F485002

General Info

Members Datasets Scaffolds Average Seq Length
896 242 896 147

Family's Representative Sequence

Representative Sequence 3300005337|Ga0070682_100645922|Ga0070682_1006459221
Length 165
Sequence VRSFSVAEYKHAYYIPLLMETLPFEIGETAHALRKAFDRRAVGLGVTRAQWKVLFKLERTPGLRQIELADLLDIEPITLSRIVDRLEEAGLVERASDPADRRAWRLHVTRKAQPLIEKLHSVADEMIAEAFAGIDTRHIEITRAVLGRVRENTARAAPMSRASNQ

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
170 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
171 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
172 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
175 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
176 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
182 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
183 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
184 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
193 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
197 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
215 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
216 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
217 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
223 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
224 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
225 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
226 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.33
Nodule 0
Rhizoplane 5.92
Rhizosphere 93.19
Stem 0
Stem Tuber 0
Unclassified 0.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13686641 2162886012 Bacteria 1251
2 JGI24740J21852_10024667 3300001979 Bacteria 2038
3 JGI24739J22299_10005757 3300001989 Bacteria 4697
4 JGI24739J22299_10021619 3300001989 Bacteria 2288
5 JGI24737J22298_10017642 3300001990 Bacteria 2297
6 JGI24737J22298_10218047 3300001990 Bacteria 563
7 JGI24743J22301_10009110 3300001991 Bacteria 1753
8 JGI24735J21928_10004294 3300002067 Bacteria 4798
9 JGI24735J21928_10036266 3300002067 Unclassified 1447
10 JGI24738J21930_10038565 3300002075 Bacteria 971
11 JGI24738J21930_10052614 3300002075 Bacteria 831
12 JGI24738J21930_10120523 3300002075 Bacteria 570
13 JGI24744J21845_10000547 3300002077 Bacteria 6755
14 JGI24742J22300_10010397 3300002244 Bacteria 1541
15 rootH1_10138689 3300003323 Unclassified 1057
16 Ga0065715_10023351 3300005293 Bacteria 1781
17 Ga0065715_10097503 3300005293 Bacteria 3695
18 Ga0065715_10392911 3300005293 Bacteria 892
19 Ga0070658_10001557 3300005327 Bacteria 19440
20 Ga0070658_10010416 3300005327 Bacteria 7455
21 Ga0070658_10018360 3300005327 Bacteria 5600
22 Ga0070658_10053135 3300005327 Bacteria 3287
23 Ga0070658_10107335 3300005327 Bacteria 2310
24 Ga0070658_10153711 3300005327 Bacteria 1928
25 Ga0070658_11273692 3300005327 Bacteria 639
26 Ga0070676_10068013 3300005328 Bacteria 2132
27 Ga0070676_10152645 3300005328 Bacteria 1480
28 Ga0070676_10685905 3300005328 Bacteria 747
29 Ga0070676_11121903 3300005328 Bacteria 595
30 Ga0070683_100008063 3300005329 Bacteria 8943
31 Ga0070683_100214995 3300005329 Bacteria 1827
32 Ga0070690_100044483 3300005330 Bacteria 2818
33 Ga0070690_100346094 3300005330 Bacteria 1078
34 Ga0070670_100003815 3300005331 Bacteria 12558
35 Ga0070670_100014338 3300005331 Bacteria 6801
36 Ga0070670_100038160 3300005331 Bacteria 4131
37 Ga0070670_100057436 3300005331 Bacteria 3341
38 Ga0070670_100072166 3300005331 Bacteria 2965
39 Ga0070670_100116815 3300005331 Bacteria 2300
40 Ga0070670_100134709 3300005331 Bacteria 2134
41 Ga0070670_100185559 3300005331 Bacteria 1806
42 Ga0070670_100258911 3300005331 Bacteria 1516
43 Ga0070677_10038409 3300005333 Bacteria 1873
44 Ga0070677_10189914 3300005333 Bacteria 984
45 Ga0070677_10330681 3300005333 Bacteria 783
46 Ga0068869_100108253 3300005334 Bacteria 2111
47 Ga0068869_101650121 3300005334 Bacteria 571
48 Ga0070666_10000381 3300005335 Bacteria 27905
49 Ga0070666_10002547 3300005335 Bacteria 11024
50 Ga0070666_10004768 3300005335 Bacteria 8286
51 Ga0070666_10045936 3300005335 Bacteria 2928
52 Ga0070666_10066097 3300005335 Bacteria 2453
53 Ga0070666_10239550 3300005335 Bacteria 1283
54 Ga0070666_10473067 3300005335 Bacteria 907
55 Ga0070680_101053767 3300005336 Bacteria 703
56 Ga0070682_100025660 3300005337 Bacteria 3519
57 Ga0070682_100645922 3300005337 Bacteria 842
58 Ga0070682_101979317 3300005337 Bacteria 512
59 Ga0068868_100002486 3300005338 Bacteria 12791
60 Ga0068868_100030303 3300005338 Bacteria 4148
61 Ga0068868_100105162 3300005338 Bacteria 2288
62 Ga0068868_100105321 3300005338 Bacteria 2287
63 Ga0068868_100424278 3300005338 Bacteria 1152
64 Ga0068868_101193142 3300005338 Bacteria 703
65 Ga0070660_100000009 3300005339 Bacteria 145691
66 Ga0070660_100038962 3300005339 Bacteria 3611
67 Ga0070660_100134992 3300005339 Bacteria 1977
68 Ga0070660_100169117 3300005339 Bacteria 1765
69 Ga0070660_100201659 3300005339 Bacteria 1614
70 Ga0070660_100408691 3300005339 Bacteria 1123
71 Ga0070660_100437917 3300005339 Bacteria 1083
72 Ga0070660_100511907 3300005339 Bacteria 999
73 Ga0070660_100994618 3300005339 Bacteria 709
74 Ga0070687_100095557 3300005343 Bacteria 1653
75 Ga0070661_100001564 3300005344 Bacteria 15911
76 Ga0070661_100014885 3300005344 Bacteria 5488
77 Ga0070661_100022387 3300005344 Bacteria 4524
78 Ga0070661_100022856 3300005344 Bacteria 4477
79 Ga0070661_100073470 3300005344 Unclassified 2518
80 Ga0070661_100074276 3300005344 Bacteria 2504
81 Ga0070661_100098170 3300005344 Bacteria 2175
82 Ga0070661_100103459 3300005344 Bacteria 2121
83 Ga0070661_100246344 3300005344 Bacteria 1378
84 Ga0070668_100258717 3300005347 Bacteria 1447
85 Ga0070668_100873325 3300005347 Unclassified 803
86 Ga0070669_100111286 3300005353 Bacteria 2078
87 Ga0070669_100318032 3300005353 Unclassified 1256
88 Ga0070669_100534663 3300005353 Bacteria 976
89 Ga0070669_101041002 3300005353 Unclassified 703
90 Ga0070669_101743996 3300005353 Bacteria 543
91 Ga0070675_100000913 3300005354 Bacteria 20987
92 Ga0070675_100051464 3300005354 Bacteria 3385
93 Ga0070675_100101317 3300005354 Bacteria 2426
94 Ga0070675_100117114 3300005354 Bacteria 2260
95 Ga0070675_100135199 3300005354 Bacteria 2104
96 Ga0070675_100450985 3300005354 Bacteria 1154
97 Ga0070671_100000784 3300005355 Bacteria 22894
98 Ga0070671_100001033 3300005355 Bacteria 20484
99 Ga0070671_100005525 3300005355 Bacteria 10069
100 Ga0070671_100069911 3300005355 Bacteria 2928
101 Ga0070671_100089952 3300005355 Bacteria 2570
102 Ga0070671_100103018 3300005355 Bacteria 2395
103 Ga0070671_100113824 3300005355 Bacteria 2273
104 Ga0070671_100124230 3300005355 Bacteria 2172
105 Ga0070671_100470394 3300005355 Bacteria 1079
106 Ga0070671_100544282 3300005355 Bacteria 1001
107 Ga0070674_100045690 3300005356 Bacteria 2992
108 Ga0070674_100079772 3300005356 Bacteria 2336
109 Ga0070674_100118178 3300005356 Bacteria 1959
110 Ga0070674_100137475 3300005356 Bacteria 1830
111 Ga0070674_100145654 3300005356 Bacteria 1783
112 Ga0070674_100271906 3300005356 Bacteria 1339
113 Ga0070673_100003767 3300005364 Bacteria 9509
114 Ga0070673_100022395 3300005364 Bacteria 4598
115 Ga0070673_100022477 3300005364 Bacteria 4591
116 Ga0070673_100035527 3300005364 Bacteria 3780
117 Ga0070673_100049622 3300005364 Bacteria 3277
118 Ga0070673_100264176 3300005364 Bacteria 1504
119 Ga0070673_100345348 3300005364 Bacteria 1320
120 Ga0070673_100556713 3300005364 Unclassified 1042
121 Ga0070673_100748287 3300005364 Bacteria 900
122 Ga0070659_100001389 3300005366 Bacteria 17465
123 Ga0070659_100006367 3300005366 Bacteria 8526
124 Ga0070659_100019299 3300005366 Bacteria 5163
125 Ga0070659_100026012 3300005366 Bacteria 4501
126 Ga0070659_100130922 3300005366 Bacteria 2037
127 Ga0070659_100361580 3300005366 Bacteria 1219
128 Ga0070659_100482416 3300005366 Bacteria 1055
129 Ga0070659_100576079 3300005366 Bacteria 965
130 Ga0070659_100581633 3300005366 Unclassified 961
131 Ga0070667_100000915 3300005367 Bacteria 27247
132 Ga0070667_100027177 3300005367 Bacteria 4761
133 Ga0070667_100030757 3300005367 Bacteria 4477
134 Ga0070667_100061978 3300005367 Bacteria 3167
135 Ga0070667_100467413 3300005367 Unclassified 1154
136 Ga0070709_10111843 3300005434 Bacteria 1837
137 Ga0070714_100063184 3300005435 Bacteria 3183
138 Ga0070714_100136216 3300005435 Bacteria 2199
139 Ga0070713_100210795 3300005436 Bacteria 1759
140 Ga0070713_100530906 3300005436 Bacteria 1113
141 Ga0070663_100016637 3300005455 Bacteria 4783
142 Ga0070663_100051620 3300005455 Bacteria 2931
143 Ga0070663_100132287 3300005455 Bacteria 1896
144 Ga0070663_100184101 3300005455 Bacteria 1622
145 Ga0070663_100200408 3300005455 Bacteria 1557
146 Ga0070663_100385417 3300005455 Bacteria 1142
147 Ga0070663_100443872 3300005455 Bacteria 1068
148 Ga0070663_101177941 3300005455 Bacteria 672
149 Ga0070678_100000775 3300005456 Bacteria 16026
150 Ga0070678_100032098 3300005456 Bacteria 3631
151 Ga0070678_100041260 3300005456 Bacteria 3270
152 Ga0070678_100339411 3300005456 Bacteria 1288
153 Ga0070662_100002539 3300005457 Bacteria 11250
154 Ga0070662_100005907 3300005457 Bacteria 7853
155 Ga0070662_100008010 3300005457 Bacteria 6876
156 Ga0070662_100009832 3300005457 Bacteria 6267
157 Ga0070662_100015832 3300005457 Bacteria 5058
158 Ga0070662_100069884 3300005457 Bacteria 2586
159 Ga0070662_100090421 3300005457 Bacteria 2298
160 Ga0070662_100104107 3300005457 Bacteria 2153
161 Ga0070662_100120994 3300005457 Bacteria 2006
162 Ga0070662_100183684 3300005457 Bacteria 1650
163 Ga0070662_100294393 3300005457 Bacteria 1317
164 Ga0070662_100788003 3300005457 Bacteria 808
165 Ga0070662_100833198 3300005457 Bacteria 785
166 Ga0070662_101009558 3300005457 Bacteria 712
167 Ga0070681_10569961 3300005458 Unclassified 1046
168 Ga0070681_10612982 3300005458 Unclassified 1003
169 Ga0070681_11230017 3300005458 Bacteria 671
170 Ga0068867_100026024 3300005459 Bacteria 4197
171 Ga0068867_100127523 3300005459 Bacteria 1973
172 Ga0068867_100437726 3300005459 Unclassified 1111
173 Ga0070685_10894126 3300005466 Bacteria 660
174 Ga0070679_100466080 3300005530 Bacteria 1208
175 Ga0070679_100611730 3300005530 Unclassified 1033
176 Ga0070679_100656370 3300005530 Bacteria 992
177 Ga0070679_100777991 3300005530 Unclassified 900
178 Ga0070684_100029760 3300005535 Bacteria 4632
179 Ga0068853_100007625 3300005539 Bacteria 8670
180 Ga0068853_100072672 3300005539 Bacteria 2998
181 Ga0068853_100107157 3300005539 Bacteria 2478
182 Ga0068853_100224754 3300005539 Bacteria 1716
183 Ga0068853_100401677 3300005539 Bacteria 1283
184 Ga0068853_100472853 3300005539 Unclassified 1181
185 Ga0070672_100007391 3300005543 Bacteria 7449
186 Ga0070672_100028901 3300005543 Bacteria 4151
187 Ga0070672_100034180 3300005543 Bacteria 3857
188 Ga0070672_100073823 3300005543 Bacteria 2719
189 Ga0070672_100073924 3300005543 Bacteria 2718
190 Ga0070672_100080781 3300005543 Bacteria 2605
191 Ga0070672_100143927 3300005543 Bacteria 1969
192 Ga0070672_100161423 3300005543 Bacteria 1860
193 Ga0070672_100163580 3300005543 Bacteria 1848
194 Ga0070672_100547703 3300005543 Unclassified 1004
195 Ga0070672_100760698 3300005543 Bacteria 851
196 Ga0070686_100010300 3300005544 Bacteria 5267
197 Ga0070686_100200541 3300005544 Bacteria 1430
198 Ga0070686_101098602 3300005544 Unclassified 657
199 Ga0070693_100001083 3300005547 Bacteria 12194
200 Ga0070665_100035090 3300005548 Bacteria 5044
201 Ga0070665_100067794 3300005548 Bacteria 3578
202 Ga0070665_100121257 3300005548 Bacteria 2616
203 Ga0070665_100127103 3300005548 Bacteria 2551
204 Ga0070665_100565415 3300005548 Bacteria 1150
205 Ga0070665_100650953 3300005548 Bacteria 1067
206 Ga0070665_100721725 3300005548 Bacteria 1010
207 Ga0070665_101296302 3300005548 Bacteria 738
208 Ga0068855_100001099 3300005563 Bacteria 33610
209 Ga0068855_100273309 3300005563 Bacteria 1879
210 Ga0068855_101436334 3300005563 Bacteria 710
211 Ga0068855_101625872 3300005563 Unclassified 660
212 Ga0070664_100000103 3300005564 Bacteria 54853
213 Ga0070664_100006945 3300005564 Bacteria 9122
214 Ga0070664_100008493 3300005564 Bacteria 8304
215 Ga0070664_100011272 3300005564 Bacteria 7251
216 Ga0070664_100033104 3300005564 Bacteria 4326
217 Ga0070664_100042247 3300005564 Bacteria 3849
218 Ga0070664_100127289 3300005564 Bacteria 2235
219 Ga0070664_100327376 3300005564 Bacteria 1389
220 Ga0070664_100390743 3300005564 Bacteria 1271
221 Ga0070664_101618353 3300005564 Bacteria 613
222 Ga0070664_102177396 3300005564 Bacteria 526
223 Ga0068857_100322567 3300005577 Unclassified 1427
224 Ga0068857_100612471 3300005577 Bacteria 1030
225 Ga0068854_100054218 3300005578 Bacteria 2883
226 Ga0068854_100060832 3300005578 Bacteria 2734
227 Ga0068854_100066869 3300005578 Bacteria 2617
228 Ga0068854_100131248 3300005578 Bacteria 1913
229 Ga0068854_100777665 3300005578 Bacteria 833
230 Ga0068854_101451338 3300005578 Bacteria 622
231 Ga0068856_100000628 3300005614 Bacteria 38462
232 Ga0068856_100042565 3300005614 Bacteria 4468
233 Ga0068856_100816567 3300005614 Bacteria 952
234 Ga0070702_100204394 3300005615 Bacteria 1310
235 Ga0070702_100394487 3300005615 Bacteria 988
236 Ga0068852_100015079 3300005616 Bacteria 5979
237 Ga0068852_100058248 3300005616 Bacteria 3345
238 Ga0068852_100143994 3300005616 Bacteria 2209
239 Ga0068852_100177688 3300005616 Bacteria 2000
240 Ga0068852_100225682 3300005616 Bacteria 1783
241 Ga0068852_100935161 3300005616 Unclassified 885
242 Ga0068852_101507230 3300005616 Bacteria 695
243 Ga0068852_101691743 3300005616 Bacteria 655
244 Ga0068859_100036677 3300005617 Bacteria 4922
245 Ga0068859_100263305 3300005617 Bacteria 1816
246 Ga0068859_100287754 3300005617 Bacteria 1736
247 Ga0068859_100402051 3300005617 Bacteria 1466
248 Ga0068864_100000982 3300005618 Bacteria 23872
249 Ga0068864_100013401 3300005618 Bacteria 6794
250 Ga0068864_100021722 3300005618 Bacteria 5376
251 Ga0068864_100023474 3300005618 Bacteria 5180
252 Ga0068864_100027035 3300005618 Bacteria 4840
253 Ga0068864_100206237 3300005618 Bacteria 1808
254 Ga0068864_100305196 3300005618 Unclassified 1491
255 Ga0068864_100513102 3300005618 Unclassified 1155
256 Ga0068864_100533098 3300005618 Bacteria 1133
257 Ga0068864_100675550 3300005618 Bacteria 1007
258 Ga0068866_10009417 3300005718 Bacteria 4147
259 Ga0068866_10020297 3300005718 Bacteria 3043
260 Ga0068866_10068913 3300005718 Bacteria 1862
261 Ga0068866_10075656 3300005718 Bacteria 1793
262 Ga0068861_100126061 3300005719 Bacteria 2071
263 Ga0068861_100518874 3300005719 Bacteria 1080
264 Ga0068861_101021403 3300005719 Unclassified 790
265 Ga0068851_10001784 3300005834 Bacteria 9415
266 Ga0068851_10017472 3300005834 Bacteria 3446
267 Ga0068851_10044505 3300005834 Bacteria 2241
268 Ga0068851_10086284 3300005834 Bacteria 1646
269 Ga0068851_10416274 3300005834 Bacteria 793
270 Ga0068870_10514120 3300005840 Unclassified 800
271 Ga0068870_10548519 3300005840 Bacteria 778
272 Ga0068863_100023172 3300005841 Bacteria 5933
273 Ga0068863_100043208 3300005841 Bacteria 4279
274 Ga0068863_100062068 3300005841 Bacteria 3534
275 Ga0068863_100110949 3300005841 Bacteria 2612
276 Ga0068858_100009318 3300005842 Bacteria 9374
277 Ga0068858_100033683 3300005842 Bacteria 4751
278 Ga0068858_100185914 3300005842 Bacteria 1962
279 Ga0068858_100198779 3300005842 Bacteria 1895
280 Ga0068860_100117181 3300005843 Bacteria 2548
281 Ga0068860_100122827 3300005843 Bacteria 2488
282 Ga0068860_100628059 3300005843 Bacteria 1081
283 Ga0070717_10222704 3300006028 Bacteria 1659
284 Ga0075364_10221214 3300006051 Bacteria 1285
285 Ga0070712_100041924 3300006175 Bacteria 3145
286 Ga0097621_100024505 3300006237 Bacteria 4713
287 Ga0097621_100049726 3300006237 Bacteria 3407
288 Ga0097621_100147655 3300006237 Bacteria 2015
289 Ga0097621_100365636 3300006237 Bacteria 1286
290 Ga0068871_100034183 3300006358 Bacteria 4032
291 Ga0068871_100075941 3300006358 Bacteria 2774
292 Ga0068871_100084375 3300006358 Bacteria 2636
293 Ga0068871_100126959 3300006358 Bacteria 2160
294 Ga0068871_100186051 3300006358 Bacteria 1787
295 Ga0068871_100582499 3300006358 Bacteria 1016
296 Ga0068865_100011026 3300006881 Bacteria 5642
297 Ga0068865_100274501 3300006881 Bacteria 1340
298 Ga0097620_100036677 3300006931 Bacteria 4922
299 Ga0097620_100263309 3300006931 Bacteria 1816
300 Ga0097620_100287765 3300006931 Bacteria 1736
301 Ga0097620_100402010 3300006931 Bacteria 1466
302 Ga0105240_10234951 3300009093 Bacteria 2128
303 Ga0105240_10252554 3300009093 Bacteria 2038
304 Ga0105245_10021117 3300009098 Bacteria 5710
305 Ga0105245_10033176 3300009098 Bacteria 4575
306 Ga0105243_10055632 3300009148 Bacteria 3144
307 Ga0105241_10173796 3300009174 Bacteria 1781
308 Ga0105241_10852419 3300009174 Unclassified 843
309 Ga0105241_11526128 3300009174 Bacteria 644
310 Ga0105242_10049979 3300009176 Bacteria 3403
311 Ga0105242_10193647 3300009176 Bacteria 1802
312 Ga0105242_10480910 3300009176 Bacteria 1177
313 Ga0105248_10000673 3300009177 Bacteria 38736
314 Ga0105248_10000724 3300009177 Bacteria 37195
315 Ga0105248_10002105 3300009177 Bacteria 22055
316 Ga0105248_10014771 3300009177 Bacteria 8598
317 Ga0105248_10070039 3300009177 Bacteria 3939
318 Ga0105248_10145240 3300009177 Bacteria 2677
319 Ga0105248_11343271 3300009177 Bacteria 809
320 Ga0105248_12534153 3300009177 Unclassified 585
321 Ga0105237_10173424 3300009545 Bacteria 2157
322 Ga0105238_10072831 3300009551 Bacteria 3430
323 Ga0105238_10166595 3300009551 Bacteria 2179
324 Ga0105238_10451747 3300009551 Bacteria 1282
325 Ga0105238_10608585 3300009551 Unclassified 1101
326 Ga0105239_10754913 3300010375 Unclassified 1113
327 Ga0105239_10807366 3300010375 Unclassified 1075
328 Ga0105246_10075364 3300011119 Bacteria 2388
329 Ga0105246_10119099 3300011119 Bacteria 1953
330 Ga0157373_10016140 3300013100 Bacteria 5451
331 Ga0157373_10090457 3300013100 Bacteria 2155
332 Ga0157373_10092960 3300013100 Bacteria 2124
333 Ga0157373_10141560 3300013100 Bacteria 1692
334 Ga0157373_11333749 3300013100 Unclassified 544
335 Ga0157371_10002159 3300013102 Bacteria 19149
336 Ga0157371_10012009 3300013102 Bacteria 6640
337 Ga0157371_10022609 3300013102 Bacteria 4603
338 Ga0157371_10087053 3300013102 Bacteria 2212
339 Ga0157371_10169076 3300013102 Bacteria 1562
340 Ga0157371_11584157 3300013102 Bacteria 512
341 Ga0157370_10408617 3300013104 Bacteria 1249
342 Ga0157370_10619753 3300013104 Unclassified 990
343 Ga0157370_10631975 3300013104 Unclassified 979
344 Ga0157370_10876372 3300013104 Bacteria 815
345 Ga0157369_10043789 3300013105 Bacteria 4877
346 Ga0157369_10629395 3300013105 Unclassified 1107
347 Ga0157369_11086590 3300013105 Unclassified 818
348 Ga0157369_12064944 3300013105 Bacteria 578
349 Ga0157374_10000882 3300013296 Bacteria 26194
350 Ga0157374_10033137 3300013296 Bacteria 4711
351 Ga0157374_10073176 3300013296 Bacteria 3235
352 Ga0157374_10280377 3300013296 Unclassified 1645
353 Ga0157374_11745388 3300013296 Bacteria 647
354 Ga0157374_12459993 3300013296 Bacteria 548
355 Ga0157378_10107911 3300013297 Bacteria 2548
356 Ga0157378_10156187 3300013297 Bacteria 2130
357 Ga0163162_10002440 3300013306 Bacteria 17525
358 Ga0163162_10024974 3300013306 Bacteria 5903
359 Ga0163162_10026987 3300013306 Bacteria 5678
360 Ga0163162_10073566 3300013306 Bacteria 3473
361 Ga0163162_10493941 3300013306 Bacteria 1355
362 Ga0163162_10763107 3300013306 Bacteria 1086
363 Ga0157372_10134336 3300013307 Bacteria 2848
364 Ga0157372_10485941 3300013307 Bacteria 1440
365 Ga0157372_10660052 3300013307 Bacteria 1218
366 Ga0157372_12828863 3300013307 Bacteria 556
367 Ga0157375_10002611 3300013308 Bacteria 15620
368 Ga0157375_10116887 3300013308 Bacteria 2772
369 Ga0157375_10132936 3300013308 Bacteria 2609
370 Ga0157375_10161166 3300013308 Bacteria 2385
371 Ga0157375_10198953 3300013308 Bacteria 2159
372 Ga0157375_10792220 3300013308 Bacteria 1097
373 Ga0157375_11100643 3300013308 Bacteria 930
374 Ga0163163_10004607 3300014325 Bacteria 11773
375 Ga0163163_10041443 3300014325 Bacteria 4502
376 Ga0163163_10137433 3300014325 Bacteria 2485
377 Ga0163163_10146877 3300014325 Bacteria 2402
378 Ga0163163_11549356 3300014325 Bacteria 724
379 Ga0157380_11449458 3300014326 Unclassified 738
380 Ga0157380_11862643 3300014326 Unclassified 662
381 Ga0182008_10116022 3300014497 Bacteria 1328
382 Ga0157377_10413947 3300014745 Bacteria 921
383 Ga0157379_10040579 3300014968 Bacteria 4155
384 Ga0157379_10230149 3300014968 Bacteria 1680
385 Ga0157379_10242372 3300014968 Bacteria 1635
386 Ga0157376_10006910 3300014969 Bacteria 8041
387 Ga0157376_10181840 3300014969 Bacteria 1923
388 Ga0163161_10024348 3300017792 Bacteria 4276
389 Ga0163161_10046050 3300017792 Bacteria 3147
390 Ga0163161_10621887 3300017792 Bacteria 892
391 Ga0213876_10021022 3300021384 Bacteria 3451
392 Ga0213875_10006414 3300021388 Bacteria 6180
393 Ga0207697_10021874 3300025315 Bacteria 2620
394 Ga0207697_10024490 3300025315 Bacteria 2471
395 Ga0207697_10164760 3300025315 Bacteria 968
396 Ga0207697_10231137 3300025315 Bacteria 817
397 Ga0207656_10014429 3300025321 Bacteria 3044
398 Ga0207656_10046907 3300025321 Bacteria 1855
399 Ga0207656_10072170 3300025321 Bacteria 1536
400 Ga0207656_10158221 3300025321 Bacteria 1077
401 Ga0207682_10013128 3300025893 Bacteria 3229
402 Ga0207682_10172691 3300025893 Bacteria 984
403 Ga0207642_10008789 3300025899 Bacteria 3486
404 Ga0207642_10016286 3300025899 Bacteria 2796
405 Ga0207642_10067123 3300025899 Bacteria 1692
406 Ga0207642_10211599 3300025899 Bacteria 1078
407 Ga0207688_10104529 3300025901 Bacteria 1638
408 Ga0207688_10137748 3300025901 Bacteria 1435
409 Ga0207680_10004726 3300025903 Bacteria 6479
410 Ga0207680_10006248 3300025903 Bacteria 5749
411 Ga0207680_10014792 3300025903 Bacteria 4052
412 Ga0207680_10029108 3300025903 Bacteria 3099
413 Ga0207680_10040837 3300025903 Bacteria 2703
414 Ga0207680_10327008 3300025903 Bacteria 1073
415 Ga0207680_10327813 3300025903 Bacteria 1072
416 Ga0207680_10392440 3300025903 Bacteria 980
417 Ga0207647_10026290 3300025904 Bacteria 3810
418 Ga0207647_10043572 3300025904 Bacteria 2808
419 Ga0207647_10048937 3300025904 Bacteria 2623
420 Ga0207647_10066872 3300025904 Bacteria 2179
421 Ga0207647_10087582 3300025904 Bacteria 1860
422 Ga0207647_10563354 3300025904 Bacteria 631
423 Ga0207645_10134262 3300025907 Bacteria 1611
424 Ga0207645_10170030 3300025907 Bacteria 1428
425 Ga0207643_10586908 3300025908 Bacteria 717
426 Ga0207705_10000113 3300025909 Bacteria 90567
427 Ga0207705_10022419 3300025909 Bacteria 4502
428 Ga0207705_10025235 3300025909 Bacteria 4243
429 Ga0207705_10028813 3300025909 Bacteria 3957
430 Ga0207705_10044812 3300025909 Bacteria 3179
431 Ga0207705_10072157 3300025909 Bacteria 2504
432 Ga0207705_10205885 3300025909 Bacteria 1491
433 Ga0207705_10217047 3300025909 Bacteria 1452
434 Ga0207705_10280308 3300025909 Bacteria 1276
435 Ga0207654_10114587 3300025911 Bacteria 1682
436 Ga0207695_10191172 3300025913 Bacteria 1964
437 Ga0207695_10374635 3300025913 Bacteria 1310
438 Ga0207671_10414191 3300025914 Unclassified 1072
439 Ga0207693_10014652 3300025915 Bacteria 6300
440 Ga0207662_10016144 3300025918 Bacteria 4211
441 Ga0207662_11326284 3300025918 Unclassified 511
442 Ga0207657_10000328 3300025919 Bacteria 50486
443 Ga0207657_10012677 3300025919 Bacteria 8308
444 Ga0207657_10018921 3300025919 Bacteria 6556
445 Ga0207657_10022698 3300025919 Bacteria 5863
446 Ga0207657_10106512 3300025919 Bacteria 2320
447 Ga0207657_10117721 3300025919 Bacteria 2188
448 Ga0207657_10143045 3300025919 Bacteria 1953
449 Ga0207657_10246524 3300025919 Bacteria 1425
450 Ga0207657_10389514 3300025919 Bacteria 1097
451 Ga0207657_10896520 3300025919 Unclassified 683
452 Ga0207649_10000228 3300025920 Bacteria 45916
453 Ga0207649_10030809 3300025920 Bacteria 3181
454 Ga0207649_10051534 3300025920 Bacteria 2549
455 Ga0207649_10095091 3300025920 Bacteria 1960
456 Ga0207649_10163325 3300025920 Bacteria 1545
457 Ga0207649_10193208 3300025920 Bacteria 1433
458 Ga0207649_10215644 3300025920 Bacteria 1364
459 Ga0207649_10275246 3300025920 Bacteria 1222
460 Ga0207652_10503467 3300025921 Unclassified 1090
461 Ga0207652_10535378 3300025921 Bacteria 1053
462 Ga0207652_10865328 3300025921 Bacteria 800
463 Ga0207652_10971809 3300025921 Bacteria 747
464 Ga0207681_10096292 3300025923 Bacteria 2125
465 Ga0207681_10285687 3300025923 Unclassified 1301
466 Ga0207681_10465807 3300025923 Bacteria 1030
467 Ga0207681_10652904 3300025923 Unclassified 872
468 Ga0207681_10675964 3300025923 Bacteria 857
469 Ga0207694_10064456 3300025924 Bacteria 2856
470 Ga0207694_10318776 3300025924 Bacteria 1283
471 Ga0207694_10472494 3300025924 Unclassified 1048
472 Ga0207650_10016267 3300025925 Bacteria 5196
473 Ga0207650_10031702 3300025925 Bacteria 3818
474 Ga0207650_10038759 3300025925 Bacteria 3482
475 Ga0207650_10065821 3300025925 Bacteria 2717
476 Ga0207650_10341840 3300025925 Bacteria 1229
477 Ga0207650_10368537 3300025925 Bacteria 1184
478 Ga0207650_10508840 3300025925 Bacteria 1007
479 Ga0207650_10970464 3300025925 Bacteria 722
480 Ga0207659_10063329 3300025926 Bacteria 2673
481 Ga0207659_10080609 3300025926 Bacteria 2405
482 Ga0207659_10106840 3300025926 Bacteria 2120
483 Ga0207659_10588074 3300025926 Bacteria 948
484 Ga0207687_10034393 3300025927 Bacteria 3441
485 Ga0207687_10195619 3300025927 Bacteria 1577
486 Ga0207700_10808208 3300025928 Bacteria 839
487 Ga0207664_10356967 3300025929 Bacteria 1294
488 Ga0207644_10000181 3300025931 Bacteria 45051
489 Ga0207644_10001877 3300025931 Bacteria 13683
490 Ga0207644_10018566 3300025931 Bacteria 4707
491 Ga0207644_10049770 3300025931 Bacteria 3001
492 Ga0207644_10072793 3300025931 Bacteria 2518
493 Ga0207644_10088987 3300025931 Bacteria 2297
494 Ga0207644_10089398 3300025931 Bacteria 2292
495 Ga0207644_10227120 3300025931 Bacteria 1482
496 Ga0207644_10297286 3300025931 Bacteria 1300
497 Ga0207690_10000036 3300025932 Bacteria 143853
498 Ga0207690_10023844 3300025932 Bacteria 3825
499 Ga0207690_10042632 3300025932 Bacteria 2982
500 Ga0207690_10046139 3300025932 Bacteria 2884
501 Ga0207690_10100436 3300025932 Bacteria 2065
502 Ga0207690_10265632 3300025932 Bacteria 1331
503 Ga0207690_10472945 3300025932 Unclassified 1010
504 Ga0207706_10000343 3300025933 Bacteria 50497
505 Ga0207706_10006757 3300025933 Bacteria 10606
506 Ga0207706_10006809 3300025933 Bacteria 10568
507 Ga0207706_10008945 3300025933 Bacteria 9219
508 Ga0207706_10015817 3300025933 Bacteria 6821
509 Ga0207706_10021335 3300025933 Bacteria 5819
510 Ga0207706_10035527 3300025933 Bacteria 4430
511 Ga0207706_10045365 3300025933 Bacteria 3895
512 Ga0207706_10103783 3300025933 Bacteria 2501
513 Ga0207706_10185969 3300025933 Bacteria 1824
514 Ga0207706_10357078 3300025933 Unclassified 1270
515 Ga0207706_10618553 3300025933 Bacteria 929
516 Ga0207686_10052847 3300025934 Bacteria 2537
517 Ga0207686_10339310 3300025934 Bacteria 1128
518 Ga0207686_11458539 3300025934 Unclassified 564
519 Ga0207709_10166679 3300025935 Bacteria 1542
520 Ga0207709_10211090 3300025935 Bacteria 1393
521 Ga0207669_10052152 3300025937 Bacteria 2455
522 Ga0207669_10185729 3300025937 Bacteria 1495
523 Ga0207669_10340766 3300025937 Unclassified 1154
524 Ga0207669_10757133 3300025937 Unclassified 802
525 Ga0207669_10794325 3300025937 Bacteria 784
526 Ga0207704_10030292 3300025938 Bacteria 3032
527 Ga0207691_10011944 3300025940 Bacteria 8332
528 Ga0207691_10022187 3300025940 Bacteria 5988
529 Ga0207691_10026376 3300025940 Bacteria 5452
530 Ga0207691_10036392 3300025940 Bacteria 4560
531 Ga0207691_10043488 3300025940 Bacteria 4140
532 Ga0207691_10125061 3300025940 Bacteria 2276
533 Ga0207691_10170254 3300025940 Bacteria 1907
534 Ga0207691_10201930 3300025940 Bacteria 1730
535 Ga0207691_10204770 3300025940 Bacteria 1716
536 Ga0207691_10595482 3300025940 Bacteria 936
537 Ga0207711_10003972 3300025941 Bacteria 12722
538 Ga0207711_10015244 3300025941 Bacteria 6380
539 Ga0207711_10015793 3300025941 Bacteria 6264
540 Ga0207711_10046278 3300025941 Bacteria 3717
541 Ga0207711_10051335 3300025941 Bacteria 3531
542 Ga0207711_10117573 3300025941 Bacteria 2371
543 Ga0207711_10588963 3300025941 Bacteria 1038
544 Ga0207689_10031981 3300025942 Bacteria 4376
545 Ga0207661_10011054 3300025944 Bacteria 6525
546 Ga0207661_10254856 3300025944 Bacteria 1561
547 Ga0207661_11548672 3300025944 Bacteria 607
548 Ga0207679_10000093 3300025945 Bacteria 78331
549 Ga0207679_10001758 3300025945 Bacteria 13501
550 Ga0207679_10007795 3300025945 Bacteria 6805
551 Ga0207679_10014634 3300025945 Bacteria 5162
552 Ga0207679_10054269 3300025945 Bacteria 2949
553 Ga0207679_10069614 3300025945 Bacteria 2648
554 Ga0207679_10234046 3300025945 Bacteria 1553
555 Ga0207679_10366230 3300025945 Bacteria 1260
556 Ga0207679_11008438 3300025945 Bacteria 763
557 Ga0207679_11361267 3300025945 Unclassified 651
558 Ga0207679_11431991 3300025945 Unclassified 634
559 Ga0207667_10002944 3300025949 Bacteria 21130
560 Ga0207667_10058823 3300025949 Bacteria 4029
561 Ga0207667_10273263 3300025949 Bacteria 1727
562 Ga0207667_10739260 3300025949 Bacteria 984
563 Ga0207651_10003789 3300025960 Bacteria 7486
564 Ga0207651_10006757 3300025960 Bacteria 6044
565 Ga0207651_10008254 3300025960 Bacteria 5613
566 Ga0207651_10026202 3300025960 Bacteria 3637
567 Ga0207651_10088284 3300025960 Bacteria 2260
568 Ga0207651_10151837 3300025960 Bacteria 1804
569 Ga0207651_10189669 3300025960 Bacteria 1638
570 Ga0207651_10514587 3300025960 Unclassified 1036
571 Ga0207668_10664451 3300025972 Bacteria 913
572 Ga0207640_10056467 3300025981 Bacteria 2577
573 Ga0207640_10059021 3300025981 Bacteria 2530
574 Ga0207640_10083864 3300025981 Bacteria 2186
575 Ga0207640_10320251 3300025981 Unclassified 1234
576 Ga0207640_10759536 3300025981 Bacteria 837
577 Ga0207658_10000936 3300025986 Bacteria 24076
578 Ga0207658_10013597 3300025986 Bacteria 5566
579 Ga0207658_10016927 3300025986 Bacteria 5018
580 Ga0207658_10090420 3300025986 Bacteria 2372
581 Ga0207658_10331945 3300025986 Bacteria 1319
582 Ga0207658_10587094 3300025986 Unclassified 1000
583 Ga0207677_10003694 3300026023 Bacteria 8118
584 Ga0207677_10020322 3300026023 Bacteria 4029
585 Ga0207677_10103499 3300026023 Bacteria 2102
586 Ga0207677_10645846 3300026023 Bacteria 933
587 Ga0207677_10759254 3300026023 Bacteria 865
588 Ga0207703_10005275 3300026035 Bacteria 10418
589 Ga0207703_10012855 3300026035 Bacteria 6529
590 Ga0207703_10020733 3300026035 Bacteria 5143
591 Ga0207703_10117459 3300026035 Bacteria 2279
592 Ga0207703_10414604 3300026035 Unclassified 1252
593 Ga0207639_10002879 3300026041 Bacteria 11560
594 Ga0207639_10589346 3300026041 Unclassified 1024
595 Ga0207639_10620216 3300026041 Bacteria 999
596 Ga0207639_10987187 3300026041 Bacteria 788
597 Ga0207678_10006618 3300026067 Bacteria 10273
598 Ga0207678_10009022 3300026067 Bacteria 8779
599 Ga0207678_10012776 3300026067 Bacteria 7372
600 Ga0207678_10065064 3300026067 Bacteria 3132
601 Ga0207678_10074005 3300026067 Bacteria 2919
602 Ga0207678_10096806 3300026067 Unclassified 2522
603 Ga0207678_10115281 3300026067 Bacteria 2292
604 Ga0207678_10266347 3300026067 Bacteria 1469
605 Ga0207708_11446752 3300026075 Unclassified 603
606 Ga0207702_10000619 3300026078 Bacteria 39068
607 Ga0207702_10243503 3300026078 Bacteria 1686
608 Ga0207702_10286322 3300026078 Bacteria 1560
609 Ga0207702_10361761 3300026078 Bacteria 1391
610 Ga0207702_10554585 3300026078 Bacteria 1124
611 Ga0207702_11401230 3300026078 Bacteria 693
612 Ga0207641_10011857 3300026088 Bacteria 7154
613 Ga0207641_10023515 3300026088 Bacteria 5075
614 Ga0207641_10123333 3300026088 Bacteria 2315
615 Ga0207641_10145579 3300026088 Bacteria 2142
616 Ga0207648_10002532 3300026089 Bacteria 19611
617 Ga0207648_10011721 3300026089 Bacteria 8244
618 Ga0207648_10186172 3300026089 Bacteria 1839
619 Ga0207676_10003014 3300026095 Bacteria 12011
620 Ga0207676_10006459 3300026095 Bacteria 8281
621 Ga0207676_10032425 3300026095 Bacteria 3936
622 Ga0207676_10076654 3300026095 Bacteria 2702
623 Ga0207676_10172054 3300026095 Bacteria 1888
624 Ga0207676_10535596 3300026095 Bacteria 1117
625 Ga0207676_10644856 3300026095 Bacteria 1021
626 Ga0207676_10874228 3300026095 Bacteria 880
627 Ga0207674_10000132 3300026116 Bacteria 87692
628 Ga0207674_10244444 3300026116 Bacteria 1742
629 Ga0207674_10472744 3300026116 Bacteria 1212
630 Ga0207674_11281950 3300026116 Unclassified 702
631 Ga0207683_10007992 3300026121 Bacteria 9046
632 Ga0207683_10011570 3300026121 Bacteria 7533
633 Ga0207683_10057305 3300026121 Bacteria 3420
634 Ga0207683_10072639 3300026121 Bacteria 3043
635 Ga0207683_10138551 3300026121 Bacteria 2191
636 Ga0207698_10010281 3300026142 Bacteria 6001
637 Ga0207698_10095891 3300026142 Bacteria 2443
638 Ga0207698_10115760 3300026142 Bacteria 2258
639 Ga0207698_10130782 3300026142 Bacteria 2144
640 Ga0207698_10299581 3300026142 Bacteria 1496
641 Ga0207698_11566110 3300026142 Bacteria 674
642 Ga0207698_11793683 3300026142 Bacteria 629
643 Ga0268266_10017931 3300028379 Bacteria 6035
644 Ga0268266_10030004 3300028379 Bacteria 4621
645 Ga0268266_10157673 3300028379 Bacteria 2051
646 Ga0268266_10268011 3300028379 Bacteria 1584
647 Ga0268266_10379532 3300028379 Bacteria 1333
648 Ga0268266_10573797 3300028379 Bacteria 1082
649 Ga0268264_10098032 3300028381 Bacteria 2541
650 Ga0268264_10197775 3300028381 Bacteria 1837
651 Ga0268264_10654756 3300028381 Bacteria 1040
652 Ga0307408_100075623 3300031548 Bacteria 2503
653 Ga0307408_100248924 3300031548 Bacteria 1465
654 Ga0307405_10007143 3300031731 Bacteria 5554
655 Ga0307405_10135857 3300031731 Bacteria 1707
656 Ga0307413_10045791 3300031824 Bacteria 2596
657 Ga0307413_10603139 3300031824 Bacteria 899
658 Ga0307413_10635945 3300031824 Bacteria 878
659 Ga0307413_11632556 3300031824 Unclassified 573
660 Ga0307410_10011217 3300031852 Bacteria 5115
661 Ga0307410_10012882 3300031852 Bacteria 4855
662 Ga0307410_10177118 3300031852 Bacteria 1611
663 Ga0307410_10211986 3300031852 Unclassified 1485
664 Ga0307410_10939133 3300031852 Bacteria 743
665 Ga0307410_11005237 3300031852 Bacteria 719
666 Ga0307406_10322822 3300031901 Bacteria 1195
667 Ga0307407_10121166 3300031903 Unclassified 1658
668 Ga0307407_10520740 3300031903 Bacteria 875
669 Ga0307407_10667041 3300031903 Unclassified 780
670 Ga0307407_11310819 3300031903 Bacteria 568
671 Ga0307412_10954048 3300031911 Bacteria 755
672 Ga0307409_100004656 3300031995 Bacteria 7752
673 Ga0307409_100033957 3300031995 Bacteria 3720
674 Ga0307409_100171667 3300031995 Bacteria 1909
675 Ga0307409_100626221 3300031995 Bacteria 1067
676 Ga0307409_101575009 3300031995 Unclassified 685
677 Ga0307409_101758536 3300031995 Bacteria 649
678 Ga0307416_100004801 3300032002 Bacteria 8213
679 Ga0307416_100056142 3300032002 Bacteria 3176
680 Ga0307416_100226339 3300032002 Bacteria 1799
681 Ga0307416_100971884 3300032002 Bacteria 952
682 Ga0307416_101134306 3300032002 Bacteria 887
683 Ga0307416_101185365 3300032002 Bacteria 869
684 Ga0307414_10045411 3300032004 Bacteria 3008
685 Ga0307414_10048731 3300032004 Bacteria 2925
686 Ga0307414_10070467 3300032004 Bacteria 2518
687 Ga0307414_10072426 3300032004 Bacteria 2489
688 Ga0307414_10320960 3300032004 Bacteria 1318
689 Ga0307414_10546479 3300032004 Unclassified 1032
690 Ga0307414_12147776 3300032004 Bacteria 521
691 Ga0307411_10040192 3300032005 Bacteria 2965
692 Ga0307411_10072858 3300032005 Bacteria 2334
693 Ga0307411_10095117 3300032005 Bacteria 2091
694 Ga0307411_10261165 3300032005 Unclassified 1367
695 Ga0307411_10384429 3300032005 Bacteria 1155
696 Ga0307415_100004436 3300032126 Bacteria 7276
697 Ga0307415_100011638 3300032126 Bacteria 5046
698 Ga0307415_100014441 3300032126 Bacteria 4643
699 Ga0307415_100018715 3300032126 Bacteria 4190
700 Ga0307415_100087487 3300032126 Bacteria 2245
701 Ga0307415_100191250 3300032126 Bacteria 1615
702 Ga0307415_102170721 3300032126 Unclassified 543
703 Ga0373950_0066784 3300034818 Bacteria 731
704 Ga0373958_0094444 3300034819 Bacteria 694
705 Ga0373938_0177178 3300034957 Bacteria 580
706 Ga0373949_0078032 3300035090 Bacteria 878
707 Ga0373939_0052601 3300035114 Bacteria 1270
708 Ga0373941_0389358 3300035115 Unclassified 574
709 Ga0373960_0006755 3300035121 Bacteria 2700
710 Ga0373960_0091583 3300035121 Bacteria 973
711 Ga0373942_0044769 3300035207 Bacteria 1220
712 Ga0373962_0045739 3300035242 Bacteria 1247
713 Ga0373931_0036991 3300035691 Bacteria 2547
714 Ga0373931_0198722 3300035691 Bacteria 1196
715 Ga0373931_0230950 3300035691 Bacteria 1118
716 Ga0373931_0273058 3300035691 Bacteria 1036
717 Ga0373947_0383316 3300035725 Bacteria 947
718 Ga0373937_0166091 3300036401 Bacteria 2070
719 Ga0395899_0051869 3300037312 Bacteria 3043
720 Ga0395899_0063518 3300037312 Bacteria 2716
721 Ga0395899_0085583 3300037312 Bacteria 2290
722 Ga0395899_0087697 3300037312 Bacteria 2258
723 Ga0395899_0097811 3300037312 Bacteria 2121
724 Ga0395899_0115661 3300037312 Bacteria 1925
725 Ga0395899_0288729 3300037312 Bacteria 1113
726 Ga0395899_0323992 3300037312 Bacteria 1037
727 Ga0395899_0374852 3300037312 Bacteria 947
728 Ga0395899_0516649 3300037312 Unclassified 772
729 Ga0395899_0531097 3300037312 Bacteria 759
730 Ga0395900_0000530 3300037418 Bacteria 53919
731 Ga0395900_0035419 3300037418 Bacteria 5141
732 Ga0395900_0047919 3300037418 Bacteria 4402
733 Ga0395900_0057291 3300037418 Bacteria 4011
734 Ga0395900_0127555 3300037418 Bacteria 2608
735 Ga0395900_0142994 3300037418 Bacteria 2448
736 Ga0395900_0208799 3300037418 Bacteria 1972
737 Ga0395900_0209526 3300037418 Bacteria 1968
738 Ga0395900_0212857 3300037418 Bacteria 1951
739 Ga0395900_0241463 3300037418 Bacteria 1812
740 Ga0395900_0328665 3300037418 Unclassified 1507
741 Ga0395900_0548453 3300037418 Bacteria 1101
742 Ga0395900_0618040 3300037418 Bacteria 1023
743 Ga0395900_0766719 3300037418 Bacteria 894
744 Ga0395900_0947215 3300037418 Unclassified 782
745 Ga0395900_0977471 3300037418 Bacteria 767
746 Ga0395898_0019899 3300037466 Bacteria 6826
747 Ga0395898_0034350 3300037466 Bacteria 5055
748 Ga0395898_0108317 3300037466 Bacteria 2664
749 Ga0395898_0163504 3300037466 Bacteria 2129
750 Ga0395898_0169515 3300037466 Bacteria 2087
751 Ga0395898_0324705 3300037466 Bacteria 1468
752 Ga0395898_0610946 3300037466 Bacteria 1033
753 Ga0395898_0790396 3300037466 Bacteria 889
754 Ga0395905_0001285 3300037471 Bacteria 30925
755 Ga0395905_0002000 3300037471 Bacteria 23293
756 Ga0395905_0012346 3300037471 Bacteria 8223
757 Ga0395905_0016638 3300037471 Bacteria 6991
758 Ga0395905_0020055 3300037471 Bacteria 6335
759 Ga0395905_0040653 3300037471 Bacteria 4362
760 Ga0395905_0050007 3300037471 Bacteria 3917
761 Ga0395905_0063997 3300037471 Bacteria 3441
762 Ga0395905_0070728 3300037471 Bacteria 3270
763 Ga0395905_0076302 3300037471 Bacteria 3141
764 Ga0395905_0083650 3300037471 Bacteria 2990
765 Ga0395905_0268351 3300037471 Bacteria 1592
766 Ga0395905_0296571 3300037471 Bacteria 1504
767 Ga0395905_0449394 3300037471 Bacteria 1187
768 Ga0395905_0662307 3300037471 Bacteria 946
769 Ga0436364_1182596 3300037853 Bacteria 26080
770 Ga0395901_0002214 3300038443 Bacteria 19825
771 Ga0395901_0034525 3300038443 Bacteria 5223
772 Ga0395901_0058940 3300038443 Bacteria 3994
773 Ga0395901_0151827 3300038443 Bacteria 2434
774 Ga0395901_0153083 3300038443 Bacteria 2422
775 Ga0395901_0200715 3300038443 Bacteria 2090
776 Ga0395901_0215909 3300038443 Bacteria 2006
777 Ga0395901_0232696 3300038443 Bacteria 1923
778 Ga0395901_0416867 3300038443 Bacteria 1377
779 Ga0395901_0458290 3300038443 Bacteria 1303
780 Ga0395901_0680903 3300038443 Unclassified 1028
781 Ga0436365_1673329 3300039437 Bacteria 4150
782 Ga0439465_0168962 3300041413 Bacteria 787
783 Ga0451802_0202772 3300041460 Bacteria 719
784 Ga0439432_017692 3300042006 Bacteria 2390
785 Ga0439449_0031141 3300042007 Bacteria 1988
786 Ga0450889_013711 3300042144 Bacteria 859
787 Ga0439458_0009596 3300042157 Bacteria 2156
788 Ga0439458_0010913 3300042157 Bacteria 2027
789 Ga0466969_0249056 3300044656 Bacteria 805
790 Ga0466972_0239889 3300044658 Unclassified 848
791 Ga0466972_0437322 3300044658 Bacteria 614
792 Ga0466966_0017961 3300044684 Bacteria 4670
793 Ga0466966_0020650 3300044684 Bacteria 4328
794 Ga0466966_0113609 3300044684 Bacteria 1668
795 Ga0466961_0020251 3300044693 Bacteria 4280
796 Ga0466963_0097924 3300044694 Bacteria 2004
797 Ga0466963_0168877 3300044694 Bacteria 1524
798 Ga0466964_0071145 3300044706 Bacteria 1471
799 Ga0466971_0019546 3300044719 Bacteria 3009
800 Ga0466971_0053303 3300044719 Bacteria 1823
801 Ga0466971_0475424 3300044719 Bacteria 615
802 Ga0466970_0109101 3300044765 Bacteria 1511
803 Ga0466970_0153439 3300044765 Bacteria 1272
804 Ga0466970_0479640 3300044765 Bacteria 715
805 Ga0466957_0028508 3300044842 Bacteria 3325
806 Ga0466957_0251517 3300044842 Bacteria 1175
807 Ga0466959_0186737 3300045049 Bacteria 1448
808 Ga0466959_0243185 3300045049 Bacteria 1242
809 Ga0466958_0015179 3300045836 Bacteria 4409
810 Ga0466958_0119555 3300045836 Bacteria 1649
811 Ga0466967_0000133 3300045976 Bacteria 28499
812 Ga0466967_0016030 3300045976 Bacteria 5895
813 Ga0466967_0217624 3300045976 Bacteria 1814
814 Ga0466967_0928497 3300045976 Unclassified 866
815 Ga0466967_1904860 3300045976 Bacteria 591
816 Ga0495643_0099815 3300046522 Bacteria 1489
817 Ga0495663_0172079 3300046525 Unclassified 747
818 Ga0495598_0001143 3300046537 Bacteria 5101
819 Ga0495598_0095684 3300046537 Unclassified 975
820 Ga0495621_0001056 3300046539 Bacteria 7053
821 Ga0495633_0099202 3300046558 Unclassified 1352
822 Ga0495669_0006895 3300046684 Bacteria 4759
823 Ga0495669_0020688 3300046684 Bacteria 2850
824 Ga0495669_0166624 3300046684 Unclassified 1047
825 Ga0495669_0190206 3300046684 Bacteria 980
826 Ga0495669_0493800 3300046684 Bacteria 595
827 Ga0495670_0002211 3300046691 Bacteria 9613
828 Ga0495600_0209187 3300046809 Bacteria 1251
829 Ga0495677_0074862 3300047445 Bacteria 1264
830 Ga0496100_0053864 3300048903 Bacteria 2621
831 Ga0496100_0442067 3300048903 Unclassified 996
832 Ga0496101_0194474 3300048904 Bacteria 1566
833 Ga0496101_0273213 3300048904 Bacteria 1320
834 Ga0496101_0273706 3300048904 Bacteria 1318
835 Ga0496101_0424833 3300048904 Bacteria 1048
836 Ga0496101_0803287 3300048904 Unclassified 742
837 Ga0496102_0147832 3300048905 Bacteria 2206
838 Ga0496102_0753659 3300048905 Bacteria 896
839 Ga0496103_0052140 3300048906 Bacteria 2534
840 Ga0496104_0094439 3300048907 Bacteria 2861
841 Ga0496105_0085975 3300048908 Bacteria 2599
842 Ga0496105_0538191 3300048908 Bacteria 913
843 Ga0496106_0026741 3300048909 Bacteria 4297
844 Ga0496106_0211061 3300048909 Bacteria 1547
845 Ga0496106_0890964 3300048909 Bacteria 703
846 Ga0496107_0022684 3300048910 Bacteria 4437
847 Ga0496107_0063532 3300048910 Bacteria 2676
848 Ga0496107_0088032 3300048910 Bacteria 2267
849 Ga0496107_0283747 3300048910 Bacteria 1232
850 Ga0496108_0002219 3300048911 Bacteria 15552
851 Ga0496108_0027261 3300048911 Bacteria 4715
852 Ga0496108_0056962 3300048911 Bacteria 3284
853 Ga0496108_0063721 3300048911 Bacteria 3104
854 Ga0496108_0189562 3300048911 Bacteria 1782
855 Ga0496109_0004027 3300048912 Bacteria 12274
856 Ga0496109_0039886 3300048912 Bacteria 4251
857 Ga0496109_0128549 3300048912 Bacteria 2364
858 Ga0496109_0284555 3300048912 Bacteria 1558
859 Ga0496109_0460580 3300048912 Unclassified 1201
860 Ga0496109_0589191 3300048912 Bacteria 1048
861 Ga0496109_1317221 3300048912 Bacteria 658
862 Ga0496110_0039477 3300048913 Bacteria 4110
863 Ga0496110_0062847 3300048913 Bacteria 3280
864 Ga0496110_0066273 3300048913 Bacteria 3193
865 Ga0496110_0087018 3300048913 Bacteria 2790
866 Ga0496110_0362117 3300048913 Bacteria 1321
867 Ga0496110_0781276 3300048913 Bacteria 859
868 Ga0496111_0007256 3300048914 Bacteria 7253
869 Ga0496111_0009171 3300048914 Bacteria 6587
870 Ga0496111_0039141 3300048914 Bacteria 3398
871 Ga0496111_0041554 3300048914 Bacteria 3300
872 Ga0496111_0371955 3300048914 Bacteria 1057
873 Ga0496111_1119477 3300048914 Unclassified 560
874 Ga0496112_0034765 3300048915 Bacteria 4905
875 Ga0496112_0089098 3300048915 Bacteria 3053
876 Ga0496112_0110085 3300048915 Bacteria 2724
877 Ga0496113_0010984 3300048916 Bacteria 6017
878 Ga0496113_0076150 3300048916 Bacteria 2562
879 Ga0496114_0000023 3300048917 Bacteria 219092
880 Ga0496114_0165102 3300048917 Bacteria 1927
881 Ga0496114_0370472 3300048917 Bacteria 1268
882 Ga0501047_0382111 3300049581 Unclassified 1243
883 Ga0501068_0138345 3300049584 Bacteria 1526
884 Ga0501069_0009266 3300049585 Bacteria 5196
885 Ga0501074_0172965 3300049590 Bacteria 1541
886 Ga0501233_134127 3300049668 Bacteria 679
887 Ga0501080_1140263 3300049742 Unclassified 672
888 Ga0501035_0863910 3300049822 Unclassified 719
889 Ga0501044_0395742 3300049823 Unclassified 1295
890 Ga0501212_007233 3300049851 Bacteria 1517
891 nmdc:mga03683_446129_c1 3300050489 Bacteria 622
892 nmdc:mga0k408_109384_c1 3300050493 Bacteria 1633
893 Ga0466962_0012233 3300061719 Bacteria 4125
894 Ga0466962_0054321 3300061719 Bacteria 1914
895 Ga0466962_0233455 3300061719 Unclassified 902
896 Ga0530510_0902909 3300061734 Bacteria 675

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046537 Ga0495598_0001143 Ga0495598_0001143_2998_3441 136
2 3300046539 Ga0495621_0001056 Ga0495621_0001056_4395_4838 136
3 3300046684 Ga0495669_0166624 Ga0495669_0166624_231_674 136
4 3300046691 Ga0495670_0002211 Ga0495670_0002211_6159_6602 136
5 3300026078 Ga0207702_10286322 Ga0207702_102863222 137
6 3300005355 Ga0070671_100544282 Ga0070671_1005442821 138
7 3300002067 JGI24735J21928_10004294 JGI24735J21928_100042941 144
8 3300005366 Ga0070659_100130922 Ga0070659_1001309222 144
9 3300005455 Ga0070663_100132287 Ga0070663_1001322872 144
10 3300005457 Ga0070662_101009558 Ga0070662_1010095582 144
11 3300005530 Ga0070679_100466080 Ga0070679_1004660802 144
12 3300005548 Ga0070665_101296302 Ga0070665_1012963022 144
13 3300005563 Ga0068855_101436334 Ga0068855_1014363342 144
14 3300005614 Ga0068856_100816567 Ga0068856_1008165672 144
15 3300013104 Ga0157370_10631975 Ga0157370_106319752 144
16 3300013296 Ga0157374_12459993 Ga0157374_124599931 144
17 3300025904 Ga0207647_10563354 Ga0207647_105633542 144
18 3300025909 Ga0207705_10044812 Ga0207705_100448123 144
19 3300025919 Ga0207657_10117721 Ga0207657_101177211 144
20 3300025920 Ga0207649_10193208 Ga0207649_101932082 144
21 3300025921 Ga0207652_10971809 Ga0207652_109718092 144
22 3300026078 Ga0207702_11401230 Ga0207702_114012302 144
23 3300028379 Ga0268266_10379532 Ga0268266_103795323 144
24 3300001991 JGI24743J22301_10009110 JGI24743J22301_100091104 145
25 3300002075 JGI24738J21930_10038565 JGI24738J21930_100385652 145
26 3300002077 JGI24744J21845_10000547 JGI24744J21845_100005477 145
27 3300002244 JGI24742J22300_10010397 JGI24742J22300_100103972 145
28 3300005327 Ga0070658_11273692 Ga0070658_112736921 145
29 3300005331 Ga0070670_100116815 Ga0070670_1001168152 145
30 3300005333 Ga0070677_10038409 Ga0070677_100384092 145
31 3300005334 Ga0068869_100108253 Ga0068869_1001082532 145
32 3300005335 Ga0070666_10239550 Ga0070666_102395502 145
33 3300005337 Ga0070682_101979317 Ga0070682_1019793171 145
34 3300005338 Ga0068868_100105162 Ga0068868_1001051624 145
35 3300005338 Ga0068868_101193142 Ga0068868_1011931421 145
36 3300005343 Ga0070687_100095557 Ga0070687_1000955572 145
37 3300005347 Ga0070668_100873325 Ga0070668_1008733252 145
38 3300005354 Ga0070675_100117114 Ga0070675_1001171144 145
39 3300005355 Ga0070671_100089952 Ga0070671_1000899522 145
40 3300005356 Ga0070674_100118178 Ga0070674_1001181783 145
41 3300005356 Ga0070674_100145654 Ga0070674_1001456542 145
42 3300005364 Ga0070673_100264176 Ga0070673_1002641762 145
43 3300005366 Ga0070659_100361580 Ga0070659_1003615803 145
44 3300005366 Ga0070659_100576079 Ga0070659_1005760791 145
45 3300005367 Ga0070667_100467413 Ga0070667_1004674132 145
46 3300005455 Ga0070663_100184101 Ga0070663_1001841012 145
47 3300005455 Ga0070663_101177941 Ga0070663_1011779412 145
48 3300005456 Ga0070678_100339411 Ga0070678_1003394111 145
49 3300005457 Ga0070662_100120994 Ga0070662_1001209942 145
50 3300005457 Ga0070662_100183684 Ga0070662_1001836841 145
51 3300005458 Ga0070681_10612982 Ga0070681_106129821 145
52 3300005459 Ga0068867_100127523 Ga0068867_1001275234 145
53 3300005530 Ga0070679_100611730 Ga0070679_1006117302 145
54 3300005539 Ga0068853_100072672 Ga0068853_1000726723 145
55 3300005539 Ga0068853_100472853 Ga0068853_1004728531 145
56 3300005543 Ga0070672_100034180 Ga0070672_1000341803 145
57 3300005543 Ga0070672_100073823 Ga0070672_1000738232 145
58 3300005543 Ga0070672_100161423 Ga0070672_1001614232 145
59 3300005544 Ga0070686_100200541 Ga0070686_1002005412 145
60 3300005564 Ga0070664_101618353 Ga0070664_1016183531 145
61 3300005615 Ga0070702_100394487 Ga0070702_1003944872 145
62 3300005616 Ga0068852_100935161 Ga0068852_1009351611 145
63 3300005617 Ga0068859_100287754 Ga0068859_1002877542 145
64 3300005618 Ga0068864_100021722 Ga0068864_1000217225 145
65 3300005618 Ga0068864_100206237 Ga0068864_1002062372 145
66 3300005718 Ga0068866_10009417 Ga0068866_100094174 145
67 3300005719 Ga0068861_100126061 Ga0068861_1001260612 145
68 3300006237 Ga0097621_100147655 Ga0097621_1001476554 145
69 3300006237 Ga0097621_100365636 Ga0097621_1003656361 145
70 3300006358 Ga0068871_100126959 Ga0068871_1001269592 145
71 3300006358 Ga0068871_100186051 Ga0068871_1001860512 145
72 3300006931 Ga0097620_100287765 Ga0097620_1002877652 145
73 3300009098 Ga0105245_10033176 Ga0105245_100331764 145
74 3300009176 Ga0105242_10193647 Ga0105242_101936472 145
75 3300009177 Ga0105248_11343271 Ga0105248_113432712 145
76 3300009551 Ga0105238_10166595 Ga0105238_101665952 145
77 3300013100 Ga0157373_11333749 Ga0157373_113337491 145
78 3300013102 Ga0157371_10169076 Ga0157371_101690764 145
79 3300013104 Ga0157370_10619753 Ga0157370_106197532 145
80 3300013306 Ga0163162_10024974 Ga0163162_100249746 145
81 3300013306 Ga0163162_10763107 Ga0163162_107631073 145
82 3300013308 Ga0157375_10132936 Ga0157375_101329362 145
83 3300013308 Ga0157375_10161166 Ga0157375_101611663 145
84 3300017792 Ga0163161_10024348 Ga0163161_100243482 145
85 3300021388 Ga0213875_10006414 Ga0213875_100064142 145
86 3300025315 Ga0207697_10021874 Ga0207697_100218742 145
87 3300025315 Ga0207697_10024490 Ga0207697_100244902 145
88 3300025893 Ga0207682_10013128 Ga0207682_100131283 145
89 3300025899 Ga0207642_10008789 Ga0207642_100087894 145
90 3300025901 Ga0207688_10137748 Ga0207688_101377484 145
91 3300025903 Ga0207680_10327008 Ga0207680_103270082 145
92 3300025918 Ga0207662_10016144 Ga0207662_100161444 145
93 3300025919 Ga0207657_10018921 Ga0207657_100189216 145
94 3300025921 Ga0207652_10503467 Ga0207652_105034671 145
95 3300025923 Ga0207681_10096292 Ga0207681_100962922 145
96 3300025925 Ga0207650_10368537 Ga0207650_103685373 145
97 3300025927 Ga0207687_10195619 Ga0207687_101956192 145
98 3300025931 Ga0207644_10049770 Ga0207644_100497704 145
99 3300025931 Ga0207644_10072793 Ga0207644_100727933 145
100 3300025932 Ga0207690_10265632 Ga0207690_102656324 145
101 3300025933 Ga0207706_10045365 Ga0207706_100453653 145
102 3300025933 Ga0207706_10185969 Ga0207706_101859692 145
103 3300025935 Ga0207709_10166679 Ga0207709_101666792 145
104 3300025937 Ga0207669_10052152 Ga0207669_100521523 145
105 3300025937 Ga0207669_10185729 Ga0207669_101857292 145
106 3300025940 Ga0207691_10022187 Ga0207691_100221875 145
107 3300025940 Ga0207691_10201930 Ga0207691_102019302 145
108 3300025940 Ga0207691_10204770 Ga0207691_102047702 145
109 3300025942 Ga0207689_10031981 Ga0207689_100319814 145
110 3300025945 Ga0207679_11008438 Ga0207679_110084382 145
111 3300025960 Ga0207651_10189669 Ga0207651_101896692 145
112 3300025981 Ga0207640_10083864 Ga0207640_100838644 145
113 3300025986 Ga0207658_10587094 Ga0207658_105870942 145
114 3300026035 Ga0207703_10414604 Ga0207703_104146042 145
115 3300026041 Ga0207639_10589346 Ga0207639_105893461 145
116 3300026067 Ga0207678_10074005 Ga0207678_100740053 145
117 3300026067 Ga0207678_10266347 Ga0207678_102663472 145
118 3300026089 Ga0207648_10011721 Ga0207648_100117218 145
119 3300026095 Ga0207676_10172054 Ga0207676_101720542 145
120 3300026116 Ga0207674_10472744 Ga0207674_104727442 145
121 3300026121 Ga0207683_10011570 Ga0207683_100115705 145
122 3300032004 Ga0307414_10048731 Ga0307414_100487312 145
123 3300037853 Ga0436364_1182596 Ga0436364_1182596_5592_6035 145
124 3300048904 Ga0496101_0273213 Ga0496101_0273213_116_553 145
125 3300048906 Ga0496103_0052140 Ga0496103_0052140_815_1255 145
126 3300048911 Ga0496108_0189562 Ga0496108_0189562_857_1294 145
127 3300048912 Ga0496109_0128549 Ga0496109_0128549_1514_1951 145
128 3300048913 Ga0496110_0066273 Ga0496110_0066273_155_592 145
129 3300048914 Ga0496111_0371955 Ga0496111_0371955_375_812 145
130 3300048917 Ga0496114_0165102 Ga0496114_0165102_276_713 145
131 2162886012 MBSR1b_contig_13686641 MBSR1b_0280.00000260 146
132 3300001979 JGI24740J21852_10024667 JGI24740J21852_100246674 146
133 3300001989 JGI24739J22299_10005757 JGI24739J22299_100057573 146
134 3300001989 JGI24739J22299_10021619 JGI24739J22299_100216193 146
135 3300001990 JGI24737J22298_10017642 JGI24737J22298_100176425 146
136 3300001990 JGI24737J22298_10218047 JGI24737J22298_102180471 146
137 3300002067 JGI24735J21928_10036266 JGI24735J21928_100362663 146
138 3300002075 JGI24738J21930_10052614 JGI24738J21930_100526142 146
139 3300002075 JGI24738J21930_10120523 JGI24738J21930_101205231 146
140 3300003323 rootH1_10138689 rootH1_101386892 146
141 3300005293 Ga0065715_10023351 Ga0065715_100233512 146
142 3300005293 Ga0065715_10097503 Ga0065715_100975034 146
143 3300005293 Ga0065715_10392911 Ga0065715_103929112 146
144 3300005327 Ga0070658_10001557 Ga0070658_1000155710 146
145 3300005327 Ga0070658_10010416 Ga0070658_100104162 146
146 3300005327 Ga0070658_10018360 Ga0070658_100183605 146
147 3300005327 Ga0070658_10053135 Ga0070658_100531353 146
148 3300005327 Ga0070658_10107335 Ga0070658_101073353 146
149 3300005327 Ga0070658_10153711 Ga0070658_101537112 146
150 3300005328 Ga0070676_10068013 Ga0070676_100680131 146
151 3300005328 Ga0070676_10152645 Ga0070676_101526452 146
152 3300005328 Ga0070676_10685905 Ga0070676_106859052 146
153 3300005328 Ga0070676_11121903 Ga0070676_111219031 146
154 3300005329 Ga0070683_100008063 Ga0070683_1000080633 146
155 3300005329 Ga0070683_100214995 Ga0070683_1002149952 146
156 3300005330 Ga0070690_100044483 Ga0070690_1000444833 146
157 3300005330 Ga0070690_100346094 Ga0070690_1003460943 146
158 3300005331 Ga0070670_100003815 Ga0070670_10000381515 146
159 3300005331 Ga0070670_100014338 Ga0070670_1000143389 146
160 3300005331 Ga0070670_100038160 Ga0070670_1000381602 146
161 3300005331 Ga0070670_100057436 Ga0070670_1000574363 146
162 3300005331 Ga0070670_100072166 Ga0070670_1000721663 146
163 3300005331 Ga0070670_100134709 Ga0070670_1001347092 146
164 3300005331 Ga0070670_100185559 Ga0070670_1001855593 146
165 3300005331 Ga0070670_100258911 Ga0070670_1002589111 146
166 3300005333 Ga0070677_10189914 Ga0070677_101899142 146
167 3300005333 Ga0070677_10330681 Ga0070677_103306812 146
168 3300005334 Ga0068869_101650121 Ga0068869_1016501211 146
169 3300005335 Ga0070666_10000381 Ga0070666_1000038119 146
170 3300005335 Ga0070666_10002547 Ga0070666_100025475 146
171 3300005335 Ga0070666_10004768 Ga0070666_100047681 146
172 3300005335 Ga0070666_10045936 Ga0070666_100459363 146
173 3300005335 Ga0070666_10066097 Ga0070666_100660973 146
174 3300005335 Ga0070666_10473067 Ga0070666_104730671 146
175 3300005336 Ga0070680_101053767 Ga0070680_1010537671 146
176 3300005337 Ga0070682_100025660 Ga0070682_1000256606 146
177 3300005337 Ga0070682_100645922 Ga0070682_1006459221 146
178 3300005338 Ga0068868_100002486 Ga0068868_1000024869 146
179 3300005338 Ga0068868_100030303 Ga0068868_1000303033 146
180 3300005338 Ga0068868_100105321 Ga0068868_1001053214 146
181 3300005338 Ga0068868_100424278 Ga0068868_1004242783 146
182 3300005339 Ga0070660_100000009 Ga0070660_100000009150 146
183 3300005339 Ga0070660_100038962 Ga0070660_1000389621 146
184 3300005339 Ga0070660_100134992 Ga0070660_1001349922 146
185 3300005339 Ga0070660_100169117 Ga0070660_1001691173 146
186 3300005339 Ga0070660_100201659 Ga0070660_1002016592 146
187 3300005339 Ga0070660_100408691 Ga0070660_1004086912 146
188 3300005339 Ga0070660_100437917 Ga0070660_1004379172 146
189 3300005339 Ga0070660_100511907 Ga0070660_1005119071 146
190 3300005339 Ga0070660_100994618 Ga0070660_1009946181 146
191 3300005344 Ga0070661_100001564 Ga0070661_1000015646 146
192 3300005344 Ga0070661_100014885 Ga0070661_1000148851 146
193 3300005344 Ga0070661_100022387 Ga0070661_1000223873 146
194 3300005344 Ga0070661_100022856 Ga0070661_1000228564 146
195 3300005344 Ga0070661_100073470 Ga0070661_1000734703 146
196 3300005344 Ga0070661_100074276 Ga0070661_1000742763 146
197 3300005344 Ga0070661_100098170 Ga0070661_1000981702 146
198 3300005344 Ga0070661_100103459 Ga0070661_1001034592 146
199 3300005344 Ga0070661_100246344 Ga0070661_1002463441 146
200 3300005347 Ga0070668_100258717 Ga0070668_1002587173 146
201 3300005353 Ga0070669_100111286 Ga0070669_1001112862 146
202 3300005353 Ga0070669_100318032 Ga0070669_1003180322 146
203 3300005353 Ga0070669_100534663 Ga0070669_1005346632 146
204 3300005353 Ga0070669_101041002 Ga0070669_1010410021 146
205 3300005353 Ga0070669_101743996 Ga0070669_1017439961 146
206 3300005354 Ga0070675_100000913 Ga0070675_10000091322 146
207 3300005354 Ga0070675_100051464 Ga0070675_1000514644 146
208 3300005354 Ga0070675_100101317 Ga0070675_1001013171 146
209 3300005354 Ga0070675_100135199 Ga0070675_1001351993 146
210 3300005354 Ga0070675_100450985 Ga0070675_1004509853 146
211 3300005355 Ga0070671_100000784 Ga0070671_1000007844 146
212 3300005355 Ga0070671_100001033 Ga0070671_10000103315 146
213 3300005355 Ga0070671_100005525 Ga0070671_1000055259 146
214 3300005355 Ga0070671_100069911 Ga0070671_1000699113 146
215 3300005355 Ga0070671_100103018 Ga0070671_1001030184 146
216 3300005355 Ga0070671_100113824 Ga0070671_1001138243 146
217 3300005355 Ga0070671_100124230 Ga0070671_1001242302 146
218 3300005355 Ga0070671_100470394 Ga0070671_1004703941 146
219 3300005356 Ga0070674_100045690 Ga0070674_1000456902 146
220 3300005356 Ga0070674_100079772 Ga0070674_1000797723 146
221 3300005356 Ga0070674_100137475 Ga0070674_1001374752 146
222 3300005356 Ga0070674_100271906 Ga0070674_1002719064 146
223 3300005364 Ga0070673_100003767 Ga0070673_10000376712 146
224 3300005364 Ga0070673_100022395 Ga0070673_1000223952 146
225 3300005364 Ga0070673_100022477 Ga0070673_1000224775 146
226 3300005364 Ga0070673_100035527 Ga0070673_1000355273 146
227 3300005364 Ga0070673_100049622 Ga0070673_1000496226 146
228 3300005364 Ga0070673_100345348 Ga0070673_1003453482 146
229 3300005364 Ga0070673_100556713 Ga0070673_1005567131 146
230 3300005364 Ga0070673_100748287 Ga0070673_1007482872 146
231 3300005366 Ga0070659_100001389 Ga0070659_10000138910 146
232 3300005366 Ga0070659_100006367 Ga0070659_1000063677 146
233 3300005366 Ga0070659_100019299 Ga0070659_1000192997 146
234 3300005366 Ga0070659_100026012 Ga0070659_1000260125 146
235 3300005366 Ga0070659_100482416 Ga0070659_1004824161 146
236 3300005366 Ga0070659_100581633 Ga0070659_1005816332 146
237 3300005367 Ga0070667_100000915 Ga0070667_10000091515 146
238 3300005367 Ga0070667_100027177 Ga0070667_1000271774 146
239 3300005367 Ga0070667_100030757 Ga0070667_1000307575 146
240 3300005367 Ga0070667_100061978 Ga0070667_1000619785 146
241 3300005434 Ga0070709_10111843 Ga0070709_101118432 146
242 3300005435 Ga0070714_100063184 Ga0070714_1000631844 146
243 3300005435 Ga0070714_100136216 Ga0070714_1001362163 146
244 3300005436 Ga0070713_100210795 Ga0070713_1002107953 146
245 3300005436 Ga0070713_100530906 Ga0070713_1005309062 146
246 3300005455 Ga0070663_100016637 Ga0070663_1000166374 146
247 3300005455 Ga0070663_100051620 Ga0070663_1000516202 146
248 3300005455 Ga0070663_100200408 Ga0070663_1002004082 146
249 3300005455 Ga0070663_100385417 Ga0070663_1003854172 146
250 3300005455 Ga0070663_100443872 Ga0070663_1004438721 146
251 3300005456 Ga0070678_100000775 Ga0070678_10000077519 146
252 3300005456 Ga0070678_100032098 Ga0070678_1000320982 146
253 3300005456 Ga0070678_100041260 Ga0070678_1000412603 146
254 3300005457 Ga0070662_100002539 Ga0070662_1000025397 146
255 3300005457 Ga0070662_100005907 Ga0070662_1000059072 146
256 3300005457 Ga0070662_100008010 Ga0070662_1000080105 146
257 3300005457 Ga0070662_100009832 Ga0070662_1000098326 146
258 3300005457 Ga0070662_100015832 Ga0070662_1000158323 146
259 3300005457 Ga0070662_100069884 Ga0070662_1000698845 146
260 3300005457 Ga0070662_100090421 Ga0070662_1000904211 146
261 3300005457 Ga0070662_100104107 Ga0070662_1001041073 146
262 3300005457 Ga0070662_100294393 Ga0070662_1002943932 146
263 3300005457 Ga0070662_100788003 Ga0070662_1007880032 146
264 3300005457 Ga0070662_100833198 Ga0070662_1008331982 146
265 3300005458 Ga0070681_10569961 Ga0070681_105699612 146
266 3300005458 Ga0070681_11230017 Ga0070681_112300171 146
267 3300005459 Ga0068867_100026024 Ga0068867_1000260243 146
268 3300005459 Ga0068867_100437726 Ga0068867_1004377261 146
269 3300005466 Ga0070685_10894126 Ga0070685_108941261 146
270 3300005530 Ga0070679_100656370 Ga0070679_1006563702 146
271 3300005530 Ga0070679_100777991 Ga0070679_1007779912 146
272 3300005535 Ga0070684_100029760 Ga0070684_1000297602 146
273 3300005539 Ga0068853_100007625 Ga0068853_1000076254 146
274 3300005539 Ga0068853_100107157 Ga0068853_1001071574 146
275 3300005539 Ga0068853_100224754 Ga0068853_1002247542 146
276 3300005539 Ga0068853_100401677 Ga0068853_1004016772 146
277 3300005543 Ga0070672_100007391 Ga0070672_1000073915 146
278 3300005543 Ga0070672_100028901 Ga0070672_1000289015 146
279 3300005543 Ga0070672_100073924 Ga0070672_1000739243 146
280 3300005543 Ga0070672_100080781 Ga0070672_1000807813 146
281 3300005543 Ga0070672_100143927 Ga0070672_1001439273 146
282 3300005543 Ga0070672_100163580 Ga0070672_1001635803 146
283 3300005543 Ga0070672_100547703 Ga0070672_1005477032 146
284 3300005543 Ga0070672_100760698 Ga0070672_1007606982 146
285 3300005544 Ga0070686_100010300 Ga0070686_1000103003 146
286 3300005544 Ga0070686_101098602 Ga0070686_1010986022 146
287 3300005547 Ga0070693_100001083 Ga0070693_1000010836 146
288 3300005548 Ga0070665_100035090 Ga0070665_1000350904 146
289 3300005548 Ga0070665_100067794 Ga0070665_1000677944 146
290 3300005548 Ga0070665_100121257 Ga0070665_1001212574 146
291 3300005548 Ga0070665_100127103 Ga0070665_1001271033 146
292 3300005548 Ga0070665_100565415 Ga0070665_1005654153 146
293 3300005548 Ga0070665_100650953 Ga0070665_1006509533 146
294 3300005548 Ga0070665_100721725 Ga0070665_1007217252 146
295 3300005563 Ga0068855_100001099 Ga0068855_10000109919 146
296 3300005563 Ga0068855_100273309 Ga0068855_1002733093 146
297 3300005563 Ga0068855_101625872 Ga0068855_1016258721 146
298 3300005564 Ga0070664_100000103 Ga0070664_10000010311 146
299 3300005564 Ga0070664_100006945 Ga0070664_1000069452 146
300 3300005564 Ga0070664_100008493 Ga0070664_1000084935 146
301 3300005564 Ga0070664_100011272 Ga0070664_1000112723 146
302 3300005564 Ga0070664_100033104 Ga0070664_1000331043 146
303 3300005564 Ga0070664_100042247 Ga0070664_1000422473 146
304 3300005564 Ga0070664_100127289 Ga0070664_1001272893 146
305 3300005564 Ga0070664_100327376 Ga0070664_1003273761 146
306 3300005564 Ga0070664_100390743 Ga0070664_1003907433 146
307 3300005564 Ga0070664_102177396 Ga0070664_1021773961 146
308 3300005577 Ga0068857_100322567 Ga0068857_1003225672 146
309 3300005577 Ga0068857_100612471 Ga0068857_1006124712 146
310 3300005578 Ga0068854_100054218 Ga0068854_1000542185 146
311 3300005578 Ga0068854_100060832 Ga0068854_1000608323 146
312 3300005578 Ga0068854_100066869 Ga0068854_1000668693 146
313 3300005578 Ga0068854_100131248 Ga0068854_1001312483 146
314 3300005578 Ga0068854_100777665 Ga0068854_1007776652 146
315 3300005578 Ga0068854_101451338 Ga0068854_1014513382 146
316 3300005614 Ga0068856_100000628 Ga0068856_1000006287 146
317 3300005614 Ga0068856_100042565 Ga0068856_1000425655 146
318 3300005615 Ga0070702_100204394 Ga0070702_1002043941 146
319 3300005616 Ga0068852_100015079 Ga0068852_1000150795 146
320 3300005616 Ga0068852_100058248 Ga0068852_1000582484 146
321 3300005616 Ga0068852_100143994 Ga0068852_1001439943 146
322 3300005616 Ga0068852_100177688 Ga0068852_1001776881 146
323 3300005616 Ga0068852_100225682 Ga0068852_1002256823 146
324 3300005616 Ga0068852_101507230 Ga0068852_1015072302 146
325 3300005616 Ga0068852_101691743 Ga0068852_1016917432 146
326 3300005617 Ga0068859_100036677 Ga0068859_1000366775 146
327 3300005617 Ga0068859_100263305 Ga0068859_1002633052 146
328 3300005617 Ga0068859_100402051 Ga0068859_1004020513 146
329 3300005618 Ga0068864_100000982 Ga0068864_10000098233 146
330 3300005618 Ga0068864_100013401 Ga0068864_1000134016 146
331 3300005618 Ga0068864_100023474 Ga0068864_1000234746 146
332 3300005618 Ga0068864_100027035 Ga0068864_1000270353 146
333 3300005618 Ga0068864_100305196 Ga0068864_1003051962 146
334 3300005618 Ga0068864_100513102 Ga0068864_1005131022 146
335 3300005618 Ga0068864_100533098 Ga0068864_1005330982 146
336 3300005618 Ga0068864_100675550 Ga0068864_1006755502 146
337 3300005718 Ga0068866_10020297 Ga0068866_100202972 146
338 3300005718 Ga0068866_10068913 Ga0068866_100689134 146
339 3300005718 Ga0068866_10075656 Ga0068866_100756562 146
340 3300005719 Ga0068861_100518874 Ga0068861_1005188742 146
341 3300005719 Ga0068861_101021403 Ga0068861_1010214032 146
342 3300005834 Ga0068851_10001784 Ga0068851_100017848 146
343 3300005834 Ga0068851_10017472 Ga0068851_100174722 146
344 3300005834 Ga0068851_10044505 Ga0068851_100445053 146
345 3300005834 Ga0068851_10086284 Ga0068851_100862843 146
346 3300005834 Ga0068851_10416274 Ga0068851_104162742 146
347 3300005840 Ga0068870_10514120 Ga0068870_105141202 146
348 3300005840 Ga0068870_10548519 Ga0068870_105485192 146
349 3300005841 Ga0068863_100023172 Ga0068863_1000231726 146
350 3300005841 Ga0068863_100043208 Ga0068863_1000432083 146
351 3300005841 Ga0068863_100062068 Ga0068863_1000620683 146
352 3300005841 Ga0068863_100110949 Ga0068863_1001109492 146
353 3300005842 Ga0068858_100009318 Ga0068858_1000093189 146
354 3300005842 Ga0068858_100033683 Ga0068858_1000336835 146
355 3300005842 Ga0068858_100185914 Ga0068858_1001859142 146
356 3300005842 Ga0068858_100198779 Ga0068858_1001987792 146
357 3300005843 Ga0068860_100117181 Ga0068860_1001171812 146
358 3300005843 Ga0068860_100122827 Ga0068860_1001228274 146
359 3300005843 Ga0068860_100628059 Ga0068860_1006280592 146
360 3300006028 Ga0070717_10222704 Ga0070717_102227044 146
361 3300006051 Ga0075364_10221214 Ga0075364_102212142 146
362 3300006175 Ga0070712_100041924 Ga0070712_1000419243 146
363 3300006237 Ga0097621_100024505 Ga0097621_1000245056 146
364 3300006237 Ga0097621_100049726 Ga0097621_1000497263 146
365 3300006358 Ga0068871_100034183 Ga0068871_1000341834 146
366 3300006358 Ga0068871_100075941 Ga0068871_1000759413 146
367 3300006358 Ga0068871_100084375 Ga0068871_1000843754 146
368 3300006358 Ga0068871_100582499 Ga0068871_1005824992 146
369 3300006881 Ga0068865_100011026 Ga0068865_1000110265 146
370 3300006881 Ga0068865_100274501 Ga0068865_1002745011 146
371 3300006931 Ga0097620_100036677 Ga0097620_1000366773 146
372 3300006931 Ga0097620_100263309 Ga0097620_1002633092 146
373 3300006931 Ga0097620_100402010 Ga0097620_1004020103 146
374 3300009093 Ga0105240_10234951 Ga0105240_102349512 146
375 3300009093 Ga0105240_10252554 Ga0105240_102525544 146
376 3300009098 Ga0105245_10021117 Ga0105245_100211174 146
377 3300009148 Ga0105243_10055632 Ga0105243_100556322 146
378 3300009174 Ga0105241_10173796 Ga0105241_101737964 146
379 3300009174 Ga0105241_10852419 Ga0105241_108524192 146
380 3300009174 Ga0105241_11526128 Ga0105241_115261282 146
381 3300009176 Ga0105242_10049979 Ga0105242_100499793 146
382 3300009176 Ga0105242_10480910 Ga0105242_104809102 146
383 3300009177 Ga0105248_10000673 Ga0105248_1000067332 146
384 3300009177 Ga0105248_10000724 Ga0105248_100007247 146
385 3300009177 Ga0105248_10002105 Ga0105248_100021057 146
386 3300009177 Ga0105248_10014771 Ga0105248_100147714 146
387 3300009177 Ga0105248_10070039 Ga0105248_100700397 146
388 3300009177 Ga0105248_10145240 Ga0105248_101452403 146
389 3300009177 Ga0105248_12534153 Ga0105248_125341531 146
390 3300009545 Ga0105237_10173424 Ga0105237_101734242 146
391 3300009551 Ga0105238_10072831 Ga0105238_100728313 146
392 3300009551 Ga0105238_10451747 Ga0105238_104517472 146
393 3300009551 Ga0105238_10608585 Ga0105238_106085851 146
394 3300010375 Ga0105239_10754913 Ga0105239_107549132 146
395 3300010375 Ga0105239_10807366 Ga0105239_108073662 146
396 3300011119 Ga0105246_10075364 Ga0105246_100753643 146
397 3300011119 Ga0105246_10119099 Ga0105246_101190992 146
398 3300013100 Ga0157373_10016140 Ga0157373_100161406 146
399 3300013100 Ga0157373_10090457 Ga0157373_100904574 146
400 3300013100 Ga0157373_10092960 Ga0157373_100929602 146
401 3300013100 Ga0157373_10141560 Ga0157373_101415603 146
402 3300013102 Ga0157371_10002159 Ga0157371_100021596 146
403 3300013102 Ga0157371_10012009 Ga0157371_100120095 146
404 3300013102 Ga0157371_10022609 Ga0157371_100226093 146
405 3300013102 Ga0157371_10087053 Ga0157371_100870532 146
406 3300013102 Ga0157371_11584157 Ga0157371_115841571 146
407 3300013104 Ga0157370_10408617 Ga0157370_104086172 146
408 3300013104 Ga0157370_10876372 Ga0157370_108763722 146
409 3300013105 Ga0157369_10043789 Ga0157369_100437894 146
410 3300013105 Ga0157369_10629395 Ga0157369_106293951 146
411 3300013105 Ga0157369_11086590 Ga0157369_110865902 146
412 3300013105 Ga0157369_12064944 Ga0157369_120649442 146
413 3300013296 Ga0157374_10000882 Ga0157374_100008823 146
414 3300013296 Ga0157374_10033137 Ga0157374_100331373 146
415 3300013296 Ga0157374_10073176 Ga0157374_100731764 146
416 3300013296 Ga0157374_10280377 Ga0157374_102803772 146
417 3300013296 Ga0157374_11745388 Ga0157374_117453882 146
418 3300013297 Ga0157378_10107911 Ga0157378_101079112 146
419 3300013297 Ga0157378_10156187 Ga0157378_101561874 146
420 3300013306 Ga0163162_10002440 Ga0163162_100024403 146
421 3300013306 Ga0163162_10026987 Ga0163162_100269874 146
422 3300013306 Ga0163162_10073566 Ga0163162_100735663 146
423 3300013306 Ga0163162_10493941 Ga0163162_104939412 146
424 3300013307 Ga0157372_10134336 Ga0157372_101343362 146
425 3300013307 Ga0157372_10485941 Ga0157372_104859413 146
426 3300013307 Ga0157372_10660052 Ga0157372_106600523 146
427 3300013307 Ga0157372_12828863 Ga0157372_128288631 146
428 3300013308 Ga0157375_10002611 Ga0157375_100026113 146
429 3300013308 Ga0157375_10116887 Ga0157375_101168873 146
430 3300013308 Ga0157375_10198953 Ga0157375_101989532 146
431 3300013308 Ga0157375_10792220 Ga0157375_107922202 146
432 3300013308 Ga0157375_11100643 Ga0157375_111006433 146
433 3300014325 Ga0163163_10004607 Ga0163163_100046074 146
434 3300014325 Ga0163163_10041443 Ga0163163_100414435 146
435 3300014325 Ga0163163_10137433 Ga0163163_101374334 146
436 3300014325 Ga0163163_10146877 Ga0163163_101468773 146
437 3300014325 Ga0163163_11549356 Ga0163163_115493562 146
438 3300014326 Ga0157380_11449458 Ga0157380_114494582 146
439 3300014326 Ga0157380_11862643 Ga0157380_118626431 146
440 3300014497 Ga0182008_10116022 Ga0182008_101160223 146
441 3300014745 Ga0157377_10413947 Ga0157377_104139472 146
442 3300014968 Ga0157379_10040579 Ga0157379_100405791 146
443 3300014968 Ga0157379_10230149 Ga0157379_102301494 146
444 3300014968 Ga0157379_10242372 Ga0157379_102423723 146
445 3300014969 Ga0157376_10006910 Ga0157376_100069104 146
446 3300014969 Ga0157376_10181840 Ga0157376_101818402 146
447 3300017792 Ga0163161_10046050 Ga0163161_100460502 146
448 3300017792 Ga0163161_10621887 Ga0163161_106218872 146
449 3300021384 Ga0213876_10021022 Ga0213876_100210223 146
450 3300025315 Ga0207697_10164760 Ga0207697_101647602 146
451 3300025315 Ga0207697_10231137 Ga0207697_102311371 146
452 3300025321 Ga0207656_10014429 Ga0207656_100144292 146
453 3300025321 Ga0207656_10046907 Ga0207656_100469071 146
454 3300025321 Ga0207656_10072170 Ga0207656_100721702 146
455 3300025321 Ga0207656_10158221 Ga0207656_101582211 146
456 3300025893 Ga0207682_10172691 Ga0207682_101726912 146
457 3300025899 Ga0207642_10016286 Ga0207642_100162863 146
458 3300025899 Ga0207642_10067123 Ga0207642_100671232 146
459 3300025899 Ga0207642_10211599 Ga0207642_102115992 146
460 3300025901 Ga0207688_10104529 Ga0207688_101045292 146
461 3300025903 Ga0207680_10004726 Ga0207680_100047264 146
462 3300025903 Ga0207680_10006248 Ga0207680_100062486 146
463 3300025903 Ga0207680_10014792 Ga0207680_100147923 146
464 3300025903 Ga0207680_10029108 Ga0207680_100291083 146
465 3300025903 Ga0207680_10040837 Ga0207680_100408372 146
466 3300025903 Ga0207680_10327813 Ga0207680_103278132 146
467 3300025903 Ga0207680_10392440 Ga0207680_103924402 146
468 3300025904 Ga0207647_10026290 Ga0207647_100262903 146
469 3300025904 Ga0207647_10043572 Ga0207647_100435723 146
470 3300025904 Ga0207647_10048937 Ga0207647_100489374 146
471 3300025904 Ga0207647_10066872 Ga0207647_100668723 146
472 3300025904 Ga0207647_10087582 Ga0207647_100875822 146
473 3300025907 Ga0207645_10134262 Ga0207645_101342622 146
474 3300025907 Ga0207645_10170030 Ga0207645_101700302 146
475 3300025908 Ga0207643_10586908 Ga0207643_105869083 146
476 3300025909 Ga0207705_10000113 Ga0207705_1000011391 146
477 3300025909 Ga0207705_10022419 Ga0207705_100224195 146
478 3300025909 Ga0207705_10025235 Ga0207705_100252352 146
479 3300025909 Ga0207705_10028813 Ga0207705_100288133 146
480 3300025909 Ga0207705_10072157 Ga0207705_100721572 146
481 3300025909 Ga0207705_10205885 Ga0207705_102058852 146
482 3300025909 Ga0207705_10217047 Ga0207705_102170472 146
483 3300025909 Ga0207705_10280308 Ga0207705_102803081 146
484 3300025911 Ga0207654_10114587 Ga0207654_101145874 146
485 3300025913 Ga0207695_10191172 Ga0207695_101911724 146
486 3300025913 Ga0207695_10374635 Ga0207695_103746351 146
487 3300025914 Ga0207671_10414191 Ga0207671_104141912 146
488 3300025915 Ga0207693_10014652 Ga0207693_100146525 146
489 3300025918 Ga0207662_11326284 Ga0207662_113262841 146
490 3300025919 Ga0207657_10000328 Ga0207657_100003287 146
491 3300025919 Ga0207657_10012677 Ga0207657_1001267713 146
492 3300025919 Ga0207657_10022698 Ga0207657_100226982 146
493 3300025919 Ga0207657_10106512 Ga0207657_101065122 146
494 3300025919 Ga0207657_10143045 Ga0207657_101430453 146
495 3300025919 Ga0207657_10246524 Ga0207657_102465242 146
496 3300025919 Ga0207657_10389514 Ga0207657_103895142 146
497 3300025919 Ga0207657_10896520 Ga0207657_108965201 146
498 3300025920 Ga0207649_10000228 Ga0207649_1000022817 146
499 3300025920 Ga0207649_10030809 Ga0207649_100308092 146
500 3300025920 Ga0207649_10051534 Ga0207649_100515342 146
501 3300025920 Ga0207649_10095091 Ga0207649_100950913 146
502 3300025920 Ga0207649_10163325 Ga0207649_101633252 146
503 3300025920 Ga0207649_10215644 Ga0207649_102156442 146
504 3300025920 Ga0207649_10275246 Ga0207649_102752462 146
505 3300025921 Ga0207652_10535378 Ga0207652_105353782 146
506 3300025921 Ga0207652_10865328 Ga0207652_108653281 146
507 3300025923 Ga0207681_10285687 Ga0207681_102856872 146
508 3300025923 Ga0207681_10465807 Ga0207681_104658072 146
509 3300025923 Ga0207681_10652904 Ga0207681_106529042 146
510 3300025923 Ga0207681_10675964 Ga0207681_106759642 146
511 3300025924 Ga0207694_10064456 Ga0207694_100644564 146
512 3300025924 Ga0207694_10318776 Ga0207694_103187762 146
513 3300025924 Ga0207694_10472494 Ga0207694_104724942 146
514 3300025925 Ga0207650_10016267 Ga0207650_100162675 146
515 3300025925 Ga0207650_10031702 Ga0207650_100317024 146
516 3300025925 Ga0207650_10038759 Ga0207650_100387593 146
517 3300025925 Ga0207650_10065821 Ga0207650_100658213 146
518 3300025925 Ga0207650_10341840 Ga0207650_103418401 146
519 3300025925 Ga0207650_10508840 Ga0207650_105088402 146
520 3300025925 Ga0207650_10970464 Ga0207650_109704642 146
521 3300025926 Ga0207659_10063329 Ga0207659_100633293 146
522 3300025926 Ga0207659_10080609 Ga0207659_100806092 146
523 3300025926 Ga0207659_10106840 Ga0207659_101068403 146
524 3300025926 Ga0207659_10588074 Ga0207659_105880742 146
525 3300025927 Ga0207687_10034393 Ga0207687_100343934 146
526 3300025928 Ga0207700_10808208 Ga0207700_108082082 146
527 3300025929 Ga0207664_10356967 Ga0207664_103569672 146
528 3300025931 Ga0207644_10000181 Ga0207644_100001818 146
529 3300025931 Ga0207644_10001877 Ga0207644_1000187713 146
530 3300025931 Ga0207644_10018566 Ga0207644_100185664 146
531 3300025931 Ga0207644_10088987 Ga0207644_100889872 146
532 3300025931 Ga0207644_10089398 Ga0207644_100893983 146
533 3300025931 Ga0207644_10227120 Ga0207644_102271201 146
534 3300025931 Ga0207644_10297286 Ga0207644_102972863 146
535 3300025932 Ga0207690_10000036 Ga0207690_1000003661 146
536 3300025932 Ga0207690_10023844 Ga0207690_100238445 146
537 3300025932 Ga0207690_10042632 Ga0207690_100426323 146
538 3300025932 Ga0207690_10046139 Ga0207690_100461393 146
539 3300025932 Ga0207690_10100436 Ga0207690_101004362 146
540 3300025932 Ga0207690_10472945 Ga0207690_104729452 146
541 3300025933 Ga0207706_10000343 Ga0207706_100003437 146
542 3300025933 Ga0207706_10006757 Ga0207706_1000675712 146
543 3300025933 Ga0207706_10006809 Ga0207706_100068099 146
544 3300025933 Ga0207706_10008945 Ga0207706_100089457 146
545 3300025933 Ga0207706_10015817 Ga0207706_100158176 146
546 3300025933 Ga0207706_10021335 Ga0207706_100213356 146
547 3300025933 Ga0207706_10035527 Ga0207706_100355275 146
548 3300025933 Ga0207706_10103783 Ga0207706_101037835 146
549 3300025933 Ga0207706_10357078 Ga0207706_103570782 146
550 3300025933 Ga0207706_10618553 Ga0207706_106185532 146
551 3300025934 Ga0207686_10052847 Ga0207686_100528472 146
552 3300025934 Ga0207686_10339310 Ga0207686_103393102 146
553 3300025934 Ga0207686_11458539 Ga0207686_114585391 146
554 3300025935 Ga0207709_10211090 Ga0207709_102110902 146
555 3300025937 Ga0207669_10340766 Ga0207669_103407662 146
556 3300025937 Ga0207669_10757133 Ga0207669_107571331 146
557 3300025937 Ga0207669_10794325 Ga0207669_107943251 146
558 3300025938 Ga0207704_10030292 Ga0207704_100302923 146
559 3300025940 Ga0207691_10011944 Ga0207691_100119449 146
560 3300025940 Ga0207691_10026376 Ga0207691_100263765 146
561 3300025940 Ga0207691_10036392 Ga0207691_100363923 146
562 3300025940 Ga0207691_10043488 Ga0207691_100434886 146
563 3300025940 Ga0207691_10125061 Ga0207691_101250612 146
564 3300025940 Ga0207691_10170254 Ga0207691_101702543 146
565 3300025940 Ga0207691_10595482 Ga0207691_105954822 146
566 3300025941 Ga0207711_10003972 Ga0207711_100039723 146
567 3300025941 Ga0207711_10015244 Ga0207711_100152441 146
568 3300025941 Ga0207711_10015793 Ga0207711_100157937 146
569 3300025941 Ga0207711_10046278 Ga0207711_100462783 146
570 3300025941 Ga0207711_10051335 Ga0207711_100513354 146
571 3300025941 Ga0207711_10117573 Ga0207711_101175733 146
572 3300025941 Ga0207711_10588963 Ga0207711_105889633 146
573 3300025944 Ga0207661_10011054 Ga0207661_100110544 146
574 3300025944 Ga0207661_10254856 Ga0207661_102548563 146
575 3300025944 Ga0207661_11548672 Ga0207661_115486721 146
576 3300025945 Ga0207679_10000093 Ga0207679_1000009362 146
577 3300025945 Ga0207679_10001758 Ga0207679_100017587 146
578 3300025945 Ga0207679_10007795 Ga0207679_100077953 146
579 3300025945 Ga0207679_10014634 Ga0207679_100146342 146
580 3300025945 Ga0207679_10054269 Ga0207679_100542692 146
581 3300025945 Ga0207679_10069614 Ga0207679_100696143 146
582 3300025945 Ga0207679_10234046 Ga0207679_102340462 146
583 3300025945 Ga0207679_10366230 Ga0207679_103662302 146
584 3300025945 Ga0207679_11361267 Ga0207679_113612671 146
585 3300025945 Ga0207679_11431991 Ga0207679_114319912 146
586 3300025949 Ga0207667_10002944 Ga0207667_100029448 146
587 3300025949 Ga0207667_10058823 Ga0207667_100588235 146
588 3300025949 Ga0207667_10273263 Ga0207667_102732632 146
589 3300025949 Ga0207667_10739260 Ga0207667_107392602 146
590 3300025960 Ga0207651_10003789 Ga0207651_1000378910 146
591 3300025960 Ga0207651_10006757 Ga0207651_100067573 146
592 3300025960 Ga0207651_10008254 Ga0207651_100082542 146
593 3300025960 Ga0207651_10026202 Ga0207651_100262023 146
594 3300025960 Ga0207651_10088284 Ga0207651_100882845 146
595 3300025960 Ga0207651_10151837 Ga0207651_101518372 146
596 3300025960 Ga0207651_10514587 Ga0207651_105145872 146
597 3300025972 Ga0207668_10664451 Ga0207668_106644512 146
598 3300025981 Ga0207640_10056467 Ga0207640_100564673 146
599 3300025981 Ga0207640_10059021 Ga0207640_100590212 146
600 3300025981 Ga0207640_10320251 Ga0207640_103202512 146
601 3300025981 Ga0207640_10759536 Ga0207640_107595361 146
602 3300025986 Ga0207658_10000936 Ga0207658_100009369 146
603 3300025986 Ga0207658_10013597 Ga0207658_100135972 146
604 3300025986 Ga0207658_10016927 Ga0207658_100169274 146
605 3300025986 Ga0207658_10090420 Ga0207658_100904201 146
606 3300025986 Ga0207658_10331945 Ga0207658_103319452 146
607 3300026023 Ga0207677_10003694 Ga0207677_100036944 146
608 3300026023 Ga0207677_10020322 Ga0207677_100203223 146
609 3300026023 Ga0207677_10103499 Ga0207677_101034992 146
610 3300026023 Ga0207677_10645846 Ga0207677_106458462 146
611 3300026023 Ga0207677_10759254 Ga0207677_107592542 146
612 3300026035 Ga0207703_10005275 Ga0207703_100052758 146
613 3300026035 Ga0207703_10012855 Ga0207703_100128558 146
614 3300026035 Ga0207703_10020733 Ga0207703_100207334 146
615 3300026035 Ga0207703_10117459 Ga0207703_101174592 146
616 3300026041 Ga0207639_10002879 Ga0207639_100028794 146
617 3300026041 Ga0207639_10620216 Ga0207639_106202162 146
618 3300026041 Ga0207639_10987187 Ga0207639_109871872 146
619 3300026067 Ga0207678_10006618 Ga0207678_100066184 146
620 3300026067 Ga0207678_10009022 Ga0207678_100090223 146
621 3300026067 Ga0207678_10012776 Ga0207678_1001277610 146
622 3300026067 Ga0207678_10065064 Ga0207678_100650643 146
623 3300026067 Ga0207678_10096806 Ga0207678_100968062 146
624 3300026067 Ga0207678_10115281 Ga0207678_101152813 146
625 3300026075 Ga0207708_11446752 Ga0207708_114467521 146
626 3300026078 Ga0207702_10000619 Ga0207702_1000061939 146
627 3300026078 Ga0207702_10243503 Ga0207702_102435033 146
628 3300026078 Ga0207702_10361761 Ga0207702_103617613 146
629 3300026078 Ga0207702_10554585 Ga0207702_105545853 146
630 3300026088 Ga0207641_10011857 Ga0207641_100118573 146
631 3300026088 Ga0207641_10023515 Ga0207641_100235154 146
632 3300026088 Ga0207641_10123333 Ga0207641_101233331 146
633 3300026088 Ga0207641_10145579 Ga0207641_101455792 146
634 3300026089 Ga0207648_10002532 Ga0207648_100025325 146
635 3300026089 Ga0207648_10186172 Ga0207648_101861722 146
636 3300026095 Ga0207676_10003014 Ga0207676_100030144 146
637 3300026095 Ga0207676_10006459 Ga0207676_100064597 146
638 3300026095 Ga0207676_10032425 Ga0207676_100324255 146
639 3300026095 Ga0207676_10076654 Ga0207676_100766542 146
640 3300026095 Ga0207676_10535596 Ga0207676_105355962 146
641 3300026095 Ga0207676_10644856 Ga0207676_106448562 146
642 3300026095 Ga0207676_10874228 Ga0207676_108742282 146
643 3300026116 Ga0207674_10000132 Ga0207674_1000013244 146
644 3300026116 Ga0207674_10244444 Ga0207674_102444442 146
645 3300026116 Ga0207674_11281950 Ga0207674_112819502 146
646 3300026121 Ga0207683_10007992 Ga0207683_100079925 146
647 3300026121 Ga0207683_10057305 Ga0207683_100573053 146
648 3300026121 Ga0207683_10072639 Ga0207683_100726392 146
649 3300026121 Ga0207683_10138551 Ga0207683_101385514 146
650 3300026142 Ga0207698_10010281 Ga0207698_100102814 146
651 3300026142 Ga0207698_10095891 Ga0207698_100958913 146
652 3300026142 Ga0207698_10115760 Ga0207698_101157604 146
653 3300026142 Ga0207698_10130782 Ga0207698_101307823 146
654 3300026142 Ga0207698_10299581 Ga0207698_102995812 146
655 3300026142 Ga0207698_11566110 Ga0207698_115661101 146
656 3300026142 Ga0207698_11793683 Ga0207698_117936832 146
657 3300028379 Ga0268266_10017931 Ga0268266_100179318 146
658 3300028379 Ga0268266_10030004 Ga0268266_100300042 146
659 3300028379 Ga0268266_10157673 Ga0268266_101576733 146
660 3300028379 Ga0268266_10268011 Ga0268266_102680113 146
661 3300028379 Ga0268266_10573797 Ga0268266_105737973 146
662 3300028381 Ga0268264_10098032 Ga0268264_100980322 146
663 3300028381 Ga0268264_10197775 Ga0268264_101977753 146
664 3300028381 Ga0268264_10654756 Ga0268264_106547562 146
665 3300031548 Ga0307408_100075623 Ga0307408_1000756232 146
666 3300031548 Ga0307408_100248924 Ga0307408_1002489242 146
667 3300031731 Ga0307405_10007143 Ga0307405_100071433 146
668 3300031731 Ga0307405_10135857 Ga0307405_101358572 146
669 3300031824 Ga0307413_10045791 Ga0307413_100457912 146
670 3300031824 Ga0307413_10603139 Ga0307413_106031392 146
671 3300031824 Ga0307413_10635945 Ga0307413_106359452 146
672 3300031824 Ga0307413_11632556 Ga0307413_116325562 146
673 3300031852 Ga0307410_10011217 Ga0307410_100112173 146
674 3300031852 Ga0307410_10012882 Ga0307410_100128822 146
675 3300031852 Ga0307410_10177118 Ga0307410_101771182 146
676 3300031852 Ga0307410_10211986 Ga0307410_102119862 146
677 3300031852 Ga0307410_10939133 Ga0307410_109391331 146
678 3300031852 Ga0307410_11005237 Ga0307410_110052371 146
679 3300031901 Ga0307406_10322822 Ga0307406_103228222 146
680 3300031903 Ga0307407_10121166 Ga0307407_101211662 146
681 3300031903 Ga0307407_10520740 Ga0307407_105207402 146
682 3300031903 Ga0307407_10667041 Ga0307407_106670411 146
683 3300031903 Ga0307407_11310819 Ga0307407_113108191 146
684 3300031911 Ga0307412_10954048 Ga0307412_109540482 146
685 3300031995 Ga0307409_100004656 Ga0307409_1000046567 146
686 3300031995 Ga0307409_100033957 Ga0307409_1000339572 146
687 3300031995 Ga0307409_100171667 Ga0307409_1001716672 146
688 3300031995 Ga0307409_100626221 Ga0307409_1006262212 146
689 3300031995 Ga0307409_101575009 Ga0307409_1015750091 146
690 3300031995 Ga0307409_101758536 Ga0307409_1017585362 146
691 3300032002 Ga0307416_100004801 Ga0307416_1000048014 146
692 3300032002 Ga0307416_100056142 Ga0307416_1000561423 146
693 3300032002 Ga0307416_100226339 Ga0307416_1002263391 146
694 3300032002 Ga0307416_100971884 Ga0307416_1009718842 146
695 3300032002 Ga0307416_101134306 Ga0307416_1011343061 146
696 3300032002 Ga0307416_101185365 Ga0307416_1011853652 146
697 3300032004 Ga0307414_10045411 Ga0307414_100454112 146
698 3300032004 Ga0307414_10070467 Ga0307414_100704672 146
699 3300032004 Ga0307414_10072426 Ga0307414_100724263 146
700 3300032004 Ga0307414_10320960 Ga0307414_103209602 146
701 3300032004 Ga0307414_10546479 Ga0307414_105464792 146
702 3300032004 Ga0307414_12147776 Ga0307414_121477761 146
703 3300032005 Ga0307411_10040192 Ga0307411_100401921 146
704 3300032005 Ga0307411_10072858 Ga0307411_100728582 146
705 3300032005 Ga0307411_10095117 Ga0307411_100951172 146
706 3300032005 Ga0307411_10261165 Ga0307411_102611652 146
707 3300032005 Ga0307411_10384429 Ga0307411_103844292 146
708 3300032126 Ga0307415_100004436 Ga0307415_1000044363 146
709 3300032126 Ga0307415_100011638 Ga0307415_1000116388 146
710 3300032126 Ga0307415_100014441 Ga0307415_1000144414 146
711 3300032126 Ga0307415_100018715 Ga0307415_1000187152 146
712 3300032126 Ga0307415_100087487 Ga0307415_1000874873 146
713 3300032126 Ga0307415_100191250 Ga0307415_1001912503 146
714 3300032126 Ga0307415_102170721 Ga0307415_1021707211 146
715 3300034818 Ga0373950_0066784 Ga0373950_0066784_137_580 146
716 3300034819 Ga0373958_0094444 Ga0373958_0094444_174_617 146
717 3300034957 Ga0373938_0177178 Ga0373938_0177178_21_464 146
718 3300035090 Ga0373949_0078032 Ga0373949_0078032_340_783 146
719 3300035114 Ga0373939_0052601 Ga0373939_0052601_740_1183 146
720 3300035115 Ga0373941_0389358 Ga0373941_0389358_14_457 146
721 3300035121 Ga0373960_0006755 Ga0373960_0006755_1508_1951 146
722 3300035121 Ga0373960_0091583 Ga0373960_0091583_366_809 146
723 3300035207 Ga0373942_0044769 Ga0373942_0044769_233_676 146
724 3300035242 Ga0373962_0045739 Ga0373962_0045739_389_832 146
725 3300035691 Ga0373931_0036991 Ga0373931_0036991_217_660 146
726 3300035691 Ga0373931_0198722 Ga0373931_0198722_411_854 146
727 3300035691 Ga0373931_0230950 Ga0373931_0230950_360_803 146
728 3300035691 Ga0373931_0273058 Ga0373931_0273058_58_501 146
729 3300035725 Ga0373947_0383316 Ga0373947_0383316_429_872 146
730 3300036401 Ga0373937_0166091 Ga0373937_0166091_1098_1541 146
731 3300037312 Ga0395899_0051869 Ga0395899_0051869_1538_1981 146
732 3300037312 Ga0395899_0063518 Ga0395899_0063518_390_833 146
733 3300037312 Ga0395899_0085583 Ga0395899_0085583_1225_1668 146
734 3300037312 Ga0395899_0087697 Ga0395899_0087697_1588_2031 146
735 3300037312 Ga0395899_0097811 Ga0395899_0097811_1111_1554 146
736 3300037312 Ga0395899_0115661 Ga0395899_0115661_298_741 146
737 3300037312 Ga0395899_0288729 Ga0395899_0288729_62_505 146
738 3300037312 Ga0395899_0323992 Ga0395899_0323992_37_480 146
739 3300037312 Ga0395899_0374852 Ga0395899_0374852_457_900 146
740 3300037312 Ga0395899_0516649 Ga0395899_0516649_275_718 146
741 3300037312 Ga0395899_0531097 Ga0395899_0531097_25_468 146
742 3300037418 Ga0395900_0000530 Ga0395900_0000530_30455_30898 146
743 3300037418 Ga0395900_0035419 Ga0395900_0035419_393_836 146
744 3300037418 Ga0395900_0047919 Ga0395900_0047919_3653_4096 146
745 3300037418 Ga0395900_0057291 Ga0395900_0057291_150_593 146
746 3300037418 Ga0395900_0127555 Ga0395900_0127555_291_734 146
747 3300037418 Ga0395900_0142994 Ga0395900_0142994_694_1137 146
748 3300037418 Ga0395900_0208799 Ga0395900_0208799_1459_1902 146
749 3300037418 Ga0395900_0209526 Ga0395900_0209526_1280_1723 146
750 3300037418 Ga0395900_0212857 Ga0395900_0212857_865_1308 146
751 3300037418 Ga0395900_0241463 Ga0395900_0241463_787_1230 146
752 3300037418 Ga0395900_0328665 Ga0395900_0328665_189_632 146
753 3300037418 Ga0395900_0548453 Ga0395900_0548453_186_629 146
754 3300037418 Ga0395900_0618040 Ga0395900_0618040_569_1012 146
755 3300037418 Ga0395900_0766719 Ga0395900_0766719_330_788 146
756 3300037418 Ga0395900_0947215 Ga0395900_0947215_104_547 146
757 3300037418 Ga0395900_0977471 Ga0395900_0977471_46_489 146
758 3300037466 Ga0395898_0019899 Ga0395898_0019899_2167_2610 146
759 3300037466 Ga0395898_0034350 Ga0395898_0034350_1459_1902 146
760 3300037466 Ga0395898_0108317 Ga0395898_0108317_269_712 146
761 3300037466 Ga0395898_0163504 Ga0395898_0163504_1062_1505 146
762 3300037466 Ga0395898_0169515 Ga0395898_0169515_1617_2060 146
763 3300037466 Ga0395898_0324705 Ga0395898_0324705_498_941 146
764 3300037466 Ga0395898_0610946 Ga0395898_0610946_289_732 146
765 3300037466 Ga0395898_0790396 Ga0395898_0790396_180_623 146
766 3300037471 Ga0395905_0001285 Ga0395905_0001285_25063_25506 146
767 3300037471 Ga0395905_0002000 Ga0395905_0002000_21277_21720 146
768 3300037471 Ga0395905_0012346 Ga0395905_0012346_1121_1564 146
769 3300037471 Ga0395905_0016638 Ga0395905_0016638_3249_3692 146
770 3300037471 Ga0395905_0020055 Ga0395905_0020055_4567_5010 146
771 3300037471 Ga0395905_0040653 Ga0395905_0040653_2718_3161 146
772 3300037471 Ga0395905_0050007 Ga0395905_0050007_647_1090 146
773 3300037471 Ga0395905_0063997 Ga0395905_0063997_324_767 146
774 3300037471 Ga0395905_0070728 Ga0395905_0070728_2074_2517 146
775 3300037471 Ga0395905_0076302 Ga0395905_0076302_913_1356 146
776 3300037471 Ga0395905_0083650 Ga0395905_0083650_2486_2929 146
777 3300037471 Ga0395905_0268351 Ga0395905_0268351_260_703 146
778 3300037471 Ga0395905_0296571 Ga0395905_0296571_516_959 146
779 3300037471 Ga0395905_0449394 Ga0395905_0449394_401_844 146
780 3300037471 Ga0395905_0662307 Ga0395905_0662307_189_632 146
781 3300038443 Ga0395901_0002214 Ga0395901_0002214_15783_16226 146
782 3300038443 Ga0395901_0034525 Ga0395901_0034525_2841_3284 146
783 3300038443 Ga0395901_0058940 Ga0395901_0058940_2625_3068 146
784 3300038443 Ga0395901_0151827 Ga0395901_0151827_111_554 146
785 3300038443 Ga0395901_0153083 Ga0395901_0153083_636_1079 146
786 3300038443 Ga0395901_0200715 Ga0395901_0200715_1098_1541 146
787 3300038443 Ga0395901_0215909 Ga0395901_0215909_1086_1529 146
788 3300038443 Ga0395901_0232696 Ga0395901_0232696_383_826 146
789 3300038443 Ga0395901_0416867 Ga0395901_0416867_65_508 146
790 3300038443 Ga0395901_0458290 Ga0395901_0458290_348_791 146
791 3300038443 Ga0395901_0680903 Ga0395901_0680903_393_836 146
792 3300039437 Ga0436365_1673329 Ga0436365_1673329_683_1126 146
793 3300041413 Ga0439465_0168962 Ga0439465_0168962_30_473 146
794 3300041460 Ga0451802_0202772 Ga0451802_0202772_158_601 146
795 3300042006 Ga0439432_017692 Ga0439432_017692_1308_1751 146
796 3300042007 Ga0439449_0031141 Ga0439449_0031141_1319_1762 146
797 3300042144 Ga0450889_013711 Ga0450889_013711_95_538 146
798 3300042157 Ga0439458_0009596 Ga0439458_0009596_453_896 146
799 3300042157 Ga0439458_0010913 Ga0439458_0010913_226_669 146
800 3300044656 Ga0466969_0249056 Ga0466969_0249056_332_775 146
801 3300044658 Ga0466972_0239889 Ga0466972_0239889_196_639 146
802 3300044658 Ga0466972_0437322 Ga0466972_0437322_106_549 146
803 3300044684 Ga0466966_0017961 Ga0466966_0017961_4026_4469 146
804 3300044684 Ga0466966_0020650 Ga0466966_0020650_2853_3296 146
805 3300044684 Ga0466966_0113609 Ga0466966_0113609_191_634 146
806 3300044693 Ga0466961_0020251 Ga0466961_0020251_2488_2931 146
807 3300044694 Ga0466963_0097924 Ga0466963_0097924_1035_1478 146
808 3300044694 Ga0466963_0168877 Ga0466963_0168877_260_703 146
809 3300044706 Ga0466964_0071145 Ga0466964_0071145_103_546 146
810 3300044719 Ga0466971_0019546 Ga0466971_0019546_81_524 146
811 3300044719 Ga0466971_0053303 Ga0466971_0053303_911_1354 146
812 3300044719 Ga0466971_0475424 Ga0466971_0475424_60_503 146
813 3300044765 Ga0466970_0109101 Ga0466970_0109101_232_675 146
814 3300044765 Ga0466970_0153439 Ga0466970_0153439_93_536 146
815 3300044765 Ga0466970_0479640 Ga0466970_0479640_87_530 146
816 3300044842 Ga0466957_0028508 Ga0466957_0028508_1770_2213 146
817 3300044842 Ga0466957_0251517 Ga0466957_0251517_721_1164 146
818 3300045049 Ga0466959_0186737 Ga0466959_0186737_950_1393 146
819 3300045049 Ga0466959_0243185 Ga0466959_0243185_715_1158 146
820 3300045836 Ga0466958_0015179 Ga0466958_0015179_2630_3073 146
821 3300045836 Ga0466958_0119555 Ga0466958_0119555_797_1240 146
822 3300045976 Ga0466967_0000133 Ga0466967_0000133_15744_16187 146
823 3300045976 Ga0466967_0016030 Ga0466967_0016030_304_747 146
824 3300045976 Ga0466967_0217624 Ga0466967_0217624_1241_1684 146
825 3300045976 Ga0466967_0928497 Ga0466967_0928497_317_760 146
826 3300045976 Ga0466967_1904860 Ga0466967_1904860_90_533 146
827 3300046522 Ga0495643_0099815 Ga0495643_0099815_202_645 146
828 3300046525 Ga0495663_0172079 Ga0495663_0172079_22_465 146
829 3300046537 Ga0495598_0095684 Ga0495598_0095684_275_718 146
830 3300046558 Ga0495633_0099202 Ga0495633_0099202_214_657 146
831 3300046684 Ga0495669_0006895 Ga0495669_0006895_3519_3962 146
832 3300046684 Ga0495669_0020688 Ga0495669_0020688_2332_2775 146
833 3300046684 Ga0495669_0190206 Ga0495669_0190206_51_494 146
834 3300046684 Ga0495669_0493800 Ga0495669_0493800_112_555 146
835 3300046809 Ga0495600_0209187 Ga0495600_0209187_342_785 146
836 3300047445 Ga0495677_0074862 Ga0495677_0074862_802_1245 146
837 3300048903 Ga0496100_0053864 Ga0496100_0053864_251_694 146
838 3300048903 Ga0496100_0442067 Ga0496100_0442067_250_693 146
839 3300048904 Ga0496101_0194474 Ga0496101_0194474_1078_1521 146
840 3300048904 Ga0496101_0273706 Ga0496101_0273706_223_666 146
841 3300048904 Ga0496101_0424833 Ga0496101_0424833_73_516 146
842 3300048904 Ga0496101_0803287 Ga0496101_0803287_26_469 146
843 3300048905 Ga0496102_0147832 Ga0496102_0147832_123_566 146
844 3300048905 Ga0496102_0753659 Ga0496102_0753659_188_631 146
845 3300048907 Ga0496104_0094439 Ga0496104_0094439_2039_2482 146
846 3300048908 Ga0496105_0085975 Ga0496105_0085975_1729_2172 146
847 3300048908 Ga0496105_0538191 Ga0496105_0538191_36_479 146
848 3300048909 Ga0496106_0026741 Ga0496106_0026741_2214_2657 146
849 3300048909 Ga0496106_0211061 Ga0496106_0211061_134_577 146
850 3300048909 Ga0496106_0890964 Ga0496106_0890964_195_638 146
851 3300048910 Ga0496107_0022684 Ga0496107_0022684_1969_2412 146
852 3300048910 Ga0496107_0063532 Ga0496107_0063532_1275_1718 146
853 3300048910 Ga0496107_0088032 Ga0496107_0088032_634_1077 146
854 3300048910 Ga0496107_0283747 Ga0496107_0283747_654_1097 146
855 3300048911 Ga0496108_0002219 Ga0496108_0002219_13339_13782 146
856 3300048911 Ga0496108_0027261 Ga0496108_0027261_1508_1951 146
857 3300048911 Ga0496108_0056962 Ga0496108_0056962_2719_3162 146
858 3300048911 Ga0496108_0063721 Ga0496108_0063721_1754_2197 146
859 3300048912 Ga0496109_0004027 Ga0496109_0004027_5922_6365 146
860 3300048912 Ga0496109_0039886 Ga0496109_0039886_2581_3024 146
861 3300048912 Ga0496109_0284555 Ga0496109_0284555_62_505 146
862 3300048912 Ga0496109_0460580 Ga0496109_0460580_300_743 146
863 3300048912 Ga0496109_0589191 Ga0496109_0589191_163_606 146
864 3300048912 Ga0496109_1317221 Ga0496109_1317221_117_560 146
865 3300048913 Ga0496110_0039477 Ga0496110_0039477_1647_2090 146
866 3300048913 Ga0496110_0062847 Ga0496110_0062847_2123_2566 146
867 3300048913 Ga0496110_0087018 Ga0496110_0087018_968_1411 146
868 3300048913 Ga0496110_0362117 Ga0496110_0362117_809_1252 146
869 3300048913 Ga0496110_0781276 Ga0496110_0781276_224_664 146
870 3300048914 Ga0496111_0007256 Ga0496111_0007256_1061_1504 146
871 3300048914 Ga0496111_0009171 Ga0496111_0009171_4033_4476 146
872 3300048914 Ga0496111_0039141 Ga0496111_0039141_2121_2564 146
873 3300048914 Ga0496111_0041554 Ga0496111_0041554_2518_2961 146
874 3300048914 Ga0496111_1119477 Ga0496111_1119477_37_480 146
875 3300048915 Ga0496112_0034765 Ga0496112_0034765_1749_2192 146
876 3300048915 Ga0496112_0089098 Ga0496112_0089098_1399_1842 146
877 3300048915 Ga0496112_0110085 Ga0496112_0110085_1045_1488 146
878 3300048916 Ga0496113_0010984 Ga0496113_0010984_3751_4194 146
879 3300048916 Ga0496113_0076150 Ga0496113_0076150_546_989 146
880 3300048917 Ga0496114_0000023 Ga0496114_0000023_116756_117199 146
881 3300048917 Ga0496114_0370472 Ga0496114_0370472_480_923 146
882 3300049581 Ga0501047_0382111 Ga0501047_0382111_642_1085 146
883 3300049584 Ga0501068_0138345 Ga0501068_0138345_350_793 146
884 3300049585 Ga0501069_0009266 Ga0501069_0009266_812_1255 146
885 3300049590 Ga0501074_0172965 Ga0501074_0172965_176_619 146
886 3300049668 Ga0501233_134127 Ga0501233_134127_160_600 146
887 3300049742 Ga0501080_1140263 Ga0501080_1140263_100_543 146
888 3300049822 Ga0501035_0863910 Ga0501035_0863910_244_687 146
889 3300049823 Ga0501044_0395742 Ga0501044_0395742_522_965 146
890 3300049851 Ga0501212_007233 Ga0501212_007233_955_1395 146
891 3300050489 nmdc:mga03683_446129_c1 nmdc:mga03683_446129_c1_165_608 146
892 3300050493 nmdc:mga0k408_109384_c1 nmdc:mga0k408_109384_c1_653_1096 146
893 3300061719 Ga0466962_0012233 Ga0466962_0012233_2337_2780 146
894 3300061719 Ga0466962_0054321 Ga0466962_0054321_73_516 146
895 3300061719 Ga0466962_0233455 Ga0466962_0233455_307_750 146
896 3300061734 Ga0530510_0902909 Ga0530510_0902909_132_575 146

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01047

MarR

MarR family

46

104

0.98

PF12802

MarR_2

MarR family

44

103

0.98

PF13463

HTH_27

Winged helix DNA-binding domain

46

112

0.96

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

47

93

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5duk-assembly1.cif.gz_A n-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05 0.9648 32 81
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9552 31 91
4hob-assembly1.cif.gz_A the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9519 31 72
4hob-assembly2.cif.gz_C the crystal structure of the zalpha domain from cyprinid herpes virus 3 0.9453 31 72
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.9435 32 90
ID Description Score Start End Superfamily
5dukB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9719 32 71 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9664 28 89 1.10.10.10
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9552 31 91 1.10.10.10
4hobA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 31 72 1.10.10.10
af_P30852_292_361_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9519 44 75 1.10.10.10
ID Description Score Start End GO Terms
AF-K2K7R1-F1-model_v4 Transcriptional regulator, MarR family protein 0.9751 4 136 GO:0003677
GO:0003700
AF-A0A0T1WPN2-F1-model_v4 MarR family transcriptional regulator 0.965 1 137 GO:0003700
AF-A0A4R1RGL7-F1-model_v4 DNA-binding MarR family transcriptional regulator 0.9647 1 137 GO:0003677
GO:0003700
GO:0006950
AF-A0A537NP25-F1-model_v4 MarR family transcriptional regulator 0.9628 3 137 GO:0003677
GO:0003700
GO:0006950
AF-A0A845FRW5-F1-model_v4 MarR family transcriptional regulator 0.9609 2 136 GO:0003677
GO:0003700
GO:0006950

Feature Viewer

pLDDT pTM Quality
92.12 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map