F485035

General Info

Members Datasets Scaffolds Average Seq Length
897 326 882 195

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1000107|Ga0055526_100010755
Length 222
Sequence MSAEPETPADHAPHARYQHPPGAPDGSIVLPLPPNVPRVKRSRLAQWTGRAILRLGGWRMVGQFPDIPRAVLIGIPHSSNWDGVWAFAAKAAMGLNVNIIAKESLFKVPVVGFMLRRFGVIPINRSAAHGVIDQAVAMMKGAEKLWLGIAPEGTRKRVEKWKAGFWKIAKNADVPVVLAYFHYPDKVIGIGPAFHLGDDMDADMRRIREYCRPFIGKNRGTV

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
6 2734482264 Dyella sp. AD052 Isolate Unclassified
7 2739367700 Dyella sp. YR388 Isolate Unclassified
8 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
9 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
10 2884411467 Dyella sp. AD56 Isolate Rhizosphere
11 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
12 2928963466 Dyella japonica 1073 Isolate Unclassified
13 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
14 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
15 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
16 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
17 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
18 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
19 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
20 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
25 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
26 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
27 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
28 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
29 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
33 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
34 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
35 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
36 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
37 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
38 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
39 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
40 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
41 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
42 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
43 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
44 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
56 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
57 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
58 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
61 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
62 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
63 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
64 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
65 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
69 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
72 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
73 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
76 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
77 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
78 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
79 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
80 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
81 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
82 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
103 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
116 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
117 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
118 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
119 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
125 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
126 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
134 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
136 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
137 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
146 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
147 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
189 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
192 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
193 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
202 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
203 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
204 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
205 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
206 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
209 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
210 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
211 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
212 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
215 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
216 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
217 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
218 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
219 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
220 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
221 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
222 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
223 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
235 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
236 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
237 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
238 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
239 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
243 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
244 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
245 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
246 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
247 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
248 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
251 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
252 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
253 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
254 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
266 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
267 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
268 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
274 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
275 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
276 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
277 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
278 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
279 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
280 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
285 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
286 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
303 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
304 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
305 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
306 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
307 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
308 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
309 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
310 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
311 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
312 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
313 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
320 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
321 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
322 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
323 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
324 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.66
Metatranscriptomes 0.67
Isolates 1.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.15
Nodule 0
Rhizoplane 2.79
Rhizosphere 72.02
Stem 0
Stem Tuber 0
Unclassified 12.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10017269 3300001979 Bacteria 2584
2 JGI24739J22299_10083624 3300001989 Bacteria 977
3 JGI24737J22298_10000503 3300001990 Bacteria 13631
4 JGI24737J22298_10109933 3300001990 Bacteria 816
5 JGI24735J21928_10023462 3300002067 Bacteria 1871
6 JGI24738J21930_10000020 3300002075 Bacteria 30020
7 JGI25156J39149_1000480 3300002705 Bacteria 24063
8 JGI25156J39149_1004347 3300002705 Bacteria 4346
9 JGI25156J39149_1006967 3300002705 Bacteria 3028
10 JGI25156J39149_1012327 3300002705 Bacteria 1886
11 JGI25162J39368_1000454 3300002737 Bacteria 32144
12 JGI25162J39368_1000657 3300002737 Bacteria 24439
13 JGI25162J39368_1000792 3300002737 Bacteria 21140
14 JGI25162J39368_1001661 3300002737 Bacteria 10994
15 JGI25162J39368_1002289 3300002737 Bacteria 7698
16 JGI25157J39369_1000300 3300002741 Bacteria 35735
17 JGI25157J39369_1000525 3300002741 Bacteria 23385
18 JGI25157J39369_1001263 3300002741 Bacteria 10336
19 JGI25157J39369_1003690 3300002741 Bacteria 3028
20 JGI25163J39215_1000882 3300002771 Bacteria 6984
21 JGI25164J39214_1000112 3300002772 Bacteria 78116
22 JGI25164J39214_1000295 3300002772 Bacteria 34610
23 JGI25164J39214_1000451 3300002772 Bacteria 21436
24 JGI25164J39214_1000454 3300002772 Bacteria 21300
25 JGI25164J39214_1008953 3300002772 Bacteria 991
26 JGI25165J46597_1000229 3300003214 Bacteria 78116
27 JGI25165J46597_1000527 3300003214 Bacteria 35739
28 JGI25165J46597_1000872 3300003214 Bacteria 21444
29 JGI25165J46597_1006555 3300003214 Bacteria 2053
30 rootH1_10006421 3300003316 Bacteria 3652
31 rootH1_10124382 3300003316 Bacteria 1390
32 rootH2_10047639 3300003320 Bacteria 15276
33 rootH2_10082323 3300003320 Bacteria 1260
34 rootL2_10011264 3300003322 Bacteria 2277
35 rootH1_10034785 3300003323 Bacteria 1263
36 rootH1_10183402 3300003323 Bacteria 1300
37 rootH1_10236681 3300003323 Bacteria 2848
38 Ga0006562J51391_1017349 3300003578 Bacteria 5332
39 Ga0006562J51391_1201163 3300003578 Bacteria 2364
40 Ga0006562J51391_1201164 3300003578 Bacteria 2270
41 Ga0055538_1001138 3300003751 Bacteria 5697
42 Ga0055539_1005663 3300003752 Bacteria 1616
43 Ga0055539_1019428 3300003752 Bacteria 814
44 Ga0055533_1000581 3300003756 Bacteria 12805
45 Ga0055533_1003055 3300003756 Bacteria 3543
46 Ga0055525_1000082 3300003759 Bacteria 159396
47 Ga0055527_1000072 3300003760 Bacteria 83753
48 Ga0055527_1000080 3300003760 Bacteria 78211
49 Ga0055527_1003188 3300003760 Bacteria 2510
50 Ga0055527_1011228 3300003760 Bacteria 1026
51 Ga0055535_1000162 3300003761 Bacteria 71868
52 Ga0055535_1000189 3300003761 Bacteria 65570
53 Ga0055535_1000491 3300003761 Bacteria 35499
54 Ga0055535_1000611 3300003761 Bacteria 29412
55 Ga0055535_1001129 3300003761 Bacteria 15988
56 Ga0055542_1000105 3300003762 Bacteria 113278
57 Ga0055542_1000163 3300003762 Bacteria 83753
58 Ga0055542_1000181 3300003762 Bacteria 78147
59 Ga0055542_1000188 3300003762 Bacteria 75366
60 Ga0055542_1000254 3300003762 Bacteria 60473
61 Ga0055542_1000573 3300003762 Bacteria 32144
62 Ga0055529_1000205 3300003763 Bacteria 78219
63 Ga0055529_1000209 3300003763 Bacteria 77662
64 Ga0055529_1000336 3300003763 Bacteria 52511
65 Ga0055529_1000496 3300003763 Bacteria 35739
66 Ga0055529_1023381 3300003763 Bacteria 765
67 Ga0055526_1000107 3300003771 Bacteria 72819
68 Ga0055537_1000125 3300003773 Bacteria 58650
69 Ga0055524_1000176 3300003775 Bacteria 72819
70 Ga0055534_1000090 3300003784 Bacteria 71465
71 Ga0055528_1000088 3300003790 Bacteria 72819
72 Ga0070658_10005032 3300005327 Bacteria 10757
73 Ga0070658_10035840 3300005327 Bacteria 3997
74 Ga0070658_10873277 3300005327 Bacteria 782
75 Ga0070670_100132781 3300005331 Bacteria 2150
76 Ga0070670_100255716 3300005331 Bacteria 1526
77 Ga0068869_100244555 3300005334 Bacteria 1430
78 Ga0070666_10000020 3300005335 Bacteria 177564
79 Ga0070682_100006648 3300005337 Bacteria 6483
80 Ga0070682_100467750 3300005337 Bacteria 969
81 Ga0068868_100462320 3300005338 Bacteria 1105
82 Ga0070660_100011111 3300005339 Bacteria 6386
83 Ga0070660_100105322 3300005339 Bacteria 2238
84 Ga0070660_100120618 3300005339 Bacteria 2092
85 Ga0070660_100205709 3300005339 Bacteria 1597
86 Ga0070689_100004873 3300005340 Bacteria 9113
87 Ga0070691_10122135 3300005341 Bacteria 1312
88 Ga0070661_100004622 3300005344 Bacteria 9475
89 Ga0070661_100007423 3300005344 Bacteria 7557
90 Ga0070661_100028888 3300005344 Bacteria 4002
91 Ga0070661_100029522 3300005344 Bacteria 3958
92 Ga0070661_100055463 3300005344 Bacteria 2902
93 Ga0070661_100095087 3300005344 Unclassified 2210
94 Ga0070692_10023906 3300005345 Bacteria 2998
95 Ga0070692_10085847 3300005345 Bacteria 1703
96 Ga0070668_100001704 3300005347 Bacteria 15947
97 Ga0070668_100834439 3300005347 Bacteria 821
98 Ga0070669_100511960 3300005353 Bacteria 997
99 Ga0070671_100025842 3300005355 Bacteria 4821
100 Ga0070673_100220277 3300005364 Bacteria 1642
101 Ga0070659_100003695 3300005366 Bacteria 10914
102 Ga0070659_100043342 3300005366 Bacteria 3519
103 Ga0070659_100127110 3300005366 Bacteria 2069
104 Ga0070659_100519562 3300005366 Bacteria 1016
105 Ga0070667_100000040 3300005367 Bacteria 170222
106 Ga0070667_100010566 3300005367 Bacteria 7620
107 Ga0070667_100031091 3300005367 Bacteria 4451
108 Ga0070667_100062316 3300005367 Bacteria 3159
109 Ga0070667_100073758 3300005367 Bacteria 2910
110 Ga0070667_100309147 3300005367 Bacteria 1424
111 Ga0070667_100620417 3300005367 Bacteria 997
112 Ga0070714_100000207 3300005435 Bacteria 47558
113 Ga0070714_100001217 3300005435 Bacteria 18571
114 Ga0070711_100015114 3300005439 Bacteria 4880
115 Ga0070711_100536123 3300005439 Bacteria 969
116 Ga0070694_100076914 3300005444 Bacteria 2311
117 Ga0070663_100001131 3300005455 Bacteria 14691
118 Ga0070663_100012632 3300005455 Bacteria 5352
119 Ga0070663_100029842 3300005455 Bacteria 3731
120 Ga0070663_100039344 3300005455 Bacteria 3303
121 Ga0070663_100107997 3300005455 Bacteria 2087
122 Ga0070663_100197199 3300005455 Bacteria 1569
123 Ga0070663_100226213 3300005455 Bacteria 1471
124 Ga0070663_100299657 3300005455 Bacteria 1286
125 Ga0070663_100933358 3300005455 Bacteria 751
126 Ga0070662_100218434 3300005457 Bacteria 1520
127 Ga0070681_10013694 3300005458 Bacteria 8072
128 Ga0070681_10023056 3300005458 Bacteria 6259
129 Ga0068867_100219122 3300005459 Bacteria 1533
130 Ga0070685_10009321 3300005466 Bacteria 5067
131 Ga0070685_10010980 3300005466 Bacteria 4724
132 Ga0070679_100059614 3300005530 Bacteria 3804
133 Ga0070679_100090918 3300005530 Bacteria 3040
134 Ga0068853_100038222 3300005539 Bacteria 4087
135 Ga0068853_100041046 3300005539 Bacteria 3950
136 Ga0068853_100049856 3300005539 Bacteria 3599
137 Ga0068853_100181559 3300005539 Bacteria 1908
138 Ga0068853_100195727 3300005539 Bacteria 1838
139 Ga0068853_100276154 3300005539 Bacteria 1548
140 Ga0068853_100358905 3300005539 Bacteria 1357
141 Ga0070696_100004108 3300005546 Bacteria 9703
142 Ga0070696_100010225 3300005546 Bacteria 6280
143 Ga0070696_100124104 3300005546 Bacteria 1872
144 Ga0070693_100019491 3300005547 Bacteria 3557
145 Ga0070693_100046384 3300005547 Bacteria 2468
146 Ga0070665_100000097 3300005548 Bacteria 166302
147 Ga0070665_100001328 3300005548 Bacteria 29401
148 Ga0070665_100013315 3300005548 Bacteria 8280
149 Ga0070665_100020995 3300005548 Bacteria 6565
150 Ga0070665_100025880 3300005548 Bacteria 5907
151 Ga0070665_100033651 3300005548 Bacteria 5156
152 Ga0070665_100161102 3300005548 Bacteria 2246
153 Ga0070665_100349215 3300005548 Bacteria 1484
154 Ga0068855_100007368 3300005563 Bacteria 13321
155 Ga0068855_100041031 3300005563 Bacteria 5487
156 Ga0068855_100058503 3300005563 Bacteria 4513
157 Ga0068855_100141160 3300005563 Bacteria 2746
158 Ga0068855_100412537 3300005563 Bacteria 1478
159 Ga0068855_100501717 3300005563 Bacteria 1318
160 Ga0068855_100523970 3300005563 Bacteria 1285
161 Ga0068855_100732842 3300005563 Bacteria 1055
162 Ga0070664_100762991 3300005564 Bacteria 903
163 Ga0068857_100016650 3300005577 Bacteria 6440
164 Ga0068857_100032832 3300005577 Bacteria 4588
165 Ga0068857_100075732 3300005577 Bacteria 3000
166 Ga0068857_100086711 3300005577 Bacteria 2800
167 Ga0068857_100108570 3300005577 Bacteria 2493
168 Ga0068857_100141891 3300005577 Bacteria 2172
169 Ga0068857_100193289 3300005577 Bacteria 1854
170 Ga0068854_100001262 3300005578 Bacteria 15194
171 Ga0068854_100045364 3300005578 Bacteria 3125
172 Ga0068856_100000184 3300005614 Bacteria 65002
173 Ga0068856_100007251 3300005614 Bacteria 10814
174 Ga0068856_100028084 3300005614 Bacteria 5491
175 Ga0068856_100771812 3300005614 Bacteria 981
176 Ga0068852_100001204 3300005616 Bacteria 17171
177 Ga0068852_100014289 3300005616 Bacteria 6106
178 Ga0068852_100092432 3300005616 Bacteria 2709
179 Ga0068852_100221594 3300005616 Bacteria 1799
180 Ga0068852_101047322 3300005616 Bacteria 835
181 Ga0068859_100007515 3300005617 Bacteria 11061
182 Ga0068851_10023176 3300005834 Bacteria 3031
183 Ga0068863_100113735 3300005841 Bacteria 2578
184 Ga0068863_100685759 3300005841 Bacteria 1018
185 Ga0068858_100078324 3300005842 Bacteria 3072
186 Ga0068858_100120194 3300005842 Bacteria 2456
187 Ga0068860_100145004 3300005843 Bacteria 2284
188 Ga0068860_100162836 3300005843 Bacteria 2151
189 Ga0068860_100412916 3300005843 Bacteria 1337
190 Ga0068862_100000224 3300005844 Bacteria 62869
191 Ga0068862_100059714 3300005844 Bacteria 3275
192 Ga0068862_100104837 3300005844 Bacteria 2477
193 Ga0070712_100027163 3300006175 Bacteria 3820
194 Ga0097621_100017790 3300006237 Bacteria 5410
195 Ga0097621_100081890 3300006237 Bacteria 2687
196 Ga0068871_100069947 3300006358 Bacteria 2884
197 Ga0068871_100195291 3300006358 Bacteria 1745
198 Ga0068865_100199275 3300006881 Bacteria 1553
199 Ga0097620_100007515 3300006931 Bacteria 11061
200 Ga0105250_10095931 3300009092 Bacteria 1209
201 Ga0105240_10006212 3300009093 Bacteria 17569
202 Ga0105240_10006230 3300009093 Bacteria 17547
203 Ga0105240_10006360 3300009093 Bacteria 17388
204 Ga0105240_10007835 3300009093 Bacteria 15418
205 Ga0105240_10031364 3300009093 Bacteria 6894
206 Ga0105240_10055146 3300009093 Bacteria 4977
207 Ga0105240_10057256 3300009093 Bacteria 4871
208 Ga0105240_10084657 3300009093 Bacteria 3887
209 Ga0105240_10464558 3300009093 Bacteria 1413
210 Ga0105240_10975403 3300009093 Bacteria 908
211 Ga0105247_10002045 3300009101 Bacteria 13966
212 Ga0105247_10025236 3300009101 Bacteria 3586
213 Ga0105247_10630510 3300009101 Bacteria 798
214 Ga0105241_10017425 3300009174 Bacteria 5280
215 Ga0105241_10417655 3300009174 Bacteria 1180
216 Ga0105241_10473819 3300009174 Bacteria 1112
217 Ga0105248_10028291 3300009177 Bacteria 6244
218 Ga0105248_10346591 3300009177 Bacteria 1672
219 Ga0105237_10000022 3300009545 Bacteria 228427
220 Ga0105237_10000036 3300009545 Bacteria 191142
221 Ga0105237_10063098 3300009545 Bacteria 3703
222 Ga0105237_10093406 3300009545 Bacteria 2997
223 Ga0105237_10118792 3300009545 Bacteria 2638
224 Ga0105237_10137559 3300009545 Bacteria 2437
225 Ga0105237_11107800 3300009545 Bacteria 798
226 Ga0105238_10001023 3300009551 Bacteria 28434
227 Ga0105238_10015508 3300009551 Bacteria 7713
228 Ga0105238_10022715 3300009551 Bacteria 6393
229 Ga0105238_10051301 3300009551 Bacteria 4150
230 Ga0105238_10099966 3300009551 Bacteria 2884
231 Ga0105238_10162538 3300009551 Bacteria 2209
232 Ga0105238_10208703 3300009551 Bacteria 1929
233 Ga0105238_10326233 3300009551 Bacteria 1521
234 Ga0105238_10326569 3300009551 Bacteria 1520
235 Ga0105238_11203240 3300009551 Bacteria 782
236 Ga0105238_11240976 3300009551 Bacteria 770
237 Ga0105249_10000193 3300009553 Bacteria 69963
238 Ga0105147_100668 3300009982 Bacteria 2754
239 Ga0105239_10000192 3300010375 Bacteria 88793
240 Ga0105239_10004724 3300010375 Bacteria 16174
241 Ga0105239_10012311 3300010375 Bacteria 9527
242 Ga0105239_10025642 3300010375 Bacteria 6491
243 Ga0105239_10103323 3300010375 Bacteria 3154
244 Ga0105239_10119105 3300010375 Bacteria 2930
245 Ga0105239_10399618 3300010375 Bacteria 1555
246 Ga0105239_10421240 3300010375 Bacteria 1513
247 Ga0105239_10550070 3300010375 Bacteria 1314
248 Ga0157314_1000060 3300012500 Bacteria 11549
249 Ga0157347_1001512 3300012502 Bacteria 1837
250 Ga0157373_10012271 3300013100 Bacteria 6299
251 Ga0157373_10019943 3300013100 Bacteria 4878
252 Ga0157373_10299074 3300013100 Bacteria 1142
253 Ga0157373_10327469 3300013100 Bacteria 1090
254 Ga0157371_10004318 3300013102 Bacteria 12463
255 Ga0157371_10021258 3300013102 Bacteria 4766
256 Ga0157370_10001178 3300013104 Bacteria 32634
257 Ga0157370_10015371 3300013104 Bacteria 7780
258 Ga0157370_10021645 3300013104 Bacteria 6407
259 Ga0157370_10132571 3300013104 Bacteria 2324
260 Ga0157370_10145090 3300013104 Bacteria 2210
261 Ga0157370_10162156 3300013104 Bacteria 2080
262 Ga0157369_10008532 3300013105 Bacteria 11753
263 Ga0157369_10102041 3300013105 Bacteria 3057
264 Ga0157369_10132720 3300013105 Bacteria 2638
265 Ga0157369_10298142 3300013105 Bacteria 1677
266 Ga0163162_10083015 3300013306 Bacteria 3277
267 Ga0163162_11669365 3300013306 Unclassified 727
268 Ga0157372_10010508 3300013307 Bacteria 9854
269 Ga0157372_10092695 3300013307 Bacteria 3437
270 Ga0157372_10096496 3300013307 Bacteria 3369
271 Ga0157372_10104820 3300013307 Bacteria 3233
272 Ga0157372_10649018 3300013307 Bacteria 1229
273 Ga0157375_10205673 3300013308 Bacteria 2125
274 Ga0163163_10083520 3300014325 Bacteria 3199
275 Ga0182008_10014259 3300014497 Bacteria 4165
276 Ga0157379_10090031 3300014968 Bacteria 2753
277 Ga0157379_10275778 3300014968 Bacteria 1530
278 Ga0157376_10105080 3300014969 Bacteria 2476
279 Ga0157376_10963307 3300014969 Bacteria 874
280 Ga0182006_1000065 3300015261 Bacteria 152292
281 Ga0182006_1073793 3300015261 Bacteria 1259
282 Ga0182007_10005217 3300015262 Bacteria 5743
283 Ga0182007_10018151 3300015262 Bacteria 2555
284 Ga0182007_10043001 3300015262 Bacteria 1503
285 Ga0182007_10103943 3300015262 Bacteria 942
286 Ga0182005_1001497 3300015265 Bacteria 9321
287 Ga0182005_1008021 3300015265 Bacteria 3133
288 Ga0183368_1002 3300015687 Bacteria 1865598
289 Ga0183360_10004 3300015689 Bacteria 289992
290 Ga0163161_10002563 3300017792 Bacteria 12983
291 Ga0163161_10097349 3300017792 Bacteria 2186
292 Ga0206356_11612961 3300020070 Bacteria 2056
293 Ga0206354_10499166 3300020081 Bacteria 722
294 Ga0206353_11908525 3300020082 Bacteria 3476
295 Ga0209435_104672 3300025206 Bacteria 1543
296 Ga0209760_100417 3300025207 Bacteria 10203
297 Ga0209784_100053 3300025224 Bacteria 182075
298 Ga0209566_101751 3300025225 Bacteria 5170
299 Ga0209674_100014 3300025226 Bacteria 704989
300 Ga0209674_100234 3300025226 Bacteria 48788
301 Ga0209674_100413 3300025226 Bacteria 21057
302 Ga0209674_102618 3300025226 Bacteria 3745
303 Ga0209672_100004 3300025228 Bacteria 1467504
304 Ga0209672_100008 3300025228 Bacteria 946876
305 Ga0209672_100089 3300025228 Bacteria 120658
306 Ga0209672_101247 3300025228 Bacteria 10176
307 Ga0209672_101845 3300025228 Bacteria 6341
308 Ga0209672_103546 3300025228 Bacteria 3187
309 Ga0209147_108813 3300025229 Bacteria 1230
310 Ga0209563_100097 3300025230 Bacteria 159453
311 Ga0207427_100044 3300025231 Bacteria 242623
312 Ga0207427_100051 3300025231 Bacteria 218792
313 Ga0207427_100061 3300025231 Bacteria 182815
314 Ga0207427_100088 3300025231 Bacteria 137220
315 Ga0207427_103025 3300025231 Bacteria 3877
316 Ga0207427_112494 3300025231 Bacteria 848
317 Ga0209437_100005 3300025233 Bacteria 1071596
318 Ga0209437_100037 3300025233 Bacteria 459730
319 Ga0209437_100152 3300025233 Bacteria 154551
320 Ga0209437_100167 3300025233 Bacteria 144661
321 Ga0209437_100279 3300025233 Bacteria 75208
322 Ga0209437_102261 3300025233 Bacteria 3807
323 Ga0209258_100003 3300025242 Bacteria 1467504
324 Ga0209258_100004 3300025242 Bacteria 1376422
325 Ga0209258_100008 3300025242 Bacteria 1009355
326 Ga0209258_100090 3300025242 Bacteria 232619
327 Ga0209258_100173 3300025242 Bacteria 144525
328 Ga0209258_100541 3300025242 Bacteria 34852
329 Ga0209258_101149 3300025242 Bacteria 10836
330 Ga0209258_102841 3300025242 Bacteria 4132
331 Ga0209646_1000700 3300025246 Bacteria 12031
332 Ga0209646_1000900 3300025246 Bacteria 9648
333 Ga0209026_1000010 3300025250 Bacteria 511986
334 Ga0209026_1000064 3300025250 Bacteria 211303
335 Ga0209026_1000104 3300025250 Bacteria 152614
336 Ga0209026_1000407 3300025250 Bacteria 37955
337 Ga0209026_1000660 3300025250 Bacteria 21079
338 Ga0209026_1003591 3300025250 Bacteria 5002
339 Ga0209677_101838 3300025253 Bacteria 8651
340 Ga0209677_112023 3300025253 Bacteria 1309
341 Ga0209148_1000001 3300025254 Bacteria 2545271
342 Ga0209148_1000002 3300025254 Bacteria 2399500
343 Ga0209148_1000016 3300025254 Bacteria 804369
344 Ga0209148_1000065 3300025254 Bacteria 344489
345 Ga0209148_1000079 3300025254 Bacteria 288992
346 Ga0209148_1000279 3300025254 Bacteria 79426
347 Ga0209759_1000165 3300025256 Bacteria 113117
348 Ga0209759_1000544 3300025256 Bacteria 39139
349 Ga0209759_1000762 3300025256 Bacteria 27542
350 Ga0209759_1001342 3300025256 Bacteria 14350
351 Ga0209759_1002477 3300025256 Bacteria 8071
352 Ga0209759_1012013 3300025256 Bacteria 2423
353 Ga0209233_1000002 3300025261 Bacteria 2501366
354 Ga0209233_1000011 3300025261 Bacteria 1071611
355 Ga0209233_1000046 3300025261 Bacteria 470971
356 Ga0209233_1000099 3300025261 Bacteria 293995
357 Ga0209233_1000759 3300025261 Bacteria 14553
358 Ga0209233_1007681 3300025261 Bacteria 3397
359 Ga0209233_1027747 3300025261 Bacteria 1367
360 Ga0209565_1000002 3300025263 Bacteria 1423083
361 Ga0209455_1000004 3300025272 Bacteria 1467504
362 Ga0209455_1000007 3300025272 Bacteria 1157983
363 Ga0209455_1000016 3300025272 Bacteria 753097
364 Ga0209455_1000079 3300025272 Bacteria 268778
365 Ga0209455_1000295 3300025272 Bacteria 52412
366 Ga0209673_1000002 3300025273 Bacteria 1423083
367 Ga0209675_1000002 3300025291 Bacteria 1423083
368 Ga0209564_1000004 3300025295 Bacteria 1424639
369 Ga0209758_1000452 3300025297 Bacteria 68495
370 Ga0209256_1000004 3300025299 Bacteria 1424643
371 Ga0207656_10035314 3300025321 Bacteria 2092
372 Ga0207696_1149757 3300025711 Bacteria 623
373 Ga0207710_10042402 3300025900 Bacteria 2021
374 Ga0207680_10000001 3300025903 Bacteria 1091453
375 Ga0207647_10000014 3300025904 Bacteria 143525
376 Ga0207647_10001935 3300025904 Bacteria 15822
377 Ga0207647_10017313 3300025904 Bacteria 4899
378 Ga0207647_10054333 3300025904 Bacteria 2464
379 Ga0207647_10064530 3300025904 Bacteria 2225
380 Ga0207647_10296206 3300025904 Bacteria 922
381 Ga0207705_10003986 3300025909 Bacteria 11232
382 Ga0207705_10005837 3300025909 Bacteria 9167
383 Ga0207654_10341553 3300025911 Bacteria 1029
384 Ga0207707_10038371 3300025912 Bacteria 4185
385 Ga0207707_10047400 3300025912 Bacteria 3742
386 Ga0207707_10161188 3300025912 Bacteria 1961
387 Ga0207707_10535118 3300025912 Bacteria 997
388 Ga0207695_10000040 3300025913 Bacteria 452787
389 Ga0207695_10000291 3300025913 Bacteria 124555
390 Ga0207695_10000362 3300025913 Bacteria 104132
391 Ga0207695_10001147 3300025913 Bacteria 45960
392 Ga0207695_10002008 3300025913 Bacteria 31403
393 Ga0207695_10024317 3300025913 Bacteria 6819
394 Ga0207695_10042674 3300025913 Bacteria 4840
395 Ga0207695_10057571 3300025913 Bacteria 4037
396 Ga0207671_10000009 3300025914 Bacteria 724862
397 Ga0207671_10000135 3300025914 Bacteria 112401
398 Ga0207671_10004793 3300025914 Bacteria 12744
399 Ga0207671_10156614 3300025914 Bacteria 1762
400 Ga0207671_10210818 3300025914 Bacteria 1520
401 Ga0207657_10012203 3300025919 Bacteria 8490
402 Ga0207657_10106355 3300025919 Bacteria 2322
403 Ga0207657_10122356 3300025919 Bacteria 2140
404 Ga0207649_10003075 3300025920 Bacteria 9164
405 Ga0207649_10006684 3300025920 Bacteria 6268
406 Ga0207649_10021106 3300025920 Bacteria 3743
407 Ga0207649_10023263 3300025920 Bacteria 3586
408 Ga0207649_10126431 3300025920 Bacteria 1731
409 Ga0207652_10143154 3300025921 Bacteria 2138
410 Ga0207652_10220312 3300025921 Bacteria 1710
411 Ga0207694_10002190 3300025924 Bacteria 16057
412 Ga0207694_10005245 3300025924 Bacteria 9997
413 Ga0207694_10006615 3300025924 Bacteria 8812
414 Ga0207694_10023988 3300025924 Bacteria 4633
415 Ga0207694_10039266 3300025924 Bacteria 3642
416 Ga0207694_10050959 3300025924 Bacteria 3208
417 Ga0207694_10179994 3300025924 Bacteria 1714
418 Ga0207694_10434103 3300025924 Bacteria 1095
419 Ga0207694_10569775 3300025924 Bacteria 951
420 Ga0207650_10217151 3300025925 Bacteria 1538
421 Ga0207700_10023446 3300025928 Bacteria 4254
422 Ga0207700_10455654 3300025928 Bacteria 1128
423 Ga0207664_10000092 3300025929 Bacteria 83276
424 Ga0207664_10000929 3300025929 Bacteria 19672
425 Ga0207664_10039255 3300025929 Bacteria 3675
426 Ga0207690_10018537 3300025932 Bacteria 4269
427 Ga0207690_10018739 3300025932 Bacteria 4248
428 Ga0207690_10024493 3300025932 Bacteria 3780
429 Ga0207690_10031438 3300025932 Bacteria 3396
430 Ga0207706_10033243 3300025933 Bacteria 4591
431 Ga0207706_10076489 3300025933 Bacteria 2944
432 Ga0207706_10084528 3300025933 Bacteria 2790
433 Ga0207670_10008997 3300025936 Bacteria 5667
434 Ga0207691_10096278 3300025940 Bacteria 2646
435 Ga0207689_10047201 3300025942 Bacteria 3558
436 Ga0207679_10036264 3300025945 Bacteria 3496
437 Ga0207679_10227486 3300025945 Bacteria 1573
438 Ga0207679_10291168 3300025945 Bacteria 1404
439 Ga0207679_10725760 3300025945 Bacteria 903
440 Ga0207667_10000262 3300025949 Bacteria 73170
441 Ga0207667_10000329 3300025949 Bacteria 65667
442 Ga0207667_10002131 3300025949 Bacteria 24808
443 Ga0207667_10012894 3300025949 Bacteria 9603
444 Ga0207667_10027480 3300025949 Bacteria 6192
445 Ga0207667_10133995 3300025949 Bacteria 2551
446 Ga0207667_10229349 3300025949 Bacteria 1902
447 Ga0207651_10072042 3300025960 Bacteria 2452
448 Ga0207712_10000498 3300025961 Bacteria 32444
449 Ga0207668_10239745 3300025972 Bacteria 1466
450 Ga0207668_10497029 3300025972 Unclassified 1049
451 Ga0207640_10000116 3300025981 Bacteria 60174
452 Ga0207640_10003397 3300025981 Bacteria 8579
453 Ga0207640_10013585 3300025981 Bacteria 4672
454 Ga0207640_10543140 3300025981 Bacteria 975
455 Ga0207658_10000289 3300025986 Bacteria 52614
456 Ga0207658_10099716 3300025986 Bacteria 2272
457 Ga0207658_10112606 3300025986 Bacteria 2154
458 Ga0207658_10532337 3300025986 Bacteria 1050
459 Ga0207658_10614275 3300025986 Bacteria 977
460 Ga0207703_10088824 3300026035 Bacteria 2595
461 Ga0207703_10401961 3300026035 Bacteria 1271
462 Ga0207639_10009617 3300026041 Bacteria 6677
463 Ga0207639_10021122 3300026041 Bacteria 4671
464 Ga0207639_10026892 3300026041 Bacteria 4184
465 Ga0207639_10038222 3300026041 Bacteria 3569
466 Ga0207639_10225944 3300026041 Bacteria 1620
467 Ga0207639_10287545 3300026041 Bacteria 1448
468 Ga0207639_10499748 3300026041 Bacteria 1111
469 Ga0207678_10001533 3300026067 Bacteria 21214
470 Ga0207678_10006482 3300026067 Bacteria 10383
471 Ga0207678_10007650 3300026067 Bacteria 9542
472 Ga0207678_10026742 3300026067 Bacteria 5033
473 Ga0207678_10050032 3300026067 Bacteria 3611
474 Ga0207678_10053454 3300026067 Bacteria 3480
475 Ga0207678_10054822 3300026067 Bacteria 3434
476 Ga0207678_10082252 3300026067 Bacteria 2755
477 Ga0207678_10152847 3300026067 Bacteria 1971
478 Ga0207678_10185207 3300026067 Bacteria 1778
479 Ga0207678_10238262 3300026067 Bacteria 1558
480 Ga0207678_10468406 3300026067 Bacteria 1096
481 Ga0207702_10000037 3300026078 Bacteria 153366
482 Ga0207702_10000960 3300026078 Bacteria 29644
483 Ga0207702_10005837 3300026078 Bacteria 10705
484 Ga0207702_10741481 3300026078 Bacteria 969
485 Ga0207641_10940351 3300026088 Bacteria 859
486 Ga0207648_10186602 3300026089 Bacteria 1837
487 Ga0207674_10010758 3300026116 Bacteria 10324
488 Ga0207674_10032637 3300026116 Bacteria 5459
489 Ga0207674_10095686 3300026116 Bacteria 2955
490 Ga0207674_10100269 3300026116 Bacteria 2877
491 Ga0207674_10105110 3300026116 Bacteria 2802
492 Ga0207674_10137452 3300026116 Bacteria 2404
493 Ga0207674_10144148 3300026116 Bacteria 2341
494 Ga0207674_10188092 3300026116 Bacteria 2015
495 Ga0207698_10009393 3300026142 Bacteria 6235
496 Ga0207698_10145111 3300026142 Bacteria 2051
497 Ga0207698_10277718 3300026142 Bacteria 1548
498 Ga0207698_10552041 3300026142 Bacteria 1129
499 Ga0268266_10000067 3300028379 Bacteria 241577
500 Ga0268266_10000101 3300028379 Bacteria 180443
501 Ga0268266_10011365 3300028379 Bacteria 7742
502 Ga0268266_10023757 3300028379 Bacteria 5217
503 Ga0268266_10106346 3300028379 Bacteria 2480
504 Ga0268266_10121872 3300028379 Bacteria 2321
505 Ga0268266_10304927 3300028379 Bacteria 1487
506 Ga0268265_10000054 3300028380 Bacteria 165504
507 Ga0268265_10062614 3300028380 Bacteria 2859
508 Ga0268264_10333291 3300028381 Bacteria 1439
509 Ga0268264_10399613 3300028381 Bacteria 1320
510 Ga0268264_10767696 3300028381 Bacteria 961
511 Ga0307517_10102780 3300028786 Bacteria 2237
512 Ga0265338_10673318 3300028800 Bacteria 716
513 Ga0265332_10077822 3300031238 Bacteria 1408
514 Ga0307508_10449642 3300031616 Bacteria 881
515 Ga0316575_10051705 3300031665 Bacteria 1636
516 Ga0316575_10064821 3300031665 Bacteria 1463
517 Ga0307507_10176250 3300033179 Bacteria 1540
518 Ga0307510_10018630 3300033180 Bacteria 8164
519 Ga0307510_10040472 3300033180 Bacteria 5116
520 Ga0395899_0000189 3300037312 Bacteria 90438
521 Ga0395899_0001468 3300037312 Bacteria 20067
522 Ga0395899_0002467 3300037312 Bacteria 15012
523 Ga0395899_0010653 3300037312 Bacteria 7045
524 Ga0395899_0032747 3300037312 Bacteria 3906
525 Ga0395900_0000011 3300037418 Bacteria 421926
526 Ga0395900_0000733 3300037418 Bacteria 43644
527 Ga0395900_0002500 3300037418 Bacteria 20203
528 Ga0395900_0023472 3300037418 Bacteria 6312
529 Ga0395900_0112130 3300037418 Bacteria 2801
530 Ga0395900_0181739 3300037418 Bacteria 2137
531 Ga0395898_0000013 3300037466 Bacteria 458788
532 Ga0395898_0000058 3300037466 Bacteria 277701
533 Ga0395898_0019179 3300037466 Bacteria 6962
534 Ga0395898_0025108 3300037466 Bacteria 6008
535 Ga0395898_0031713 3300037466 Bacteria 5278
536 Ga0395898_0043523 3300037466 Bacteria 4424
537 Ga0395898_0122504 3300037466 Bacteria 2491
538 Ga0395898_0123055 3300037466 Bacteria 2486
539 Ga0395905_0257375 3300037471 Bacteria 1630
540 Ga0436364_1417079 3300037853 Bacteria 1546
541 Ga0395901_0000961 3300038443 Bacteria 31360
542 Ga0395901_0002045 3300038443 Bacteria 20694
543 Ga0395901_0018477 3300038443 Bacteria 7116
544 Ga0395901_0038039 3300038443 Bacteria 4977
545 Ga0395901_0134373 3300038443 Bacteria 2600
546 Ga0395901_0140291 3300038443 Bacteria 2540
547 Ga0395901_0142535 3300038443 Bacteria 2518
548 Ga0395901_0176825 3300038443 Bacteria 2238
549 Ga0395901_0311716 3300038443 Bacteria 1629
550 Ga0439466_0055399 3300041411 Bacteria 1289
551 Ga0451791_1402863 3300041451 Bacteria 1125
552 Ga0451793_1096456 3300041452 Bacteria 2302
553 Ga0451797_0845396 3300041453 Bacteria 1406
554 Ga0451800_0536604 3300041459 Bacteria 1206
555 Ga0451802_0271155 3300041460 Bacteria 1535
556 Ga0451807_1337181 3300041486 Bacteria 1222
557 Ga0451807_1964740 3300041486 Bacteria 1315
558 Ga0451833_1330051 3300041491 Bacteria 1166
559 Ga0451837_0571727 3300041494 Bacteria 4974
560 Ga0451837_1034586 3300041494 Bacteria 2204
561 Ga0451837_1245730 3300041494 Bacteria 898
562 Ga0451837_1427531 3300041494 Bacteria 2203
563 Ga0451843_0143886 3300041509 Bacteria 1032
564 Ga0451843_1235005 3300041509 Bacteria 1958
565 Ga0451853_1120445 3300041512 Bacteria 1637
566 Ga0451853_2151927 3300041512 Bacteria 934
567 Ga0439448_0012270 3300042005 Bacteria 2562
568 Ga0439448_0023023 3300042005 Bacteria 1940
569 Ga0439448_0182303 3300042005 Bacteria 734
570 Ga0439459_0003827 3300042438 Bacteria 2406
571 Ga0466988_0289744 3300044536 Bacteria 890
572 Ga0466969_0003545 3300044656 Bacteria 8300
573 Ga0466969_0028054 3300044656 Bacteria 2879
574 Ga0466969_0048569 3300044656 Bacteria 2097
575 Ga0466972_0005270 3300044658 Bacteria 6474
576 Ga0466972_0048682 3300044658 Bacteria 2047
577 Ga0466982_0000001 3300044672 Bacteria 514662
578 Ga0466965_0003322 3300044683 Bacteria 7038
579 Ga0466965_0039831 3300044683 Bacteria 2310
580 Ga0466966_0007089 3300044684 Bacteria 7429
581 Ga0466966_0012332 3300044684 Bacteria 5662
582 Ga0466966_0014647 3300044684 Bacteria 5190
583 Ga0466961_0000349 3300044693 Bacteria 30070
584 Ga0466961_0000378 3300044693 Bacteria 28652
585 Ga0466961_0000794 3300044693 Bacteria 19749
586 Ga0466961_0002114 3300044693 Bacteria 12365
587 Ga0466963_0092187 3300044694 Bacteria 2064
588 Ga0466963_0299782 3300044694 Bacteria 1130
589 Ga0466964_0055064 3300044706 Bacteria 1641
590 Ga0466964_0056523 3300044706 Bacteria 1622
591 Ga0466971_0007188 3300044719 Bacteria 4847
592 Ga0466971_0016413 3300044719 Bacteria 3268
593 Ga0466971_0045006 3300044719 Bacteria 1982
594 Ga0466971_0098167 3300044719 Bacteria 1345
595 Ga0466968_0000075 3300044735 Bacteria 29240
596 Ga0466970_0001508 3300044765 Bacteria 11209
597 Ga0466970_0001565 3300044765 Bacteria 11046
598 Ga0466970_0007450 3300044765 Bacteria 5485
599 Ga0466970_0013456 3300044765 Bacteria 4193
600 Ga0466970_0030479 3300044765 Bacteria 2844
601 Ga0466957_0001666 3300044842 Bacteria 11668
602 Ga0466957_0020866 3300044842 Bacteria 3854
603 Ga0466957_0076440 3300044842 Bacteria 2079
604 Ga0466957_0101706 3300044842 Bacteria 1812
605 Ga0466957_0462041 3300044842 Bacteria 876
606 Ga0466960_0007010 3300044901 Bacteria 4551
607 Ga0466959_0002024 3300045049 Bacteria 12808
608 Ga0466959_0019504 3300045049 Bacteria 4986
609 Ga0466959_0034927 3300045049 Bacteria 3718
610 Ga0466958_0009531 3300045836 Bacteria 5413
611 Ga0466958_0016435 3300045836 Bacteria 4261
612 Ga0466958_0067952 3300045836 Bacteria 2178
613 Ga0466967_0051040 3300045976 Bacteria 3623
614 Ga0466967_0255901 3300045976 Bacteria 1674
615 Ga0466967_0455997 3300045976 Bacteria 1250
616 Ga0495617_000091 3300046452 Bacteria 64325
617 Ga0495617_001450 3300046452 Bacteria 10407
618 Ga0495638_0000389 3300046460 Bacteria 54061
619 Ga0495638_0000511 3300046460 Bacteria 45545
620 Ga0495638_0000799 3300046460 Bacteria 33240
621 Ga0495641_0194264 3300046461 Bacteria 910
622 Ga0495650_0000210 3300046471 Bacteria 125249
623 Ga0495650_0000465 3300046471 Bacteria 62638
624 Ga0495584_0003983 3300046491 Bacteria 7967
625 Ga0495585_0000112 3300046492 Bacteria 87291
626 Ga0495585_0001222 3300046492 Bacteria 20809
627 Ga0495607_0000006 3300046501 Bacteria 281664
628 Ga0495583_0043307 3300046506 Bacteria 2096
629 Ga0495606_0000016 3300046507 Bacteria 284865
630 Ga0495606_0000248 3300046507 Bacteria 94934
631 Ga0495606_0000267 3300046507 Bacteria 92177
632 Ga0495606_0009735 3300046507 Bacteria 8086
633 Ga0495606_0026232 3300046507 Bacteria 4155
634 Ga0495606_0147989 3300046507 Bacteria 1380
635 Ga0495610_0068091 3300046512 Bacteria 1669
636 Ga0495616_0000074 3300046513 Bacteria 84866
637 Ga0495616_0056702 3300046513 Bacteria 1933
638 Ga0495620_0000066 3300046515 Bacteria 89405
639 Ga0495620_0002396 3300046515 Bacteria 10858
640 Ga0495631_0000997 3300046518 Bacteria 17566
641 Ga0495631_0044271 3300046518 Bacteria 1962
642 Ga0495632_0000279 3300046519 Bacteria 50089
643 Ga0495632_0018629 3300046519 Bacteria 3805
644 Ga0495643_0060116 3300046522 Bacteria 2018
645 Ga0495648_0000820 3300046524 Bacteria 32800
646 Ga0495609_0013453 3300046538 Bacteria 3862
647 Ga0495597_0181882 3300046542 Bacteria 849
648 Ga0495622_0008826 3300046557 Bacteria 4668
649 Ga0495668_0004126 3300046616 Bacteria 10514
650 Ga0495611_0000051 3300046648 Bacteria 83900
651 Ga0495625_0009320 3300046660 Bacteria 8226
652 Ga0495625_0027097 3300046660 Bacteria 4320
653 Ga0495625_0065402 3300046660 Bacteria 2563
654 Ga0495625_0584377 3300046660 Bacteria 672
655 Ga0495661_0001828 3300046665 Bacteria 17057
656 Ga0495661_0020848 3300046665 Bacteria 4273
657 Ga0495588_0094759 3300046674 Bacteria 1565
658 Ga0495670_0001121 3300046691 Bacteria 12980
659 Ga0495670_0003174 3300046691 Bacteria 8095
660 Ga0495671_0000220 3300046692 Bacteria 49354
661 Ga0495649_0006391 3300046694 Bacteria 7334
662 Ga0495589_0000067 3300046794 Bacteria 99395
663 Ga0495660_0000432 3300046810 Bacteria 35230
664 Ga0495660_0000808 3300046810 Bacteria 23439
665 Ga0495683_0001807 3300047323 Bacteria 13459
666 Ga0495673_0000004 3300047469 Bacteria 1354526
667 Ga0495673_0000062 3300047469 Bacteria 226461
668 Ga0495673_0001868 3300047469 Bacteria 15802
669 Ga0495673_0021570 3300047469 Bacteria 3177
670 Ga0495686_0000024 3300047472 Bacteria 400343
671 Ga0495686_0000287 3300047472 Bacteria 88733
672 Ga0495686_0007582 3300047472 Bacteria 8109
673 Ga0495686_0013559 3300047472 Bacteria 5651
674 Ga0495686_0047340 3300047472 Bacteria 2715
675 Ga0496100_0006210 3300048903 Bacteria 6498
676 Ga0496101_0018413 3300048904 Bacteria 4749
677 Ga0496101_0020683 3300048904 Bacteria 4512
678 Ga0496104_0052949 3300048907 Bacteria 3834
679 Ga0496105_0005605 3300048908 Bacteria 9547
680 Ga0496106_0000344 3300048909 Bacteria 32816
681 Ga0496106_0190925 3300048909 Bacteria 1628
682 Ga0496107_0341431 3300048910 Bacteria 1114
683 Ga0496107_0789362 3300048910 Unclassified 696
684 Ga0496112_0380324 3300048915 Bacteria 1353
685 Ga0496113_0195270 3300048916 Bacteria 1607
686 Ga0496113_0327063 3300048916 Bacteria 1229
687 Ga0496114_0164280 3300048917 Bacteria 1932
688 Ga0496114_0525977 3300048917 Bacteria 1046
689 Ga0496115_0000124 3300048918 Bacteria 70162
690 Ga0496115_0000466 3300048918 Bacteria 32209
691 Ga0496115_0018698 3300048918 Bacteria 5326
692 Ga0496115_0020772 3300048918 Bacteria 5066
693 Ga0496116_0027095 3300048919 Bacteria 4176
694 Ga0496117_0003423 3300048920 Bacteria 18456
695 Ga0496117_0014978 3300048920 Bacteria 6643
696 Ga0496117_0128885 3300048920 Bacteria 1537
697 Ga0496117_0337814 3300048920 Bacteria 783
698 Ga0496117_0426450 3300048920 Bacteria 662
699 Ga0496118_0000268 3300048921 Bacteria 91201
700 Ga0496118_0001052 3300048921 Bacteria 43071
701 Ga0496118_0001207 3300048921 Bacteria 39788
702 Ga0496118_0007168 3300048921 Bacteria 11924
703 Ga0496118_0022313 3300048921 Bacteria 5540
704 Ga0496118_0025910 3300048921 Bacteria 5013
705 Ga0496118_0322159 3300048921 Bacteria 838
706 Ga0496118_0329414 3300048921 Bacteria 824
707 Ga0496119_0001330 3300048922 Bacteria 30360
708 Ga0496119_0007350 3300048922 Bacteria 9956
709 Ga0496120_0000359 3300048923 Bacteria 74678
710 Ga0496120_0000539 3300048923 Bacteria 58074
711 Ga0496121_0000327 3300048924 Bacteria 99562
712 Ga0496121_0000450 3300048924 Bacteria 81062
713 Ga0496121_0001992 3300048924 Bacteria 32457
714 Ga0496121_0002452 3300048924 Bacteria 28356
715 Ga0496121_0026203 3300048924 Bacteria 5503
716 Ga0496121_0039112 3300048924 Bacteria 4187
717 Ga0496121_0045473 3300048924 Bacteria 3771
718 Ga0496121_0073796 3300048924 Bacteria 2732
719 Ga0496122_0008948 3300048925 Bacteria 10650
720 Ga0496122_0011189 3300048925 Bacteria 9131
721 Ga0496122_0018881 3300048925 Bacteria 6335
722 Ga0496122_0213971 3300048925 Bacteria 1113
723 Ga0496123_0000870 3300048926 Bacteria 48048
724 Ga0496123_0001731 3300048926 Bacteria 28930
725 Ga0496123_0128183 3300048926 Bacteria 1412
726 Ga0496123_0255814 3300048926 Bacteria 861
727 Ga0496124_0000550 3300048927 Bacteria 63401
728 Ga0496124_0277709 3300048927 Bacteria 1223
729 Ga0496125_0000088 3300048928 Bacteria 214942
730 Ga0496125_0104405 3300048928 Bacteria 2076
731 Ga0496125_0403797 3300048928 Bacteria 797
732 Ga0496126_0001255 3300048929 Bacteria 40994
733 Ga0496126_0043756 3300048929 Bacteria 4128
734 Ga0496126_0089276 3300048929 Bacteria 2713
735 Ga0496126_0099388 3300048929 Bacteria 2548
736 Ga0496126_0205539 3300048929 Bacteria 1660
737 Ga0496126_0274518 3300048929 Bacteria 1398
738 Ga0496126_0419888 3300048929 Bacteria 1081
739 Ga0496126_0595557 3300048929 Bacteria 871
740 Ga0495678_000717 3300049459 Bacteria 30162
741 Ga0495682_0002423 3300049460 Bacteria 8838
742 Ga0495682_0035371 3300049460 Bacteria 1840
743 Ga0501031_0017958 3300049568 Bacteria 4602
744 Ga0501031_0046308 3300049568 Bacteria 2836
745 Ga0501031_0082901 3300049568 Bacteria 2090
746 Ga0501031_0097531 3300049568 Bacteria 1918
747 Ga0501031_0246758 3300049568 Bacteria 1160
748 Ga0501032_0013508 3300049569 Bacteria 5806
749 Ga0501032_0015498 3300049569 Bacteria 5374
750 Ga0501032_0081607 3300049569 Bacteria 2151
751 Ga0501032_0155893 3300049569 Bacteria 1500
752 Ga0501032_0500882 3300049569 Bacteria 776
753 Ga0501033_0000821 3300049570 Bacteria 28339
754 Ga0501033_0020890 3300049570 Bacteria 4942
755 Ga0501033_0073695 3300049570 Bacteria 2507
756 Ga0501033_0204748 3300049570 Unclassified 1408
757 Ga0501033_0335896 3300049570 Bacteria 1060
758 Ga0501033_0341584 3300049570 Bacteria 1049
759 Ga0501033_0352101 3300049570 Bacteria 1031
760 Ga0501034_0000367 3300049571 Bacteria 76895
761 Ga0501034_0003776 3300049571 Bacteria 17093
762 Ga0501034_0006750 3300049571 Bacteria 12286
763 Ga0501034_0016243 3300049571 Bacteria 7639
764 Ga0501034_0026207 3300049571 Bacteria 5937
765 Ga0501034_0026424 3300049571 Bacteria 5911
766 Ga0501034_0099868 3300049571 Bacteria 2897
767 Ga0501036_0009039 3300049572 Bacteria 8192
768 Ga0501036_0018300 3300049572 Bacteria 5866
769 Ga0501036_0056006 3300049572 Bacteria 3340
770 Ga0501036_0304166 3300049572 Bacteria 1334
771 Ga0501037_0023840 3300049573 Bacteria 4525
772 Ga0501037_0040451 3300049573 Bacteria 3430
773 Ga0501037_0058913 3300049573 Bacteria 2802
774 Ga0501037_0090847 3300049573 Bacteria 2208
775 Ga0501037_0139593 3300049573 Bacteria 1735
776 Ga0501037_0162354 3300049573 Bacteria 1592
777 Ga0501037_0283099 3300049573 Bacteria 1155
778 Ga0501038_0001913 3300049574 Bacteria 19262
779 Ga0501038_0002023 3300049574 Bacteria 18731
780 Ga0501038_0011166 3300049574 Bacteria 8202
781 Ga0501038_0102047 3300049574 Bacteria 2388
782 Ga0501038_0125255 3300049574 Unclassified 2115
783 Ga0501038_0126984 3300049574 Bacteria 2098
784 Ga0501038_0316749 3300049574 Bacteria 1221
785 Ga0501038_0488022 3300049574 Bacteria 943
786 Ga0501039_0016405 3300049575 Bacteria 5673
787 Ga0501039_0049274 3300049575 Bacteria 3256
788 Ga0501042_0008733 3300049578 Bacteria 6721
789 Ga0501042_0172574 3300049578 Bacteria 1560
790 Ga0501042_0231764 3300049578 Bacteria 1332
791 Ga0501043_0002412 3300049579 Bacteria 15824
792 Ga0501043_0038855 3300049579 Bacteria 3742
793 Ga0501043_0081322 3300049579 Bacteria 2545
794 Ga0501043_0397587 3300049579 Bacteria 1041
795 Ga0501046_0005696 3300049580 Bacteria 11116
796 Ga0501046_0122223 3300049580 Bacteria 1980
797 Ga0501046_0144280 3300049580 Bacteria 1799
798 Ga0501047_0004935 3300049581 Bacteria 12527
799 Ga0501047_0019091 3300049581 Bacteria 6577
800 Ga0501047_0039526 3300049581 Bacteria 4562
801 Ga0501047_0040924 3300049581 Bacteria 4480
802 Ga0501047_0149576 3300049581 Bacteria 2211
803 Ga0501047_0245383 3300049581 Bacteria 1640
804 Ga0501047_0293539 3300049581 Bacteria 1469
805 Ga0501047_0635092 3300049581 Bacteria 888
806 Ga0501047_1030727 3300049581 Bacteria 636
807 Ga0501048_0064496 3300049582 Bacteria 2591
808 Ga0501048_0161859 3300049582 Bacteria 1584
809 Ga0501067_0011288 3300049583 Bacteria 4946
810 Ga0501067_0039847 3300049583 Bacteria 2609
811 Ga0501067_0091198 3300049583 Bacteria 1692
812 Ga0501067_0407467 3300049583 Unclassified 758
813 Ga0501068_0021725 3300049584 Bacteria 3750
814 Ga0501068_0041960 3300049584 Bacteria 2751
815 Ga0501069_0006690 3300049585 Bacteria 6035
816 Ga0501069_0055707 3300049585 Bacteria 2202
817 Ga0501069_0075989 3300049585 Bacteria 1888
818 Ga0501070_0007977 3300049586 Bacteria 8969
819 Ga0501070_0091418 3300049586 Bacteria 2518
820 Ga0501070_0103357 3300049586 Bacteria 2356
821 Ga0501070_0158682 3300049586 Bacteria 1865
822 Ga0501070_0178257 3300049586 Unclassified 1749
823 Ga0501070_0262264 3300049586 Bacteria 1412
824 Ga0501070_0376549 3300049586 Bacteria 1150
825 Ga0501071_0011086 3300049587 Bacteria 6058
826 Ga0501072_0121337 3300049588 Bacteria 2082
827 Ga0501073_0003257 3300049589 Bacteria 12187
828 Ga0501073_0007880 3300049589 Bacteria 7904
829 Ga0501073_0030626 3300049589 Bacteria 3841
830 Ga0501073_0039795 3300049589 Bacteria 3329
831 Ga0501073_0056974 3300049589 Bacteria 2732
832 Ga0501074_0006338 3300049590 Bacteria 8545
833 Ga0501074_0066000 3300049590 Bacteria 2603
834 Ga0501075_0625313 3300049591 Unclassified 821
835 Ga0501076_0131219 3300049592 Bacteria 2032
836 Ga0501077_0109670 3300049593 Bacteria 1749
837 Ga0501079_0032313 3300049741 Bacteria 4024
838 Ga0501080_0002305 3300049742 Bacteria 16635
839 Ga0501080_0036164 3300049742 Bacteria 4610
840 Ga0501080_0060497 3300049742 Bacteria 3526
841 Ga0501080_0250821 3300049742 Bacteria 1614
842 Ga0501080_0280718 3300049742 Bacteria 1514
843 Ga0501080_0486894 3300049742 Bacteria 1103
844 Ga0501080_0659825 3300049742 Bacteria 925
845 Ga0501083_0010536 3300049744 Bacteria 6506
846 Ga0501035_0005637 3300049822 Bacteria 11821
847 Ga0501035_0008113 3300049822 Bacteria 9785
848 Ga0501035_0009495 3300049822 Bacteria 9045
849 Ga0501035_0021755 3300049822 Bacteria 5895
850 Ga0501035_0063675 3300049822 Bacteria 3279
851 Ga0501035_0127152 3300049822 Bacteria 2224
852 Ga0501035_0315395 3300049822 Bacteria 1315
853 Ga0501035_0344346 3300049822 Bacteria 1248
854 Ga0501035_0406360 3300049822 Bacteria 1132
855 Ga0501044_0008272 3300049823 Bacteria 11407
856 Ga0501044_0017849 3300049823 Bacteria 7611
857 Ga0501044_0024496 3300049823 Bacteria 6404
858 Ga0501044_0030059 3300049823 Bacteria 5726
859 Ga0501044_0054290 3300049823 Bacteria 4119
860 Ga0501044_0069628 3300049823 Bacteria 3581
861 Ga0501044_0069885 3300049823 Bacteria 3574
862 Ga0501044_0075476 3300049823 Bacteria 3422
863 Ga0501044_0260274 3300049823 Bacteria 1673
864 Ga0501045_0061332 3300049824 Bacteria 2758
865 Ga0500643_000031 3300053087 Bacteria 204488
866 Ga0500643_019762 3300053087 Bacteria 2212
867 Ga0500646_0083100 3300053090 Bacteria 980
868 Ga0500651_0000144 3300053093 Bacteria 44879
869 Ga0500651_0013646 3300053093 Bacteria 4958
870 Ga0500651_0074083 3300053093 Bacteria 2116
871 Ga0500555_000249 3300053103 Bacteria 23702
872 Ga0500597_000253 3300053120 Bacteria 10919
873 Ga0500568_0000455 3300053139 Bacteria 30618
874 Ga0500633_0017865 3300053160 Bacteria 2090
875 Ga0500645_002319 3300053730 Bacteria 8588
876 Ga0501084_0011253 3300054114 Bacteria 7408
877 Ga0501084_0022192 3300054114 Bacteria 5297
878 Ga0501082_0011219 3300060353 Bacteria 7698
879 Ga0501082_0021595 3300060353 Bacteria 5550
880 Ga0501082_0078979 3300060353 Bacteria 2838
881 Ga0466962_0001040 3300061719 Bacteria 12727
882 Ga0466962_0008740 3300061719 Bacteria 4855

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0182303 Ga0439448_0182303_207_707 166
2 3300049582 Ga0501048_0161859 Ga0501048_0161859_1053_1559 168
3 3300009982 Ga0105147_100668 Ga0105147_1006683 169
4 iso_pu_bacteria 2718218334 2721025542 171
5 iso_pu_bacteria 2734482264 2735834488 171
6 3300038443 Ga0395901_0142535 Ga0395901_0142535_57_578 172
7 3300005344 Ga0070661_100055463 Ga0070661_1000554634 175
8 3300005455 Ga0070663_100933358 Ga0070663_1009333581 175
9 3300009545 Ga0105237_11107800 Ga0105237_111078001 175
10 3300010375 Ga0105239_10012311 Ga0105239_1001231111 175
11 3300013306 Ga0163162_10083015 Ga0163162_100830154 175
12 3300026067 Ga0207678_10238262 Ga0207678_102382622 175
13 3300046452 Ga0495617_000091 Ga0495617_000091_12842_13369 175
14 3300046452 Ga0495617_001450 Ga0495617_001450_7269_7796 175
15 3300046491 Ga0495584_0003983 Ga0495584_0003983_3729_4256 175
16 3300046492 Ga0495585_0000112 Ga0495585_0000112_59304_59831 175
17 3300046492 Ga0495585_0001222 Ga0495585_0001222_7299_7826 175
18 3300046501 Ga0495607_0000006 Ga0495607_0000006_223189_223716 175
19 3300046506 Ga0495583_0043307 Ga0495583_0043307_957_1484 175
20 3300046507 Ga0495606_0000248 Ga0495606_0000248_61935_62462 175
21 3300046507 Ga0495606_0000267 Ga0495606_0000267_31263_31790 175
22 3300046507 Ga0495606_0009735 Ga0495606_0009735_7009_7536 175
23 3300046507 Ga0495606_0147989 Ga0495606_0147989_567_1094 175
24 3300046512 Ga0495610_0068091 Ga0495610_0068091_977_1504 175
25 3300046513 Ga0495616_0000074 Ga0495616_0000074_51547_52074 175
26 3300046513 Ga0495616_0056702 Ga0495616_0056702_1105_1632 175
27 3300046515 Ga0495620_0000066 Ga0495620_0000066_12842_13369 175
28 3300046515 Ga0495620_0002396 Ga0495620_0002396_3549_4076 175
29 3300046518 Ga0495631_0000997 Ga0495631_0000997_7672_8199 175
30 3300046518 Ga0495631_0044271 Ga0495631_0044271_1028_1555 175
31 3300046519 Ga0495632_0018629 Ga0495632_0018629_2077_2604 175
32 3300046522 Ga0495643_0060116 Ga0495643_0060116_1354_1881 175
33 3300046524 Ga0495648_0000820 Ga0495648_0000820_24642_25169 175
34 3300046538 Ga0495609_0013453 Ga0495609_0013453_153_680 175
35 3300046616 Ga0495668_0004126 Ga0495668_0004126_5088_5615 175
36 3300046648 Ga0495611_0000051 Ga0495611_0000051_30124_30651 175
37 3300046660 Ga0495625_0009320 Ga0495625_0009320_5238_5765 175
38 3300046665 Ga0495661_0001828 Ga0495661_0001828_5034_5561 175
39 3300046665 Ga0495661_0020848 Ga0495661_0020848_2915_3442 175
40 3300046691 Ga0495670_0001121 Ga0495670_0001121_10827_11354 175
41 3300046691 Ga0495670_0003174 Ga0495670_0003174_5502_6029 175
42 3300046692 Ga0495671_0000220 Ga0495671_0000220_2182_2709 175
43 3300046794 Ga0495589_0000067 Ga0495589_0000067_9895_10422 175
44 3300046810 Ga0495660_0000432 Ga0495660_0000432_26905_27432 175
45 3300046810 Ga0495660_0000808 Ga0495660_0000808_17463_17990 175
46 3300047323 Ga0495683_0001807 Ga0495683_0001807_406_933 175
47 3300047469 Ga0495673_0000004 Ga0495673_0000004_1204817_1205344 175
48 3300047469 Ga0495673_0000062 Ga0495673_0000062_33851_34378 175
49 3300047469 Ga0495673_0001868 Ga0495673_0001868_11371_11898 175
50 3300047469 Ga0495673_0021570 Ga0495673_0021570_1529_2056 175
51 3300047472 Ga0495686_0007582 Ga0495686_0007582_6348_6875 175
52 3300047472 Ga0495686_0013559 Ga0495686_0013559_5066_5593 175
53 3300047472 Ga0495686_0047340 Ga0495686_0047340_1037_1564 175
54 3300048903 Ga0496100_0006210 Ga0496100_0006210_862_1389 175
55 3300048924 Ga0496121_0000450 Ga0496121_0000450_29072_29599 175
56 3300048924 Ga0496121_0002452 Ga0496121_0002452_15680_16207 175
57 3300048924 Ga0496121_0045473 Ga0496121_0045473_3203_3730 175
58 3300048925 Ga0496122_0018881 Ga0496122_0018881_3553_4080 175
59 3300048926 Ga0496123_0255814 Ga0496123_0255814_206_733 175
60 3300048927 Ga0496124_0000550 Ga0496124_0000550_55295_55822 175
61 3300048927 Ga0496124_0277709 Ga0496124_0277709_161_688 175
62 3300049459 Ga0495678_000717 Ga0495678_000717_7863_8390 175
63 3300049460 Ga0495682_0002423 Ga0495682_0002423_3538_4065 175
64 3300053087 Ga0500643_000031 Ga0500643_000031_29795_30322 175
65 3300053103 Ga0500555_000249 Ga0500555_000249_8747_9274 175
66 3300053160 Ga0500633_0017865 Ga0500633_0017865_166_693 175
67 3300053730 Ga0500645_002319 Ga0500645_002319_3138_3665 175
68 3300002737 JGI25162J39368_1001661 JGI25162J39368_10016617 184
69 3300002772 JGI25164J39214_1000454 JGI25164J39214_100045411 184
70 3300003214 JGI25165J46597_1006555 JGI25165J46597_10065551 184
71 3300005459 Ga0068867_100219122 Ga0068867_1002191222 184
72 3300025231 Ga0207427_100044 Ga0207427_10004441 184
73 3300025233 Ga0209437_100005 Ga0209437_100005336 184
74 3300025261 Ga0209233_1000011 Ga0209233_1000011606 184
75 3300025940 Ga0207691_10096278 Ga0207691_100962782 184
76 3300028379 Ga0268266_10304927 Ga0268266_103049271 184
77 3300031238 Ga0265332_10077822 Ga0265332_100778222 184
78 3300037418 Ga0395900_0000733 Ga0395900_0000733_5000_5554 184
79 3300037466 Ga0395898_0031713 Ga0395898_0031713_442_996 184
80 3300041451 Ga0451791_1402863 Ga0451791_1402863_480_1040 184
81 3300041452 Ga0451793_1096456 Ga0451793_1096456_1359_1916 184
82 3300041453 Ga0451797_0845396 Ga0451797_0845396_395_955 184
83 3300041460 Ga0451802_0271155 Ga0451802_0271155_405_965 184
84 3300041486 Ga0451807_1964740 Ga0451807_1964740_585_1145 184
85 3300041491 Ga0451833_1330051 Ga0451833_1330051_393_953 184
86 3300041512 Ga0451853_1120445 Ga0451853_1120445_826_1386 184
87 3300048910 Ga0496107_0789362 Ga0496107_0789362_112_669 184
88 3300048920 Ga0496117_0426450 Ga0496117_0426450_11_565 184
89 3300049568 Ga0501031_0246758 Ga0501031_0246758_564_1118 184
90 3300049569 Ga0501032_0015498 Ga0501032_0015498_4244_4798 184
91 3300049569 Ga0501032_0081607 Ga0501032_0081607_1062_1616 184
92 3300049570 Ga0501033_0000821 Ga0501033_0000821_6932_7486 184
93 3300049570 Ga0501033_0204748 Ga0501033_0204748_564_1118 184
94 3300049571 Ga0501034_0003776 Ga0501034_0003776_9738_10292 184
95 3300049571 Ga0501034_0026424 Ga0501034_0026424_2213_2767 184
96 3300049572 Ga0501036_0009039 Ga0501036_0009039_3671_4225 184
97 3300049573 Ga0501037_0023840 Ga0501037_0023840_301_855 184
98 3300049573 Ga0501037_0162354 Ga0501037_0162354_503_1057 184
99 3300049574 Ga0501038_0002023 Ga0501038_0002023_11503_12057 184
100 3300049574 Ga0501038_0011166 Ga0501038_0011166_291_845 184
101 3300049575 Ga0501039_0016405 Ga0501039_0016405_4071_4625 184
102 3300049578 Ga0501042_0008733 Ga0501042_0008733_3712_4266 184
103 3300049578 Ga0501042_0172574 Ga0501042_0172574_372_926 184
104 3300049578 Ga0501042_0231764 Ga0501042_0231764_197_751 184
105 3300049579 Ga0501043_0002412 Ga0501043_0002412_3175_3729 184
106 3300049579 Ga0501043_0397587 Ga0501043_0397587_197_751 184
107 3300049580 Ga0501046_0005696 Ga0501046_0005696_4342_4896 184
108 3300049581 Ga0501047_0004935 Ga0501047_0004935_6859_7413 184
109 3300049581 Ga0501047_0019091 Ga0501047_0019091_4433_4987 184
110 3300049582 Ga0501048_0064496 Ga0501048_0064496_1656_2210 184
111 3300049583 Ga0501067_0011288 Ga0501067_0011288_3878_4432 184
112 3300049583 Ga0501067_0039847 Ga0501067_0039847_920_1474 184
113 3300049584 Ga0501068_0021725 Ga0501068_0021725_599_1153 184
114 3300049585 Ga0501069_0006690 Ga0501069_0006690_4242_4796 184
115 3300049585 Ga0501069_0075989 Ga0501069_0075989_271_825 184
116 3300049586 Ga0501070_0007977 Ga0501070_0007977_3799_4353 184
117 3300049586 Ga0501070_0091418 Ga0501070_0091418_1674_2228 184
118 3300049586 Ga0501070_0376549 Ga0501070_0376549_320_874 184
119 3300049587 Ga0501071_0011086 Ga0501071_0011086_4067_4621 184
120 3300049588 Ga0501072_0121337 Ga0501072_0121337_712_1266 184
121 3300049589 Ga0501073_0007880 Ga0501073_0007880_5166_5720 184
122 3300049589 Ga0501073_0030626 Ga0501073_0030626_832_1386 184
123 3300049589 Ga0501073_0039795 Ga0501073_0039795_291_845 184
124 3300049590 Ga0501074_0006338 Ga0501074_0006338_7701_8255 184
125 3300049590 Ga0501074_0066000 Ga0501074_0066000_1100_1654 184
126 3300049591 Ga0501075_0625313 Ga0501075_0625313_36_590 184
127 3300049592 Ga0501076_0131219 Ga0501076_0131219_181_735 184
128 3300049741 Ga0501079_0032313 Ga0501079_0032313_2285_2839 184
129 3300049742 Ga0501080_0002305 Ga0501080_0002305_6539_7093 184
130 3300049822 Ga0501035_0005637 Ga0501035_0005637_8045_8599 184
131 3300049822 Ga0501035_0008113 Ga0501035_0008113_8797_9351 184
132 3300049822 Ga0501035_0315395 Ga0501035_0315395_730_1284 184
133 3300049823 Ga0501044_0030059 Ga0501044_0030059_3299_3853 184
134 3300049823 Ga0501044_0054290 Ga0501044_0054290_577_1131 184
135 3300049823 Ga0501044_0075476 Ga0501044_0075476_536_1090 184
136 3300049824 Ga0501045_0061332 Ga0501045_0061332_1010_1564 184
137 3300053093 Ga0500651_0000144 Ga0500651_0000144_43514_44071 184
138 3300054114 Ga0501084_0011253 Ga0501084_0011253_1126_1680 184
139 3300060353 Ga0501082_0011219 Ga0501082_0011219_3268_3822 184
140 3300060353 Ga0501082_0078979 Ga0501082_0078979_2229_2783 184
141 3300041512 Ga0451853_2151927 Ga0451853_2151927_242_823 188
142 3300044693 Ga0466961_0000378 Ga0466961_0000378_23675_24250 188
143 3300044719 Ga0466971_0098167 Ga0466971_0098167_589_1164 188
144 3300003322 rootL2_10011264 rootL2_100112641 189
145 3300003323 rootH1_10034785 rootH1_100347851 189
146 3300015689 Ga0183360_10004 Ga0183360_10004199 189
147 3300041411 Ga0439466_0055399 Ga0439466_0055399_422_1096 189
148 3300049593 Ga0501077_0109670 Ga0501077_0109670_292_867 190
149 3300048924 Ga0496121_0001992 Ga0496121_0001992_5308_5952 191
150 3300049742 Ga0501080_0250821 Ga0501080_0250821_289_888 191
151 3300049823 Ga0501044_0260274 Ga0501044_0260274_748_1347 191
152 iso_pu_bacteria 2884338543 2884338883 191
153 3300003762 Ga0055542_1000105 Ga0055542_100010522 192
154 3300005616 Ga0068852_100001204 Ga0068852_1000012046 192
155 3300013307 Ga0157372_10649018 Ga0157372_106490183 192
156 3300025242 Ga0209258_100090 Ga0209258_100090132 192
157 3300025254 Ga0209148_1000065 Ga0209148_1000065132 192
158 3300037312 Ga0395899_0001468 Ga0395899_0001468_10200_10787 192
159 3300037418 Ga0395900_0002500 Ga0395900_0002500_12194_12775 192
160 3300037466 Ga0395898_0000013 Ga0395898_0000013_63468_64055 192
161 3300037853 Ga0436364_1417079 Ga0436364_1417079_880_1467 192
162 3300038443 Ga0395901_0134373 Ga0395901_0134373_1577_2164 192
163 3300041486 Ga0451807_1337181 Ga0451807_1337181_463_1062 192
164 3300044694 Ga0466963_0299782 Ga0466963_0299782_267_854 192
165 3300044735 Ga0466968_0000075 Ga0466968_0000075_7785_8363 192
166 3300045976 Ga0466967_0051040 Ga0466967_0051040_1221_1808 192
167 3300048915 Ga0496112_0380324 Ga0496112_0380324_110_688 192
168 3300048916 Ga0496113_0195270 Ga0496113_0195270_982_1560 192
169 3300048918 Ga0496115_0000124 Ga0496115_0000124_42553_43131 192
170 3300048925 Ga0496122_0213971 Ga0496122_0213971_186_764 192
171 3300048926 Ga0496123_0128183 Ga0496123_0128183_55_633 192
172 iso_pu_bacteria 2643221577 2643896583 192
173 iso_pu_bacteria 2643221685 2644478664 192
174 iso_pu_bacteria 2739367700 2739733187 192
175 iso_pu_bacteria 2884411467 2884415724 192
176 iso_pu_bacteria 2928963466 2928966899 192
177 3300005327 Ga0070658_10005032 Ga0070658_100050329 193
178 3300005335 Ga0070666_10000020 Ga0070666_10000020133 193
179 3300005344 Ga0070661_100004622 Ga0070661_1000046228 193
180 3300005548 Ga0070665_100001328 Ga0070665_1000013289 193
181 3300005843 Ga0068860_100412916 Ga0068860_1004129162 193
182 3300009092 Ga0105250_10095931 Ga0105250_100959311 193
183 3300009101 Ga0105247_10630510 Ga0105247_106305102 193
184 3300009551 Ga0105238_10001023 Ga0105238_100010239 193
185 3300025711 Ga0207696_1149757 Ga0207696_11497571 193
186 3300025903 Ga0207680_10000001 Ga0207680_10000001935 193
187 3300025904 Ga0207647_10296206 Ga0207647_102962062 193
188 3300025909 Ga0207705_10003986 Ga0207705_100039866 193
189 3300025920 Ga0207649_10003075 Ga0207649_100030755 193
190 3300025924 Ga0207694_10006615 Ga0207694_100066154 193
191 3300028379 Ga0268266_10000067 Ga0268266_1000006795 193
192 3300028381 Ga0268264_10333291 Ga0268264_103332912 193
193 3300028786 Ga0307517_10102780 Ga0307517_101027804 193
194 3300033180 Ga0307510_10018630 Ga0307510_100186302 193
195 3300033180 Ga0307510_10040472 Ga0307510_100404722 193
196 3300038443 Ga0395901_0140291 Ga0395901_0140291_1311_1895 193
197 3300046471 Ga0495650_0000465 Ga0495650_0000465_30003_30590 193
198 3300046507 Ga0495606_0026232 Ga0495606_0026232_2843_3430 193
199 3300046660 Ga0495625_0027097 Ga0495625_0027097_3114_3701 193
200 3300048904 Ga0496101_0020683 Ga0496101_0020683_2798_3391 193
201 3300048907 Ga0496104_0052949 Ga0496104_0052949_1470_2063 193
202 3300048908 Ga0496105_0005605 Ga0496105_0005605_4753_5346 193
203 3300048918 Ga0496115_0018698 Ga0496115_0018698_1946_2539 193
204 3300048919 Ga0496116_0027095 Ga0496116_0027095_3284_3877 193
205 3300048920 Ga0496117_0003423 Ga0496117_0003423_16698_17291 193
206 3300048920 Ga0496117_0337814 Ga0496117_0337814_86_679 193
207 3300048921 Ga0496118_0001207 Ga0496118_0001207_8670_9263 193
208 3300048921 Ga0496118_0022313 Ga0496118_0022313_67_660 193
209 3300048921 Ga0496118_0322159 Ga0496118_0322159_38_625 193
210 3300048922 Ga0496119_0001330 Ga0496119_0001330_4221_4814 193
211 3300048923 Ga0496120_0000539 Ga0496120_0000539_53263_53856 193
212 3300048924 Ga0496121_0026203 Ga0496121_0026203_167_760 193
213 3300048924 Ga0496121_0073796 Ga0496121_0073796_1950_2537 193
214 3300048928 Ga0496125_0403797 Ga0496125_0403797_85_672 193
215 3300048929 Ga0496126_0001255 Ga0496126_0001255_18039_18632 193
216 3300048929 Ga0496126_0043756 Ga0496126_0043756_2403_2990 193
217 3300053090 Ga0500646_0083100 Ga0500646_0083100_179_766 193
218 iso_pu_bacteria 2537561836 2538831992 193
219 iso_pu_bacteria 2643221562 2643828880 193
220 iso_pu_bacteria 2842914999 2842915674 193
221 iso_pu_bacteria 2895395659 2895395923 193
222 iso_pu_bacteria 2939611941 2939613344 193
223 iso_pu_bacteria 2995948881 2995953853 193
224 3300041494 Ga0451837_0571727 Ga0451837_0571727_4269_4874 194
225 3300041494 Ga0451837_1034586 Ga0451837_1034586_143_748 194
226 3300041494 Ga0451837_1245730 Ga0451837_1245730_154_759 194
227 3300041509 Ga0451843_0143886 Ga0451843_0143886_201_806 194
228 3300041509 Ga0451843_1235005 Ga0451843_1235005_94_699 194
229 3300045976 Ga0466967_0255901 Ga0466967_0255901_312_899 194
230 3300049571 Ga0501034_0000367 Ga0501034_0000367_74351_74959 194
231 3300049581 Ga0501047_1030727 Ga0501047_1030727_16_624 194
232 3300002075 JGI24738J21930_10000020 JGI24738J21930_1000002022 195
233 3300003578 Ga0006562J51391_1201163 Ga0006562J51391_12011634 195
234 3300003578 Ga0006562J51391_1201164 Ga0006562J51391_12011642 195
235 3300005455 Ga0070663_100012632 Ga0070663_1000126323 195
236 3300009101 Ga0105247_10002045 Ga0105247_1000204514 195
237 3300013105 Ga0157369_10008532 Ga0157369_1000853210 195
238 3300013308 Ga0157375_10205673 Ga0157375_102056732 195
239 3300015261 Ga0182006_1000065 Ga0182006_100006535 195
240 3300015262 Ga0182007_10005217 Ga0182007_100052179 195
241 3300015265 Ga0182005_1001497 Ga0182005_10014976 195
242 3300015265 Ga0182005_1008021 Ga0182005_10080212 195
243 3300017792 Ga0163161_10002563 Ga0163161_100025637 195
244 3300017792 Ga0163161_10097349 Ga0163161_100973492 195
245 3300025229 Ga0209147_108813 Ga0209147_1088132 195
246 3300025904 Ga0207647_10000014 Ga0207647_100000146 195
247 3300025920 Ga0207649_10023263 Ga0207649_100232634 195
248 3300026067 Ga0207678_10026742 Ga0207678_100267425 195
249 3300026067 Ga0207678_10050032 Ga0207678_100500326 195
250 3300044842 Ga0466957_0101706 Ga0466957_0101706_370_957 195
251 3300046519 Ga0495632_0000279 Ga0495632_0000279_7989_8579 195
252 3300047472 Ga0495686_0000024 Ga0495686_0000024_25786_26373 195
253 3300047472 Ga0495686_0000287 Ga0495686_0000287_28499_29086 195
254 3300048904 Ga0496101_0018413 Ga0496101_0018413_2817_3404 195
255 3300048909 Ga0496106_0000344 Ga0496106_0000344_9228_9815 195
256 3300048920 Ga0496117_0014978 Ga0496117_0014978_5251_5838 195
257 3300048920 Ga0496117_0128885 Ga0496117_0128885_715_1302 195
258 3300048921 Ga0496118_0000268 Ga0496118_0000268_83450_84037 195
259 3300048921 Ga0496118_0007168 Ga0496118_0007168_8932_9519 195
260 3300048929 Ga0496126_0205539 Ga0496126_0205539_634_1221 195
261 iso_pu_bacteria 2941489479 2941492705 195
262 3300001989 JGI24739J22299_10083624 JGI24739J22299_100836242 196
263 3300001990 JGI24737J22298_10109933 JGI24737J22298_101099332 196
264 3300002705 JGI25156J39149_1000480 JGI25156J39149_100048023 196
265 3300002705 JGI25156J39149_1004347 JGI25156J39149_10043474 196
266 3300002705 JGI25156J39149_1012327 JGI25156J39149_10123273 196
267 3300002737 JGI25162J39368_1000454 JGI25162J39368_10004545 196
268 3300002737 JGI25162J39368_1000657 JGI25162J39368_10006578 196
269 3300002737 JGI25162J39368_1002289 JGI25162J39368_10022894 196
270 3300002741 JGI25157J39369_1000300 JGI25157J39369_10003005 196
271 3300002741 JGI25157J39369_1000525 JGI25157J39369_10005255 196
272 3300002741 JGI25157J39369_1001263 JGI25157J39369_10012637 196
273 3300002771 JGI25163J39215_1000882 JGI25163J39215_10008823 196
274 3300002772 JGI25164J39214_1000112 JGI25164J39214_100011247 196
275 3300002772 JGI25164J39214_1000295 JGI25164J39214_100029532 196
276 3300002772 JGI25164J39214_1008953 JGI25164J39214_10089531 196
277 3300003214 JGI25165J46597_1000229 JGI25165J46597_100022947 196
278 3300003214 JGI25165J46597_1000527 JGI25165J46597_10005275 196
279 3300003316 rootH1_10006421 rootH1_100064212 196
280 3300003316 rootH1_10124382 rootH1_101243822 196
281 3300003320 rootH2_10047639 rootH2_100476393 196
282 3300003320 rootH2_10082323 rootH2_100823232 196
283 3300003323 rootH1_10183402 rootH1_101834022 196
284 3300003323 rootH1_10236681 rootH1_102366813 196
285 3300003751 Ga0055538_1001138 Ga0055538_10011385 196
286 3300003752 Ga0055539_1005663 Ga0055539_10056631 196
287 3300003752 Ga0055539_1019428 Ga0055539_10194281 196
288 3300003756 Ga0055533_1000581 Ga0055533_10005817 196
289 3300003756 Ga0055533_1003055 Ga0055533_10030552 196
290 3300003759 Ga0055525_1000082 Ga0055525_100008266 196
291 3300003760 Ga0055527_1000072 Ga0055527_100007248 196
292 3300003760 Ga0055527_1000080 Ga0055527_100008027 196
293 3300003760 Ga0055527_1003188 Ga0055527_10031882 196
294 3300003760 Ga0055527_1011228 Ga0055527_10112282 196
295 3300003761 Ga0055535_1000162 Ga0055535_100016243 196
296 3300003761 Ga0055535_1000189 Ga0055535_100018938 196
297 3300003761 Ga0055535_1000491 Ga0055535_100049133 196
298 3300003761 Ga0055535_1000611 Ga0055535_100061116 196
299 3300003761 Ga0055535_1001129 Ga0055535_10011294 196
300 3300003762 Ga0055542_1000163 Ga0055542_100016326 196
301 3300003762 Ga0055542_1000181 Ga0055542_100018146 196
302 3300003762 Ga0055542_1000188 Ga0055542_100018823 196
303 3300003762 Ga0055542_1000254 Ga0055542_100025430 196
304 3300003762 Ga0055542_1000573 Ga0055542_100057330 196
305 3300003763 Ga0055529_1000205 Ga0055529_100020546 196
306 3300003763 Ga0055529_1000209 Ga0055529_100020925 196
307 3300003763 Ga0055529_1000336 Ga0055529_100033628 196
308 3300003763 Ga0055529_1000496 Ga0055529_10004965 196
309 3300005327 Ga0070658_10873277 Ga0070658_108732771 196
310 3300005331 Ga0070670_100132781 Ga0070670_1001327812 196
311 3300005338 Ga0068868_100462320 Ga0068868_1004623201 196
312 3300005340 Ga0070689_100004873 Ga0070689_1000048735 196
313 3300005341 Ga0070691_10122135 Ga0070691_101221352 196
314 3300005344 Ga0070661_100028888 Ga0070661_1000288881 196
315 3300005344 Ga0070661_100029522 Ga0070661_1000295223 196
316 3300005355 Ga0070671_100025842 Ga0070671_1000258421 196
317 3300005364 Ga0070673_100220277 Ga0070673_1002202773 196
318 3300005367 Ga0070667_100010566 Ga0070667_1000105662 196
319 3300005367 Ga0070667_100031091 Ga0070667_1000310913 196
320 3300005367 Ga0070667_100620417 Ga0070667_1006204171 196
321 3300005455 Ga0070663_100107997 Ga0070663_1001079972 196
322 3300005458 Ga0070681_10013694 Ga0070681_100136944 196
323 3300005466 Ga0070685_10010980 Ga0070685_100109804 196
324 3300005539 Ga0068853_100041046 Ga0068853_1000410463 196
325 3300005539 Ga0068853_100181559 Ga0068853_1001815591 196
326 3300005539 Ga0068853_100358905 Ga0068853_1003589051 196
327 3300005548 Ga0070665_100000097 Ga0070665_100000097135 196
328 3300005563 Ga0068855_100412537 Ga0068855_1004125372 196
329 3300005563 Ga0068855_100501717 Ga0068855_1005017172 196
330 3300005577 Ga0068857_100032832 Ga0068857_1000328323 196
331 3300005577 Ga0068857_100075732 Ga0068857_1000757324 196
332 3300005577 Ga0068857_100108570 Ga0068857_1001085702 196
333 3300005614 Ga0068856_100007251 Ga0068856_10000725111 196
334 3300005614 Ga0068856_100771812 Ga0068856_1007718122 196
335 3300005616 Ga0068852_100221594 Ga0068852_1002215943 196
336 3300005834 Ga0068851_10023176 Ga0068851_100231763 196
337 3300005843 Ga0068860_100145004 Ga0068860_1001450041 196
338 3300005844 Ga0068862_100059714 Ga0068862_1000597143 196
339 3300005844 Ga0068862_100104837 Ga0068862_1001048373 196
340 3300006237 Ga0097621_100017790 Ga0097621_1000177904 196
341 3300006358 Ga0068871_100069947 Ga0068871_1000699472 196
342 3300006881 Ga0068865_100199275 Ga0068865_1001992752 196
343 3300009093 Ga0105240_10006212 Ga0105240_1000621210 196
344 3300009093 Ga0105240_10006230 Ga0105240_1000623010 196
345 3300009093 Ga0105240_10084657 Ga0105240_100846574 196
346 3300009093 Ga0105240_10464558 Ga0105240_104645581 196
347 3300009093 Ga0105240_10975403 Ga0105240_109754031 196
348 3300009177 Ga0105248_10346591 Ga0105248_103465912 196
349 3300009551 Ga0105238_10208703 Ga0105238_102087032 196
350 3300009551 Ga0105238_11203240 Ga0105238_112032402 196
351 3300010375 Ga0105239_10000192 Ga0105239_1000019258 196
352 3300010375 Ga0105239_10550070 Ga0105239_105500703 196
353 3300012502 Ga0157347_1001512 Ga0157347_10015123 196
354 3300013104 Ga0157370_10162156 Ga0157370_101621561 196
355 3300013105 Ga0157369_10132720 Ga0157369_101327202 196
356 3300013307 Ga0157372_10104820 Ga0157372_101048204 196
357 3300014325 Ga0163163_10083520 Ga0163163_100835203 196
358 3300014968 Ga0157379_10090031 Ga0157379_100900313 196
359 3300014969 Ga0157376_10963307 Ga0157376_109633071 196
360 3300015687 Ga0183368_1002 Ga0183368_10021317 196
361 3300025206 Ga0209435_104672 Ga0209435_1046722 196
362 3300025207 Ga0209760_100417 Ga0209760_1004175 196
363 3300025224 Ga0209784_100053 Ga0209784_100053152 196
364 3300025225 Ga0209566_101751 Ga0209566_1017513 196
365 3300025226 Ga0209674_100014 Ga0209674_100014144 196
366 3300025226 Ga0209674_100234 Ga0209674_10023420 196
367 3300025226 Ga0209674_100413 Ga0209674_10041316 196
368 3300025228 Ga0209672_100004 Ga0209672_100004443 196
369 3300025228 Ga0209672_100008 Ga0209672_100008343 196
370 3300025228 Ga0209672_100089 Ga0209672_10008987 196
371 3300025228 Ga0209672_101247 Ga0209672_10124711 196
372 3300025228 Ga0209672_101845 Ga0209672_1018455 196
373 3300025228 Ga0209672_103546 Ga0209672_1035463 196
374 3300025230 Ga0209563_100097 Ga0209563_10009768 196
375 3300025231 Ga0207427_100051 Ga0207427_100051150 196
376 3300025231 Ga0207427_100061 Ga0207427_1000615 196
377 3300025231 Ga0207427_103025 Ga0207427_1030253 196
378 3300025231 Ga0207427_112494 Ga0207427_1124942 196
379 3300025233 Ga0209437_100037 Ga0209437_100037164 196
380 3300025233 Ga0209437_100152 Ga0209437_10015298 196
381 3300025233 Ga0209437_100279 Ga0209437_10027966 196
382 3300025233 Ga0209437_102261 Ga0209437_1022615 196
383 3300025242 Ga0209258_100003 Ga0209258_100003443 196
384 3300025242 Ga0209258_100004 Ga0209258_100004847 196
385 3300025242 Ga0209258_100008 Ga0209258_100008472 196
386 3300025242 Ga0209258_100173 Ga0209258_100173107 196
387 3300025242 Ga0209258_100541 Ga0209258_1005415 196
388 3300025242 Ga0209258_101149 Ga0209258_10114910 196
389 3300025242 Ga0209258_102841 Ga0209258_1028412 196
390 3300025246 Ga0209646_1000700 Ga0209646_10007004 196
391 3300025246 Ga0209646_1000900 Ga0209646_10009005 196
392 3300025250 Ga0209026_1000064 Ga0209026_100006470 196
393 3300025250 Ga0209026_1000104 Ga0209026_10001045 196
394 3300025250 Ga0209026_1000407 Ga0209026_10004076 196
395 3300025250 Ga0209026_1003591 Ga0209026_10035912 196
396 3300025253 Ga0209677_101838 Ga0209677_1018388 196
397 3300025253 Ga0209677_112023 Ga0209677_1120233 196
398 3300025254 Ga0209148_1000001 Ga0209148_1000001346 196
399 3300025254 Ga0209148_1000002 Ga0209148_1000002304 196
400 3300025254 Ga0209148_1000016 Ga0209148_1000016443 196
401 3300025254 Ga0209148_1000079 Ga0209148_1000079210 196
402 3300025254 Ga0209148_1000279 Ga0209148_100027928 196
403 3300025256 Ga0209759_1000165 Ga0209759_100016567 196
404 3300025256 Ga0209759_1000544 Ga0209759_10005445 196
405 3300025256 Ga0209759_1000762 Ga0209759_100076218 196
406 3300025256 Ga0209759_1002477 Ga0209759_10024776 196
407 3300025261 Ga0209233_1000002 Ga0209233_10000021885 196
408 3300025261 Ga0209233_1000099 Ga0209233_1000099214 196
409 3300025261 Ga0209233_1007681 Ga0209233_10076813 196
410 3300025261 Ga0209233_1027747 Ga0209233_10277472 196
411 3300025272 Ga0209455_1000004 Ga0209455_1000004443 196
412 3300025272 Ga0209455_1000007 Ga0209455_1000007592 196
413 3300025272 Ga0209455_1000016 Ga0209455_1000016211 196
414 3300025272 Ga0209455_1000079 Ga0209455_10000795 196
415 3300025321 Ga0207656_10035314 Ga0207656_100353143 196
416 3300025904 Ga0207647_10017313 Ga0207647_100173133 196
417 3300025904 Ga0207647_10064530 Ga0207647_100645302 196
418 3300025912 Ga0207707_10161188 Ga0207707_101611883 196
419 3300025913 Ga0207695_10000291 Ga0207695_1000029193 196
420 3300025913 Ga0207695_10001147 Ga0207695_1000114729 196
421 3300025913 Ga0207695_10057571 Ga0207695_100575713 196
422 3300025920 Ga0207649_10021106 Ga0207649_100211064 196
423 3300025924 Ga0207694_10569775 Ga0207694_105697752 196
424 3300025936 Ga0207670_10008997 Ga0207670_100089973 196
425 3300025945 Ga0207679_10036264 Ga0207679_100362643 196
426 3300025949 Ga0207667_10133995 Ga0207667_101339953 196
427 3300025960 Ga0207651_10072042 Ga0207651_100720423 196
428 3300025981 Ga0207640_10543140 Ga0207640_105431402 196
429 3300025986 Ga0207658_10099716 Ga0207658_100997162 196
430 3300026035 Ga0207703_10401961 Ga0207703_104019612 196
431 3300026041 Ga0207639_10009617 Ga0207639_100096173 196
432 3300026067 Ga0207678_10053454 Ga0207678_100534544 196
433 3300026067 Ga0207678_10152847 Ga0207678_101528472 196
434 3300026078 Ga0207702_10000960 Ga0207702_100009609 196
435 3300026078 Ga0207702_10741481 Ga0207702_107414812 196
436 3300026116 Ga0207674_10032637 Ga0207674_100326375 196
437 3300026116 Ga0207674_10100269 Ga0207674_101002692 196
438 3300026142 Ga0207698_10277718 Ga0207698_102777182 196
439 3300026142 Ga0207698_10552041 Ga0207698_105520412 196
440 3300028379 Ga0268266_10000101 Ga0268266_10000101136 196
441 3300028380 Ga0268265_10062614 Ga0268265_100626144 196
442 3300028381 Ga0268264_10767696 Ga0268264_107676961 196
443 3300028800 Ga0265338_10673318 Ga0265338_106733181 196
444 3300031665 Ga0316575_10051705 Ga0316575_100517052 196
445 3300031665 Ga0316575_10064821 Ga0316575_100648212 196
446 3300037312 Ga0395899_0000189 Ga0395899_0000189_68020_68619 196
447 3300037312 Ga0395899_0002467 Ga0395899_0002467_4935_5537 196
448 3300037312 Ga0395899_0032747 Ga0395899_0032747_1930_2523 196
449 3300037418 Ga0395900_0000011 Ga0395900_0000011_62975_63574 196
450 3300037418 Ga0395900_0023472 Ga0395900_0023472_1708_2310 196
451 3300037418 Ga0395900_0112130 Ga0395900_0112130_1008_1601 196
452 3300037466 Ga0395898_0000058 Ga0395898_0000058_68297_68896 196
453 3300037466 Ga0395898_0019179 Ga0395898_0019179_3538_4140 196
454 3300037466 Ga0395898_0025108 Ga0395898_0025108_3904_4506 196
455 3300037466 Ga0395898_0043523 Ga0395898_0043523_3615_4208 196
456 3300037466 Ga0395898_0122504 Ga0395898_0122504_1557_2150 196
457 3300037471 Ga0395905_0257375 Ga0395905_0257375_736_1338 196
458 3300038443 Ga0395901_0000961 Ga0395901_0000961_21122_21715 196
459 3300038443 Ga0395901_0018477 Ga0395901_0018477_5822_6424 196
460 3300038443 Ga0395901_0176825 Ga0395901_0176825_404_1003 196
461 3300038443 Ga0395901_0311716 Ga0395901_0311716_626_1225 196
462 3300042005 Ga0439448_0012270 Ga0439448_0012270_612_1205 196
463 3300044536 Ga0466988_0289744 Ga0466988_0289744_122_721 196
464 3300044656 Ga0466969_0003545 Ga0466969_0003545_3273_3872 196
465 3300044656 Ga0466969_0028054 Ga0466969_0028054_194_787 196
466 3300044656 Ga0466969_0048569 Ga0466969_0048569_898_1497 196
467 3300044658 Ga0466972_0048682 Ga0466972_0048682_210_803 196
468 3300044672 Ga0466982_0000001 Ga0466982_0000001_377312_377905 196
469 3300044683 Ga0466965_0003322 Ga0466965_0003322_2966_3577 196
470 3300044683 Ga0466965_0039831 Ga0466965_0039831_15_608 196
471 3300044684 Ga0466966_0007089 Ga0466966_0007089_5750_6343 196
472 3300044684 Ga0466966_0012332 Ga0466966_0012332_4477_5076 196
473 3300044684 Ga0466966_0014647 Ga0466966_0014647_4095_4694 196
474 3300044693 Ga0466961_0000349 Ga0466961_0000349_18217_18828 196
475 3300044693 Ga0466961_0000794 Ga0466961_0000794_8004_8603 196
476 3300044693 Ga0466961_0002114 Ga0466961_0002114_3768_4367 196
477 3300044694 Ga0466963_0092187 Ga0466963_0092187_745_1356 196
478 3300044706 Ga0466964_0055064 Ga0466964_0055064_396_989 196
479 3300044706 Ga0466964_0056523 Ga0466964_0056523_873_1472 196
480 3300044719 Ga0466971_0007188 Ga0466971_0007188_4049_4660 196
481 3300044719 Ga0466971_0016413 Ga0466971_0016413_956_1555 196
482 3300044719 Ga0466971_0045006 Ga0466971_0045006_1266_1859 196
483 3300044765 Ga0466970_0001565 Ga0466970_0001565_4689_5288 196
484 3300044765 Ga0466970_0007450 Ga0466970_0007450_2055_2654 196
485 3300044765 Ga0466970_0013456 Ga0466970_0013456_1538_2131 196
486 3300044765 Ga0466970_0030479 Ga0466970_0030479_1188_1787 196
487 3300044842 Ga0466957_0001666 Ga0466957_0001666_4856_5455 196
488 3300044842 Ga0466957_0020866 Ga0466957_0020866_1107_1718 196
489 3300044842 Ga0466957_0076440 Ga0466957_0076440_189_782 196
490 3300044842 Ga0466957_0462041 Ga0466957_0462041_170_781 196
491 3300044901 Ga0466960_0007010 Ga0466960_0007010_3433_4026 196
492 3300045049 Ga0466959_0002024 Ga0466959_0002024_201_800 196
493 3300045049 Ga0466959_0019504 Ga0466959_0019504_154_765 196
494 3300045049 Ga0466959_0034927 Ga0466959_0034927_14_613 196
495 3300045836 Ga0466958_0009531 Ga0466958_0009531_1571_2170 196
496 3300045836 Ga0466958_0016435 Ga0466958_0016435_1127_1738 196
497 3300045836 Ga0466958_0067952 Ga0466958_0067952_770_1369 196
498 3300045976 Ga0466967_0455997 Ga0466967_0455997_54_644 196
499 3300046460 Ga0495638_0000389 Ga0495638_0000389_25196_25792 196
500 3300046460 Ga0495638_0000799 Ga0495638_0000799_27193_27789 196
501 3300046471 Ga0495650_0000210 Ga0495650_0000210_99800_100396 196
502 3300046507 Ga0495606_0000016 Ga0495606_0000016_3904_4500 196
503 3300046542 Ga0495597_0181882 Ga0495597_0181882_56_652 196
504 3300046557 Ga0495622_0008826 Ga0495622_0008826_793_1389 196
505 3300046660 Ga0495625_0065402 Ga0495625_0065402_327_923 196
506 3300046660 Ga0495625_0584377 Ga0495625_0584377_26_622 196
507 3300046694 Ga0495649_0006391 Ga0495649_0006391_1875_2471 196
508 3300048909 Ga0496106_0190925 Ga0496106_0190925_905_1507 196
509 3300048910 Ga0496107_0341431 Ga0496107_0341431_367_969 196
510 3300048917 Ga0496114_0164280 Ga0496114_0164280_83_679 196
511 3300048918 Ga0496115_0000466 Ga0496115_0000466_27652_28248 196
512 3300048918 Ga0496115_0020772 Ga0496115_0020772_4439_5035 196
513 3300048922 Ga0496119_0007350 Ga0496119_0007350_4133_4735 196
514 3300048923 Ga0496120_0000359 Ga0496120_0000359_65070_65672 196
515 3300048924 Ga0496121_0000327 Ga0496121_0000327_60882_61484 196
516 3300048928 Ga0496125_0104405 Ga0496125_0104405_136_729 196
517 3300048929 Ga0496126_0089276 Ga0496126_0089276_1211_1813 196
518 3300048929 Ga0496126_0099388 Ga0496126_0099388_72_665 196
519 3300048929 Ga0496126_0419888 Ga0496126_0419888_76_672 196
520 3300049460 Ga0495682_0035371 Ga0495682_0035371_1162_1758 196
521 3300049568 Ga0501031_0017958 Ga0501031_0017958_2321_2914 196
522 3300049568 Ga0501031_0046308 Ga0501031_0046308_1489_2085 196
523 3300049568 Ga0501031_0082901 Ga0501031_0082901_273_866 196
524 3300049569 Ga0501032_0013508 Ga0501032_0013508_500_1093 196
525 3300049569 Ga0501032_0155893 Ga0501032_0155893_12_605 196
526 3300049569 Ga0501032_0500882 Ga0501032_0500882_22_612 196
527 3300049570 Ga0501033_0020890 Ga0501033_0020890_166_759 196
528 3300049570 Ga0501033_0335896 Ga0501033_0335896_323_940 196
529 3300049570 Ga0501033_0341584 Ga0501033_0341584_167_760 196
530 3300049571 Ga0501034_0006750 Ga0501034_0006750_9572_10168 196
531 3300049571 Ga0501034_0026207 Ga0501034_0026207_1856_2449 196
532 3300049572 Ga0501036_0056006 Ga0501036_0056006_1535_2128 196
533 3300049573 Ga0501037_0040451 Ga0501037_0040451_769_1365 196
534 3300049573 Ga0501037_0139593 Ga0501037_0139593_887_1480 196
535 3300049573 Ga0501037_0283099 Ga0501037_0283099_354_947 196
536 3300049574 Ga0501038_0001913 Ga0501038_0001913_17555_18151 196
537 3300049574 Ga0501038_0102047 Ga0501038_0102047_1333_1926 196
538 3300049574 Ga0501038_0488022 Ga0501038_0488022_301_894 196
539 3300049575 Ga0501039_0049274 Ga0501039_0049274_776_1372 196
540 3300049579 Ga0501043_0038855 Ga0501043_0038855_136_732 196
541 3300049579 Ga0501043_0081322 Ga0501043_0081322_753_1343 196
542 3300049580 Ga0501046_0144280 Ga0501046_0144280_642_1232 196
543 3300049581 Ga0501047_0039526 Ga0501047_0039526_3426_4043 196
544 3300049581 Ga0501047_0040924 Ga0501047_0040924_1559_2152 196
545 3300049581 Ga0501047_0293539 Ga0501047_0293539_323_916 196
546 3300049581 Ga0501047_0635092 Ga0501047_0635092_234_827 196
547 3300049584 Ga0501068_0041960 Ga0501068_0041960_2057_2653 196
548 3300049586 Ga0501070_0262264 Ga0501070_0262264_554_1147 196
549 3300049589 Ga0501073_0003257 Ga0501073_0003257_9362_9958 196
550 3300049742 Ga0501080_0060497 Ga0501080_0060497_824_1420 196
551 3300049742 Ga0501080_0486894 Ga0501080_0486894_247_837 196
552 3300049742 Ga0501080_0659825 Ga0501080_0659825_283_876 196
553 3300049822 Ga0501035_0021755 Ga0501035_0021755_1768_2361 196
554 3300049822 Ga0501035_0063675 Ga0501035_0063675_560_1153 196
555 3300049822 Ga0501035_0344346 Ga0501035_0344346_225_821 196
556 3300049822 Ga0501035_0406360 Ga0501035_0406360_408_1025 196
557 3300049823 Ga0501044_0008272 Ga0501044_0008272_2546_3139 196
558 3300049823 Ga0501044_0017849 Ga0501044_0017849_2070_2666 196
559 3300049823 Ga0501044_0024496 Ga0501044_0024496_3433_4026 196
560 3300049823 Ga0501044_0069628 Ga0501044_0069628_468_1058 196
561 3300061719 Ga0466962_0001040 Ga0466962_0001040_1610_2203 196
562 3300061719 Ga0466962_0008740 Ga0466962_0008740_3681_4292 196
563 3300001979 JGI24740J21852_10017269 JGI24740J21852_100172694 197
564 3300001990 JGI24737J22298_10000503 JGI24737J22298_1000050314 197
565 3300002067 JGI24735J21928_10023462 JGI24735J21928_100234622 197
566 3300002705 JGI25156J39149_1006967 JGI25156J39149_10069673 197
567 3300002737 JGI25162J39368_1000792 JGI25162J39368_100079211 197
568 3300002741 JGI25157J39369_1003690 JGI25157J39369_10036903 197
569 3300002772 JGI25164J39214_1000451 JGI25164J39214_10004519 197
570 3300003214 JGI25165J46597_1000872 JGI25165J46597_10008729 197
571 3300003578 Ga0006562J51391_1017349 Ga0006562J51391_10173497 197
572 3300003763 Ga0055529_1023381 Ga0055529_10233811 197
573 3300003771 Ga0055526_1000107 Ga0055526_100010755 197
574 3300003773 Ga0055537_1000125 Ga0055537_100012542 197
575 3300003775 Ga0055524_1000176 Ga0055524_100017655 197
576 3300003784 Ga0055534_1000090 Ga0055534_100009055 197
577 3300003790 Ga0055528_1000088 Ga0055528_100008855 197
578 3300005327 Ga0070658_10035840 Ga0070658_100358403 197
579 3300005331 Ga0070670_100255716 Ga0070670_1002557162 197
580 3300005334 Ga0068869_100244555 Ga0068869_1002445551 197
581 3300005337 Ga0070682_100006648 Ga0070682_1000066486 197
582 3300005337 Ga0070682_100467750 Ga0070682_1004677502 197
583 3300005339 Ga0070660_100011111 Ga0070660_1000111114 197
584 3300005339 Ga0070660_100105322 Ga0070660_1001053223 197
585 3300005339 Ga0070660_100120618 Ga0070660_1001206182 197
586 3300005339 Ga0070660_100205709 Ga0070660_1002057093 197
587 3300005344 Ga0070661_100007423 Ga0070661_1000074236 197
588 3300005344 Ga0070661_100095087 Ga0070661_1000950872 197
589 3300005345 Ga0070692_10023906 Ga0070692_100239063 197
590 3300005345 Ga0070692_10085847 Ga0070692_100858472 197
591 3300005347 Ga0070668_100001704 Ga0070668_10000170410 197
592 3300005347 Ga0070668_100834439 Ga0070668_1008344391 197
593 3300005353 Ga0070669_100511960 Ga0070669_1005119602 197
594 3300005366 Ga0070659_100003695 Ga0070659_1000036954 197
595 3300005366 Ga0070659_100043342 Ga0070659_1000433424 197
596 3300005366 Ga0070659_100127110 Ga0070659_1001271102 197
597 3300005366 Ga0070659_100519562 Ga0070659_1005195621 197
598 3300005367 Ga0070667_100000040 Ga0070667_1000000402 197
599 3300005367 Ga0070667_100062316 Ga0070667_1000623162 197
600 3300005367 Ga0070667_100073758 Ga0070667_1000737582 197
601 3300005367 Ga0070667_100309147 Ga0070667_1003091472 197
602 3300005435 Ga0070714_100000207 Ga0070714_10000020737 197
603 3300005435 Ga0070714_100001217 Ga0070714_1000012174 197
604 3300005439 Ga0070711_100015114 Ga0070711_1000151143 197
605 3300005439 Ga0070711_100536123 Ga0070711_1005361231 197
606 3300005444 Ga0070694_100076914 Ga0070694_1000769142 197
607 3300005455 Ga0070663_100001131 Ga0070663_10000113113 197
608 3300005455 Ga0070663_100029842 Ga0070663_1000298423 197
609 3300005455 Ga0070663_100039344 Ga0070663_1000393441 197
610 3300005455 Ga0070663_100197199 Ga0070663_1001971992 197
611 3300005455 Ga0070663_100226213 Ga0070663_1002262132 197
612 3300005455 Ga0070663_100299657 Ga0070663_1002996571 197
613 3300005457 Ga0070662_100218434 Ga0070662_1002184341 197
614 3300005458 Ga0070681_10023056 Ga0070681_100230565 197
615 3300005466 Ga0070685_10009321 Ga0070685_100093216 197
616 3300005530 Ga0070679_100059614 Ga0070679_1000596144 197
617 3300005530 Ga0070679_100090918 Ga0070679_1000909182 197
618 3300005539 Ga0068853_100038222 Ga0068853_1000382223 197
619 3300005539 Ga0068853_100049856 Ga0068853_1000498563 197
620 3300005539 Ga0068853_100195727 Ga0068853_1001957273 197
621 3300005539 Ga0068853_100276154 Ga0068853_1002761542 197
622 3300005546 Ga0070696_100004108 Ga0070696_1000041088 197
623 3300005546 Ga0070696_100010225 Ga0070696_1000102254 197
624 3300005546 Ga0070696_100124104 Ga0070696_1001241043 197
625 3300005547 Ga0070693_100019491 Ga0070693_1000194914 197
626 3300005547 Ga0070693_100046384 Ga0070693_1000463843 197
627 3300005548 Ga0070665_100013315 Ga0070665_1000133157 197
628 3300005548 Ga0070665_100020995 Ga0070665_1000209952 197
629 3300005548 Ga0070665_100025880 Ga0070665_1000258805 197
630 3300005548 Ga0070665_100033651 Ga0070665_1000336514 197
631 3300005548 Ga0070665_100161102 Ga0070665_1001611023 197
632 3300005548 Ga0070665_100349215 Ga0070665_1003492152 197
633 3300005563 Ga0068855_100007368 Ga0068855_1000073687 197
634 3300005563 Ga0068855_100041031 Ga0068855_1000410314 197
635 3300005563 Ga0068855_100058503 Ga0068855_1000585035 197
636 3300005563 Ga0068855_100141160 Ga0068855_1001411604 197
637 3300005563 Ga0068855_100523970 Ga0068855_1005239702 197
638 3300005563 Ga0068855_100732842 Ga0068855_1007328422 197
639 3300005564 Ga0070664_100762991 Ga0070664_1007629911 197
640 3300005577 Ga0068857_100016650 Ga0068857_1000166504 197
641 3300005577 Ga0068857_100086711 Ga0068857_1000867111 197
642 3300005577 Ga0068857_100141891 Ga0068857_1001418912 197
643 3300005577 Ga0068857_100193289 Ga0068857_1001932891 197
644 3300005578 Ga0068854_100001262 Ga0068854_10000126211 197
645 3300005578 Ga0068854_100045364 Ga0068854_1000453644 197
646 3300005614 Ga0068856_100000184 Ga0068856_10000018445 197
647 3300005614 Ga0068856_100028084 Ga0068856_1000280841 197
648 3300005616 Ga0068852_100014289 Ga0068852_1000142896 197
649 3300005616 Ga0068852_100092432 Ga0068852_1000924324 197
650 3300005616 Ga0068852_101047322 Ga0068852_1010473222 197
651 3300005617 Ga0068859_100007515 Ga0068859_10000751510 197
652 3300005841 Ga0068863_100113735 Ga0068863_1001137354 197
653 3300005841 Ga0068863_100685759 Ga0068863_1006857591 197
654 3300005842 Ga0068858_100078324 Ga0068858_1000783242 197
655 3300005842 Ga0068858_100120194 Ga0068858_1001201943 197
656 3300005843 Ga0068860_100162836 Ga0068860_1001628362 197
657 3300005844 Ga0068862_100000224 Ga0068862_10000022449 197
658 3300006175 Ga0070712_100027163 Ga0070712_1000271634 197
659 3300006237 Ga0097621_100081890 Ga0097621_1000818901 197
660 3300006358 Ga0068871_100195291 Ga0068871_1001952912 197
661 3300006931 Ga0097620_100007515 Ga0097620_10000751510 197
662 3300009093 Ga0105240_10006360 Ga0105240_1000636011 197
663 3300009093 Ga0105240_10007835 Ga0105240_100078354 197
664 3300009093 Ga0105240_10031364 Ga0105240_100313644 197
665 3300009093 Ga0105240_10055146 Ga0105240_100551464 197
666 3300009093 Ga0105240_10057256 Ga0105240_100572563 197
667 3300009101 Ga0105247_10025236 Ga0105247_100252363 197
668 3300009174 Ga0105241_10017425 Ga0105241_100174254 197
669 3300009174 Ga0105241_10417655 Ga0105241_104176552 197
670 3300009174 Ga0105241_10473819 Ga0105241_104738192 197
671 3300009177 Ga0105248_10028291 Ga0105248_100282912 197
672 3300009545 Ga0105237_10000022 Ga0105237_10000022189 197
673 3300009545 Ga0105237_10000036 Ga0105237_1000003611 197
674 3300009545 Ga0105237_10063098 Ga0105237_100630983 197
675 3300009545 Ga0105237_10093406 Ga0105237_100934064 197
676 3300009545 Ga0105237_10118792 Ga0105237_101187923 197
677 3300009545 Ga0105237_10137559 Ga0105237_101375592 197
678 3300009551 Ga0105238_10015508 Ga0105238_100155089 197
679 3300009551 Ga0105238_10022715 Ga0105238_100227154 197
680 3300009551 Ga0105238_10051301 Ga0105238_100513014 197
681 3300009551 Ga0105238_10099966 Ga0105238_100999664 197
682 3300009551 Ga0105238_10162538 Ga0105238_101625384 197
683 3300009551 Ga0105238_10326233 Ga0105238_103262332 197
684 3300009551 Ga0105238_10326569 Ga0105238_103265692 197
685 3300009551 Ga0105238_11240976 Ga0105238_112409761 197
686 3300009553 Ga0105249_10000193 Ga0105249_100001932 197
687 3300010375 Ga0105239_10004724 Ga0105239_100047241 197
688 3300010375 Ga0105239_10025642 Ga0105239_100256422 197
689 3300010375 Ga0105239_10103323 Ga0105239_101033234 197
690 3300010375 Ga0105239_10119105 Ga0105239_101191054 197
691 3300010375 Ga0105239_10399618 Ga0105239_103996181 197
692 3300010375 Ga0105239_10421240 Ga0105239_104212402 197
693 3300012500 Ga0157314_1000060 Ga0157314_10000602 197
694 3300013100 Ga0157373_10012271 Ga0157373_100122714 197
695 3300013100 Ga0157373_10019943 Ga0157373_100199434 197
696 3300013100 Ga0157373_10299074 Ga0157373_102990741 197
697 3300013100 Ga0157373_10327469 Ga0157373_103274692 197
698 3300013102 Ga0157371_10004318 Ga0157371_1000431811 197
699 3300013102 Ga0157371_10021258 Ga0157371_100212583 197
700 3300013104 Ga0157370_10001178 Ga0157370_1000117824 197
701 3300013104 Ga0157370_10015371 Ga0157370_100153713 197
702 3300013104 Ga0157370_10021645 Ga0157370_100216454 197
703 3300013104 Ga0157370_10132571 Ga0157370_101325713 197
704 3300013104 Ga0157370_10145090 Ga0157370_101450901 197
705 3300013105 Ga0157369_10102041 Ga0157369_101020413 197
706 3300013105 Ga0157369_10298142 Ga0157369_102981423 197
707 3300013306 Ga0163162_11669365 Ga0163162_116693651 197
708 3300013307 Ga0157372_10010508 Ga0157372_100105086 197
709 3300013307 Ga0157372_10092695 Ga0157372_100926954 197
710 3300013307 Ga0157372_10096496 Ga0157372_100964962 197
711 3300014497 Ga0182008_10014259 Ga0182008_100142593 197
712 3300014968 Ga0157379_10275778 Ga0157379_102757782 197
713 3300014969 Ga0157376_10105080 Ga0157376_101050802 197
714 3300015261 Ga0182006_1073793 Ga0182006_10737933 197
715 3300015262 Ga0182007_10018151 Ga0182007_100181512 197
716 3300015262 Ga0182007_10043001 Ga0182007_100430013 197
717 3300015262 Ga0182007_10103943 Ga0182007_101039431 197
718 3300020070 Ga0206356_11612961 Ga0206356_116129613 197
719 3300020081 Ga0206354_10499166 Ga0206354_104991662 197
720 3300020082 Ga0206353_11908525 Ga0206353_119085254 197
721 3300025226 Ga0209674_102618 Ga0209674_1026184 197
722 3300025231 Ga0207427_100088 Ga0207427_10008840 197
723 3300025233 Ga0209437_100167 Ga0209437_10016740 197
724 3300025250 Ga0209026_1000010 Ga0209026_1000010309 197
725 3300025250 Ga0209026_1000660 Ga0209026_10006604 197
726 3300025256 Ga0209759_1001342 Ga0209759_10013426 197
727 3300025256 Ga0209759_1012013 Ga0209759_10120133 197
728 3300025261 Ga0209233_1000046 Ga0209233_100004640 197
729 3300025261 Ga0209233_1000759 Ga0209233_100075910 197
730 3300025263 Ga0209565_1000002 Ga0209565_10000021178 197
731 3300025272 Ga0209455_1000295 Ga0209455_100029534 197
732 3300025273 Ga0209673_1000002 Ga0209673_10000021178 197
733 3300025291 Ga0209675_1000002 Ga0209675_10000021178 197
734 3300025295 Ga0209564_1000004 Ga0209564_10000041179 197
735 3300025297 Ga0209758_1000452 Ga0209758_100045241 197
736 3300025299 Ga0209256_1000004 Ga0209256_10000041179 197
737 3300025900 Ga0207710_10042402 Ga0207710_100424021 197
738 3300025904 Ga0207647_10001935 Ga0207647_100019357 197
739 3300025904 Ga0207647_10054333 Ga0207647_100543331 197
740 3300025909 Ga0207705_10005837 Ga0207705_100058374 197
741 3300025911 Ga0207654_10341553 Ga0207654_103415532 197
742 3300025912 Ga0207707_10038371 Ga0207707_100383714 197
743 3300025912 Ga0207707_10047400 Ga0207707_100474003 197
744 3300025912 Ga0207707_10535118 Ga0207707_105351182 197
745 3300025913 Ga0207695_10000040 Ga0207695_10000040148 197
746 3300025913 Ga0207695_10000362 Ga0207695_1000036230 197
747 3300025913 Ga0207695_10002008 Ga0207695_1000200820 197
748 3300025913 Ga0207695_10024317 Ga0207695_100243174 197
749 3300025913 Ga0207695_10042674 Ga0207695_100426743 197
750 3300025914 Ga0207671_10000009 Ga0207671_10000009442 197
751 3300025914 Ga0207671_10000135 Ga0207671_100001352 197
752 3300025914 Ga0207671_10004793 Ga0207671_1000479312 197
753 3300025914 Ga0207671_10156614 Ga0207671_101566143 197
754 3300025914 Ga0207671_10210818 Ga0207671_102108182 197
755 3300025919 Ga0207657_10012203 Ga0207657_100122038 197
756 3300025919 Ga0207657_10106355 Ga0207657_101063552 197
757 3300025919 Ga0207657_10122356 Ga0207657_101223563 197
758 3300025920 Ga0207649_10006684 Ga0207649_100066842 197
759 3300025920 Ga0207649_10126431 Ga0207649_101264312 197
760 3300025921 Ga0207652_10143154 Ga0207652_101431541 197
761 3300025921 Ga0207652_10220312 Ga0207652_102203123 197
762 3300025924 Ga0207694_10002190 Ga0207694_100021905 197
763 3300025924 Ga0207694_10005245 Ga0207694_100052457 197
764 3300025924 Ga0207694_10023988 Ga0207694_100239883 197
765 3300025924 Ga0207694_10039266 Ga0207694_100392663 197
766 3300025924 Ga0207694_10050959 Ga0207694_100509592 197
767 3300025924 Ga0207694_10179994 Ga0207694_101799943 197
768 3300025924 Ga0207694_10434103 Ga0207694_104341032 197
769 3300025925 Ga0207650_10217151 Ga0207650_102171512 197
770 3300025928 Ga0207700_10023446 Ga0207700_100234464 197
771 3300025928 Ga0207700_10455654 Ga0207700_104556542 197
772 3300025929 Ga0207664_10000092 Ga0207664_1000009244 197
773 3300025929 Ga0207664_10000929 Ga0207664_100009297 197
774 3300025929 Ga0207664_10039255 Ga0207664_100392554 197
775 3300025932 Ga0207690_10018537 Ga0207690_100185374 197
776 3300025932 Ga0207690_10018739 Ga0207690_100187393 197
777 3300025932 Ga0207690_10024493 Ga0207690_100244934 197
778 3300025932 Ga0207690_10031438 Ga0207690_100314383 197
779 3300025933 Ga0207706_10033243 Ga0207706_100332435 197
780 3300025933 Ga0207706_10076489 Ga0207706_100764892 197
781 3300025933 Ga0207706_10084528 Ga0207706_100845284 197
782 3300025942 Ga0207689_10047201 Ga0207689_100472014 197
783 3300025945 Ga0207679_10227486 Ga0207679_102274862 197
784 3300025945 Ga0207679_10291168 Ga0207679_102911683 197
785 3300025945 Ga0207679_10725760 Ga0207679_107257602 197
786 3300025949 Ga0207667_10000262 Ga0207667_1000026234 197
787 3300025949 Ga0207667_10000329 Ga0207667_1000032928 197
788 3300025949 Ga0207667_10002131 Ga0207667_1000213113 197
789 3300025949 Ga0207667_10012894 Ga0207667_100128944 197
790 3300025949 Ga0207667_10027480 Ga0207667_100274808 197
791 3300025949 Ga0207667_10229349 Ga0207667_102293493 197
792 3300025961 Ga0207712_10000498 Ga0207712_100004982 197
793 3300025972 Ga0207668_10239745 Ga0207668_102397452 197
794 3300025972 Ga0207668_10497029 Ga0207668_104970292 197
795 3300025981 Ga0207640_10000116 Ga0207640_1000011629 197
796 3300025981 Ga0207640_10003397 Ga0207640_100033978 197
797 3300025981 Ga0207640_10013585 Ga0207640_100135855 197
798 3300025986 Ga0207658_10000289 Ga0207658_1000028949 197
799 3300025986 Ga0207658_10112606 Ga0207658_101126062 197
800 3300025986 Ga0207658_10532337 Ga0207658_105323372 197
801 3300025986 Ga0207658_10614275 Ga0207658_106142752 197
802 3300026035 Ga0207703_10088824 Ga0207703_100888242 197
803 3300026041 Ga0207639_10021122 Ga0207639_100211222 197
804 3300026041 Ga0207639_10026892 Ga0207639_100268923 197
805 3300026041 Ga0207639_10038222 Ga0207639_100382223 197
806 3300026041 Ga0207639_10225944 Ga0207639_102259442 197
807 3300026041 Ga0207639_10287545 Ga0207639_102875452 197
808 3300026041 Ga0207639_10499748 Ga0207639_104997482 197
809 3300026067 Ga0207678_10001533 Ga0207678_100015338 197
810 3300026067 Ga0207678_10006482 Ga0207678_100064827 197
811 3300026067 Ga0207678_10007650 Ga0207678_100076502 197
812 3300026067 Ga0207678_10054822 Ga0207678_100548224 197
813 3300026067 Ga0207678_10082252 Ga0207678_100822523 197
814 3300026067 Ga0207678_10185207 Ga0207678_101852072 197
815 3300026067 Ga0207678_10468406 Ga0207678_104684061 197
816 3300026078 Ga0207702_10000037 Ga0207702_1000003742 197
817 3300026078 Ga0207702_10005837 Ga0207702_100058378 197
818 3300026088 Ga0207641_10940351 Ga0207641_109403511 197
819 3300026089 Ga0207648_10186602 Ga0207648_101866022 197
820 3300026116 Ga0207674_10010758 Ga0207674_100107587 197
821 3300026116 Ga0207674_10095686 Ga0207674_100956862 197
822 3300026116 Ga0207674_10105110 Ga0207674_101051104 197
823 3300026116 Ga0207674_10137452 Ga0207674_101374524 197
824 3300026116 Ga0207674_10144148 Ga0207674_101441482 197
825 3300026116 Ga0207674_10188092 Ga0207674_101880922 197
826 3300026142 Ga0207698_10009393 Ga0207698_100093936 197
827 3300026142 Ga0207698_10145111 Ga0207698_101451113 197
828 3300028379 Ga0268266_10011365 Ga0268266_100113656 197
829 3300028379 Ga0268266_10023757 Ga0268266_100237573 197
830 3300028379 Ga0268266_10106346 Ga0268266_101063464 197
831 3300028379 Ga0268266_10121872 Ga0268266_101218722 197
832 3300028380 Ga0268265_10000054 Ga0268265_10000054106 197
833 3300028381 Ga0268264_10399613 Ga0268264_103996132 197
834 3300031616 Ga0307508_10449642 Ga0307508_104496421 197
835 3300033179 Ga0307507_10176250 Ga0307507_101762501 197
836 3300037312 Ga0395899_0010653 Ga0395899_0010653_3676_4272 197
837 3300037418 Ga0395900_0181739 Ga0395900_0181739_755_1351 197
838 3300037466 Ga0395898_0123055 Ga0395898_0123055_995_1591 197
839 3300038443 Ga0395901_0002045 Ga0395901_0002045_7734_8330 197
840 3300038443 Ga0395901_0038039 Ga0395901_0038039_2689_3285 197
841 3300041459 Ga0451800_0536604 Ga0451800_0536604_496_1089 197
842 3300041494 Ga0451837_1427531 Ga0451837_1427531_1240_1866 197
843 3300042005 Ga0439448_0023023 Ga0439448_0023023_1014_1607 197
844 3300042438 Ga0439459_0003827 Ga0439459_0003827_467_1063 197
845 3300044658 Ga0466972_0005270 Ga0466972_0005270_2785_3390 197
846 3300044765 Ga0466970_0001508 Ga0466970_0001508_3109_3714 197
847 3300046460 Ga0495638_0000511 Ga0495638_0000511_41425_42021 197
848 3300046461 Ga0495641_0194264 Ga0495641_0194264_20_616 197
849 3300046674 Ga0495588_0094759 Ga0495588_0094759_791_1387 197
850 3300048916 Ga0496113_0327063 Ga0496113_0327063_364_960 197
851 3300048917 Ga0496114_0525977 Ga0496114_0525977_360_956 197
852 3300048921 Ga0496118_0001052 Ga0496118_0001052_7112_7705 197
853 3300048921 Ga0496118_0025910 Ga0496118_0025910_3339_3944 197
854 3300048921 Ga0496118_0329414 Ga0496118_0329414_48_641 197
855 3300048924 Ga0496121_0039112 Ga0496121_0039112_1741_2334 197
856 3300048925 Ga0496122_0008948 Ga0496122_0008948_9122_9715 197
857 3300048925 Ga0496122_0011189 Ga0496122_0011189_7570_8169 197
858 3300048926 Ga0496123_0000870 Ga0496123_0000870_45641_46234 197
859 3300048926 Ga0496123_0001731 Ga0496123_0001731_14388_14987 197
860 3300048928 Ga0496125_0000088 Ga0496125_0000088_111826_112419 197
861 3300048929 Ga0496126_0274518 Ga0496126_0274518_698_1291 197
862 3300048929 Ga0496126_0595557 Ga0496126_0595557_175_768 197
863 3300049568 Ga0501031_0097531 Ga0501031_0097531_1096_1692 197
864 3300049570 Ga0501033_0073695 Ga0501033_0073695_1002_1598 197
865 3300049570 Ga0501033_0352101 Ga0501033_0352101_190_786 197
866 3300049571 Ga0501034_0016243 Ga0501034_0016243_3275_3871 197
867 3300049571 Ga0501034_0099868 Ga0501034_0099868_1974_2570 197
868 3300049572 Ga0501036_0018300 Ga0501036_0018300_3146_3742 197
869 3300049572 Ga0501036_0304166 Ga0501036_0304166_262_858 197
870 3300049573 Ga0501037_0058913 Ga0501037_0058913_1377_1973 197
871 3300049573 Ga0501037_0090847 Ga0501037_0090847_252_848 197
872 3300049574 Ga0501038_0125255 Ga0501038_0125255_1243_1839 197
873 3300049574 Ga0501038_0126984 Ga0501038_0126984_1193_1789 197
874 3300049574 Ga0501038_0316749 Ga0501038_0316749_373_969 197
875 3300049580 Ga0501046_0122223 Ga0501046_0122223_230_826 197
876 3300049581 Ga0501047_0149576 Ga0501047_0149576_1597_2193 197
877 3300049581 Ga0501047_0245383 Ga0501047_0245383_845_1441 197
878 3300049583 Ga0501067_0091198 Ga0501067_0091198_703_1299 197
879 3300049583 Ga0501067_0407467 Ga0501067_0407467_43_639 197
880 3300049585 Ga0501069_0055707 Ga0501069_0055707_914_1510 197
881 3300049586 Ga0501070_0103357 Ga0501070_0103357_1374_1970 197
882 3300049586 Ga0501070_0158682 Ga0501070_0158682_805_1401 197
883 3300049586 Ga0501070_0178257 Ga0501070_0178257_868_1464 197
884 3300049589 Ga0501073_0056974 Ga0501073_0056974_1291_1887 197
885 3300049742 Ga0501080_0036164 Ga0501080_0036164_421_1017 197
886 3300049742 Ga0501080_0280718 Ga0501080_0280718_59_655 197
887 3300049744 Ga0501083_0010536 Ga0501083_0010536_5214_5810 197
888 3300049822 Ga0501035_0009495 Ga0501035_0009495_5821_6417 197
889 3300049822 Ga0501035_0127152 Ga0501035_0127152_842_1438 197
890 3300049823 Ga0501044_0069885 Ga0501044_0069885_2747_3343 197
891 3300053087 Ga0500643_019762 Ga0500643_019762_410_1003 197
892 3300053093 Ga0500651_0013646 Ga0500651_0013646_4162_4761 197
893 3300053093 Ga0500651_0074083 Ga0500651_0074083_871_1467 197
894 3300053120 Ga0500597_000253 Ga0500597_000253_427_1020 197
895 3300053139 Ga0500568_0000455 Ga0500568_0000455_23720_24316 197
896 3300054114 Ga0501084_0022192 Ga0501084_0022192_2704_3300 197
897 3300060353 Ga0501082_0021595 Ga0501082_0021595_3665_4261 197

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

61

181

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e50-assembly1.cif.gz_A cryo-em structure of human glycerol-3-phosphate acyltransferase 1 (gpat1) in complex with coa and palmitoyl-lpa 0.6336 13 150
6zvj-assembly1.cif.gz_1 structure of a human abce1-bound 43s pre-initiation complex - state ii 0.5376 94 178
5f34-assembly1.cif.gz_A crystal structure of membrane associated pata from mycobacterium smegmatis in complex with s-hexadecyl coenzyme a - p21 space group 0.5325 12 184
3kwp-assembly1.cif.gz_A-2 crystal structure of putative methyltransferase from lactobacillus brevis 0.5269 41 150
3hh1-assembly2.cif.gz_C the structure of a tetrapyrrole methylase family protein domain from chlorobium tepidum tls 0.5253 38 149
ID Description Score Start End Superfamily
af_P26647_52_180_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7378 31 149 3.40.50.620
af_Q2FXJ7_19_144_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7339 36 149 3.40.50.2000
af_Q8IL28_86_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7305 33 149 3.40.50.620
af_Q8GXU8_180_307_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7285 36 149 3.40.50.2000
af_D4AC45_64_192_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7279 34 149 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A1B8PVB4-F1-model_v4 Glycerol acyltransferase 0.9491 11 189 GO:0003841
GO:0006654
AF-A0A091BH66-F1-model_v4 Phospholipid/glycerol acyltransferase domain-containing protein 0.947 4 191 GO:0003841
GO:0006654
AF-A0A7Y0LF21-F1-model_v4 Acyltransferase 0.9457 10 189 GO:0003841
GO:0006654
AF-A0A143HR79-F1-model_v4 Acyltransferase 0.9428 11 189 GO:0003841
GO:0006654
AF-A0A160N2L2-F1-model_v4 1-acylglycerol-3-phosphate O-acyltransferase (EC 2.3.1.51) 0.942 26 191 GO:0003841
GO:0006654

Feature Viewer

pLDDT pTM Quality
80.32 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map