608 | Ga0466959_0019504 | 3300045049 | Bacteria | 4986 |
| 609 | Ga0466959_0034927 | 3300045049 | Bacteria | 3718 |
| 610 | Ga0466958_0009531 | 3300045836 | Bacteria | 5413 |
| 611 | Ga0466958_0016435 | 3300045836 | Bacteria | 4261 |
| 612 | Ga0466958_0067952 | 3300045836 | Bacteria | 2178 |
| 613 | Ga0466967_0051040 | 3300045976 | Bacteria | 3623 |
| 614 | Ga0466967_0255901 | 3300045976 | Bacteria | 1674 |
| 615 | Ga0466967_0455997 | 3300045976 | Bacteria | 1250 |
| 616 | Ga0495617_000091 | 3300046452 | Bacteria | 64325 |
| 617 | Ga0495617_001450 | 3300046452 | Bacteria | 10407 |
| 618 | Ga0495638_0000389 | 3300046460 | Bacteria | 54061 |
| 619 | Ga0495638_0000511 | 3300046460 | Bacteria | 45545 |
| 620 | Ga0495638_0000799 | 3300046460 | Bacteria | 33240 |
| 621 | Ga0495641_0194264 | 3300046461 | Bacteria | 910 |
| 622 | Ga0495650_0000210 | 3300046471 | Bacteria | 125249 |
| 623 | Ga0495650_0000465 | 3300046471 | Bacteria | 62638 |
| 624 | Ga0495584_0003983 | 3300046491 | Bacteria | 7967 |
| 625 | Ga0495585_0000112 | 3300046492 | Bacteria | 87291 |
| 626 | Ga0495585_0001222 | 3300046492 | Bacteria | 20809 |
| 627 | Ga0495607_0000006 | 3300046501 | Bacteria | 281664 |
| 628 | Ga0495583_0043307 | 3300046506 | Bacteria | 2096 |
| 629 | Ga0495606_0000016 | 3300046507 | Bacteria | 284865 |
| 630 | Ga0495606_0000248 | 3300046507 | Bacteria | 94934 |
| 631 | Ga0495606_0000267 | 3300046507 | Bacteria | 92177 |
| 632 | Ga0495606_0009735 | 3300046507 | Bacteria | 8086 |
| 633 | Ga0495606_0026232 | 3300046507 | Bacteria | 4155 |
| 634 | Ga0495606_0147989 | 3300046507 | Bacteria | 1380 |
| 635 | Ga0495610_0068091 | 3300046512 | Bacteria | 1669 |
| 636 | Ga0495616_0000074 | 3300046513 | Bacteria | 84866 |
| 637 | Ga0495616_0056702 | 3300046513 | Bacteria | 1933 |
| 638 | Ga0495620_0000066 | 3300046515 | Bacteria | 89405 |
| 639 | Ga0495620_0002396 | 3300046515 | Bacteria | 10858 |
| 640 | Ga0495631_0000997 | 3300046518 | Bacteria | 17566 |
| 641 | Ga0495631_0044271 | 3300046518 | Bacteria | 1962 |
| 642 | Ga0495632_0000279 | 3300046519 | Bacteria | 50089 |
| 643 | Ga0495632_0018629 | 3300046519 | Bacteria | 3805 |
| 644 | Ga0495643_0060116 | 3300046522 | Bacteria | 2018 |
| 645 | Ga0495648_0000820 | 3300046524 | Bacteria | 32800 |
| 646 | Ga0495609_0013453 | 3300046538 | Bacteria | 3862 |
| 647 | Ga0495597_0181882 | 3300046542 | Bacteria | 849 |
| 648 | Ga0495622_0008826 | 3300046557 | Bacteria | 4668 |
| 649 | Ga0495668_0004126 | 3300046616 | Bacteria | 10514 |
| 650 | Ga0495611_0000051 | 3300046648 | Bacteria | 83900 |
| 651 | Ga0495625_0009320 | 3300046660 | Bacteria | 8226 |
| 652 | Ga0495625_0027097 | 3300046660 | Bacteria | 4320 |
| 653 | Ga0495625_0065402 | 3300046660 | Bacteria | 2563 |
| 654 | Ga0495625_0584377 | 3300046660 | Bacteria | 672 |
| 655 | Ga0495661_0001828 | 3300046665 | Bacteria | 17057 |
| 656 | Ga0495661_0020848 | 3300046665 | Bacteria | 4273 |
| 657 | Ga0495588_0094759 | 3300046674 | Bacteria | 1565 |
| 658 | Ga0495670_0001121 | 3300046691 | Bacteria | 12980 |
| 659 | Ga0495670_0003174 | 3300046691 | Bacteria | 8095 |
| 660 | Ga0495671_0000220 | 3300046692 | Bacteria | 49354 |
| 661 | Ga0495649_0006391 | 3300046694 | Bacteria | 7334 |
| 662 | Ga0495589_0000067 | 3300046794 | Bacteria | 99395 |
| 663 | Ga0495660_0000432 | 3300046810 | Bacteria | 35230 |
| 664 | Ga0495660_0000808 | 3300046810 | Bacteria | 23439 |
| 665 | Ga0495683_0001807 | 3300047323 | Bacteria | 13459 |
| 666 | Ga0495673_0000004 | 3300047469 | Bacteria | 1354526 |
| 667 | Ga0495673_0000062 | 3300047469 | Bacteria | 226461 |
| 668 | Ga0495673_0001868 | 3300047469 | Bacteria | 15802 |
| 669 | Ga0495673_0021570 | 3300047469 | Bacteria | 3177 |
| 670 | Ga0495686_0000024 | 3300047472 | Bacteria | 400343 |
| 671 | Ga0495686_0000287 | 3300047472 | Bacteria | 88733 |
| 672 | Ga0495686_0007582 | 3300047472 | Bacteria | 8109 |
| 673 | Ga0495686_0013559 | 3300047472 | Bacteria | 5651 |
| 674 | Ga0495686_0047340 | 3300047472 | Bacteria | 2715 |
| 675 | Ga0496100_0006210 | 3300048903 | Bacteria | 6498 |
| 676 | Ga0496101_0018413 | 3300048904 | Bacteria | 4749 |
| 677 | Ga0496101_0020683 | 3300048904 | Bacteria | 4512 |
| 678 | Ga0496104_0052949 | 3300048907 | Bacteria | 3834 |
| 679 | Ga0496105_0005605 | 3300048908 | Bacteria | 9547 |
| 680 | Ga0496106_0000344 | 3300048909 | Bacteria | 32816 |
| 681 | Ga0496106_0190925 | 3300048909 | Bacteria | 1628 |
| 682 | Ga0496107_0341431 | 3300048910 | Bacteria | 1114 |
| 683 | Ga0496107_0789362 | 3300048910 | Unclassified | 696 |
| 684 | Ga0496112_0380324 | 3300048915 | Bacteria | 1353 |
| 685 | Ga0496113_0195270 | 3300048916 | Bacteria | 1607 |
| 686 | Ga0496113_0327063 | 3300048916 | Bacteria | 1229 |
| 687 | Ga0496114_0164280 | 3300048917 | Bacteria | 1932 |
| 688 | Ga0496114_0525977 | 3300048917 | Bacteria | 1046 |
| 689 | Ga0496115_0000124 | 3300048918 | Bacteria | 70162 |
| 690 | Ga0496115_0000466 | 3300048918 | Bacteria | 32209 |
| 691 | Ga0496115_0018698 | 3300048918 | Bacteria | 5326 |
| 692 | Ga0496115_0020772 | 3300048918 | Bacteria | 5066 |
| 693 | Ga0496116_0027095 | 3300048919 | Bacteria | 4176 |
| 694 | Ga0496117_0003423 | 3300048920 | Bacteria | 18456 |
| 695 | Ga0496117_0014978 | 3300048920 | Bacteria | 6643 |
| 696 | Ga0496117_0128885 | 3300048920 | Bacteria | 1537 |
| 697 | Ga0496117_0337814 | 3300048920 | Bacteria | 783 |
| 698 | Ga0496117_0426450 | 3300048920 | Bacteria | 662 |
| 699 | Ga0496118_0000268 | 3300048921 | Bacteria | 91201 |
| 700 | Ga0496118_0001052 | 3300048921 | Bacteria | 43071 |
| 701 | Ga0496118_0001207 | 3300048921 | Bacteria | 39788 |
| 702 | Ga0496118_0007168 | 3300048921 | Bacteria | 11924 |
| 703 | Ga0496118_0022313 | 3300048921 | Bacteria | 5540 |
| 704 | Ga0496118_0025910 | 3300048921 | Bacteria | 5013 |
| 705 | Ga0496118_0322159 | 3300048921 | Bacteria | 838 |
| 706 | Ga0496118_0329414 | 3300048921 | Bacteria | 824 |
| 707 | Ga0496119_0001330 | 3300048922 | Bacteria | 30360 |
| 708 | Ga0496119_0007350 | 3300048922 | Bacteria | 9956 |
| 709 | Ga0496120_0000359 | 3300048923 | Bacteria | 74678 |
| 710 | Ga0496120_0000539 | 3300048923 | Bacteria | 58074 |
| 711 | Ga0496121_0000327 | 3300048924 | Bacteria | 99562 |
| 712 | Ga0496121_0000450 | 3300048924 | Bacteria | 81062 |
| 713 | Ga0496121_0001992 | 3300048924 | Bacteria | 32457 |
| 714 | Ga0496121_0002452 | 3300048924 | Bacteria | 28356 |
| 715 | Ga0496121_0026203 | 3300048924 | Bacteria | 5503 |
| 716 | Ga0496121_0039112 | 3300048924 | Bacteria | 4187 |
| 717 | Ga0496121_0045473 | 3300048924 | Bacteria | 3771 |
| 718 | Ga0496121_0073796 | 3300048924 | Bacteria | 2732 |
| 719 | Ga0496122_0008948 | 3300048925 | Bacteria | 10650 |
| 720 | Ga0496122_0011189 | 3300048925 | Bacteria | 9131 |
| 721 | Ga0496122_0018881 | 3300048925 | Bacteria | 6335 |
| 722 | Ga0496122_0213971 | 3300048925 | Bacteria | 1113 |
| 723 | Ga0496123_0000870 | 3300048926 | Bacteria | 48048 |
| 724 | Ga0496123_0001731 | 3300048926 | Bacteria | 28930 |
| 725 | Ga0496123_0128183 | 3300048926 | Bacteria | 1412 |
| 726 | Ga0496123_0255814 | 3300048926 | Bacteria | 861 |
| 727 | Ga0496124_0000550 | 3300048927 | Bacteria | 63401 |
| 728 | Ga0496124_0277709 | 3300048927 | Bacteria | 1223 |
| 729 | Ga0496125_0000088 | 3300048928 | Bacteria | 214942 |
| 730 | Ga0496125_0104405 | 3300048928 | Bacteria | 2076 |
| 731 | Ga0496125_0403797 | 3300048928 | Bacteria | 797 |
| 732 | Ga0496126_0001255 | 3300048929 | Bacteria | 40994 |
| 733 | Ga0496126_0043756 | 3300048929 | Bacteria | 4128 |
| 734 | Ga0496126_0089276 | 3300048929 | Bacteria | 2713 |
| 735 | Ga0496126_0099388 | 3300048929 | Bacteria | 2548 |
| 736 | Ga0496126_0205539 | 3300048929 | Bacteria | 1660 |
| 737 | Ga0496126_0274518 | 3300048929 | Bacteria | 1398 |
| 738 | Ga0496126_0419888 | 3300048929 | Bacteria | 1081 |
| 739 | Ga0496126_0595557 | 3300048929 | Bacteria | 871 |
| 740 | Ga0495678_000717 | 3300049459 | Bacteria | 30162 |
| 741 | Ga0495682_0002423 | 3300049460 | Bacteria | 8838 |
| 742 | Ga0495682_0035371 | 3300049460 | Bacteria | 1840 |
| 743 | Ga0501031_0017958 | 3300049568 | Bacteria | 4602 |
| 744 | Ga0501031_0046308 | 3300049568 | Bacteria | 2836 |
| 745 | Ga0501031_0082901 | 3300049568 | Bacteria | 2090 |
| 746 | Ga0501031_0097531 | 3300049568 | Bacteria | 1918 |
| 747 | Ga0501031_0246758 | 3300049568 | Bacteria | 1160 |
| 748 | Ga0501032_0013508 | 3300049569 | Bacteria | 5806 |
| 749 | Ga0501032_0015498 | 3300049569 | Bacteria | 5374 |
| 750 | Ga0501032_0081607 | 3300049569 | Bacteria | 2151 |
| 751 | Ga0501032_0155893 | 3300049569 | Bacteria | 1500 |
| 752 | Ga0501032_0500882 | 3300049569 | Bacteria | 776 |
| 753 | Ga0501033_0000821 | 3300049570 | Bacteria | 28339 |
| 754 | Ga0501033_0020890 | 3300049570 | Bacteria | 4942 |
| 755 | Ga0501033_0073695 | 3300049570 | Bacteria | 2507 |
| 756 | Ga0501033_0204748 | 3300049570 | Unclassified | 1408 |
| 757 | Ga0501033_0335896 | 3300049570 | Bacteria | 1060 |
| 758 | Ga0501033_0341584 | 3300049570 | Bacteria | 1049 |
| 759 | Ga0501033_0352101 | 3300049570 | Bacteria | 1031 |
| 760 | Ga0501034_0000367 | 3300049571 | Bacteria | 76895 |
| 761 | Ga0501034_0003776 | 3300049571 | Bacteria | 17093 |
| 762 | Ga0501034_0006750 | 3300049571 | Bacteria | 12286 |
| 763 | Ga0501034_0016243 | 3300049571 | Bacteria | 7639 |
| 764 | Ga0501034_0026207 | 3300049571 | Bacteria | 5937 |
| 765 | Ga0501034_0026424 | 3300049571 | Bacteria | 5911 |
| 766 | Ga0501034_0099868 | 3300049571 | Bacteria | 2897 |
| 767 | Ga0501036_0009039 | 3300049572 | Bacteria | 8192 |
| 768 | Ga0501036_0018300 | 3300049572 | Bacteria | 5866 |
| 769 | Ga0501036_0056006 | 3300049572 | Bacteria | 3340 |
| 770 | Ga0501036_0304166 | 3300049572 | Bacteria | 1334 |
| 771 | Ga0501037_0023840 | 3300049573 | Bacteria | 4525 |
| 772 | Ga0501037_0040451 | 3300049573 | Bacteria | 3430 |
| 773 | Ga0501037_0058913 | 3300049573 | Bacteria | 2802 |
| 774 | Ga0501037_0090847 | 3300049573 | Bacteria | 2208 |
| 775 | Ga0501037_0139593 | 3300049573 | Bacteria | 1735 |
| 776 | Ga0501037_0162354 | 3300049573 | Bacteria | 1592 |
| 777 | Ga0501037_0283099 | 3300049573 | Bacteria | 1155 |
| 778 | Ga0501038_0001913 | 3300049574 | Bacteria | 19262 |
| 779 | Ga0501038_0002023 | 3300049574 | Bacteria | 18731 |
| 780 | Ga0501038_0011166 | 3300049574 | Bacteria | 8202 |
| 781 | Ga0501038_0102047 | 3300049574 | Bacteria | 2388 |
| 782 | Ga0501038_0125255 | 3300049574 | Unclassified | 2115 |
| 783 | Ga0501038_0126984 | 3300049574 | Bacteria | 2098 |
| 784 | Ga0501038_0316749 | 3300049574 | Bacteria | 1221 |
| 785 | Ga0501038_0488022 | 3300049574 | Bacteria | 943 |
| 786 | Ga0501039_0016405 | 3300049575 | Bacteria | 5673 |
| 787 | Ga0501039_0049274 | 3300049575 | Bacteria | 3256 |
| 788 | Ga0501042_0008733 | 3300049578 | Bacteria | 6721 |
| 789 | Ga0501042_0172574 | 3300049578 | Bacteria | 1560 |
| 790 | Ga0501042_0231764 | 3300049578 | Bacteria | 1332 |
| 791 | Ga0501043_0002412 | 3300049579 | Bacteria | 15824 |
| 792 | Ga0501043_0038855 | 3300049579 | Bacteria | 3742 |
| 793 | Ga0501043_0081322 | 3300049579 | Bacteria | 2545 |
| 794 | Ga0501043_0397587 | 3300049579 | Bacteria | 1041 |
| 795 | Ga0501046_0005696 | 3300049580 | Bacteria | 11116 |
| 796 | Ga0501046_0122223 | 3300049580 | Bacteria | 1980 |
| 797 | Ga0501046_0144280 | 3300049580 | Bacteria | 1799 |
| 798 | Ga0501047_0004935 | 3300049581 | Bacteria | 12527 |
| 799 | Ga0501047_0019091 | 3300049581 | Bacteria | 6577 |
| 800 | Ga0501047_0039526 | 3300049581 | Bacteria | 4562 |
| 801 | Ga0501047_0040924 | 3300049581 | Bacteria | 4480 |
| 802 | Ga0501047_0149576 | 3300049581 | Bacteria | 2211 |
| 803 | Ga0501047_0245383 | 3300049581 | Bacteria | 1640 |
| 804 | Ga0501047_0293539 | 3300049581 | Bacteria | 1469 |
| 805 | Ga0501047_0635092 | 3300049581 | Bacteria | 888 |
| 806 | Ga0501047_1030727 | 3300049581 | Bacteria | 636 |
| 807 | Ga0501048_0064496 | 3300049582 | Bacteria | 2591 |
| 808 | Ga0501048_0161859 | 3300049582 | Bacteria | 1584 |
| 809 | Ga0501067_0011288 | 3300049583 | Bacteria | 4946 |
| 810 | Ga0501067_0039847 | 3300049583 | Bacteria | 2609 |
| 811 | Ga0501067_0091198 | 3300049583 | Bacteria | 1692 |
| 812 | Ga0501067_0407467 | 3300049583 | Unclassified | 758 |
| 813 | Ga0501068_0021725 | 3300049584 | Bacteria | 3750 |
| 814 | Ga0501068_0041960 | 3300049584 | Bacteria | 2751 |
| 815 | Ga0501069_0006690 | 3300049585 | Bacteria | 6035 |
| 816 | Ga0501069_0055707 | 3300049585 | Bacteria | 2202 |
| 817 | Ga0501069_0075989 | 3300049585 | Bacteria | 1888 |
| 818 | Ga0501070_0007977 | 3300049586 | Bacteria | 8969 |
| 819 | Ga0501070_0091418 | 3300049586 | Bacteria | 2518 |
| 820 | Ga0501070_0103357 | 3300049586 | Bacteria | 2356 |
| 821 | Ga0501070_0158682 | 3300049586 | Bacteria | 1865 |
| 822 | Ga0501070_0178257 | 3300049586 | Unclassified | 1749 |
| 823 | Ga0501070_0262264 | 3300049586 | Bacteria | 1412 |
| 824 | Ga0501070_0376549 | 3300049586 | Bacteria | 1150 |
| 825 | Ga0501071_0011086 | 3300049587 | Bacteria | 6058 |
| 826 | Ga0501072_0121337 | 3300049588 | Bacteria | 2082 |
| 827 | Ga0501073_0003257 | 3300049589 | Bacteria | 12187 |
| 828 | Ga0501073_0007880 | 3300049589 | Bacteria | 7904 |
| 829 | Ga0501073_0030626 | 3300049589 | Bacteria | 3841 |
| 830 | Ga0501073_0039795 | 3300049589 | Bacteria | 3329 |
| 831 | Ga0501073_0056974 | 3300049589 | Bacteria | 2732 |
| 832 | Ga0501074_0006338 | 3300049590 | Bacteria | 8545 |
| 833 | Ga0501074_0066000 | 3300049590 | Bacteria | 2603 |
| 834 | Ga0501075_0625313 | 3300049591 | Unclassified | 821 |
| 835 | Ga0501076_0131219 | 3300049592 | Bacteria | 2032 |
| 836 | Ga0501077_0109670 | 3300049593 | Bacteria | 1749 |
| 837 | Ga0501079_0032313 | 3300049741 | Bacteria | 4024 |
| 838 | Ga0501080_0002305 | 3300049742 | Bacteria | 16635 |
| 839 | Ga0501080_0036164 | 3300049742 | Bacteria | 4610 |
| 840 | Ga0501080_0060497 | 3300049742 | Bacteria | 3526 |
| 841 | Ga0501080_0250821 | 3300049742 | Bacteria | 1614 |
| 842 | Ga0501080_0280718 | 3300049742 | Bacteria | 1514 |
| 843 | Ga0501080_0486894 | 3300049742 | Bacteria | 1103 |
| 844 | Ga0501080_0659825 | 3300049742 | Bacteria | 925 |
| 845 | Ga0501083_0010536 | 3300049744 | Bacteria | 6506 |
| 846 | Ga0501035_0005637 | 3300049822 | Bacteria | 11821 |
| 847 | Ga0501035_0008113 | 3300049822 | Bacteria | 9785 |
| 848 | Ga0501035_0009495 | 3300049822 | Bacteria | 9045 |
| 849 | Ga0501035_0021755 | 3300049822 | Bacteria | 5895 |
| 850 | Ga0501035_0063675 | 3300049822 | Bacteria | 3279 |
| 851 | Ga0501035_0127152 | 3300049822 | Bacteria | 2224 |
| 852 | Ga0501035_0315395 | 3300049822 | Bacteria | 1315 |
| 853 | Ga0501035_0344346 | 3300049822 | Bacteria | 1248 |
| 854 | Ga0501035_0406360 | 3300049822 | Bacteria | 1132 |
| 855 | Ga0501044_0008272 | 3300049823 | Bacteria | 11407 |
| 856 | Ga0501044_0017849 | 3300049823 | Bacteria | 7611 |
| 857 | Ga0501044_0024496 | 3300049823 | Bacteria | 6404 |
| 858 | Ga0501044_0030059 | 3300049823 | Bacteria | 5726 |
| 859 | Ga0501044_0054290 | 3300049823 | Bacteria | 4119 |
| 860 | Ga0501044_0069628 | 3300049823 | Bacteria | 3581 |
| 861 | Ga0501044_0069885 | 3300049823 | Bacteria | 3574 |
| 862 | Ga0501044_0075476 | 3300049823 | Bacteria | 3422 |
| 863 | Ga0501044_0260274 | 3300049823 | Bacteria | 1673 |
| 864 | Ga0501045_0061332 | 3300049824 | Bacteria | 2758 |
| 865 | Ga0500643_000031 | 3300053087 | Bacteria | 204488 |
| 866 | Ga0500643_019762 | 3300053087 | Bacteria | 2212 |
| 867 | Ga0500646_0083100 | 3300053090 | Bacteria | 980 |
| 868 | Ga0500651_0000144 | 3300053093 | Bacteria | 44879 |
| 869 | Ga0500651_0013646 | 3300053093 | Bacteria | 4958 |
| 870 | Ga0500651_0074083 | 3300053093 | Bacteria | 2116 |
| 871 | Ga0500555_000249 | 3300053103 | Bacteria | 23702 |
| 872 | Ga0500597_000253 | 3300053120 | Bacteria | 10919 |
| 873 | Ga0500568_0000455 | 3300053139 | Bacteria | 30618 |
| 874 | Ga0500633_0017865 | 3300053160 | Bacteria | 2090 |
| 875 | Ga0500645_002319 | 3300053730 | Bacteria | 8588 |
| 876 | Ga0501084_0011253 | 3300054114 | Bacteria | 7408 |
| 877 | Ga0501084_0022192 | 3300054114 | Bacteria | 5297 |
| 878 | Ga0501082_0011219 | 3300060353 | Bacteria | 7698 |
| 879 | Ga0501082_0021595 | 3300060353 | Bacteria | 5550 |
| 880 | Ga0501082_0078979 | 3300060353 | Bacteria | 2838 |
| 881 | Ga0466962_0001040 | 3300061719 | Bacteria | 12727 |
| 882 | Ga0466962_0008740 | 3300061719 | Bacteria | 4855 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042005 | Ga0439448_0182303 | Ga0439448_0182303_207_707 | 166 |
| 2 | 3300049582 | Ga0501048_0161859 | Ga0501048_0161859_1053_1559 | 168 |
| 3 | 3300009982 | Ga0105147_100668 | Ga0105147_1006683 | 169 |
| 4 | iso_pu_bacteria | 2718218334 | 2721025542 | 171 |
| 5 | iso_pu_bacteria | 2734482264 | 2735834488 | 171 |
| 6 | 3300038443 | Ga0395901_0142535 | Ga0395901_0142535_57_578 | 172 |
| 7 | 3300005344 | Ga0070661_100055463 | Ga0070661_1000554634 | 175 |
| 8 | 3300005455 | Ga0070663_100933358 | Ga0070663_1009333581 | 175 |
| 9 | 3300009545 | Ga0105237_11107800 | Ga0105237_111078001 | 175 |
| 10 | 3300010375 | Ga0105239_10012311 | Ga0105239_1001231111 | 175 |
| 11 | 3300013306 | Ga0163162_10083015 | Ga0163162_100830154 | 175 |
| 12 | 3300026067 | Ga0207678_10238262 | Ga0207678_102382622 | 175 |
| 13 | 3300046452 | Ga0495617_000091 | Ga0495617_000091_12842_13369 | 175 |
| 14 | 3300046452 | Ga0495617_001450 | Ga0495617_001450_7269_7796 | 175 |
| 15 | 3300046491 | Ga0495584_0003983 | Ga0495584_0003983_3729_4256 | 175 |
| 16 | 3300046492 | Ga0495585_0000112 | Ga0495585_0000112_59304_59831 | 175 |
| 17 | 3300046492 | Ga0495585_0001222 | Ga0495585_0001222_7299_7826 | 175 |
| 18 | 3300046501 | Ga0495607_0000006 | Ga0495607_0000006_223189_223716 | 175 |
| 19 | 3300046506 | Ga0495583_0043307 | Ga0495583_0043307_957_1484 | 175 |
| 20 | 3300046507 | Ga0495606_0000248 | Ga0495606_0000248_61935_62462 | 175 |
| 21 | 3300046507 | Ga0495606_0000267 | Ga0495606_0000267_31263_31790 | 175 |
| 22 | 3300046507 | Ga0495606_0009735 | Ga0495606_0009735_7009_7536 | 175 |
| 23 | 3300046507 | Ga0495606_0147989 | Ga0495606_0147989_567_1094 | 175 |
| 24 | 3300046512 | Ga0495610_0068091 | Ga0495610_0068091_977_1504 | 175 |
| 25 | 3300046513 | Ga0495616_0000074 | Ga0495616_0000074_51547_52074 | 175 |
| 26 | 3300046513 | Ga0495616_0056702 | Ga0495616_0056702_1105_1632 | 175 |
| 27 | 3300046515 | Ga0495620_0000066 | Ga0495620_0000066_12842_13369 | 175 |
| 28 | 3300046515 | Ga0495620_0002396 | Ga0495620_0002396_3549_4076 | 175 |
| 29 | 3300046518 | Ga0495631_0000997 | Ga0495631_0000997_7672_8199 | 175 |
| 30 | 3300046518 | Ga0495631_0044271 | Ga0495631_0044271_1028_1555 | 175 |
| 31 | 3300046519 | Ga0495632_0018629 | Ga0495632_0018629_2077_2604 | 175 |
| 32 | 3300046522 | Ga0495643_0060116 | Ga0495643_0060116_1354_1881 | 175 |
| 33 | 3300046524 | Ga0495648_0000820 | Ga0495648_0000820_24642_25169 | 175 |
| 34 | 3300046538 | Ga0495609_0013453 | Ga0495609_0013453_153_680 | 175 |
| 35 | 3300046616 | Ga0495668_0004126 | Ga0495668_0004126_5088_5615 | 175 |
| 36 | 3300046648 | Ga0495611_0000051 | Ga0495611_0000051_30124_30651 | 175 |
| 37 | 3300046660 | Ga0495625_0009320 | Ga0495625_0009320_5238_5765 | 175 |
| 38 | 3300046665 | Ga0495661_0001828 | Ga0495661_0001828_5034_5561 | 175 |
| 39 | 3300046665 | Ga0495661_0020848 | Ga0495661_0020848_2915_3442 | 175 |
| 40 | 3300046691 | Ga0495670_0001121 | Ga0495670_0001121_10827_11354 | 175 |
| 41 | 3300046691 | Ga0495670_0003174 | Ga0495670_0003174_5502_6029 | 175 |
| 42 | 3300046692 | Ga0495671_0000220 | Ga0495671_0000220_2182_2709 | 175 |
| 43 | 3300046794 | Ga0495589_0000067 | Ga0495589_0000067_9895_10422 | 175 |
| 44 | 3300046810 | Ga0495660_0000432 | Ga0495660_0000432_26905_27432 | 175 |
| 45 | 3300046810 | Ga0495660_0000808 | Ga0495660_0000808_17463_17990 | 175 |
| 46 | 3300047323 | Ga0495683_0001807 | Ga0495683_0001807_406_933 | 175 |
| 47 | 3300047469 | Ga0495673_0000004 | Ga0495673_0000004_1204817_1205344 | 175 |
| 48 | 3300047469 | Ga0495673_0000062 | Ga0495673_0000062_33851_34378 | 175 |
| 49 | 3300047469 | Ga0495673_0001868 | Ga0495673_0001868_11371_11898 | 175 |
| 50 | 3300047469 | Ga0495673_0021570 | Ga0495673_0021570_1529_2056 | 175 |
| 51 | 3300047472 | Ga0495686_0007582 | Ga0495686_0007582_6348_6875 | 175 |
| 52 | 3300047472 | Ga0495686_0013559 | Ga0495686_0013559_5066_5593 | 175 |
| 53 | 3300047472 | Ga0495686_0047340 | Ga0495686_0047340_1037_1564 | 175 |
| 54 | 3300048903 | Ga0496100_0006210 | Ga0496100_0006210_862_1389 | 175 |
| 55 | 3300048924 | Ga0496121_0000450 | Ga0496121_0000450_29072_29599 | 175 |
| 56 | 3300048924 | Ga0496121_0002452 | Ga0496121_0002452_15680_16207 | 175 |
| 57 | 3300048924 | Ga0496121_0045473 | Ga0496121_0045473_3203_3730 | 175 |
| 58 | 3300048925 | Ga0496122_0018881 | Ga0496122_0018881_3553_4080 | 175 |
| 59 | 3300048926 | Ga0496123_0255814 | Ga0496123_0255814_206_733 | 175 |
| 60 | 3300048927 | Ga0496124_0000550 | Ga0496124_0000550_55295_55822 | 175 |
| 61 | 3300048927 | Ga0496124_0277709 | Ga0496124_0277709_161_688 | 175 |
| 62 | 3300049459 | Ga0495678_000717 | Ga0495678_000717_7863_8390 | 175 |
| 63 | 3300049460 | Ga0495682_0002423 | Ga0495682_0002423_3538_4065 | 175 |
| 64 | 3300053087 | Ga0500643_000031 | Ga0500643_000031_29795_30322 | 175 |
| 65 | 3300053103 | Ga0500555_000249 | Ga0500555_000249_8747_9274 | 175 |
| 66 | 3300053160 | Ga0500633_0017865 | Ga0500633_0017865_166_693 | 175 |
| 67 | 3300053730 | Ga0500645_002319 | Ga0500645_002319_3138_3665 | 175 |
| 68 | 3300002737 | JGI25162J39368_1001661 | JGI25162J39368_10016617 | 184 |
| 69 | 3300002772 | JGI25164J39214_1000454 | JGI25164J39214_100045411 | 184 |
| 70 | 3300003214 | JGI25165J46597_1006555 | JGI25165J46597_10065551 | 184 |
| 71 | 3300005459 | Ga0068867_100219122 | Ga0068867_1002191222 | 184 |
| 72 | 3300025231 | Ga0207427_100044 | Ga0207427_10004441 | 184 |
| 73 | 3300025233 | Ga0209437_100005 | Ga0209437_100005336 | 184 |
| 74 | 3300025261 | Ga0209233_1000011 | Ga0209233_1000011606 | 184 |
| 75 | 3300025940 | Ga0207691_10096278 | Ga0207691_100962782 | 184 |
| 76 | 3300028379 | Ga0268266_10304927 | Ga0268266_103049271 | 184 |
| 77 | 3300031238 | Ga0265332_10077822 | Ga0265332_100778222 | 184 |
| 78 | 3300037418 | Ga0395900_0000733 | Ga0395900_0000733_5000_5554 | 184 |
| 79 | 3300037466 | Ga0395898_0031713 | Ga0395898_0031713_442_996 | 184 |
| 80 | 3300041451 | Ga0451791_1402863 | Ga0451791_1402863_480_1040 | 184 |
| 81 | 3300041452 | Ga0451793_1096456 | Ga0451793_1096456_1359_1916 | 184 |
| 82 | 3300041453 | Ga0451797_0845396 | Ga0451797_0845396_395_955 | 184 |
| 83 | 3300041460 | Ga0451802_0271155 | Ga0451802_0271155_405_965 | 184 |
| 84 | 3300041486 | Ga0451807_1964740 | Ga0451807_1964740_585_1145 | 184 |
| 85 | 3300041491 | Ga0451833_1330051 | Ga0451833_1330051_393_953 | 184 |
| 86 | 3300041512 | Ga0451853_1120445 | Ga0451853_1120445_826_1386 | 184 |
| 87 | 3300048910 | Ga0496107_0789362 | Ga0496107_0789362_112_669 | 184 |
| 88 | 3300048920 | Ga0496117_0426450 | Ga0496117_0426450_11_565 | 184 |
| 89 | 3300049568 | Ga0501031_0246758 | Ga0501031_0246758_564_1118 | 184 |
| 90 | 3300049569 | Ga0501032_0015498 | Ga0501032_0015498_4244_4798 | 184 |
| 91 | 3300049569 | Ga0501032_0081607 | Ga0501032_0081607_1062_1616 | 184 |
| 92 | 3300049570 | Ga0501033_0000821 | Ga0501033_0000821_6932_7486 | 184 |
| 93 | 3300049570 | Ga0501033_0204748 | Ga0501033_0204748_564_1118 | 184 |
| 94 | 3300049571 | Ga0501034_0003776 | Ga0501034_0003776_9738_10292 | 184 |
| 95 | 3300049571 | Ga0501034_0026424 | Ga0501034_0026424_2213_2767 | 184 |
| 96 | 3300049572 | Ga0501036_0009039 | Ga0501036_0009039_3671_4225 | 184 |
| 97 | 3300049573 | Ga0501037_0023840 | Ga0501037_0023840_301_855 | 184 |
| 98 | 3300049573 | Ga0501037_0162354 | Ga0501037_0162354_503_1057 | 184 |
| 99 | 3300049574 | Ga0501038_0002023 | Ga0501038_0002023_11503_12057 | 184 |
| 100 | 3300049574 | Ga0501038_0011166 | Ga0501038_0011166_291_845 | 184 |
| 101 | 3300049575 | Ga0501039_0016405 | Ga0501039_0016405_4071_4625 | 184 |
| 102 | 3300049578 | Ga0501042_0008733 | Ga0501042_0008733_3712_4266 | 184 |
| 103 | 3300049578 | Ga0501042_0172574 | Ga0501042_0172574_372_926 | 184 |
| 104 | 3300049578 | Ga0501042_0231764 | Ga0501042_0231764_197_751 | 184 |
| 105 | 3300049579 | Ga0501043_0002412 | Ga0501043_0002412_3175_3729 | 184 |
| 106 | 3300049579 | Ga0501043_0397587 | Ga0501043_0397587_197_751 | 184 |
| 107 | 3300049580 | Ga0501046_0005696 | Ga0501046_0005696_4342_4896 | 184 |
| 108 | 3300049581 | Ga0501047_0004935 | Ga0501047_0004935_6859_7413 | 184 |
| 109 | 3300049581 | Ga0501047_0019091 | Ga0501047_0019091_4433_4987 | 184 |
| 110 | 3300049582 | Ga0501048_0064496 | Ga0501048_0064496_1656_2210 | 184 |
| 111 | 3300049583 | Ga0501067_0011288 | Ga0501067_0011288_3878_4432 | 184 |
| 112 | 3300049583 | Ga0501067_0039847 | Ga0501067_0039847_920_1474 | 184 |
| 113 | 3300049584 | Ga0501068_0021725 | Ga0501068_0021725_599_1153 | 184 |
| 114 | 3300049585 | Ga0501069_0006690 | Ga0501069_0006690_4242_4796 | 184 |
| 115 | 3300049585 | Ga0501069_0075989 | Ga0501069_0075989_271_825 | 184 |
| 116 | 3300049586 | Ga0501070_0007977 | Ga0501070_0007977_3799_4353 | 184 |
| 117 | 3300049586 | Ga0501070_0091418 | Ga0501070_0091418_1674_2228 | 184 |
| 118 | 3300049586 | Ga0501070_0376549 | Ga0501070_0376549_320_874 | 184 |
| 119 | 3300049587 | Ga0501071_0011086 | Ga0501071_0011086_4067_4621 | 184 |
| 120 | 3300049588 | Ga0501072_0121337 | Ga0501072_0121337_712_1266 | 184 |
| 121 | 3300049589 | Ga0501073_0007880 | Ga0501073_0007880_5166_5720 | 184 |
| 122 | 3300049589 | Ga0501073_0030626 | Ga0501073_0030626_832_1386 | 184 |
| 123 | 3300049589 | Ga0501073_0039795 | Ga0501073_0039795_291_845 | 184 |
| 124 | 3300049590 | Ga0501074_0006338 | Ga0501074_0006338_7701_8255 | 184 |
| 125 | 3300049590 | Ga0501074_0066000 | Ga0501074_0066000_1100_1654 | 184 |
| 126 | 3300049591 | Ga0501075_0625313 | Ga0501075_0625313_36_590 | 184 |
| 127 | 3300049592 | Ga0501076_0131219 | Ga0501076_0131219_181_735 | 184 |
| 128 | 3300049741 | Ga0501079_0032313 | Ga0501079_0032313_2285_2839 | 184 |
| 129 | 3300049742 | Ga0501080_0002305 | Ga0501080_0002305_6539_7093 | 184 |
| 130 | 3300049822 | Ga0501035_0005637 | Ga0501035_0005637_8045_8599 | 184 |
| 131 | 3300049822 | Ga0501035_0008113 | Ga0501035_0008113_8797_9351 | 184 |
| 132 | 3300049822 | Ga0501035_0315395 | Ga0501035_0315395_730_1284 | 184 |
| 133 | 3300049823 | Ga0501044_0030059 | Ga0501044_0030059_3299_3853 | 184 |
| 134 | 3300049823 | Ga0501044_0054290 | Ga0501044_0054290_577_1131 | 184 |
| 135 | 3300049823 | Ga0501044_0075476 | Ga0501044_0075476_536_1090 | 184 |
| 136 | 3300049824 | Ga0501045_0061332 | Ga0501045_0061332_1010_1564 | 184 |
| 137 | 3300053093 | Ga0500651_0000144 | Ga0500651_0000144_43514_44071 | 184 |
| 138 | 3300054114 | Ga0501084_0011253 | Ga0501084_0011253_1126_1680 | 184 |
| 139 | 3300060353 | Ga0501082_0011219 | Ga0501082_0011219_3268_3822 | 184 |
| 140 | 3300060353 | Ga0501082_0078979 | Ga0501082_0078979_2229_2783 | 184 |
| 141 | 3300041512 | Ga0451853_2151927 | Ga0451853_2151927_242_823 | 188 |
| 142 | 3300044693 | Ga0466961_0000378 | Ga0466961_0000378_23675_24250 | 188 |
| 143 | 3300044719 | Ga0466971_0098167 | Ga0466971_0098167_589_1164 | 188 |
| 144 | 3300003322 | rootL2_10011264 | rootL2_100112641 | 189 |
| 145 | 3300003323 | rootH1_10034785 | rootH1_100347851 | 189 |
| 146 | 3300015689 | Ga0183360_10004 | Ga0183360_10004199 | 189 |
| 147 | 3300041411 | Ga0439466_0055399 | Ga0439466_0055399_422_1096 | 189 |
| 148 | 3300049593 | Ga0501077_0109670 | Ga0501077_0109670_292_867 | 190 |
| 149 | 3300048924 | Ga0496121_0001992 | Ga0496121_0001992_5308_5952 | 191 |
| 150 | 3300049742 | Ga0501080_0250821 | Ga0501080_0250821_289_888 | 191 |
| 151 | 3300049823 | Ga0501044_0260274 | Ga0501044_0260274_748_1347 | 191 |
| 152 | iso_pu_bacteria | 2884338543 | 2884338883 | 191 |
| 153 | 3300003762 | Ga0055542_1000105 | Ga0055542_100010522 | 192 |
| 154 | 3300005616 | Ga0068852_100001204 | Ga0068852_1000012046 | 192 |
| 155 | 3300013307 | Ga0157372_10649018 | Ga0157372_106490183 | 192 |
| 156 | 3300025242 | Ga0209258_100090 | Ga0209258_100090132 | 192 |
| 157 | 3300025254 | Ga0209148_1000065 | Ga0209148_1000065132 | 192 |
| 158 | 3300037312 | Ga0395899_0001468 | Ga0395899_0001468_10200_10787 | 192 |
| 159 | 3300037418 | Ga0395900_0002500 | Ga0395900_0002500_12194_12775 | 192 |
| 160 | 3300037466 | Ga0395898_0000013 | Ga0395898_0000013_63468_64055 | 192 |
| 161 | 3300037853 | Ga0436364_1417079 | Ga0436364_1417079_880_1467 | 192 |
| 162 | 3300038443 | Ga0395901_0134373 | Ga0395901_0134373_1577_2164 | 192 |
| 163 | 3300041486 | Ga0451807_1337181 | Ga0451807_1337181_463_1062 | 192 |
| 164 | 3300044694 | Ga0466963_0299782 | Ga0466963_0299782_267_854 | 192 |
| 165 | 3300044735 | Ga0466968_0000075 | Ga0466968_0000075_7785_8363 | 192 |
| 166 | 3300045976 | Ga0466967_0051040 | Ga0466967_0051040_1221_1808 | 192 |
| 167 | 3300048915 | Ga0496112_0380324 | Ga0496112_0380324_110_688 | 192 |
| 168 | 3300048916 | Ga0496113_0195270 | Ga0496113_0195270_982_1560 | 192 |
| 169 | 3300048918 | Ga0496115_0000124 | Ga0496115_0000124_42553_43131 | 192 |
| 170 | 3300048925 | Ga0496122_0213971 | Ga0496122_0213971_186_764 | 192 |
| 171 | 3300048926 | Ga0496123_0128183 | Ga0496123_0128183_55_633 | 192 |
| 172 | iso_pu_bacteria | 2643221577 | 2643896583 | 192 |
| 173 | iso_pu_bacteria | 2643221685 | 2644478664 | 192 |
| 174 | iso_pu_bacteria | 2739367700 | 2739733187 | 192 |
| 175 | iso_pu_bacteria | 2884411467 | 2884415724 | 192 |
| 176 | iso_pu_bacteria | 2928963466 | 2928966899 | 192 |
| 177 | 3300005327 | Ga0070658_10005032 | Ga0070658_100050329 | 193 |
| 178 | 3300005335 | Ga0070666_10000020 | Ga0070666_10000020133 | 193 |
| 179 | 3300005344 | Ga0070661_100004622 | Ga0070661_1000046228 | 193 |
| 180 | 3300005548 | Ga0070665_100001328 | Ga0070665_1000013289 | 193 |
| 181 | 3300005843 | Ga0068860_100412916 | Ga0068860_1004129162 | 193 |
| 182 | 3300009092 | Ga0105250_10095931 | Ga0105250_100959311 | 193 |
| 183 | 3300009101 | Ga0105247_10630510 | Ga0105247_106305102 | 193 |
| 184 | 3300009551 | Ga0105238_10001023 | Ga0105238_100010239 | 193 |
| 185 | 3300025711 | Ga0207696_1149757 | Ga0207696_11497571 | 193 |
| 186 | 3300025903 | Ga0207680_10000001 | Ga0207680_10000001935 | 193 |
| 187 | 3300025904 | Ga0207647_10296206 | Ga0207647_102962062 | 193 |
| 188 | 3300025909 | Ga0207705_10003986 | Ga0207705_100039866 | 193 |
| 189 | 3300025920 | Ga0207649_10003075 | Ga0207649_100030755 | 193 |
| 190 | 3300025924 | Ga0207694_10006615 | Ga0207694_100066154 | 193 |
| 191 | 3300028379 | Ga0268266_10000067 | Ga0268266_1000006795 | 193 |
| 192 | 3300028381 | Ga0268264_10333291 | Ga0268264_103332912 | 193 |
| 193 | 3300028786 | Ga0307517_10102780 | Ga0307517_101027804 | 193 |
| 194 | 3300033180 | Ga0307510_10018630 | Ga0307510_100186302 | 193 |
| 195 | 3300033180 | Ga0307510_10040472 | Ga0307510_100404722 | 193 |
| 196 | 3300038443 | Ga0395901_0140291 | Ga0395901_0140291_1311_1895 | 193 |
| 197 | 3300046471 | Ga0495650_0000465 | Ga0495650_0000465_30003_30590 | 193 |
| 198 | 3300046507 | Ga0495606_0026232 | Ga0495606_0026232_2843_3430 | 193 |
| 199 | 3300046660 | Ga0495625_0027097 | Ga0495625_0027097_3114_3701 | 193 |
| 200 | 3300048904 | Ga0496101_0020683 | Ga0496101_0020683_2798_3391 | 193 |
| 201 | 3300048907 | Ga0496104_0052949 | Ga0496104_0052949_1470_2063 | 193 |
| 202 | 3300048908 | Ga0496105_0005605 | Ga0496105_0005605_4753_5346 | 193 |
| 203 | 3300048918 | Ga0496115_0018698 | Ga0496115_0018698_1946_2539 | 193 |
| 204 | 3300048919 | Ga0496116_0027095 | Ga0496116_0027095_3284_3877 | 193 |
| 205 | 3300048920 | Ga0496117_0003423 | Ga0496117_0003423_16698_17291 | 193 |
| 206 | 3300048920 | Ga0496117_0337814 | Ga0496117_0337814_86_679 | 193 |
| 207 | 3300048921 | Ga0496118_0001207 | Ga0496118_0001207_8670_9263 | 193 |
| 208 | 3300048921 | Ga0496118_0022313 | Ga0496118_0022313_67_660 | 193 |
| 209 | 3300048921 | Ga0496118_0322159 | Ga0496118_0322159_38_625 | 193 |
| 210 | 3300048922 | Ga0496119_0001330 | Ga0496119_0001330_4221_4814 | 193 |
| 211 | 3300048923 | Ga0496120_0000539 | Ga0496120_0000539_53263_53856 | 193 |
| 212 | 3300048924 | Ga0496121_0026203 | Ga0496121_0026203_167_760 | 193 |
| 213 | 3300048924 | Ga0496121_0073796 | Ga0496121_0073796_1950_2537 | 193 |
| 214 | 3300048928 | Ga0496125_0403797 | Ga0496125_0403797_85_672 | 193 |
| 215 | 3300048929 | Ga0496126_0001255 | Ga0496126_0001255_18039_18632 | 193 |
| 216 | 3300048929 | Ga0496126_0043756 | Ga0496126_0043756_2403_2990 | 193 |
| 217 | 3300053090 | Ga0500646_0083100 | Ga0500646_0083100_179_766 | 193 |
| 218 | iso_pu_bacteria | 2537561836 | 2538831992 | 193 |
| 219 | iso_pu_bacteria | 2643221562 | 2643828880 | 193 |
| 220 | iso_pu_bacteria | 2842914999 | 2842915674 | 193 |
| 221 | iso_pu_bacteria | 2895395659 | 2895395923 | 193 |
| 222 | iso_pu_bacteria | 2939611941 | 2939613344 | 193 |
| 223 | iso_pu_bacteria | 2995948881 | 2995953853 | 193 |
| 224 | 3300041494 | Ga0451837_0571727 | Ga0451837_0571727_4269_4874 | 194 |
| 225 | 3300041494 | Ga0451837_1034586 | Ga0451837_1034586_143_748 | 194 |
| 226 | 3300041494 | Ga0451837_1245730 | Ga0451837_1245730_154_759 | 194 |
| 227 | 3300041509 | Ga0451843_0143886 | Ga0451843_0143886_201_806 | 194 |
| 228 | 3300041509 | Ga0451843_1235005 | Ga0451843_1235005_94_699 | 194 |
| 229 | 3300045976 | Ga0466967_0255901 | Ga0466967_0255901_312_899 | 194 |
| 230 | 3300049571 | Ga0501034_0000367 | Ga0501034_0000367_74351_74959 | 194 |
| 231 | 3300049581 | Ga0501047_1030727 | Ga0501047_1030727_16_624 | 194 |
| 232 | 3300002075 | JGI24738J21930_10000020 | JGI24738J21930_1000002022 | 195 |
| 233 | 3300003578 | Ga0006562J51391_1201163 | Ga0006562J51391_12011634 | 195 |
| 234 | 3300003578 | Ga0006562J51391_1201164 | Ga0006562J51391_12011642 | 195 |
| 235 | 3300005455 | Ga0070663_100012632 | Ga0070663_1000126323 | 195 |
| 236 | 3300009101 | Ga0105247_10002045 | Ga0105247_1000204514 | 195 |
| 237 | 3300013105 | Ga0157369_10008532 | Ga0157369_1000853210 | 195 |
| 238 | 3300013308 | Ga0157375_10205673 | Ga0157375_102056732 | 195 |
| 239 | 3300015261 | Ga0182006_1000065 | Ga0182006_100006535 | 195 |
| 240 | 3300015262 | Ga0182007_10005217 | Ga0182007_100052179 | 195 |
| 241 | 3300015265 | Ga0182005_1001497 | Ga0182005_10014976 | 195 |
| 242 | 3300015265 | Ga0182005_1008021 | Ga0182005_10080212 | 195 |
| 243 | 3300017792 | Ga0163161_10002563 | Ga0163161_100025637 | 195 |
| 244 | 3300017792 | Ga0163161_10097349 | Ga0163161_100973492 | 195 |
| 245 | 3300025229 | Ga0209147_108813 | Ga0209147_1088132 | 195 |
| 246 | 3300025904 | Ga0207647_10000014 | Ga0207647_100000146 | 195 |
| 247 | 3300025920 | Ga0207649_10023263 | Ga0207649_100232634 | 195 |
| 248 | 3300026067 | Ga0207678_10026742 | Ga0207678_100267425 | 195 |
| 249 | 3300026067 | Ga0207678_10050032 | Ga0207678_100500326 | 195 |
| 250 | 3300044842 | Ga0466957_0101706 | Ga0466957_0101706_370_957 | 195 |
| 251 | 3300046519 | Ga0495632_0000279 | Ga0495632_0000279_7989_8579 | 195 |
| 252 | 3300047472 | Ga0495686_0000024 | Ga0495686_0000024_25786_26373 | 195 |
| 253 | 3300047472 | Ga0495686_0000287 | Ga0495686_0000287_28499_29086 | 195 |
| 254 | 3300048904 | Ga0496101_0018413 | Ga0496101_0018413_2817_3404 | 195 |
| 255 | 3300048909 | Ga0496106_0000344 | Ga0496106_0000344_9228_9815 | 195 |
| 256 | 3300048920 | Ga0496117_0014978 | Ga0496117_0014978_5251_5838 | 195 |
| 257 | 3300048920 | Ga0496117_0128885 | Ga0496117_0128885_715_1302 | 195 |
| 258 | 3300048921 | Ga0496118_0000268 | Ga0496118_0000268_83450_84037 | 195 |
| 259 | 3300048921 | Ga0496118_0007168 | Ga0496118_0007168_8932_9519 | 195 |
| 260 | 3300048929 | Ga0496126_0205539 | Ga0496126_0205539_634_1221 | 195 |
| 261 | iso_pu_bacteria | 2941489479 | 2941492705 | 195 |
| 262 | 3300001989 | JGI24739J22299_10083624 | JGI24739J22299_100836242 | 196 |
| 263 | 3300001990 | JGI24737J22298_10109933 | JGI24737J22298_101099332 | 196 |
| 264 | 3300002705 | JGI25156J39149_1000480 | JGI25156J39149_100048023 | 196 |
| 265 | 3300002705 | JGI25156J39149_1004347 | JGI25156J39149_10043474 | 196 |
| 266 | 3300002705 | JGI25156J39149_1012327 | JGI25156J39149_10123273 | 196 |
| 267 | 3300002737 | JGI25162J39368_1000454 | JGI25162J39368_10004545 | 196 |
| 268 | 3300002737 | JGI25162J39368_1000657 | JGI25162J39368_10006578 | 196 |
| 269 | 3300002737 | JGI25162J39368_1002289 | JGI25162J39368_10022894 | 196 |
| 270 | 3300002741 | JGI25157J39369_1000300 | JGI25157J39369_10003005 | 196 |
| 271 | 3300002741 | JGI25157J39369_1000525 | JGI25157J39369_10005255 | 196 |
| 272 | 3300002741 | JGI25157J39369_1001263 | JGI25157J39369_10012637 | 196 |
| 273 | 3300002771 | JGI25163J39215_1000882 | JGI25163J39215_10008823 | 196 |
| 274 | 3300002772 | JGI25164J39214_1000112 | JGI25164J39214_100011247 | 196 |
| 275 | 3300002772 | JGI25164J39214_1000295 | JGI25164J39214_100029532 | 196 |
| 276 | 3300002772 | JGI25164J39214_1008953 | JGI25164J39214_10089531 | 196 |
| 277 | 3300003214 | JGI25165J46597_1000229 | JGI25165J46597_100022947 | 196 |
| 278 | 3300003214 | JGI25165J46597_1000527 | JGI25165J46597_10005275 | 196 |
| 279 | 3300003316 | rootH1_10006421 | rootH1_100064212 | 196 |
| 280 | 3300003316 | rootH1_10124382 | rootH1_101243822 | 196 |
| 281 | 3300003320 | rootH2_10047639 | rootH2_100476393 | 196 |
| 282 | 3300003320 | rootH2_10082323 | rootH2_100823232 | 196 |
| 283 | 3300003323 | rootH1_10183402 | rootH1_101834022 | 196 |
| 284 | 3300003323 | rootH1_10236681 | rootH1_102366813 | 196 |
| 285 | 3300003751 | Ga0055538_1001138 | Ga0055538_10011385 | 196 |
| 286 | 3300003752 | Ga0055539_1005663 | Ga0055539_10056631 | 196 |
| 287 | 3300003752 | Ga0055539_1019428 | Ga0055539_10194281 | 196 |
| 288 | 3300003756 | Ga0055533_1000581 | Ga0055533_10005817 | 196 |
| 289 | 3300003756 | Ga0055533_1003055 | Ga0055533_10030552 | 196 |
| 290 | 3300003759 | Ga0055525_1000082 | Ga0055525_100008266 | 196 |
| 291 | 3300003760 | Ga0055527_1000072 | Ga0055527_100007248 | 196 |
| 292 | 3300003760 | Ga0055527_1000080 | Ga0055527_100008027 | 196 |
| 293 | 3300003760 | Ga0055527_1003188 | Ga0055527_10031882 | 196 |
| 294 | 3300003760 | Ga0055527_1011228 | Ga0055527_10112282 | 196 |
| 295 | 3300003761 | Ga0055535_1000162 | Ga0055535_100016243 | 196 |
| 296 | 3300003761 | Ga0055535_1000189 | Ga0055535_100018938 | 196 |
| 297 | 3300003761 | Ga0055535_1000491 | Ga0055535_100049133 | 196 |
| 298 | 3300003761 | Ga0055535_1000611 | Ga0055535_100061116 | 196 |
| 299 | 3300003761 | Ga0055535_1001129 | Ga0055535_10011294 | 196 |
| 300 | 3300003762 | Ga0055542_1000163 | Ga0055542_100016326 | 196 |
| 301 | 3300003762 | Ga0055542_1000181 | Ga0055542_100018146 | 196 |
| 302 | 3300003762 | Ga0055542_1000188 | Ga0055542_100018823 | 196 |
| 303 | 3300003762 | Ga0055542_1000254 | Ga0055542_100025430 | 196 |
| 304 | 3300003762 | Ga0055542_1000573 | Ga0055542_100057330 | 196 |
| 305 | 3300003763 | Ga0055529_1000205 | Ga0055529_100020546 | 196 |
| 306 | 3300003763 | Ga0055529_1000209 | Ga0055529_100020925 | 196 |
| 307 | 3300003763 | Ga0055529_1000336 | Ga0055529_100033628 | 196 |
| 308 | 3300003763 | Ga0055529_1000496 | Ga0055529_10004965 | 196 |
| 309 | 3300005327 | Ga0070658_10873277 | Ga0070658_108732771 | 196 |
| 310 | 3300005331 | Ga0070670_100132781 | Ga0070670_1001327812 | 196 |
| 311 | 3300005338 | Ga0068868_100462320 | Ga0068868_1004623201 | 196 |
| 312 | 3300005340 | Ga0070689_100004873 | Ga0070689_1000048735 | 196 |
| 313 | 3300005341 | Ga0070691_10122135 | Ga0070691_101221352 | 196 |
| 314 | 3300005344 | Ga0070661_100028888 | Ga0070661_1000288881 | 196 |
| 315 | 3300005344 | Ga0070661_100029522 | Ga0070661_1000295223 | 196 |
| 316 | 3300005355 | Ga0070671_100025842 | Ga0070671_1000258421 | 196 |
| 317 | 3300005364 | Ga0070673_100220277 | Ga0070673_1002202773 | 196 |
| 318 | 3300005367 | Ga0070667_100010566 | Ga0070667_1000105662 | 196 |
| 319 | 3300005367 | Ga0070667_100031091 | Ga0070667_1000310913 | 196 |
| 320 | 3300005367 | Ga0070667_100620417 | Ga0070667_1006204171 | 196 |
| 321 | 3300005455 | Ga0070663_100107997 | Ga0070663_1001079972 | 196 |
| 322 | 3300005458 | Ga0070681_10013694 | Ga0070681_100136944 | 196 |
| 323 | 3300005466 | Ga0070685_10010980 | Ga0070685_100109804 | 196 |
| 324 | 3300005539 | Ga0068853_100041046 | Ga0068853_1000410463 | 196 |
| 325 | 3300005539 | Ga0068853_100181559 | Ga0068853_1001815591 | 196 |
| 326 | 3300005539 | Ga0068853_100358905 | Ga0068853_1003589051 | 196 |
| 327 | 3300005548 | Ga0070665_100000097 | Ga0070665_100000097135 | 196 |
| 328 | 3300005563 | Ga0068855_100412537 | Ga0068855_1004125372 | 196 |
| 329 | 3300005563 | Ga0068855_100501717 | Ga0068855_1005017172 | 196 |
| 330 | 3300005577 | Ga0068857_100032832 | Ga0068857_1000328323 | 196 |
| 331 | 3300005577 | Ga0068857_100075732 | Ga0068857_1000757324 | 196 |
| 332 | 3300005577 | Ga0068857_100108570 | Ga0068857_1001085702 | 196 |
| 333 | 3300005614 | Ga0068856_100007251 | Ga0068856_10000725111 | 196 |
| 334 | 3300005614 | Ga0068856_100771812 | Ga0068856_1007718122 | 196 |
| 335 | 3300005616 | Ga0068852_100221594 | Ga0068852_1002215943 | 196 |
| 336 | 3300005834 | Ga0068851_10023176 | Ga0068851_100231763 | 196 |
| 337 | 3300005843 | Ga0068860_100145004 | Ga0068860_1001450041 | 196 |
| 338 | 3300005844 | Ga0068862_100059714 | Ga0068862_1000597143 | 196 |
| 339 | 3300005844 | Ga0068862_100104837 | Ga0068862_1001048373 | 196 |
| 340 | 3300006237 | Ga0097621_100017790 | Ga0097621_1000177904 | 196 |
| 341 | 3300006358 | Ga0068871_100069947 | Ga0068871_1000699472 | 196 |
| 342 | 3300006881 | Ga0068865_100199275 | Ga0068865_1001992752 | 196 |
| 343 | 3300009093 | Ga0105240_10006212 | Ga0105240_1000621210 | 196 |
| 344 | 3300009093 | Ga0105240_10006230 | Ga0105240_1000623010 | 196 |
| 345 | 3300009093 | Ga0105240_10084657 | Ga0105240_100846574 | 196 |
| 346 | 3300009093 | Ga0105240_10464558 | Ga0105240_104645581 | 196 |
| 347 | 3300009093 | Ga0105240_10975403 | Ga0105240_109754031 | 196 |
| 348 | 3300009177 | Ga0105248_10346591 | Ga0105248_103465912 | 196 |
| 349 | 3300009551 | Ga0105238_10208703 | Ga0105238_102087032 | 196 |
| 350 | 3300009551 | Ga0105238_11203240 | Ga0105238_112032402 | 196 |
| 351 | 3300010375 | Ga0105239_10000192 | Ga0105239_1000019258 | 196 |
| 352 | 3300010375 | Ga0105239_10550070 | Ga0105239_105500703 | 196 |
| 353 | 3300012502 | Ga0157347_1001512 | Ga0157347_10015123 | 196 |
| 354 | 3300013104 | Ga0157370_10162156 | Ga0157370_101621561 | 196 |
| 355 | 3300013105 | Ga0157369_10132720 | Ga0157369_101327202 | 196 |
| 356 | 3300013307 | Ga0157372_10104820 | Ga0157372_101048204 | 196 |
| 357 | 3300014325 | Ga0163163_10083520 | Ga0163163_100835203 | 196 |
| 358 | 3300014968 | Ga0157379_10090031 | Ga0157379_100900313 | 196 |
| 359 | 3300014969 | Ga0157376_10963307 | Ga0157376_109633071 | 196 |
| 360 | 3300015687 | Ga0183368_1002 | Ga0183368_10021317 | 196 |
| 361 | 3300025206 | Ga0209435_104672 | Ga0209435_1046722 | 196 |
| 362 | 3300025207 | Ga0209760_100417 | Ga0209760_1004175 | 196 |
| 363 | 3300025224 | Ga0209784_100053 | Ga0209784_100053152 | 196 |
| 364 | 3300025225 | Ga0209566_101751 | Ga0209566_1017513 | 196 |
| 365 | 3300025226 | Ga0209674_100014 | Ga0209674_100014144 | 196 |
| 366 | 3300025226 | Ga0209674_100234 | Ga0209674_10023420 | 196 |
| 367 | 3300025226 | Ga0209674_100413 | Ga0209674_10041316 | 196 |
| 368 | 3300025228 | Ga0209672_100004 | Ga0209672_100004443 | 196 |
| 369 | 3300025228 | Ga0209672_100008 | Ga0209672_100008343 | 196 |
| 370 | 3300025228 | Ga0209672_100089 | Ga0209672_10008987 | 196 |
| 371 | 3300025228 | Ga0209672_101247 | Ga0209672_10124711 | 196 |
| 372 | 3300025228 | Ga0209672_101845 | Ga0209672_1018455 | 196 |
| 373 | 3300025228 | Ga0209672_103546 | Ga0209672_1035463 | 196 |
| 374 | 3300025230 | Ga0209563_100097 | Ga0209563_10009768 | 196 |
| 375 | 3300025231 | Ga0207427_100051 | Ga0207427_100051150 | 196 |
| 376 | 3300025231 | Ga0207427_100061 | Ga0207427_1000615 | 196 |
| 377 | 3300025231 | Ga0207427_103025 | Ga0207427_1030253 | 196 |
| 378 | 3300025231 | Ga0207427_112494 | Ga0207427_1124942 | 196 |
| 379 | 3300025233 | Ga0209437_100037 | Ga0209437_100037164 | 196 |
| 380 | 3300025233 | Ga0209437_100152 | Ga0209437_10015298 | 196 |
| 381 | 3300025233 | Ga0209437_100279 | Ga0209437_10027966 | 196 |
| 382 | 3300025233 | Ga0209437_102261 | Ga0209437_1022615 | 196 |
| 383 | 3300025242 | Ga0209258_100003 | Ga0209258_100003443 | 196 |
| 384 | 3300025242 | Ga0209258_100004 | Ga0209258_100004847 | 196 |
| 385 | 3300025242 | Ga0209258_100008 | Ga0209258_100008472 | 196 |
| 386 | 3300025242 | Ga0209258_100173 | Ga0209258_100173107 | 196 |
| 387 | 3300025242 | Ga0209258_100541 | Ga0209258_1005415 | 196 |
| 388 | 3300025242 | Ga0209258_101149 | Ga0209258_10114910 | 196 |
| 389 | 3300025242 | Ga0209258_102841 | Ga0209258_1028412 | 196 |
| 390 | 3300025246 | Ga0209646_1000700 | Ga0209646_10007004 | 196 |
| 391 | 3300025246 | Ga0209646_1000900 | Ga0209646_10009005 | 196 |
| 392 | 3300025250 | Ga0209026_1000064 | Ga0209026_100006470 | 196 |
| 393 | 3300025250 | Ga0209026_1000104 | Ga0209026_10001045 | 196 |
| 394 | 3300025250 | Ga0209026_1000407 | Ga0209026_10004076 | 196 |
| 395 | 3300025250 | Ga0209026_1003591 | Ga0209026_10035912 | 196 |
| 396 | 3300025253 | Ga0209677_101838 | Ga0209677_1018388 | 196 |
| 397 | 3300025253 | Ga0209677_112023 | Ga0209677_1120233 | 196 |
| 398 | 3300025254 | Ga0209148_1000001 | Ga0209148_1000001346 | 196 |
| 399 | 3300025254 | Ga0209148_1000002 | Ga0209148_1000002304 | 196 |
| 400 | 3300025254 | Ga0209148_1000016 | Ga0209148_1000016443 | 196 |
| 401 | 3300025254 | Ga0209148_1000079 | Ga0209148_1000079210 | 196 |
| 402 | 3300025254 | Ga0209148_1000279 | Ga0209148_100027928 | 196 |
| 403 | 3300025256 | Ga0209759_1000165 | Ga0209759_100016567 | 196 |
| 404 | 3300025256 | Ga0209759_1000544 | Ga0209759_10005445 | 196 |
| 405 | 3300025256 | Ga0209759_1000762 | Ga0209759_100076218 | 196 |
| 406 | 3300025256 | Ga0209759_1002477 | Ga0209759_10024776 | 196 |
| 407 | 3300025261 | Ga0209233_1000002 | Ga0209233_10000021885 | 196 |
| 408 | 3300025261 | Ga0209233_1000099 | Ga0209233_1000099214 | 196 |
| 409 | 3300025261 | Ga0209233_1007681 | Ga0209233_10076813 | 196 |
| 410 | 3300025261 | Ga0209233_1027747 | Ga0209233_10277472 | 196 |
| 411 | 3300025272 | Ga0209455_1000004 | Ga0209455_1000004443 | 196 |
| 412 | 3300025272 | Ga0209455_1000007 | Ga0209455_1000007592 | 196 |
| 413 | 3300025272 | Ga0209455_1000016 | Ga0209455_1000016211 | 196 |
| 414 | 3300025272 | Ga0209455_1000079 | Ga0209455_10000795 | 196 |
| 415 | 3300025321 | Ga0207656_10035314 | Ga0207656_100353143 | 196 |
| 416 | 3300025904 | Ga0207647_10017313 | Ga0207647_100173133 | 196 |
| 417 | 3300025904 | Ga0207647_10064530 | Ga0207647_100645302 | 196 |
| 418 | 3300025912 | Ga0207707_10161188 | Ga0207707_101611883 | 196 |
| 419 | 3300025913 | Ga0207695_10000291 | Ga0207695_1000029193 | 196 |
| 420 | 3300025913 | Ga0207695_10001147 | Ga0207695_1000114729 | 196 |
| 421 | 3300025913 | Ga0207695_10057571 | Ga0207695_100575713 | 196 |
| 422 | 3300025920 | Ga0207649_10021106 | Ga0207649_100211064 | 196 |
| 423 | 3300025924 | Ga0207694_10569775 | Ga0207694_105697752 | 196 |
| 424 | 3300025936 | Ga0207670_10008997 | Ga0207670_100089973 | 196 |
| 425 | 3300025945 | Ga0207679_10036264 | Ga0207679_100362643 | 196 |
| 426 | 3300025949 | Ga0207667_10133995 | Ga0207667_101339953 | 196 |
| 427 | 3300025960 | Ga0207651_10072042 | Ga0207651_100720423 | 196 |
| 428 | 3300025981 | Ga0207640_10543140 | Ga0207640_105431402 | 196 |
| 429 | 3300025986 | Ga0207658_10099716 | Ga0207658_100997162 | 196 |
| 430 | 3300026035 | Ga0207703_10401961 | Ga0207703_104019612 | 196 |
| 431 | 3300026041 | Ga0207639_10009617 | Ga0207639_100096173 | 196 |
| 432 | 3300026067 | Ga0207678_10053454 | Ga0207678_100534544 | 196 |
| 433 | 3300026067 | Ga0207678_10152847 | Ga0207678_101528472 | 196 |
| 434 | 3300026078 | Ga0207702_10000960 | Ga0207702_100009609 | 196 |
| 435 | 3300026078 | Ga0207702_10741481 | Ga0207702_107414812 | 196 |
| 436 | 3300026116 | Ga0207674_10032637 | Ga0207674_100326375 | 196 |
| 437 | 3300026116 | Ga0207674_10100269 | Ga0207674_101002692 | 196 |
| 438 | 3300026142 | Ga0207698_10277718 | Ga0207698_102777182 | 196 |
| 439 | 3300026142 | Ga0207698_10552041 | Ga0207698_105520412 | 196 |
| 440 | 3300028379 | Ga0268266_10000101 | Ga0268266_10000101136 | 196 |
| 441 | 3300028380 | Ga0268265_10062614 | Ga0268265_100626144 | 196 |
| 442 | 3300028381 | Ga0268264_10767696 | Ga0268264_107676961 | 196 |
| 443 | 3300028800 | Ga0265338_10673318 | Ga0265338_106733181 | 196 |
| 444 | 3300031665 | Ga0316575_10051705 | Ga0316575_100517052 | 196 |
| 445 | 3300031665 | Ga0316575_10064821 | Ga0316575_100648212 | 196 |
| 446 | 3300037312 | Ga0395899_0000189 | Ga0395899_0000189_68020_68619 | 196 |
| 447 | 3300037312 | Ga0395899_0002467 | Ga0395899_0002467_4935_5537 | 196 |
| 448 | 3300037312 | Ga0395899_0032747 | Ga0395899_0032747_1930_2523 | 196 |
| 449 | 3300037418 | Ga0395900_0000011 | Ga0395900_0000011_62975_63574 | 196 |
| 450 | 3300037418 | Ga0395900_0023472 | Ga0395900_0023472_1708_2310 | 196 |
| 451 | 3300037418 | Ga0395900_0112130 | Ga0395900_0112130_1008_1601 | 196 |
| 452 | 3300037466 | Ga0395898_0000058 | Ga0395898_0000058_68297_68896 | 196 |
| 453 | 3300037466 | Ga0395898_0019179 | Ga0395898_0019179_3538_4140 | 196 |
| 454 | 3300037466 | Ga0395898_0025108 | Ga0395898_0025108_3904_4506 | 196 |
| 455 | 3300037466 | Ga0395898_0043523 | Ga0395898_0043523_3615_4208 | 196 |
| 456 | 3300037466 | Ga0395898_0122504 | Ga0395898_0122504_1557_2150 | 196 |
| 457 | 3300037471 | Ga0395905_0257375 | Ga0395905_0257375_736_1338 | 196 |
| 458 | 3300038443 | Ga0395901_0000961 | Ga0395901_0000961_21122_21715 | 196 |
| 459 | 3300038443 | Ga0395901_0018477 | Ga0395901_0018477_5822_6424 | 196 |
| 460 | 3300038443 | Ga0395901_0176825 | Ga0395901_0176825_404_1003 | 196 |
| 461 | 3300038443 | Ga0395901_0311716 | Ga0395901_0311716_626_1225 | 196 |
| 462 | 3300042005 | Ga0439448_0012270 | Ga0439448_0012270_612_1205 | 196 |
| 463 | 3300044536 | Ga0466988_0289744 | Ga0466988_0289744_122_721 | 196 |
| 464 | 3300044656 | Ga0466969_0003545 | Ga0466969_0003545_3273_3872 | 196 |
| 465 | 3300044656 | Ga0466969_0028054 | Ga0466969_0028054_194_787 | 196 |
| 466 | 3300044656 | Ga0466969_0048569 | Ga0466969_0048569_898_1497 | 196 |
| 467 | 3300044658 | Ga0466972_0048682 | Ga0466972_0048682_210_803 | 196 |
| 468 | 3300044672 | Ga0466982_0000001 | Ga0466982_0000001_377312_377905 | 196 |
| 469 | 3300044683 | Ga0466965_0003322 | Ga0466965_0003322_2966_3577 | 196 |
| 470 | 3300044683 | Ga0466965_0039831 | Ga0466965_0039831_15_608 | 196 |
| 471 | 3300044684 | Ga0466966_0007089 | Ga0466966_0007089_5750_6343 | 196 |
| 472 | 3300044684 | Ga0466966_0012332 | Ga0466966_0012332_4477_5076 | 196 |
| 473 | 3300044684 | Ga0466966_0014647 | Ga0466966_0014647_4095_4694 | 196 |
| 474 | 3300044693 | Ga0466961_0000349 | Ga0466961_0000349_18217_18828 | 196 |
| 475 | 3300044693 | Ga0466961_0000794 | Ga0466961_0000794_8004_8603 | 196 |
| 476 | 3300044693 | Ga0466961_0002114 | Ga0466961_0002114_3768_4367 | 196 |
| 477 | 3300044694 | Ga0466963_0092187 | Ga0466963_0092187_745_1356 | 196 |
| 478 | 3300044706 | Ga0466964_0055064 | Ga0466964_0055064_396_989 | 196 |
| 479 | 3300044706 | Ga0466964_0056523 | Ga0466964_0056523_873_1472 | 196 |
| 480 | 3300044719 | Ga0466971_0007188 | Ga0466971_0007188_4049_4660 | 196 |
| 481 | 3300044719 | Ga0466971_0016413 | Ga0466971_0016413_956_1555 | 196 |
| 482 | 3300044719 | Ga0466971_0045006 | Ga0466971_0045006_1266_1859 | 196 |
| 483 | 3300044765 | Ga0466970_0001565 | Ga0466970_0001565_4689_5288 | 196 |
| 484 | 3300044765 | Ga0466970_0007450 | Ga0466970_0007450_2055_2654 | 196 |
| 485 | 3300044765 | Ga0466970_0013456 | Ga0466970_0013456_1538_2131 | 196 |
| 486 | 3300044765 | Ga0466970_0030479 | Ga0466970_0030479_1188_1787 | 196 |
| 487 | 3300044842 | Ga0466957_0001666 | Ga0466957_0001666_4856_5455 | 196 |
| 488 | 3300044842 | Ga0466957_0020866 | Ga0466957_0020866_1107_1718 | 196 |
| 489 | 3300044842 | Ga0466957_0076440 | Ga0466957_0076440_189_782 | 196 |
| 490 | 3300044842 | Ga0466957_0462041 | Ga0466957_0462041_170_781 | 196 |
| 491 | 3300044901 | Ga0466960_0007010 | Ga0466960_0007010_3433_4026 | 196 |
| 492 | 3300045049 | Ga0466959_0002024 | Ga0466959_0002024_201_800 | 196 |
| 493 | 3300045049 | Ga0466959_0019504 | Ga0466959_0019504_154_765 | 196 |
| 494 | 3300045049 | Ga0466959_0034927 | Ga0466959_0034927_14_613 | 196 |
| 495 | 3300045836 | Ga0466958_0009531 | Ga0466958_0009531_1571_2170 | 196 |
| 496 | 3300045836 | Ga0466958_0016435 | Ga0466958_0016435_1127_1738 | 196 |
| 497 | 3300045836 | Ga0466958_0067952 | Ga0466958_0067952_770_1369 | 196 |
| 498 | 3300045976 | Ga0466967_0455997 | Ga0466967_0455997_54_644 | 196 |
| 499 | 3300046460 | Ga0495638_0000389 | Ga0495638_0000389_25196_25792 | 196 |
| 500 | 3300046460 | Ga0495638_0000799 | Ga0495638_0000799_27193_27789 | 196 |
| 501 | 3300046471 | Ga0495650_0000210 | Ga0495650_0000210_99800_100396 | 196 |
| 502 | 3300046507 | Ga0495606_0000016 | Ga0495606_0000016_3904_4500 | 196 |
| 503 | 3300046542 | Ga0495597_0181882 | Ga0495597_0181882_56_652 | 196 |
| 504 | 3300046557 | Ga0495622_0008826 | Ga0495622_0008826_793_1389 | 196 |
| 505 | 3300046660 | Ga0495625_0065402 | Ga0495625_0065402_327_923 | 196 |
| 506 | 3300046660 | Ga0495625_0584377 | Ga0495625_0584377_26_622 | 196 |
| 507 | 3300046694 | Ga0495649_0006391 | Ga0495649_0006391_1875_2471 | 196 |
| 508 | 3300048909 | Ga0496106_0190925 | Ga0496106_0190925_905_1507 | 196 |
| 509 | 3300048910 | Ga0496107_0341431 | Ga0496107_0341431_367_969 | 196 |
| 510 | 3300048917 | Ga0496114_0164280 | Ga0496114_0164280_83_679 | 196 |
| 511 | 3300048918 | Ga0496115_0000466 | Ga0496115_0000466_27652_28248 | 196 |
| 512 | 3300048918 | Ga0496115_0020772 | Ga0496115_0020772_4439_5035 | 196 |
| 513 | 3300048922 | Ga0496119_0007350 | Ga0496119_0007350_4133_4735 | 196 |
| 514 | 3300048923 | Ga0496120_0000359 | Ga0496120_0000359_65070_65672 | 196 |
| 515 | 3300048924 | Ga0496121_0000327 | Ga0496121_0000327_60882_61484 | 196 |
| 516 | 3300048928 | Ga0496125_0104405 | Ga0496125_0104405_136_729 | 196 |
| 517 | 3300048929 | Ga0496126_0089276 | Ga0496126_0089276_1211_1813 | 196 |
| 518 | 3300048929 | Ga0496126_0099388 | Ga0496126_0099388_72_665 | 196 |
| 519 | 3300048929 | Ga0496126_0419888 | Ga0496126_0419888_76_672 | 196 |
| 520 | 3300049460 | Ga0495682_0035371 | Ga0495682_0035371_1162_1758 | 196 |
| 521 | 3300049568 | Ga0501031_0017958 | Ga0501031_0017958_2321_2914 | 196 |
| 522 | 3300049568 | Ga0501031_0046308 | Ga0501031_0046308_1489_2085 | 196 |
| 523 | 3300049568 | Ga0501031_0082901 | Ga0501031_0082901_273_866 | 196 |
| 524 | 3300049569 | Ga0501032_0013508 | Ga0501032_0013508_500_1093 | 196 |
| 525 | 3300049569 | Ga0501032_0155893 | Ga0501032_0155893_12_605 | 196 |
| 526 | 3300049569 | Ga0501032_0500882 | Ga0501032_0500882_22_612 | 196 |
| 527 | 3300049570 | Ga0501033_0020890 | Ga0501033_0020890_166_759 | 196 |
| 528 | 3300049570 | Ga0501033_0335896 | Ga0501033_0335896_323_940 | 196 |
| 529 | 3300049570 | Ga0501033_0341584 | Ga0501033_0341584_167_760 | 196 |
| 530 | 3300049571 | Ga0501034_0006750 | Ga0501034_0006750_9572_10168 | 196 |
| 531 | 3300049571 | Ga0501034_0026207 | Ga0501034_0026207_1856_2449 | 196 |
| 532 | 3300049572 | Ga0501036_0056006 | Ga0501036_0056006_1535_2128 | 196 |
| 533 | 3300049573 | Ga0501037_0040451 | Ga0501037_0040451_769_1365 | 196 |
| 534 | 3300049573 | Ga0501037_0139593 | Ga0501037_0139593_887_1480 | 196 |
| 535 | 3300049573 | Ga0501037_0283099 | Ga0501037_0283099_354_947 | 196 |
| 536 | 3300049574 | Ga0501038_0001913 | Ga0501038_0001913_17555_18151 | 196 |
| 537 | 3300049574 | Ga0501038_0102047 | Ga0501038_0102047_1333_1926 | 196 |
| 538 | 3300049574 | Ga0501038_0488022 | Ga0501038_0488022_301_894 | 196 |
| 539 | 3300049575 | Ga0501039_0049274 | Ga0501039_0049274_776_1372 | 196 |
| 540 | 3300049579 | Ga0501043_0038855 | Ga0501043_0038855_136_732 | 196 |
| 541 | 3300049579 | Ga0501043_0081322 | Ga0501043_0081322_753_1343 | 196 |
| 542 | 3300049580 | Ga0501046_0144280 | Ga0501046_0144280_642_1232 | 196 |
| 543 | 3300049581 | Ga0501047_0039526 | Ga0501047_0039526_3426_4043 | 196 |
| 544 | 3300049581 | Ga0501047_0040924 | Ga0501047_0040924_1559_2152 | 196 |
| 545 | 3300049581 | Ga0501047_0293539 | Ga0501047_0293539_323_916 | 196 |
| 546 | 3300049581 | Ga0501047_0635092 | Ga0501047_0635092_234_827 | 196 |
| 547 | 3300049584 | Ga0501068_0041960 | Ga0501068_0041960_2057_2653 | 196 |
| 548 | 3300049586 | Ga0501070_0262264 | Ga0501070_0262264_554_1147 | 196 |
| 549 | 3300049589 | Ga0501073_0003257 | Ga0501073_0003257_9362_9958 | 196 |
| 550 | 3300049742 | Ga0501080_0060497 | Ga0501080_0060497_824_1420 | 196 |
| 551 | 3300049742 | Ga0501080_0486894 | Ga0501080_0486894_247_837 | 196 |
| 552 | 3300049742 | Ga0501080_0659825 | Ga0501080_0659825_283_876 | 196 |
| 553 | 3300049822 | Ga0501035_0021755 | Ga0501035_0021755_1768_2361 | 196 |
| 554 | 3300049822 | Ga0501035_0063675 | Ga0501035_0063675_560_1153 | 196 |
| 555 | 3300049822 | Ga0501035_0344346 | Ga0501035_0344346_225_821 | 196 |
| 556 | 3300049822 | Ga0501035_0406360 | Ga0501035_0406360_408_1025 | 196 |
| 557 | 3300049823 | Ga0501044_0008272 | Ga0501044_0008272_2546_3139 | 196 |
| 558 | 3300049823 | Ga0501044_0017849 | Ga0501044_0017849_2070_2666 | 196 |
| 559 | 3300049823 | Ga0501044_0024496 | Ga0501044_0024496_3433_4026 | 196 |
| 560 | 3300049823 | Ga0501044_0069628 | Ga0501044_0069628_468_1058 | 196 |
| 561 | 3300061719 | Ga0466962_0001040 | Ga0466962_0001040_1610_2203 | 196 |
| 562 | 3300061719 | Ga0466962_0008740 | Ga0466962_0008740_3681_4292 | 196 |
| 563 | 3300001979 | JGI24740J21852_10017269 | JGI24740J21852_100172694 | 197 |
| 564 | 3300001990 | JGI24737J22298_10000503 | JGI24737J22298_1000050314 | 197 |
| 565 | 3300002067 | JGI24735J21928_10023462 | JGI24735J21928_100234622 | 197 |
| 566 | 3300002705 | JGI25156J39149_1006967 | JGI25156J39149_10069673 | 197 |
| 567 | 3300002737 | JGI25162J39368_1000792 | JGI25162J39368_100079211 | 197 |
| 568 | 3300002741 | JGI25157J39369_1003690 | JGI25157J39369_10036903 | 197 |
| 569 | 3300002772 | JGI25164J39214_1000451 | JGI25164J39214_10004519 | 197 |
| 570 | 3300003214 | JGI25165J46597_1000872 | JGI25165J46597_10008729 | 197 |
| 571 | 3300003578 | Ga0006562J51391_1017349 | Ga0006562J51391_10173497 | 197 |
| 572 | 3300003763 | Ga0055529_1023381 | Ga0055529_10233811 | 197 |
| 573 | 3300003771 | Ga0055526_1000107 | Ga0055526_100010755 | 197 |
| 574 | 3300003773 | Ga0055537_1000125 | Ga0055537_100012542 | 197 |
| 575 | 3300003775 | Ga0055524_1000176 | Ga0055524_100017655 | 197 |
| 576 | 3300003784 | Ga0055534_1000090 | Ga0055534_100009055 | 197 |
| 577 | 3300003790 | Ga0055528_1000088 | Ga0055528_100008855 | 197 |
| 578 | 3300005327 | Ga0070658_10035840 | Ga0070658_100358403 | 197 |
| 579 | 3300005331 | Ga0070670_100255716 | Ga0070670_1002557162 | 197 |
| 580 | 3300005334 | Ga0068869_100244555 | Ga0068869_1002445551 | 197 |
| 581 | 3300005337 | Ga0070682_100006648 | Ga0070682_1000066486 | 197 |
| 582 | 3300005337 | Ga0070682_100467750 | Ga0070682_1004677502 | 197 |
| 583 | 3300005339 | Ga0070660_100011111 | Ga0070660_1000111114 | 197 |
| 584 | 3300005339 | Ga0070660_100105322 | Ga0070660_1001053223 | 197 |
| 585 | 3300005339 | Ga0070660_100120618 | Ga0070660_1001206182 | 197 |
| 586 | 3300005339 | Ga0070660_100205709 | Ga0070660_1002057093 | 197 |
| 587 | 3300005344 | Ga0070661_100007423 | Ga0070661_1000074236 | 197 |
| 588 | 3300005344 | Ga0070661_100095087 | Ga0070661_1000950872 | 197 |
| 589 | 3300005345 | Ga0070692_10023906 | Ga0070692_100239063 | 197 |
| 590 | 3300005345 | Ga0070692_10085847 | Ga0070692_100858472 | 197 |
| 591 | 3300005347 | Ga0070668_100001704 | Ga0070668_10000170410 | 197 |
| 592 | 3300005347 | Ga0070668_100834439 | Ga0070668_1008344391 | 197 |
| 593 | 3300005353 | Ga0070669_100511960 | Ga0070669_1005119602 | 197 |
| 594 | 3300005366 | Ga0070659_100003695 | Ga0070659_1000036954 | 197 |
| 595 | 3300005366 | Ga0070659_100043342 | Ga0070659_1000433424 | 197 |
| 596 | 3300005366 | Ga0070659_100127110 | Ga0070659_1001271102 | 197 |
| 597 | 3300005366 | Ga0070659_100519562 | Ga0070659_1005195621 | 197 |
| 598 | 3300005367 | Ga0070667_100000040 | Ga0070667_1000000402 | 197 |
| 599 | 3300005367 | Ga0070667_100062316 | Ga0070667_1000623162 | 197 |
| 600 | 3300005367 | Ga0070667_100073758 | Ga0070667_1000737582 | 197 |
| 601 | 3300005367 | Ga0070667_100309147 | Ga0070667_1003091472 | 197 |
| 602 | 3300005435 | Ga0070714_100000207 | Ga0070714_10000020737 | 197 |
| 603 | 3300005435 | Ga0070714_100001217 | Ga0070714_1000012174 | 197 |
| 604 | 3300005439 | Ga0070711_100015114 | Ga0070711_1000151143 | 197 |
| 605 | 3300005439 | Ga0070711_100536123 | Ga0070711_1005361231 | 197 |
| 606 | 3300005444 | Ga0070694_100076914 | Ga0070694_1000769142 | 197 |
| 607 | 3300005455 | Ga0070663_100001131 | Ga0070663_10000113113 | 197 |
| 608 | 3300005455 | Ga0070663_100029842 | Ga0070663_1000298423 | 197 |
| 609 | 3300005455 | Ga0070663_100039344 | Ga0070663_1000393441 | 197 |
| 610 | 3300005455 | Ga0070663_100197199 | Ga0070663_1001971992 | 197 |
| 611 | 3300005455 | Ga0070663_100226213 | Ga0070663_1002262132 | 197 |
| 612 | 3300005455 | Ga0070663_100299657 | Ga0070663_1002996571 | 197 |
| 613 | 3300005457 | Ga0070662_100218434 | Ga0070662_1002184341 | 197 |
| 614 | 3300005458 | Ga0070681_10023056 | Ga0070681_100230565 | 197 |
| 615 | 3300005466 | Ga0070685_10009321 | Ga0070685_100093216 | 197 |
| 616 | 3300005530 | Ga0070679_100059614 | Ga0070679_1000596144 | 197 |
| 617 | 3300005530 | Ga0070679_100090918 | Ga0070679_1000909182 | 197 |
| 618 | 3300005539 | Ga0068853_100038222 | Ga0068853_1000382223 | 197 |
| 619 | 3300005539 | Ga0068853_100049856 | Ga0068853_1000498563 | 197 |
| 620 | 3300005539 | Ga0068853_100195727 | Ga0068853_1001957273 | 197 |
| 621 | 3300005539 | Ga0068853_100276154 | Ga0068853_1002761542 | 197 |
| 622 | 3300005546 | Ga0070696_100004108 | Ga0070696_1000041088 | 197 |
| 623 | 3300005546 | Ga0070696_100010225 | Ga0070696_1000102254 | 197 |
| 624 | 3300005546 | Ga0070696_100124104 | Ga0070696_1001241043 | 197 |
| 625 | 3300005547 | Ga0070693_100019491 | Ga0070693_1000194914 | 197 |
| 626 | 3300005547 | Ga0070693_100046384 | Ga0070693_1000463843 | 197 |
| 627 | 3300005548 | Ga0070665_100013315 | Ga0070665_1000133157 | 197 |
| 628 | 3300005548 | Ga0070665_100020995 | Ga0070665_1000209952 | 197 |
| 629 | 3300005548 | Ga0070665_100025880 | Ga0070665_1000258805 | 197 |
| 630 | 3300005548 | Ga0070665_100033651 | Ga0070665_1000336514 | 197 |
| 631 | 3300005548 | Ga0070665_100161102 | Ga0070665_1001611023 | 197 |
| 632 | 3300005548 | Ga0070665_100349215 | Ga0070665_1003492152 | 197 |
| 633 | 3300005563 | Ga0068855_100007368 | Ga0068855_1000073687 | 197 |
| 634 | 3300005563 | Ga0068855_100041031 | Ga0068855_1000410314 | 197 |
| 635 | 3300005563 | Ga0068855_100058503 | Ga0068855_1000585035 | 197 |
| 636 | 3300005563 | Ga0068855_100141160 | Ga0068855_1001411604 | 197 |
| 637 | 3300005563 | Ga0068855_100523970 | Ga0068855_1005239702 | 197 |
| 638 | 3300005563 | Ga0068855_100732842 | Ga0068855_1007328422 | 197 |
| 639 | 3300005564 | Ga0070664_100762991 | Ga0070664_1007629911 | 197 |
| 640 | 3300005577 | Ga0068857_100016650 | Ga0068857_1000166504 | 197 |
| 641 | 3300005577 | Ga0068857_100086711 | Ga0068857_1000867111 | 197 |
| 642 | 3300005577 | Ga0068857_100141891 | Ga0068857_1001418912 | 197 |
| 643 | 3300005577 | Ga0068857_100193289 | Ga0068857_1001932891 | 197 |
| 644 | 3300005578 | Ga0068854_100001262 | Ga0068854_10000126211 | 197 |
| 645 | 3300005578 | Ga0068854_100045364 | Ga0068854_1000453644 | 197 |
| 646 | 3300005614 | Ga0068856_100000184 | Ga0068856_10000018445 | 197 |
| 647 | 3300005614 | Ga0068856_100028084 | Ga0068856_1000280841 | 197 |
| 648 | 3300005616 | Ga0068852_100014289 | Ga0068852_1000142896 | 197 |
| 649 | 3300005616 | Ga0068852_100092432 | Ga0068852_1000924324 | 197 |
| 650 | 3300005616 | Ga0068852_101047322 | Ga0068852_1010473222 | 197 |
| 651 | 3300005617 | Ga0068859_100007515 | Ga0068859_10000751510 | 197 |
| 652 | 3300005841 | Ga0068863_100113735 | Ga0068863_1001137354 | 197 |
| 653 | 3300005841 | Ga0068863_100685759 | Ga0068863_1006857591 | 197 |
| 654 | 3300005842 | Ga0068858_100078324 | Ga0068858_1000783242 | 197 |
| 655 | 3300005842 | Ga0068858_100120194 | Ga0068858_1001201943 | 197 |
| 656 | 3300005843 | Ga0068860_100162836 | Ga0068860_1001628362 | 197 |
| 657 | 3300005844 | Ga0068862_100000224 | Ga0068862_10000022449 | 197 |
| 658 | 3300006175 | Ga0070712_100027163 | Ga0070712_1000271634 | 197 |
| 659 | 3300006237 | Ga0097621_100081890 | Ga0097621_1000818901 | 197 |
| 660 | 3300006358 | Ga0068871_100195291 | Ga0068871_1001952912 | 197 |
| 661 | 3300006931 | Ga0097620_100007515 | Ga0097620_10000751510 | 197 |
| 662 | 3300009093 | Ga0105240_10006360 | Ga0105240_1000636011 | 197 |
| 663 | 3300009093 | Ga0105240_10007835 | Ga0105240_100078354 | 197 |
| 664 | 3300009093 | Ga0105240_10031364 | Ga0105240_100313644 | 197 |
| 665 | 3300009093 | Ga0105240_10055146 | Ga0105240_100551464 | 197 |
| 666 | 3300009093 | Ga0105240_10057256 | Ga0105240_100572563 | 197 |
| 667 | 3300009101 | Ga0105247_10025236 | Ga0105247_100252363 | 197 |
| 668 | 3300009174 | Ga0105241_10017425 | Ga0105241_100174254 | 197 |
| 669 | 3300009174 | Ga0105241_10417655 | Ga0105241_104176552 | 197 |
| 670 | 3300009174 | Ga0105241_10473819 | Ga0105241_104738192 | 197 |
| 671 | 3300009177 | Ga0105248_10028291 | Ga0105248_100282912 | 197 |
| 672 | 3300009545 | Ga0105237_10000022 | Ga0105237_10000022189 | 197 |
| 673 | 3300009545 | Ga0105237_10000036 | Ga0105237_1000003611 | 197 |
| 674 | 3300009545 | Ga0105237_10063098 | Ga0105237_100630983 | 197 |
| 675 | 3300009545 | Ga0105237_10093406 | Ga0105237_100934064 | 197 |
| 676 | 3300009545 | Ga0105237_10118792 | Ga0105237_101187923 | 197 |
| 677 | 3300009545 | Ga0105237_10137559 | Ga0105237_101375592 | 197 |
| 678 | 3300009551 | Ga0105238_10015508 | Ga0105238_100155089 | 197 |
| 679 | 3300009551 | Ga0105238_10022715 | Ga0105238_100227154 | 197 |
| 680 | 3300009551 | Ga0105238_10051301 | Ga0105238_100513014 | 197 |
| 681 | 3300009551 | Ga0105238_10099966 | Ga0105238_100999664 | 197 |
| 682 | 3300009551 | Ga0105238_10162538 | Ga0105238_101625384 | 197 |
| 683 | 3300009551 | Ga0105238_10326233 | Ga0105238_103262332 | 197 |
| 684 | 3300009551 | Ga0105238_10326569 | Ga0105238_103265692 | 197 |
| 685 | 3300009551 | Ga0105238_11240976 | Ga0105238_112409761 | 197 |
| 686 | 3300009553 | Ga0105249_10000193 | Ga0105249_100001932 | 197 |
| 687 | 3300010375 | Ga0105239_10004724 | Ga0105239_100047241 | 197 |
| 688 | 3300010375 | Ga0105239_10025642 | Ga0105239_100256422 | 197 |
| 689 | 3300010375 | Ga0105239_10103323 | Ga0105239_101033234 | 197 |
| 690 | 3300010375 | Ga0105239_10119105 | Ga0105239_101191054 | 197 |
| 691 | 3300010375 | Ga0105239_10399618 | Ga0105239_103996181 | 197 |
| 692 | 3300010375 | Ga0105239_10421240 | Ga0105239_104212402 | 197 |
| 693 | 3300012500 | Ga0157314_1000060 | Ga0157314_10000602 | 197 |
| 694 | 3300013100 | Ga0157373_10012271 | Ga0157373_100122714 | 197 |
| 695 | 3300013100 | Ga0157373_10019943 | Ga0157373_100199434 | 197 |
| 696 | 3300013100 | Ga0157373_10299074 | Ga0157373_102990741 | 197 |
| 697 | 3300013100 | Ga0157373_10327469 | Ga0157373_103274692 | 197 |
| 698 | 3300013102 | Ga0157371_10004318 | Ga0157371_1000431811 | 197 |
| 699 | 3300013102 | Ga0157371_10021258 | Ga0157371_100212583 | 197 |
| 700 | 3300013104 | Ga0157370_10001178 | Ga0157370_1000117824 | 197 |
| 701 | 3300013104 | Ga0157370_10015371 | Ga0157370_100153713 | 197 |
| 702 | 3300013104 | Ga0157370_10021645 | Ga0157370_100216454 | 197 |
| 703 | 3300013104 | Ga0157370_10132571 | Ga0157370_101325713 | 197 |
| 704 | 3300013104 | Ga0157370_10145090 | Ga0157370_101450901 | 197 |
| 705 | 3300013105 | Ga0157369_10102041 | Ga0157369_101020413 | 197 |
| 706 | 3300013105 | Ga0157369_10298142 | Ga0157369_102981423 | 197 |
| 707 | 3300013306 | Ga0163162_11669365 | Ga0163162_116693651 | 197 |
| 708 | 3300013307 | Ga0157372_10010508 | Ga0157372_100105086 | 197 |
| 709 | 3300013307 | Ga0157372_10092695 | Ga0157372_100926954 | 197 |
| 710 | 3300013307 | Ga0157372_10096496 | Ga0157372_100964962 | 197 |
| 711 | 3300014497 | Ga0182008_10014259 | Ga0182008_100142593 | 197 |
| 712 | 3300014968 | Ga0157379_10275778 | Ga0157379_102757782 | 197 |
| 713 | 3300014969 | Ga0157376_10105080 | Ga0157376_101050802 | 197 |
| 714 | 3300015261 | Ga0182006_1073793 | Ga0182006_10737933 | 197 |
| 715 | 3300015262 | Ga0182007_10018151 | Ga0182007_100181512 | 197 |
| 716 | 3300015262 | Ga0182007_10043001 | Ga0182007_100430013 | 197 |
| 717 | 3300015262 | Ga0182007_10103943 | Ga0182007_101039431 | 197 |
| 718 | 3300020070 | Ga0206356_11612961 | Ga0206356_116129613 | 197 |
| 719 | 3300020081 | Ga0206354_10499166 | Ga0206354_104991662 | 197 |
| 720 | 3300020082 | Ga0206353_11908525 | Ga0206353_119085254 | 197 |
| 721 | 3300025226 | Ga0209674_102618 | Ga0209674_1026184 | 197 |
| 722 | 3300025231 | Ga0207427_100088 | Ga0207427_10008840 | 197 |
| 723 | 3300025233 | Ga0209437_100167 | Ga0209437_10016740 | 197 |
| 724 | 3300025250 | Ga0209026_1000010 | Ga0209026_1000010309 | 197 |
| 725 | 3300025250 | Ga0209026_1000660 | Ga0209026_10006604 | 197 |
| 726 | 3300025256 | Ga0209759_1001342 | Ga0209759_10013426 | 197 |
| 727 | 3300025256 | Ga0209759_1012013 | Ga0209759_10120133 | 197 |
| 728 | 3300025261 | Ga0209233_1000046 | Ga0209233_100004640 | 197 |
| 729 | 3300025261 | Ga0209233_1000759 | Ga0209233_100075910 | 197 |
| 730 | 3300025263 | Ga0209565_1000002 | Ga0209565_10000021178 | 197 |
| 731 | 3300025272 | Ga0209455_1000295 | Ga0209455_100029534 | 197 |
| 732 | 3300025273 | Ga0209673_1000002 | Ga0209673_10000021178 | 197 |
| 733 | 3300025291 | Ga0209675_1000002 | Ga0209675_10000021178 | 197 |
| 734 | 3300025295 | Ga0209564_1000004 | Ga0209564_10000041179 | 197 |
| 735 | 3300025297 | Ga0209758_1000452 | Ga0209758_100045241 | 197 |
| 736 | 3300025299 | Ga0209256_1000004 | Ga0209256_10000041179 | 197 |
| 737 | 3300025900 | Ga0207710_10042402 | Ga0207710_100424021 | 197 |
| 738 | 3300025904 | Ga0207647_10001935 | Ga0207647_100019357 | 197 |
| 739 | 3300025904 | Ga0207647_10054333 | Ga0207647_100543331 | 197 |
| 740 | 3300025909 | Ga0207705_10005837 | Ga0207705_100058374 | 197 |
| 741 | 3300025911 | Ga0207654_10341553 | Ga0207654_103415532 | 197 |
| 742 | 3300025912 | Ga0207707_10038371 | Ga0207707_100383714 | 197 |
| 743 | 3300025912 | Ga0207707_10047400 | Ga0207707_100474003 | 197 |
| 744 | 3300025912 | Ga0207707_10535118 | Ga0207707_105351182 | 197 |
| 745 | 3300025913 | Ga0207695_10000040 | Ga0207695_10000040148 | 197 |
| 746 | 3300025913 | Ga0207695_10000362 | Ga0207695_1000036230 | 197 |
| 747 | 3300025913 | Ga0207695_10002008 | Ga0207695_1000200820 | 197 |
| 748 | 3300025913 | Ga0207695_10024317 | Ga0207695_100243174 | 197 |
| 749 | 3300025913 | Ga0207695_10042674 | Ga0207695_100426743 | 197 |
| 750 | 3300025914 | Ga0207671_10000009 | Ga0207671_10000009442 | 197 |
| 751 | 3300025914 | Ga0207671_10000135 | Ga0207671_100001352 | 197 |
| 752 | 3300025914 | Ga0207671_10004793 | Ga0207671_1000479312 | 197 |
| 753 | 3300025914 | Ga0207671_10156614 | Ga0207671_101566143 | 197 |
| 754 | 3300025914 | Ga0207671_10210818 | Ga0207671_102108182 | 197 |
| 755 | 3300025919 | Ga0207657_10012203 | Ga0207657_100122038 | 197 |
| 756 | 3300025919 | Ga0207657_10106355 | Ga0207657_101063552 | 197 |
| 757 | 3300025919 | Ga0207657_10122356 | Ga0207657_101223563 | 197 |
| 758 | 3300025920 | Ga0207649_10006684 | Ga0207649_100066842 | 197 |
| 759 | 3300025920 | Ga0207649_10126431 | Ga0207649_101264312 | 197 |
| 760 | 3300025921 | Ga0207652_10143154 | Ga0207652_101431541 | 197 |
| 761 | 3300025921 | Ga0207652_10220312 | Ga0207652_102203123 | 197 |
| 762 | 3300025924 | Ga0207694_10002190 | Ga0207694_100021905 | 197 |
| 763 | 3300025924 | Ga0207694_10005245 | Ga0207694_100052457 | 197 |
| 764 | 3300025924 | Ga0207694_10023988 | Ga0207694_100239883 | 197 |
| 765 | 3300025924 | Ga0207694_10039266 | Ga0207694_100392663 | 197 |
| 766 | 3300025924 | Ga0207694_10050959 | Ga0207694_100509592 | 197 |
| 767 | 3300025924 | Ga0207694_10179994 | Ga0207694_101799943 | 197 |
| 768 | 3300025924 | Ga0207694_10434103 | Ga0207694_104341032 | 197 |
| 769 | 3300025925 | Ga0207650_10217151 | Ga0207650_102171512 | 197 |
| 770 | 3300025928 | Ga0207700_10023446 | Ga0207700_100234464 | 197 |
| 771 | 3300025928 | Ga0207700_10455654 | Ga0207700_104556542 | 197 |
| 772 | 3300025929 | Ga0207664_10000092 | Ga0207664_1000009244 | 197 |
| 773 | 3300025929 | Ga0207664_10000929 | Ga0207664_100009297 | 197 |
| 774 | 3300025929 | Ga0207664_10039255 | Ga0207664_100392554 | 197 |
| 775 | 3300025932 | Ga0207690_10018537 | Ga0207690_100185374 | 197 |
| 776 | 3300025932 | Ga0207690_10018739 | Ga0207690_100187393 | 197 |
| 777 | 3300025932 | Ga0207690_10024493 | Ga0207690_100244934 | 197 |
| 778 | 3300025932 | Ga0207690_10031438 | Ga0207690_100314383 | 197 |
| 779 | 3300025933 | Ga0207706_10033243 | Ga0207706_100332435 | 197 |
| 780 | 3300025933 | Ga0207706_10076489 | Ga0207706_100764892 | 197 |
| 781 | 3300025933 | Ga0207706_10084528 | Ga0207706_100845284 | 197 |
| 782 | 3300025942 | Ga0207689_10047201 | Ga0207689_100472014 | 197 |
| 783 | 3300025945 | Ga0207679_10227486 | Ga0207679_102274862 | 197 |
| 784 | 3300025945 | Ga0207679_10291168 | Ga0207679_102911683 | 197 |
| 785 | 3300025945 | Ga0207679_10725760 | Ga0207679_107257602 | 197 |
| 786 | 3300025949 | Ga0207667_10000262 | Ga0207667_1000026234 | 197 |
| 787 | 3300025949 | Ga0207667_10000329 | Ga0207667_1000032928 | 197 |
| 788 | 3300025949 | Ga0207667_10002131 | Ga0207667_1000213113 | 197 |
| 789 | 3300025949 | Ga0207667_10012894 | Ga0207667_100128944 | 197 |
| 790 | 3300025949 | Ga0207667_10027480 | Ga0207667_100274808 | 197 |
| 791 | 3300025949 | Ga0207667_10229349 | Ga0207667_102293493 | 197 |
| 792 | 3300025961 | Ga0207712_10000498 | Ga0207712_100004982 | 197 |
| 793 | 3300025972 | Ga0207668_10239745 | Ga0207668_102397452 | 197 |
| 794 | 3300025972 | Ga0207668_10497029 | Ga0207668_104970292 | 197 |
| 795 | 3300025981 | Ga0207640_10000116 | Ga0207640_1000011629 | 197 |
| 796 | 3300025981 | Ga0207640_10003397 | Ga0207640_100033978 | 197 |
| 797 | 3300025981 | Ga0207640_10013585 | Ga0207640_100135855 | 197 |
| 798 | 3300025986 | Ga0207658_10000289 | Ga0207658_1000028949 | 197 |
| 799 | 3300025986 | Ga0207658_10112606 | Ga0207658_101126062 | 197 |
| 800 | 3300025986 | Ga0207658_10532337 | Ga0207658_105323372 | 197 |
| 801 | 3300025986 | Ga0207658_10614275 | Ga0207658_106142752 | 197 |
| 802 | 3300026035 | Ga0207703_10088824 | Ga0207703_100888242 | 197 |
| 803 | 3300026041 | Ga0207639_10021122 | Ga0207639_100211222 | 197 |
| 804 | 3300026041 | Ga0207639_10026892 | Ga0207639_100268923 | 197 |
| 805 | 3300026041 | Ga0207639_10038222 | Ga0207639_100382223 | 197 |
| 806 | 3300026041 | Ga0207639_10225944 | Ga0207639_102259442 | 197 |
| 807 | 3300026041 | Ga0207639_10287545 | Ga0207639_102875452 | 197 |
| 808 | 3300026041 | Ga0207639_10499748 | Ga0207639_104997482 | 197 |
| 809 | 3300026067 | Ga0207678_10001533 | Ga0207678_100015338 | 197 |
| 810 | 3300026067 | Ga0207678_10006482 | Ga0207678_100064827 | 197 |
| 811 | 3300026067 | Ga0207678_10007650 | Ga0207678_100076502 | 197 |
| 812 | 3300026067 | Ga0207678_10054822 | Ga0207678_100548224 | 197 |
| 813 | 3300026067 | Ga0207678_10082252 | Ga0207678_100822523 | 197 |
| 814 | 3300026067 | Ga0207678_10185207 | Ga0207678_101852072 | 197 |
| 815 | 3300026067 | Ga0207678_10468406 | Ga0207678_104684061 | 197 |
| 816 | 3300026078 | Ga0207702_10000037 | Ga0207702_1000003742 | 197 |
| 817 | 3300026078 | Ga0207702_10005837 | Ga0207702_100058378 | 197 |
| 818 | 3300026088 | Ga0207641_10940351 | Ga0207641_109403511 | 197 |
| 819 | 3300026089 | Ga0207648_10186602 | Ga0207648_101866022 | 197 |
| 820 | 3300026116 | Ga0207674_10010758 | Ga0207674_100107587 | 197 |
| 821 | 3300026116 | Ga0207674_10095686 | Ga0207674_100956862 | 197 |
| 822 | 3300026116 | Ga0207674_10105110 | Ga0207674_101051104 | 197 |
| 823 | 3300026116 | Ga0207674_10137452 | Ga0207674_101374524 | 197 |
| 824 | 3300026116 | Ga0207674_10144148 | Ga0207674_101441482 | 197 |
| 825 | 3300026116 | Ga0207674_10188092 | Ga0207674_101880922 | 197 |
| 826 | 3300026142 | Ga0207698_10009393 | Ga0207698_100093936 | 197 |
| 827 | 3300026142 | Ga0207698_10145111 | Ga0207698_101451113 | 197 |
| 828 | 3300028379 | Ga0268266_10011365 | Ga0268266_100113656 | 197 |
| 829 | 3300028379 | Ga0268266_10023757 | Ga0268266_100237573 | 197 |
| 830 | 3300028379 | Ga0268266_10106346 | Ga0268266_101063464 | 197 |
| 831 | 3300028379 | Ga0268266_10121872 | Ga0268266_101218722 | 197 |
| 832 | 3300028380 | Ga0268265_10000054 | Ga0268265_10000054106 | 197 |
| 833 | 3300028381 | Ga0268264_10399613 | Ga0268264_103996132 | 197 |
| 834 | 3300031616 | Ga0307508_10449642 | Ga0307508_104496421 | 197 |
| 835 | 3300033179 | Ga0307507_10176250 | Ga0307507_101762501 | 197 |
| 836 | 3300037312 | Ga0395899_0010653 | Ga0395899_0010653_3676_4272 | 197 |
| 837 | 3300037418 | Ga0395900_0181739 | Ga0395900_0181739_755_1351 | 197 |
| 838 | 3300037466 | Ga0395898_0123055 | Ga0395898_0123055_995_1591 | 197 |
| 839 | 3300038443 | Ga0395901_0002045 | Ga0395901_0002045_7734_8330 | 197 |
| 840 | 3300038443 | Ga0395901_0038039 | Ga0395901_0038039_2689_3285 | 197 |
| 841 | 3300041459 | Ga0451800_0536604 | Ga0451800_0536604_496_1089 | 197 |
| 842 | 3300041494 | Ga0451837_1427531 | Ga0451837_1427531_1240_1866 | 197 |
| 843 | 3300042005 | Ga0439448_0023023 | Ga0439448_0023023_1014_1607 | 197 |
| 844 | 3300042438 | Ga0439459_0003827 | Ga0439459_0003827_467_1063 | 197 |
| 845 | 3300044658 | Ga0466972_0005270 | Ga0466972_0005270_2785_3390 | 197 |
| 846 | 3300044765 | Ga0466970_0001508 | Ga0466970_0001508_3109_3714 | 197 |
| 847 | 3300046460 | Ga0495638_0000511 | Ga0495638_0000511_41425_42021 | 197 |
| 848 | 3300046461 | Ga0495641_0194264 | Ga0495641_0194264_20_616 | 197 |
| 849 | 3300046674 | Ga0495588_0094759 | Ga0495588_0094759_791_1387 | 197 |
| 850 | 3300048916 | Ga0496113_0327063 | Ga0496113_0327063_364_960 | 197 |
| 851 | 3300048917 | Ga0496114_0525977 | Ga0496114_0525977_360_956 | 197 |
| 852 | 3300048921 | Ga0496118_0001052 | Ga0496118_0001052_7112_7705 | 197 |
| 853 | 3300048921 | Ga0496118_0025910 | Ga0496118_0025910_3339_3944 | 197 |
| 854 | 3300048921 | Ga0496118_0329414 | Ga0496118_0329414_48_641 | 197 |
| 855 | 3300048924 | Ga0496121_0039112 | Ga0496121_0039112_1741_2334 | 197 |
| 856 | 3300048925 | Ga0496122_0008948 | Ga0496122_0008948_9122_9715 | 197 |
| 857 | 3300048925 | Ga0496122_0011189 | Ga0496122_0011189_7570_8169 | 197 |
| 858 | 3300048926 | Ga0496123_0000870 | Ga0496123_0000870_45641_46234 | 197 |
| 859 | 3300048926 | Ga0496123_0001731 | Ga0496123_0001731_14388_14987 | 197 |
| 860 | 3300048928 | Ga0496125_0000088 | Ga0496125_0000088_111826_112419 | 197 |
| 861 | 3300048929 | Ga0496126_0274518 | Ga0496126_0274518_698_1291 | 197 |
| 862 | 3300048929 | Ga0496126_0595557 | Ga0496126_0595557_175_768 | 197 |
| 863 | 3300049568 | Ga0501031_0097531 | Ga0501031_0097531_1096_1692 | 197 |
| 864 | 3300049570 | Ga0501033_0073695 | Ga0501033_0073695_1002_1598 | 197 |
| 865 | 3300049570 | Ga0501033_0352101 | Ga0501033_0352101_190_786 | 197 |
| 866 | 3300049571 | Ga0501034_0016243 | Ga0501034_0016243_3275_3871 | 197 |
| 867 | 3300049571 | Ga0501034_0099868 | Ga0501034_0099868_1974_2570 | 197 |
| 868 | 3300049572 | Ga0501036_0018300 | Ga0501036_0018300_3146_3742 | 197 |
| 869 | 3300049572 | Ga0501036_0304166 | Ga0501036_0304166_262_858 | 197 |
| 870 | 3300049573 | Ga0501037_0058913 | Ga0501037_0058913_1377_1973 | 197 |
| 871 | 3300049573 | Ga0501037_0090847 | Ga0501037_0090847_252_848 | 197 |
| 872 | 3300049574 | Ga0501038_0125255 | Ga0501038_0125255_1243_1839 | 197 |
| 873 | 3300049574 | Ga0501038_0126984 | Ga0501038_0126984_1193_1789 | 197 |
| 874 | 3300049574 | Ga0501038_0316749 | Ga0501038_0316749_373_969 | 197 |
| 875 | 3300049580 | Ga0501046_0122223 | Ga0501046_0122223_230_826 | 197 |
| 876 | 3300049581 | Ga0501047_0149576 | Ga0501047_0149576_1597_2193 | 197 |
| 877 | 3300049581 | Ga0501047_0245383 | Ga0501047_0245383_845_1441 | 197 |
| 878 | 3300049583 | Ga0501067_0091198 | Ga0501067_0091198_703_1299 | 197 |
| 879 | 3300049583 | Ga0501067_0407467 | Ga0501067_0407467_43_639 | 197 |
| 880 | 3300049585 | Ga0501069_0055707 | Ga0501069_0055707_914_1510 | 197 |
| 881 | 3300049586 | Ga0501070_0103357 | Ga0501070_0103357_1374_1970 | 197 |
| 882 | 3300049586 | Ga0501070_0158682 | Ga0501070_0158682_805_1401 | 197 |
| 883 | 3300049586 | Ga0501070_0178257 | Ga0501070_0178257_868_1464 | 197 |
| 884 | 3300049589 | Ga0501073_0056974 | Ga0501073_0056974_1291_1887 | 197 |
| 885 | 3300049742 | Ga0501080_0036164 | Ga0501080_0036164_421_1017 | 197 |
| 886 | 3300049742 | Ga0501080_0280718 | Ga0501080_0280718_59_655 | 197 |
| 887 | 3300049744 | Ga0501083_0010536 | Ga0501083_0010536_5214_5810 | 197 |
| 888 | 3300049822 | Ga0501035_0009495 | Ga0501035_0009495_5821_6417 | 197 |
| 889 | 3300049822 | Ga0501035_0127152 | Ga0501035_0127152_842_1438 | 197 |
| 890 | 3300049823 | Ga0501044_0069885 | Ga0501044_0069885_2747_3343 | 197 |
| 891 | 3300053087 | Ga0500643_019762 | Ga0500643_019762_410_1003 | 197 |
| 892 | 3300053093 | Ga0500651_0013646 | Ga0500651_0013646_4162_4761 | 197 |
| 893 | 3300053093 | Ga0500651_0074083 | Ga0500651_0074083_871_1467 | 197 |
| 894 | 3300053120 | Ga0500597_000253 | Ga0500597_000253_427_1020 | 197 |
| 895 | 3300053139 | Ga0500568_0000455 | Ga0500568_0000455_23720_24316 | 197 |
| 896 | 3300054114 | Ga0501084_0022192 | Ga0501084_0022192_2704_3300 | 197 |
| 897 | 3300060353 | Ga0501082_0021595 | Ga0501082_0021595_3665_4261 | 197 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8e50-assembly1.cif.gz_A | cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa | 0.6336 | 13 | 150 |
| 6zvj-assembly1.cif.gz_1 | structure of a human abce1-bound 43s pre-initiation complex - state ii | 0.5376 | 94 | 178 |
| 5f34-assembly1.cif.gz_A | crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group | 0.5325 | 12 | 184 |
| 3kwp-assembly1.cif.gz_A-2 | crystal structure of putative methyltransferase from lactobacillus brevis | 0.5269 | 41 | 150 |
| 3hh1-assembly2.cif.gz_C | the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls | 0.5253 | 38 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P26647_52_180_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7378 | 31 | 149 | 3.40.50.620 |
| af_Q2FXJ7_19_144_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7339 | 36 | 149 | 3.40.50.2000 |
| af_Q8IL28_86_216_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7305 | 33 | 149 | 3.40.50.620 |
| af_Q8GXU8_180_307_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7285 | 36 | 149 | 3.40.50.2000 |
| af_D4AC45_64_192_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7279 | 34 | 149 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B8PVB4-F1-model_v4 | Glycerol acyltransferase | 0.9491 | 11 | 189 |
GO:0003841
GO:0006654 |
| AF-A0A091BH66-F1-model_v4 | Phospholipid/glycerol acyltransferase domain-containing protein | 0.947 | 4 | 191 |
GO:0003841
GO:0006654 |
| AF-A0A7Y0LF21-F1-model_v4 | Acyltransferase | 0.9457 | 10 | 189 |
GO:0003841
GO:0006654 |
| AF-A0A143HR79-F1-model_v4 | Acyltransferase | 0.9428 | 11 | 189 |
GO:0003841
GO:0006654 |
| AF-A0A160N2L2-F1-model_v4 | 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) | 0.942 | 26 | 191 |
GO:0003841
GO:0006654 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar