F484895
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 892 | 301 | 1784 | 161 |
Family's Representative Sequence
| Representative Sequence | 3300046472|Ga0495580_0431528|Ga0495580_0431528_208_765 |
| Length | 185 |
| Sequence | MYYRFASGNGRVPVDVTCSHLMTPSPTFSDVKKEIDRLNQAAGSVEDFMWETVKLLHDRMLKYNWVGFYMLEDKSPDSQPRMLALGPFQGAMTPHTRIPLNQGICGAAATTGKTIVVDDVTLDNRYLACSTETKSEIVVPVFVRNKVVGELDVDSHFPAAFGDQDRELVEYCASLVGKQLEKLPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 85 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 93 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 132 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 133 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 134 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 200 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 201 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 209 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 210 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 211 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 212 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 213 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 214 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 215 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 217 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 218 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 221 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 222 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 223 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 224 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 225 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 226 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 227 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 229 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 230 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 232 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 233 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 236 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 240 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 242 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 243 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 244 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 245 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 246 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 247 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 249 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 250 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 251 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 252 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 253 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 254 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 255 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 278 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 279 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 280 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 285 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 286 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 287 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 288 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 289 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 290 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 291 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 295 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.99 |
| Metatranscriptomes | 1.01 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.11 |
| Nodule | 0 |
| Rhizoplane | 6.84 |
| Rhizosphere | 92.49 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495580_0431528 | 3300046472 | Bacteria | 886 |
| 2 | MBSR1b_contig_12289486 | 2162886012 | Unclassified | 934 |
| 3 | MBSR1b_contig_14142699 | 2162886012 | Bacteria | 1307 |
| 4 | MBSR1b_contig_14292732 | 2162886012 | Bacteria | 1095 |
| 5 | MBSR1b_contig_5587874 | 2162886012 | Bacteria | 2114 |
| 6 | LJNas_1001182 | 3300000546 | Bacteria | 3955 |
| 7 | JGI24737J22298_10063201 | 3300001990 | Bacteria | 1111 |
| 8 | JGI24743J22301_10012727 | 3300001991 | Bacteria | 1535 |
| 9 | JGI24034J26672_10017411 | 3300002239 | Bacteria | 1112 |
| 10 | JGI24751J29686_10004031 | 3300002459 | Bacteria | 2973 |
| 11 | rootH2_10227596 | 3300003320 | Unclassified | 1232 |
| 12 | rootH1_10403911 | 3300003323 | Bacteria | 1331 |
| 13 | Ga0065712_10092655 | 3300005290 | Bacteria | 2323 |
| 14 | Ga0065712_10352935 | 3300005290 | Unclassified | 785 |
| 15 | Ga0065715_10119611 | 3300005293 | Bacteria | 2282 |
| 16 | Ga0065715_10140426 | 3300005293 | Bacteria | 1862 |
| 17 | Ga0065715_10187153 | 3300005293 | Bacteria | 1438 |
| 18 | Ga0070658_10115792 | 3300005327 | Bacteria | 2224 |
| 19 | Ga0070658_10305551 | 3300005327 | Unclassified | 1357 |
| 20 | Ga0070676_10047767 | 3300005328 | Bacteria | 2501 |
| 21 | Ga0070676_10114591 | 3300005328 | Bacteria | 1683 |
| 22 | Ga0070676_10240739 | 3300005328 | Unclassified | 1203 |
| 23 | Ga0070683_100104197 | 3300005329 | Bacteria | 2673 |
| 24 | Ga0070683_100107295 | 3300005329 | Bacteria | 2633 |
| 25 | Ga0070690_100019935 | 3300005330 | Bacteria | 4080 |
| 26 | Ga0070690_100151190 | 3300005330 | Bacteria | 1584 |
| 27 | Ga0070670_100026528 | 3300005331 | Bacteria | 4984 |
| 28 | Ga0070670_100452666 | 3300005331 | Unclassified | 1138 |
| 29 | Ga0070677_10012562 | 3300005333 | Bacteria | 2943 |
| 30 | Ga0070677_10034842 | 3300005333 | Bacteria | 1947 |
| 31 | Ga0068869_100002319 | 3300005334 | Bacteria | 11450 |
| 32 | Ga0068869_100026540 | 3300005334 | Bacteria | 4033 |
| 33 | Ga0068869_100073707 | 3300005334 | Bacteria | 2532 |
| 34 | Ga0070666_10013454 | 3300005335 | Bacteria | 5193 |
| 35 | Ga0070666_10034660 | 3300005335 | Bacteria | 3345 |
| 36 | Ga0070666_10141130 | 3300005335 | Bacteria | 1678 |
| 37 | Ga0070680_100063061 | 3300005336 | Bacteria | 3035 |
| 38 | Ga0070680_100076099 | 3300005336 | Bacteria | 2763 |
| 39 | Ga0070680_100515132 | 3300005336 | Bacteria | 1024 |
| 40 | Ga0070680_100625488 | 3300005336 | Unclassified | 924 |
| 41 | Ga0070682_100008588 | 3300005337 | Bacteria | 5767 |
| 42 | Ga0070682_100125217 | 3300005337 | Bacteria | 1731 |
| 43 | Ga0070682_100438374 | 3300005337 | Unclassified | 997 |
| 44 | Ga0070682_101053414 | 3300005337 | Unclassified | 678 |
| 45 | Ga0068868_100004356 | 3300005338 | Bacteria | 9923 |
| 46 | Ga0068868_100006106 | 3300005338 | Bacteria | 8511 |
| 47 | Ga0068868_100006804 | 3300005338 | Bacteria | 8118 |
| 48 | Ga0068868_100049472 | 3300005338 | Bacteria | 3299 |
| 49 | Ga0068868_100265133 | 3300005338 | Unclassified | 1450 |
| 50 | Ga0068868_100322094 | 3300005338 | Unclassified | 1317 |
| 51 | Ga0070660_100071577 | 3300005339 | Bacteria | 2707 |
| 52 | Ga0070660_100134103 | 3300005339 | Bacteria | 1983 |
| 53 | Ga0070689_100009760 | 3300005340 | Bacteria | 6818 |
| 54 | Ga0070689_100763003 | 3300005340 | Unclassified | 848 |
| 55 | Ga0070689_101009762 | 3300005340 | Unclassified | 740 |
| 56 | Ga0070689_101016024 | 3300005340 | Bacteria | 738 |
| 57 | Ga0070687_100006630 | 3300005343 | Bacteria | 4758 |
| 58 | Ga0070661_100013287 | 3300005344 | Bacteria | 5779 |
| 59 | Ga0070661_100043647 | 3300005344 | Unclassified | 3275 |
| 60 | Ga0070692_10112780 | 3300005345 | Bacteria | 1506 |
| 61 | Ga0070668_100026551 | 3300005347 | Unclassified | 4395 |
| 62 | Ga0070668_100141409 | 3300005347 | Bacteria | 1939 |
| 63 | Ga0070669_100143075 | 3300005353 | Bacteria | 1845 |
| 64 | Ga0070669_100243108 | 3300005353 | Bacteria | 1431 |
| 65 | Ga0070675_100021889 | 3300005354 | Bacteria | 5108 |
| 66 | Ga0070675_100439005 | 3300005354 | Bacteria | 1169 |
| 67 | Ga0070671_100096198 | 3300005355 | Unclassified | 2483 |
| 68 | Ga0070671_100337418 | 3300005355 | Bacteria | 1285 |
| 69 | Ga0070674_100018421 | 3300005356 | Bacteria | 4415 |
| 70 | Ga0070674_100586601 | 3300005356 | Unclassified | 940 |
| 71 | Ga0070673_100010209 | 3300005364 | Bacteria | 6344 |
| 72 | Ga0070673_100550303 | 3300005364 | Bacteria | 1048 |
| 73 | Ga0070688_100065322 | 3300005365 | Bacteria | 2312 |
| 74 | Ga0070688_100079617 | 3300005365 | Bacteria | 2117 |
| 75 | Ga0070659_100003788 | 3300005366 | Bacteria | 10791 |
| 76 | Ga0070659_100004572 | 3300005366 | Bacteria | 9894 |
| 77 | Ga0070659_100023398 | 3300005366 | Bacteria | 4727 |
| 78 | Ga0070659_100396095 | 3300005366 | Bacteria | 1165 |
| 79 | Ga0070667_100024022 | 3300005367 | Bacteria | 5063 |
| 80 | Ga0070667_100097809 | 3300005367 | Bacteria | 2532 |
| 81 | Ga0070667_100460754 | 3300005367 | Bacteria | 1162 |
| 82 | Ga0070709_10000312 | 3300005434 | Bacteria | 30748 |
| 83 | Ga0070709_10011171 | 3300005434 | Bacteria | 4995 |
| 84 | Ga0070709_10095300 | 3300005434 | Bacteria | 1971 |
| 85 | Ga0070709_10186443 | 3300005434 | Unclassified | 1461 |
| 86 | Ga0070709_10197918 | 3300005434 | Bacteria | 1421 |
| 87 | Ga0070709_10211451 | 3300005434 | Unclassified | 1379 |
| 88 | Ga0070709_10261333 | 3300005434 | Bacteria | 1251 |
| 89 | Ga0070709_10505123 | 3300005434 | Bacteria | 919 |
| 90 | Ga0070709_10667765 | 3300005434 | Unclassified | 806 |
| 91 | Ga0070714_100000060 | 3300005435 | Bacteria | 100913 |
| 92 | Ga0070714_100003931 | 3300005435 | Bacteria | 11172 |
| 93 | Ga0070714_100290592 | 3300005435 | Bacteria | 1521 |
| 94 | Ga0070714_100494263 | 3300005435 | Bacteria | 1166 |
| 95 | Ga0070714_100549632 | 3300005435 | Unclassified | 1105 |
| 96 | Ga0070714_100717321 | 3300005435 | Unclassified | 965 |
| 97 | Ga0070714_100862468 | 3300005435 | Unclassified | 878 |
| 98 | Ga0070713_100000162 | 3300005436 | Bacteria | 45425 |
| 99 | Ga0070713_100000344 | 3300005436 | Bacteria | 30312 |
| 100 | Ga0070713_100018136 | 3300005436 | Bacteria | 5347 |
| 101 | Ga0070713_100028068 | 3300005436 | Bacteria | 4440 |
| 102 | Ga0070713_100031349 | 3300005436 | Unclassified | 4234 |
| 103 | Ga0070713_100091091 | 3300005436 | Bacteria | 2622 |
| 104 | Ga0070713_100191702 | 3300005436 | Bacteria | 1842 |
| 105 | Ga0070713_100197806 | 3300005436 | Bacteria | 1814 |
| 106 | Ga0070713_100681451 | 3300005436 | Bacteria | 981 |
| 107 | Ga0070713_100712049 | 3300005436 | Bacteria | 959 |
| 108 | Ga0070710_10001044 | 3300005437 | Bacteria | 13170 |
| 109 | Ga0070710_10009785 | 3300005437 | Bacteria | 4697 |
| 110 | Ga0070710_10075136 | 3300005437 | Unclassified | 1957 |
| 111 | Ga0070710_10085744 | 3300005437 | Bacteria | 1848 |
| 112 | Ga0070710_10137689 | 3300005437 | Bacteria | 1494 |
| 113 | Ga0070710_10204247 | 3300005437 | Bacteria | 1249 |
| 114 | Ga0070710_10286213 | 3300005437 | Unclassified | 1071 |
| 115 | Ga0070710_10619239 | 3300005437 | Bacteria | 755 |
| 116 | Ga0070711_100000231 | 3300005439 | Bacteria | 29031 |
| 117 | Ga0070711_100004865 | 3300005439 | Bacteria | 7973 |
| 118 | Ga0070711_100045235 | 3300005439 | Unclassified | 2993 |
| 119 | Ga0070711_100051480 | 3300005439 | Bacteria | 2828 |
| 120 | Ga0070711_100061715 | 3300005439 | Bacteria | 2610 |
| 121 | Ga0070711_100079194 | 3300005439 | Bacteria | 2336 |
| 122 | Ga0070711_100132561 | 3300005439 | Bacteria | 1858 |
| 123 | Ga0070711_100372206 | 3300005439 | Unclassified | 1153 |
| 124 | Ga0070711_100600854 | 3300005439 | Bacteria | 918 |
| 125 | Ga0070711_101334202 | 3300005439 | Unclassified | 623 |
| 126 | Ga0070700_101257518 | 3300005441 | Unclassified | 620 |
| 127 | Ga0070708_100001600 | 3300005445 | Bacteria | 17349 |
| 128 | Ga0070708_100005188 | 3300005445 | Bacteria | 10314 |
| 129 | Ga0070708_100115232 | 3300005445 | Unclassified | 2474 |
| 130 | Ga0070708_100244435 | 3300005445 | Bacteria | 1685 |
| 131 | Ga0070708_100391009 | 3300005445 | Bacteria | 1311 |
| 132 | Ga0070708_100434497 | 3300005445 | Bacteria | 1238 |
| 133 | Ga0070663_100006281 | 3300005455 | Bacteria | 7129 |
| 134 | Ga0070678_100164903 | 3300005456 | Bacteria | 1799 |
| 135 | Ga0070678_100691800 | 3300005456 | Unclassified | 918 |
| 136 | Ga0070678_100887980 | 3300005456 | Bacteria | 814 |
| 137 | Ga0070662_100005657 | 3300005457 | Bacteria | 7997 |
| 138 | Ga0070662_100056787 | 3300005457 | Bacteria | 2842 |
| 139 | Ga0070681_10005365 | 3300005458 | Bacteria | 12377 |
| 140 | Ga0070681_10061088 | 3300005458 | Bacteria | 3745 |
| 141 | Ga0070681_10119342 | 3300005458 | Bacteria | 2573 |
| 142 | Ga0070681_10287040 | 3300005458 | Bacteria | 1556 |
| 143 | Ga0070681_10855764 | 3300005458 | Unclassified | 827 |
| 144 | Ga0068867_100006383 | 3300005459 | Bacteria | 8334 |
| 145 | Ga0068867_100040007 | 3300005459 | Bacteria | 3420 |
| 146 | Ga0070685_10006397 | 3300005466 | Bacteria | 6004 |
| 147 | Ga0070706_100005888 | 3300005467 | Bacteria | 11620 |
| 148 | Ga0070706_100012684 | 3300005467 | Bacteria | 7797 |
| 149 | Ga0070706_100015107 | 3300005467 | Bacteria | 7131 |
| 150 | Ga0070706_100433856 | 3300005467 | Bacteria | 1223 |
| 151 | Ga0070707_100021616 | 3300005468 | Bacteria | 6083 |
| 152 | Ga0070707_100238876 | 3300005468 | Unclassified | 1769 |
| 153 | Ga0070698_100016133 | 3300005471 | Bacteria | 7888 |
| 154 | Ga0070698_100021148 | 3300005471 | Bacteria | 6817 |
| 155 | Ga0070698_100068413 | 3300005471 | Bacteria | 3569 |
| 156 | Ga0070699_100000358 | 3300005518 | Bacteria | 44500 |
| 157 | Ga0070699_100006278 | 3300005518 | Bacteria | 10370 |
| 158 | Ga0070699_100096103 | 3300005518 | Unclassified | 2595 |
| 159 | Ga0070699_100223728 | 3300005518 | Bacteria | 1677 |
| 160 | Ga0070679_100169393 | 3300005530 | Unclassified | 2157 |
| 161 | Ga0070679_100196092 | 3300005530 | Bacteria | 1987 |
| 162 | Ga0070679_100323076 | 3300005530 | Bacteria | 1492 |
| 163 | Ga0070679_100352747 | 3300005530 | Bacteria | 1419 |
| 164 | Ga0070679_100611566 | 3300005530 | Bacteria | 1033 |
| 165 | Ga0070684_100005271 | 3300005535 | Bacteria | 9892 |
| 166 | Ga0070684_100018826 | 3300005535 | Bacteria | 5698 |
| 167 | Ga0070684_100182160 | 3300005535 | Bacteria | 1910 |
| 168 | Ga0070684_100661047 | 3300005535 | Unclassified | 973 |
| 169 | Ga0070697_100000215 | 3300005536 | Bacteria | 47439 |
| 170 | Ga0070697_100003842 | 3300005536 | Bacteria | 11532 |
| 171 | Ga0070697_100012842 | 3300005536 | Bacteria | 6562 |
| 172 | Ga0070697_100067026 | 3300005536 | Bacteria | 2935 |
| 173 | Ga0070697_101152859 | 3300005536 | Unclassified | 690 |
| 174 | Ga0068853_100010295 | 3300005539 | Bacteria | 7564 |
| 175 | Ga0068853_100118467 | 3300005539 | Bacteria | 2359 |
| 176 | Ga0070672_100129698 | 3300005543 | Bacteria | 2071 |
| 177 | Ga0070686_100070666 | 3300005544 | Bacteria | 2283 |
| 178 | Ga0070686_100094723 | 3300005544 | Bacteria | 2004 |
| 179 | Ga0070695_100069076 | 3300005545 | Bacteria | 2308 |
| 180 | Ga0070695_100444174 | 3300005545 | Unclassified | 992 |
| 181 | Ga0070696_100037515 | 3300005546 | Unclassified | 3343 |
| 182 | Ga0070696_100461306 | 3300005546 | Unclassified | 1004 |
| 183 | Ga0070696_100862079 | 3300005546 | Unclassified | 749 |
| 184 | Ga0070693_100003903 | 3300005547 | Bacteria | 6990 |
| 185 | Ga0070693_100078524 | 3300005547 | Bacteria | 1962 |
| 186 | Ga0070693_100122555 | 3300005547 | Bacteria | 1614 |
| 187 | Ga0070665_100037529 | 3300005548 | Bacteria | 4872 |
| 188 | Ga0070704_100076031 | 3300005549 | Bacteria | 2455 |
| 189 | Ga0068855_100111914 | 3300005563 | Bacteria | 3133 |
| 190 | Ga0068855_100113376 | 3300005563 | Bacteria | 3110 |
| 191 | Ga0068855_100373258 | 3300005563 | Bacteria | 1567 |
| 192 | Ga0068855_100595659 | 3300005563 | Bacteria | 1192 |
| 193 | Ga0068855_100932460 | 3300005563 | Bacteria | 916 |
| 194 | Ga0070664_100004094 | 3300005564 | Bacteria | 11710 |
| 195 | Ga0070664_100027609 | 3300005564 | Bacteria | 4717 |
| 196 | Ga0070664_100056026 | 3300005564 | Bacteria | 3349 |
| 197 | Ga0070664_100469290 | 3300005564 | Bacteria | 1157 |
| 198 | Ga0070664_100512197 | 3300005564 | Bacteria | 1107 |
| 199 | Ga0068857_100003130 | 3300005577 | Bacteria | 13691 |
| 200 | Ga0068857_100024228 | 3300005577 | Bacteria | 5341 |
| 201 | Ga0068857_100060763 | 3300005577 | Unclassified | 3356 |
| 202 | Ga0068857_100130026 | 3300005577 | Bacteria | 2270 |
| 203 | Ga0068854_100014950 | 3300005578 | Bacteria | 5127 |
| 204 | Ga0068854_100073787 | 3300005578 | Bacteria | 2502 |
| 205 | Ga0068854_100078751 | 3300005578 | Bacteria | 2429 |
| 206 | Ga0068854_100726560 | 3300005578 | Unclassified | 859 |
| 207 | Ga0068856_100003761 | 3300005614 | Bacteria | 15218 |
| 208 | Ga0068856_100030810 | 3300005614 | Bacteria | 5245 |
| 209 | Ga0068856_100080283 | 3300005614 | Bacteria | 3235 |
| 210 | Ga0068856_100088279 | 3300005614 | Bacteria | 3083 |
| 211 | Ga0068856_100113817 | 3300005614 | Bacteria | 2704 |
| 212 | Ga0068856_100469647 | 3300005614 | Bacteria | 1279 |
| 213 | Ga0068852_100188647 | 3300005616 | Bacteria | 1944 |
| 214 | Ga0068852_100334874 | 3300005616 | Bacteria | 1473 |
| 215 | Ga0068859_100009951 | 3300005617 | Bacteria | 9591 |
| 216 | Ga0068859_100015798 | 3300005617 | Bacteria | 7585 |
| 217 | Ga0068859_100054207 | 3300005617 | Bacteria | 4032 |
| 218 | Ga0068859_101300422 | 3300005617 | Unclassified | 801 |
| 219 | Ga0068864_100020897 | 3300005618 | Bacteria | 5480 |
| 220 | Ga0068864_100224521 | 3300005618 | Bacteria | 1734 |
| 221 | Ga0068864_100286421 | 3300005618 | Bacteria | 1539 |
| 222 | Ga0068864_100895035 | 3300005618 | Unclassified | 876 |
| 223 | Ga0068866_10002476 | 3300005718 | Bacteria | 7615 |
| 224 | Ga0068866_10121646 | 3300005718 | Bacteria | 1472 |
| 225 | Ga0068861_100020397 | 3300005719 | Bacteria | 4748 |
| 226 | Ga0068861_100213710 | 3300005719 | Bacteria | 1626 |
| 227 | Ga0068851_10005084 | 3300005834 | Bacteria | 5965 |
| 228 | Ga0068851_10006223 | 3300005834 | Bacteria | 5446 |
| 229 | Ga0068851_10012881 | 3300005834 | Bacteria | 3950 |
| 230 | Ga0068870_10011230 | 3300005840 | Bacteria | 4145 |
| 231 | Ga0068870_10397057 | 3300005840 | Unclassified | 896 |
| 232 | Ga0068863_100095190 | 3300005841 | Unclassified | 2826 |
| 233 | Ga0068863_100117932 | 3300005841 | Bacteria | 2529 |
| 234 | Ga0068863_100566847 | 3300005841 | Unclassified | 1122 |
| 235 | Ga0068863_100646969 | 3300005841 | Unclassified | 1048 |
| 236 | Ga0068858_100027977 | 3300005842 | Bacteria | 5238 |
| 237 | Ga0068858_100083404 | 3300005842 | Bacteria | 2972 |
| 238 | Ga0068858_100130378 | 3300005842 | Bacteria | 2357 |
| 239 | Ga0068858_100283089 | 3300005842 | Bacteria | 1579 |
| 240 | Ga0068858_100604996 | 3300005842 | Bacteria | 1063 |
| 241 | Ga0068860_100004017 | 3300005843 | Bacteria | 15108 |
| 242 | Ga0068860_100015666 | 3300005843 | Bacteria | 7401 |
| 243 | Ga0068860_100104930 | 3300005843 | Bacteria | 2698 |
| 244 | Ga0068860_100362505 | 3300005843 | Unclassified | 1428 |
| 245 | Ga0068860_100369270 | 3300005843 | Unclassified | 1415 |
| 246 | Ga0068860_100911128 | 3300005843 | Unclassified | 895 |
| 247 | Ga0068862_100027696 | 3300005844 | Unclassified | 4771 |
| 248 | Ga0068862_100079452 | 3300005844 | Bacteria | 2843 |
| 249 | Ga0068862_100238748 | 3300005844 | Bacteria | 1651 |
| 250 | Ga0081540_1093958 | 3300005983 | Bacteria | 1311 |
| 251 | Ga0070717_10007158 | 3300006028 | Bacteria | 8269 |
| 252 | Ga0070717_10010694 | 3300006028 | Bacteria | 6940 |
| 253 | Ga0070717_10015399 | 3300006028 | Bacteria | 5908 |
| 254 | Ga0070717_10016305 | 3300006028 | Bacteria | 5758 |
| 255 | Ga0070717_10041852 | 3300006028 | Bacteria | 3735 |
| 256 | Ga0070717_10043343 | 3300006028 | Unclassified | 3672 |
| 257 | Ga0070717_10157594 | 3300006028 | Bacteria | 1968 |
| 258 | Ga0070717_10192149 | 3300006028 | Bacteria | 1784 |
| 259 | Ga0070717_10198404 | 3300006028 | Bacteria | 1757 |
| 260 | Ga0070717_10358992 | 3300006028 | Bacteria | 1304 |
| 261 | Ga0070717_10433051 | 3300006028 | Bacteria | 1184 |
| 262 | Ga0070717_10931203 | 3300006028 | Unclassified | 791 |
| 263 | Ga0070717_11498533 | 3300006028 | Unclassified | 612 |
| 264 | Ga0070715_10001994 | 3300006163 | Bacteria | 6153 |
| 265 | Ga0070715_10004193 | 3300006163 | Unclassified | 4695 |
| 266 | Ga0070715_10005218 | 3300006163 | Unclassified | 4317 |
| 267 | Ga0070715_10014527 | 3300006163 | Bacteria | 2918 |
| 268 | Ga0070715_10072340 | 3300006163 | Bacteria | 1543 |
| 269 | Ga0070715_10263209 | 3300006163 | Unclassified | 907 |
| 270 | Ga0070716_100000233 | 3300006173 | Bacteria | 22241 |
| 271 | Ga0070716_100001391 | 3300006173 | Bacteria | 10730 |
| 272 | Ga0070716_100006726 | 3300006173 | Bacteria | 5630 |
| 273 | Ga0070716_100048939 | 3300006173 | Bacteria | 2393 |
| 274 | Ga0070716_100270760 | 3300006173 | Unclassified | 1167 |
| 275 | Ga0070716_100275286 | 3300006173 | Unclassified | 1159 |
| 276 | Ga0070716_100280667 | 3300006173 | Bacteria | 1149 |
| 277 | Ga0070716_100352215 | 3300006173 | Bacteria | 1043 |
| 278 | Ga0070716_100375424 | 3300006173 | Unclassified | 1014 |
| 279 | Ga0070712_100000056 | 3300006175 | Bacteria | 56756 |
| 280 | Ga0070712_100000057 | 3300006175 | Bacteria | 56727 |
| 281 | Ga0070712_100002047 | 3300006175 | Bacteria | 12338 |
| 282 | Ga0070712_100002910 | 3300006175 | Bacteria | 10609 |
| 283 | Ga0070712_100074837 | 3300006175 | Unclassified | 2434 |
| 284 | Ga0070712_100093069 | 3300006175 | Unclassified | 2212 |
| 285 | Ga0070712_100097870 | 3300006175 | Bacteria | 2163 |
| 286 | Ga0070712_100130157 | 3300006175 | Bacteria | 1906 |
| 287 | Ga0070712_100182410 | 3300006175 | Unclassified | 1637 |
| 288 | Ga0070712_100615593 | 3300006175 | Unclassified | 920 |
| 289 | Ga0097621_100000377 | 3300006237 | Bacteria | 31025 |
| 290 | Ga0097621_100044023 | 3300006237 | Bacteria | 3600 |
| 291 | Ga0097621_100165634 | 3300006237 | Bacteria | 1903 |
| 292 | Ga0097621_100208616 | 3300006237 | Unclassified | 1699 |
| 293 | Ga0097621_100375098 | 3300006237 | Bacteria | 1270 |
| 294 | Ga0097621_100453225 | 3300006237 | Unclassified | 1156 |
| 295 | Ga0068871_100002049 | 3300006358 | Bacteria | 13655 |
| 296 | Ga0068871_100023357 | 3300006358 | Bacteria | 4781 |
| 297 | Ga0068871_100177893 | 3300006358 | Bacteria | 1827 |
| 298 | Ga0068871_100188451 | 3300006358 | Unclassified | 1776 |
| 299 | Ga0068871_100193680 | 3300006358 | Bacteria | 1752 |
| 300 | Ga0068871_101151461 | 3300006358 | Bacteria | 726 |
| 301 | Ga0068871_101353811 | 3300006358 | Bacteria | 670 |
| 302 | Ga0075434_100007390 | 3300006871 | Bacteria | 10174 |
| 303 | Ga0075434_100490640 | 3300006871 | Bacteria | 1249 |
| 304 | Ga0075434_100565087 | 3300006871 | Unclassified | 1157 |
| 305 | Ga0075434_100651770 | 3300006871 | Bacteria | 1071 |
| 306 | Ga0068865_100137269 | 3300006881 | Bacteria | 1839 |
| 307 | Ga0068865_100170105 | 3300006881 | Unclassified | 1670 |
| 308 | Ga0068865_100682906 | 3300006881 | Unclassified | 876 |
| 309 | Ga0075436_100008529 | 3300006914 | Bacteria | 7005 |
| 310 | Ga0075436_100239868 | 3300006914 | Bacteria | 1289 |
| 311 | Ga0075436_100474575 | 3300006914 | Unclassified | 913 |
| 312 | Ga0097620_100009951 | 3300006931 | Bacteria | 9591 |
| 313 | Ga0097620_100015799 | 3300006931 | Bacteria | 7585 |
| 314 | Ga0097620_100054205 | 3300006931 | Bacteria | 4032 |
| 315 | Ga0097620_101300196 | 3300006931 | Unclassified | 801 |
| 316 | Ga0075435_101029556 | 3300007076 | Unclassified | 719 |
| 317 | Ga0099795_10174808 | 3300007788 | Bacteria | 894 |
| 318 | Ga0105250_10161329 | 3300009092 | Unclassified | 936 |
| 319 | Ga0105240_10011378 | 3300009093 | Bacteria | 12393 |
| 320 | Ga0105240_10031271 | 3300009093 | Bacteria | 6905 |
| 321 | Ga0105240_10285028 | 3300009093 | Bacteria | 1896 |
| 322 | Ga0105240_10449204 | 3300009093 | Bacteria | 1443 |
| 323 | Ga0105240_12194228 | 3300009093 | Unclassified | 573 |
| 324 | Ga0111539_10376001 | 3300009094 | Bacteria | 1654 |
| 325 | Ga0105245_10001216 | 3300009098 | Bacteria | 23271 |
| 326 | Ga0105245_10035352 | 3300009098 | Unclassified | 4434 |
| 327 | Ga0105245_10112515 | 3300009098 | Bacteria | 2534 |
| 328 | Ga0105245_10118505 | 3300009098 | Bacteria | 2470 |
| 329 | Ga0105245_10219247 | 3300009098 | Bacteria | 1835 |
| 330 | Ga0105245_10276642 | 3300009098 | Bacteria | 1639 |
| 331 | Ga0105245_10403726 | 3300009098 | Bacteria | 1366 |
| 332 | Ga0105247_10021502 | 3300009101 | Bacteria | 3882 |
| 333 | Ga0105247_10168489 | 3300009101 | Bacteria | 1455 |
| 334 | Ga0105247_10212387 | 3300009101 | Bacteria | 1306 |
| 335 | Ga0105247_10270908 | 3300009101 | Bacteria | 1168 |
| 336 | Ga0105247_11323312 | 3300009101 | Unclassified | 579 |
| 337 | Ga0105243_10012041 | 3300009148 | Bacteria | 6541 |
| 338 | Ga0105243_10613233 | 3300009148 | Bacteria | 1049 |
| 339 | Ga0105241_10010024 | 3300009174 | Bacteria | 6959 |
| 340 | Ga0105241_10012439 | 3300009174 | Bacteria | 6238 |
| 341 | Ga0105241_10036890 | 3300009174 | Bacteria | 3680 |
| 342 | Ga0105241_10042011 | 3300009174 | Bacteria | 3457 |
| 343 | Ga0105241_10093037 | 3300009174 | Bacteria | 2382 |
| 344 | Ga0105242_10017682 | 3300009176 | Bacteria | 5561 |
| 345 | Ga0105242_10020643 | 3300009176 | Bacteria | 5168 |
| 346 | Ga0105242_10029598 | 3300009176 | Bacteria | 4368 |
| 347 | Ga0105242_10391147 | 3300009176 | Bacteria | 1295 |
| 348 | Ga0105248_10041125 | 3300009177 | Bacteria | 5182 |
| 349 | Ga0105248_10067741 | 3300009177 | Bacteria | 4008 |
| 350 | Ga0105248_10202179 | 3300009177 | Bacteria | 2238 |
| 351 | Ga0105248_10503513 | 3300009177 | Bacteria | 1365 |
| 352 | Ga0105248_10864405 | 3300009177 | Bacteria | 1021 |
| 353 | Ga0105248_11039506 | 3300009177 | Unclassified | 925 |
| 354 | Ga0105248_11659201 | 3300009177 | Unclassified | 724 |
| 355 | Ga0105237_10005849 | 3300009545 | Bacteria | 13799 |
| 356 | Ga0105237_10019096 | 3300009545 | Bacteria | 7086 |
| 357 | Ga0105237_10023583 | 3300009545 | Bacteria | 6302 |
| 358 | Ga0105237_10082241 | 3300009545 | Unclassified | 3211 |
| 359 | Ga0105237_10147929 | 3300009545 | Unclassified | 2344 |
| 360 | Ga0105237_10235879 | 3300009545 | Bacteria | 1830 |
| 361 | Ga0105238_10009257 | 3300009551 | Bacteria | 9858 |
| 362 | Ga0105238_10084826 | 3300009551 | Bacteria | 3157 |
| 363 | Ga0105238_10085860 | 3300009551 | Unclassified | 3135 |
| 364 | Ga0105238_10358871 | 3300009551 | Bacteria | 1447 |
| 365 | Ga0105249_10006117 | 3300009553 | Bacteria | 10441 |
| 366 | Ga0105249_10020166 | 3300009553 | Bacteria | 5957 |
| 367 | Ga0105249_10142313 | 3300009553 | Unclassified | 2301 |
| 368 | Ga0099796_10019102 | 3300010159 | Unclassified | 2072 |
| 369 | Ga0105239_10005922 | 3300010375 | Bacteria | 14234 |
| 370 | Ga0105239_10019624 | 3300010375 | Bacteria | 7462 |
| 371 | Ga0105239_10030855 | 3300010375 | Bacteria | 5896 |
| 372 | Ga0105239_10065312 | 3300010375 | Bacteria | 3996 |
| 373 | Ga0105246_10018550 | 3300011119 | Bacteria | 4436 |
| 374 | Ga0105246_10161701 | 3300011119 | Bacteria | 1706 |
| 375 | Ga0105246_10373159 | 3300011119 | Bacteria | 1176 |
| 376 | Ga0157324_1001777 | 3300012506 | Bacteria | 1238 |
| 377 | Ga0157373_10002006 | 3300013100 | Bacteria | 15426 |
| 378 | Ga0157371_10013493 | 3300013102 | Bacteria | 6202 |
| 379 | Ga0157371_10039104 | 3300013102 | Bacteria | 3393 |
| 380 | Ga0157370_10200977 | 3300013104 | Bacteria | 1849 |
| 381 | Ga0157369_10020901 | 3300013105 | Bacteria | 7318 |
| 382 | Ga0157369_10044713 | 3300013105 | Bacteria | 4818 |
| 383 | Ga0157369_10080441 | 3300013105 | Bacteria | 3489 |
| 384 | Ga0157369_10558690 | 3300013105 | Unclassified | 1183 |
| 385 | Ga0157374_10006392 | 3300013296 | Bacteria | 10001 |
| 386 | Ga0157374_10007905 | 3300013296 | Bacteria | 9080 |
| 387 | Ga0157374_10009965 | 3300013296 | Bacteria | 8158 |
| 388 | Ga0157374_10034699 | 3300013296 | Bacteria | 4611 |
| 389 | Ga0157374_10043341 | 3300013296 | Unclassified | 4156 |
| 390 | Ga0157374_10113184 | 3300013296 | Unclassified | 2612 |
| 391 | Ga0157374_10147964 | 3300013296 | Unclassified | 2282 |
| 392 | Ga0157374_10151797 | 3300013296 | Bacteria | 2252 |
| 393 | Ga0157374_10755442 | 3300013296 | Unclassified | 987 |
| 394 | Ga0157374_11179862 | 3300013296 | Unclassified | 787 |
| 395 | Ga0157378_10000500 | 3300013297 | Bacteria | 37186 |
| 396 | Ga0157378_10027150 | 3300013297 | Bacteria | 5051 |
| 397 | Ga0157378_10031909 | 3300013297 | Bacteria | 4653 |
| 398 | Ga0157378_10041884 | 3300013297 | Bacteria | 4063 |
| 399 | Ga0157378_10051536 | 3300013297 | Bacteria | 3662 |
| 400 | Ga0157378_10154534 | 3300013297 | Bacteria | 2140 |
| 401 | Ga0157378_10335665 | 3300013297 | Bacteria | 1472 |
| 402 | Ga0157378_10986657 | 3300013297 | Unclassified | 876 |
| 403 | Ga0163162_10004111 | 3300013306 | Bacteria | 13961 |
| 404 | Ga0163162_10025814 | 3300013306 | Bacteria | 5807 |
| 405 | Ga0163162_10028631 | 3300013306 | Bacteria | 5513 |
| 406 | Ga0163162_10041900 | 3300013306 | Bacteria | 4581 |
| 407 | Ga0163162_10052703 | 3300013306 | Bacteria | 4087 |
| 408 | Ga0163162_10376726 | 3300013306 | Unclassified | 1552 |
| 409 | Ga0163162_10738771 | 3300013306 | Unclassified | 1104 |
| 410 | Ga0157372_10005010 | 3300013307 | Bacteria | 14071 |
| 411 | Ga0157372_10017917 | 3300013307 | Bacteria | 7611 |
| 412 | Ga0157372_10088321 | 3300013307 | Bacteria | 3519 |
| 413 | Ga0157372_10164562 | 3300013307 | Bacteria | 2564 |
| 414 | Ga0157372_10571909 | 3300013307 | Unclassified | 1317 |
| 415 | Ga0157372_11145692 | 3300013307 | Bacteria | 899 |
| 416 | Ga0157375_10003750 | 3300013308 | Bacteria | 13180 |
| 417 | Ga0157375_10004968 | 3300013308 | Bacteria | 11566 |
| 418 | Ga0157375_10022457 | 3300013308 | Bacteria | 5807 |
| 419 | Ga0157375_10214376 | 3300013308 | Bacteria | 2083 |
| 420 | Ga0157375_11263325 | 3300013308 | Unclassified | 867 |
| 421 | Ga0163163_10003969 | 3300014325 | Bacteria | 12633 |
| 422 | Ga0163163_10022798 | 3300014325 | Bacteria | 5934 |
| 423 | Ga0163163_10070616 | 3300014325 | Bacteria | 3478 |
| 424 | Ga0163163_10075760 | 3300014325 | Unclassified | 3358 |
| 425 | Ga0163163_10076433 | 3300014325 | Unclassified | 3343 |
| 426 | Ga0163163_10813774 | 3300014325 | Unclassified | 998 |
| 427 | Ga0157380_10590111 | 3300014326 | Bacteria | 1097 |
| 428 | Ga0157380_10590888 | 3300014326 | Bacteria | 1097 |
| 429 | Ga0182008_10011317 | 3300014497 | Bacteria | 4751 |
| 430 | Ga0157377_10001238 | 3300014745 | Bacteria | 10917 |
| 431 | Ga0157377_10679140 | 3300014745 | Unclassified | 745 |
| 432 | Ga0157379_10001079 | 3300014968 | Bacteria | 22250 |
| 433 | Ga0157379_10029253 | 3300014968 | Bacteria | 4900 |
| 434 | Ga0157379_10042037 | 3300014968 | Unclassified | 4080 |
| 435 | Ga0157379_10092539 | 3300014968 | Bacteria | 2712 |
| 436 | Ga0157379_10346130 | 3300014968 | Unclassified | 1360 |
| 437 | Ga0157376_10016890 | 3300014969 | Bacteria | 5553 |
| 438 | Ga0157376_10018776 | 3300014969 | Bacteria | 5312 |
| 439 | Ga0157376_10020940 | 3300014969 | Bacteria | 5069 |
| 440 | Ga0157376_10046901 | 3300014969 | Bacteria | 3565 |
| 441 | Ga0157376_10087080 | 3300014969 | Bacteria | 2694 |
| 442 | Ga0157376_10087229 | 3300014969 | Bacteria | 2692 |
| 443 | Ga0157376_10285495 | 3300014969 | Bacteria | 1556 |
| 444 | Ga0157376_10609695 | 3300014969 | Unclassified | 1087 |
| 445 | Ga0157376_10774416 | 3300014969 | Bacteria | 970 |
| 446 | Ga0182006_1016501 | 3300015261 | Bacteria | 3150 |
| 447 | Ga0182007_10002720 | 3300015262 | Bacteria | 8652 |
| 448 | Ga0182005_1226137 | 3300015265 | Unclassified | 571 |
| 449 | Ga0163161_10012193 | 3300017792 | Bacteria | 5962 |
| 450 | Ga0206356_11855300 | 3300020070 | Unclassified | 569 |
| 451 | Ga0213874_10145638 | 3300021377 | Bacteria | 823 |
| 452 | Ga0224569_100483 | 3300022732 | Unclassified | 3438 |
| 453 | Ga0224572_1001830 | 3300024225 | Bacteria | 3273 |
| 454 | Ga0224572_1001886 | 3300024225 | Bacteria | 3243 |
| 455 | Ga0224572_1023503 | 3300024225 | Bacteria | 1184 |
| 456 | Ga0228598_1000189 | 3300024227 | Bacteria | 11193 |
| 457 | Ga0228598_1001276 | 3300024227 | Bacteria | 5541 |
| 458 | Ga0228598_1001673 | 3300024227 | Bacteria | 4849 |
| 459 | Ga0207697_10004521 | 3300025315 | Bacteria | 6631 |
| 460 | Ga0207656_10010867 | 3300025321 | Bacteria | 3424 |
| 461 | Ga0207656_10110733 | 3300025321 | Bacteria | 1268 |
| 462 | Ga0207653_10407233 | 3300025885 | Unclassified | 533 |
| 463 | Ga0207682_10002451 | 3300025893 | Bacteria | 8310 |
| 464 | Ga0207682_10161156 | 3300025893 | Unclassified | 1016 |
| 465 | Ga0207692_10003629 | 3300025898 | Bacteria | 6039 |
| 466 | Ga0207692_10013556 | 3300025898 | Bacteria | 3539 |
| 467 | Ga0207692_10030890 | 3300025898 | Unclassified | 2560 |
| 468 | Ga0207692_10032115 | 3300025898 | Bacteria | 2520 |
| 469 | Ga0207692_10365983 | 3300025898 | Bacteria | 892 |
| 470 | Ga0207692_10819472 | 3300025898 | Unclassified | 609 |
| 471 | Ga0207642_10009961 | 3300025899 | Bacteria | 3329 |
| 472 | Ga0207642_10010581 | 3300025899 | Bacteria | 3260 |
| 473 | Ga0207710_10102404 | 3300025900 | Bacteria | 1352 |
| 474 | Ga0207688_10000776 | 3300025901 | Bacteria | 15893 |
| 475 | Ga0207680_10125010 | 3300025903 | Unclassified | 1687 |
| 476 | Ga0207680_10292301 | 3300025903 | Bacteria | 1134 |
| 477 | Ga0207647_10026923 | 3300025904 | Unclassified | 3754 |
| 478 | Ga0207647_10040871 | 3300025904 | Bacteria | 2918 |
| 479 | Ga0207647_10099104 | 3300025904 | Bacteria | 1731 |
| 480 | Ga0207685_10002976 | 3300025905 | Bacteria | 4018 |
| 481 | Ga0207685_10003636 | 3300025905 | Bacteria | 3781 |
| 482 | Ga0207685_10022304 | 3300025905 | Bacteria | 2137 |
| 483 | Ga0207685_10071377 | 3300025905 | Bacteria | 1409 |
| 484 | Ga0207685_10103127 | 3300025905 | Bacteria | 1223 |
| 485 | Ga0207685_10462334 | 3300025905 | Unclassified | 662 |
| 486 | Ga0207699_10000416 | 3300025906 | Bacteria | 21815 |
| 487 | Ga0207699_10011990 | 3300025906 | Bacteria | 4396 |
| 488 | Ga0207699_10042624 | 3300025906 | Unclassified | 2631 |
| 489 | Ga0207699_10071103 | 3300025906 | Bacteria | 2127 |
| 490 | Ga0207699_10080100 | 3300025906 | Bacteria | 2023 |
| 491 | Ga0207699_10143920 | 3300025906 | Bacteria | 1569 |
| 492 | Ga0207699_10216958 | 3300025906 | Bacteria | 1304 |
| 493 | Ga0207699_10238902 | 3300025906 | Bacteria | 1247 |
| 494 | Ga0207699_10441854 | 3300025906 | Unclassified | 932 |
| 495 | Ga0207699_10711116 | 3300025906 | Unclassified | 736 |
| 496 | Ga0207699_11281642 | 3300025906 | Unclassified | 542 |
| 497 | Ga0207645_10000073 | 3300025907 | Bacteria | 71786 |
| 498 | Ga0207645_10006315 | 3300025907 | Bacteria | 8523 |
| 499 | Ga0207643_10000501 | 3300025908 | Bacteria | 25007 |
| 500 | Ga0207643_10243421 | 3300025908 | Unclassified | 1106 |
| 501 | Ga0207705_10167895 | 3300025909 | Bacteria | 1651 |
| 502 | Ga0207705_10445455 | 3300025909 | Bacteria | 1004 |
| 503 | Ga0207684_10002508 | 3300025910 | Bacteria | 18472 |
| 504 | Ga0207684_10010254 | 3300025910 | Bacteria | 8248 |
| 505 | Ga0207684_10022651 | 3300025910 | Bacteria | 5363 |
| 506 | Ga0207684_10262687 | 3300025910 | Bacteria | 1490 |
| 507 | Ga0207654_10441625 | 3300025911 | Unclassified | 911 |
| 508 | Ga0207654_10672869 | 3300025911 | Bacteria | 742 |
| 509 | Ga0207707_10008829 | 3300025912 | Bacteria | 8753 |
| 510 | Ga0207707_10122784 | 3300025912 | Bacteria | 2271 |
| 511 | Ga0207707_10245761 | 3300025912 | Bacteria | 1555 |
| 512 | Ga0207707_10310345 | 3300025912 | Bacteria | 1363 |
| 513 | Ga0207695_10019060 | 3300025913 | Bacteria | 7912 |
| 514 | Ga0207695_10053604 | 3300025913 | Bacteria | 4217 |
| 515 | Ga0207695_10071484 | 3300025913 | Bacteria | 3544 |
| 516 | Ga0207671_10095513 | 3300025914 | Bacteria | 2245 |
| 517 | Ga0207671_10201857 | 3300025914 | Bacteria | 1553 |
| 518 | Ga0207671_10654225 | 3300025914 | Bacteria | 837 |
| 519 | Ga0207693_10000096 | 3300025915 | Bacteria | 78447 |
| 520 | Ga0207693_10000119 | 3300025915 | Bacteria | 69804 |
| 521 | Ga0207693_10000850 | 3300025915 | Bacteria | 27261 |
| 522 | Ga0207693_10002121 | 3300025915 | Bacteria | 17309 |
| 523 | Ga0207693_10057014 | 3300025915 | Bacteria | 3062 |
| 524 | Ga0207693_10057079 | 3300025915 | Bacteria | 3060 |
| 525 | Ga0207693_10058329 | 3300025915 | Bacteria | 3024 |
| 526 | Ga0207693_10266776 | 3300025915 | Unclassified | 1342 |
| 527 | Ga0207693_10416953 | 3300025915 | Unclassified | 1050 |
| 528 | Ga0207663_10003336 | 3300025916 | Bacteria | 7839 |
| 529 | Ga0207663_10005024 | 3300025916 | Bacteria | 6640 |
| 530 | Ga0207663_10012144 | 3300025916 | Bacteria | 4646 |
| 531 | Ga0207663_10013106 | 3300025916 | Unclassified | 4499 |
| 532 | Ga0207663_10014369 | 3300025916 | Unclassified | 4330 |
| 533 | Ga0207663_10060021 | 3300025916 | Bacteria | 2408 |
| 534 | Ga0207663_10555994 | 3300025916 | Unclassified | 898 |
| 535 | Ga0207663_10870510 | 3300025916 | Bacteria | 720 |
| 536 | Ga0207662_10003629 | 3300025918 | Bacteria | 7982 |
| 537 | Ga0207657_10000321 | 3300025919 | Bacteria | 51030 |
| 538 | Ga0207657_10000379 | 3300025919 | Bacteria | 47118 |
| 539 | Ga0207657_10000845 | 3300025919 | Bacteria | 32438 |
| 540 | Ga0207649_10000727 | 3300025920 | Bacteria | 21654 |
| 541 | Ga0207649_10009574 | 3300025920 | Bacteria | 5306 |
| 542 | Ga0207649_10461717 | 3300025920 | Unclassified | 960 |
| 543 | Ga0207652_10139421 | 3300025921 | Bacteria | 2168 |
| 544 | Ga0207652_10173661 | 3300025921 | Bacteria | 1934 |
| 545 | Ga0207652_10553520 | 3300025921 | Bacteria | 1034 |
| 546 | Ga0207646_10020449 | 3300025922 | Bacteria | 6132 |
| 547 | Ga0207646_10038531 | 3300025922 | Unclassified | 4305 |
| 548 | Ga0207646_10070886 | 3300025922 | Unclassified | 3113 |
| 549 | Ga0207681_10402794 | 3300025923 | Unclassified | 1105 |
| 550 | Ga0207694_10034679 | 3300025924 | Bacteria | 3870 |
| 551 | Ga0207694_10101208 | 3300025924 | Bacteria | 2283 |
| 552 | Ga0207694_10218059 | 3300025924 | Bacteria | 1555 |
| 553 | Ga0207650_10000045 | 3300025925 | Bacteria | 181507 |
| 554 | Ga0207659_10017862 | 3300025926 | Bacteria | 4641 |
| 555 | Ga0207659_11233041 | 3300025926 | Unclassified | 643 |
| 556 | Ga0207687_10028281 | 3300025927 | Bacteria | 3767 |
| 557 | Ga0207687_10111038 | 3300025927 | Bacteria | 2035 |
| 558 | Ga0207687_10135791 | 3300025927 | Unclassified | 1860 |
| 559 | Ga0207687_10212054 | 3300025927 | Unclassified | 1520 |
| 560 | Ga0207687_10297260 | 3300025927 | Unclassified | 1299 |
| 561 | Ga0207700_10000467 | 3300025928 | Bacteria | 23733 |
| 562 | Ga0207700_10000611 | 3300025928 | Bacteria | 20908 |
| 563 | Ga0207700_10005967 | 3300025928 | Bacteria | 7332 |
| 564 | Ga0207700_10014391 | 3300025928 | Bacteria | 5182 |
| 565 | Ga0207700_10154866 | 3300025928 | Bacteria | 1898 |
| 566 | Ga0207700_10227923 | 3300025928 | Bacteria | 1583 |
| 567 | Ga0207700_10334467 | 3300025928 | Bacteria | 1315 |
| 568 | Ga0207700_10553194 | 3300025928 | Bacteria | 1021 |
| 569 | Ga0207700_10961835 | 3300025928 | Bacteria | 764 |
| 570 | Ga0207664_10000017 | 3300025929 | Bacteria | 230967 |
| 571 | Ga0207664_10088293 | 3300025929 | Bacteria | 2537 |
| 572 | Ga0207664_10093267 | 3300025929 | Bacteria | 2472 |
| 573 | Ga0207664_10141353 | 3300025929 | Unclassified | 2036 |
| 574 | Ga0207664_10267902 | 3300025929 | Unclassified | 1495 |
| 575 | Ga0207664_11375053 | 3300025929 | Unclassified | 626 |
| 576 | Ga0207644_10002234 | 3300025931 | Bacteria | 12557 |
| 577 | Ga0207644_10261836 | 3300025931 | Bacteria | 1383 |
| 578 | Ga0207690_10077529 | 3300025932 | Bacteria | 2310 |
| 579 | Ga0207706_10000213 | 3300025933 | Bacteria | 63821 |
| 580 | Ga0207706_10000370 | 3300025933 | Bacteria | 48701 |
| 581 | Ga0207706_10005630 | 3300025933 | Bacteria | 11671 |
| 582 | Ga0207686_10034816 | 3300025934 | Bacteria | 3017 |
| 583 | Ga0207686_10100284 | 3300025934 | Bacteria | 1932 |
| 584 | Ga0207686_10253809 | 3300025934 | Bacteria | 1286 |
| 585 | Ga0207686_10446941 | 3300025934 | Unclassified | 994 |
| 586 | Ga0207709_10275340 | 3300025935 | Bacteria | 1241 |
| 587 | Ga0207670_10873783 | 3300025936 | Unclassified | 752 |
| 588 | Ga0207704_10022941 | 3300025938 | Bacteria | 3354 |
| 589 | Ga0207704_10143193 | 3300025938 | Unclassified | 1675 |
| 590 | Ga0207704_10451668 | 3300025938 | Unclassified | 1026 |
| 591 | Ga0207665_10002537 | 3300025939 | Bacteria | 12279 |
| 592 | Ga0207665_10006824 | 3300025939 | Bacteria | 7562 |
| 593 | Ga0207665_10033174 | 3300025939 | Bacteria | 3421 |
| 594 | Ga0207665_10034312 | 3300025939 | Bacteria | 3367 |
| 595 | Ga0207665_10052282 | 3300025939 | Bacteria | 2752 |
| 596 | Ga0207665_10131930 | 3300025939 | Unclassified | 1774 |
| 597 | Ga0207665_10299447 | 3300025939 | Bacteria | 1202 |
| 598 | Ga0207665_10556190 | 3300025939 | Bacteria | 892 |
| 599 | Ga0207665_10986915 | 3300025939 | Bacteria | 670 |
| 600 | Ga0207691_10000151 | 3300025940 | Bacteria | 64391 |
| 601 | Ga0207711_10024010 | 3300025941 | Bacteria | 5103 |
| 602 | Ga0207711_10030477 | 3300025941 | Bacteria | 4549 |
| 603 | Ga0207711_10089953 | 3300025941 | Bacteria | 2698 |
| 604 | Ga0207711_10133886 | 3300025941 | Bacteria | 2224 |
| 605 | Ga0207711_10398925 | 3300025941 | Bacteria | 1278 |
| 606 | Ga0207711_10437602 | 3300025941 | Unclassified | 1217 |
| 607 | Ga0207689_10000129 | 3300025942 | Bacteria | 63859 |
| 608 | Ga0207689_10000166 | 3300025942 | Bacteria | 57369 |
| 609 | Ga0207689_10012861 | 3300025942 | Bacteria | 7148 |
| 610 | Ga0207661_10000099 | 3300025944 | Bacteria | 54986 |
| 611 | Ga0207661_10080027 | 3300025944 | Bacteria | 2695 |
| 612 | Ga0207661_10232065 | 3300025944 | Bacteria | 1634 |
| 613 | Ga0207679_10000096 | 3300025945 | Bacteria | 76971 |
| 614 | Ga0207679_10151353 | 3300025945 | Bacteria | 1889 |
| 615 | Ga0207679_10455970 | 3300025945 | Bacteria | 1135 |
| 616 | Ga0207679_10503115 | 3300025945 | Bacteria | 1081 |
| 617 | Ga0207667_10020353 | 3300025949 | Bacteria | 7383 |
| 618 | Ga0207667_10042127 | 3300025949 | Bacteria | 4855 |
| 619 | Ga0207667_10208166 | 3300025949 | Bacteria | 2005 |
| 620 | Ga0207667_10333123 | 3300025949 | Unclassified | 1549 |
| 621 | Ga0207667_10832018 | 3300025949 | Bacteria | 918 |
| 622 | Ga0207651_10062182 | 3300025960 | Bacteria | 2600 |
| 623 | Ga0207651_10532036 | 3300025960 | Bacteria | 1020 |
| 624 | Ga0207712_10071282 | 3300025961 | Bacteria | 2499 |
| 625 | Ga0207712_10130650 | 3300025961 | Unclassified | 1913 |
| 626 | Ga0207668_10034712 | 3300025972 | Bacteria | 3351 |
| 627 | Ga0207640_10003526 | 3300025981 | Bacteria | 8432 |
| 628 | Ga0207640_10009802 | 3300025981 | Bacteria | 5372 |
| 629 | Ga0207640_10238081 | 3300025981 | Bacteria | 1405 |
| 630 | Ga0207640_10608754 | 3300025981 | Unclassified | 926 |
| 631 | Ga0207658_10041272 | 3300025986 | Unclassified | 3340 |
| 632 | Ga0207658_10891745 | 3300025986 | Unclassified | 809 |
| 633 | Ga0207677_10063083 | 3300026023 | Bacteria | 2574 |
| 634 | Ga0207677_10483722 | 3300026023 | Bacteria | 1067 |
| 635 | Ga0207677_10514646 | 3300026023 | Unclassified | 1037 |
| 636 | Ga0207677_11040227 | 3300026023 | Unclassified | 744 |
| 637 | Ga0207703_10050074 | 3300026035 | Unclassified | 3379 |
| 638 | Ga0207703_10066556 | 3300026035 | Bacteria | 2964 |
| 639 | Ga0207703_10077224 | 3300026035 | Bacteria | 2764 |
| 640 | Ga0207703_10139381 | 3300026035 | Bacteria | 2103 |
| 641 | Ga0207703_11745599 | 3300026035 | Unclassified | 598 |
| 642 | Ga0207639_10018041 | 3300026041 | Bacteria | 5007 |
| 643 | Ga0207639_10115151 | 3300026041 | Bacteria | 2198 |
| 644 | Ga0207678_10000026 | 3300026067 | Bacteria | 116850 |
| 645 | Ga0207678_10000381 | 3300026067 | Bacteria | 40336 |
| 646 | Ga0207702_10000993 | 3300026078 | Bacteria | 29058 |
| 647 | Ga0207702_10072869 | 3300026078 | Unclassified | 2961 |
| 648 | Ga0207702_10082190 | 3300026078 | Bacteria | 2800 |
| 649 | Ga0207702_10307456 | 3300026078 | Unclassified | 1506 |
| 650 | Ga0207702_11639619 | 3300026078 | Unclassified | 636 |
| 651 | Ga0207702_11873587 | 3300026078 | Unclassified | 591 |
| 652 | Ga0207641_10000075 | 3300026088 | Bacteria | 145149 |
| 653 | Ga0207641_10191705 | 3300026088 | Unclassified | 1879 |
| 654 | Ga0207641_10244361 | 3300026088 | Bacteria | 1674 |
| 655 | Ga0207641_10550873 | 3300026088 | Unclassified | 1125 |
| 656 | Ga0207641_10590747 | 3300026088 | Unclassified | 1086 |
| 657 | Ga0207648_10000890 | 3300026089 | Bacteria | 33695 |
| 658 | Ga0207648_10041404 | 3300026089 | Bacteria | 4045 |
| 659 | Ga0207648_10053396 | 3300026089 | Bacteria | 3532 |
| 660 | Ga0207676_10000212 | 3300026095 | Bacteria | 50034 |
| 661 | Ga0207676_10043033 | 3300026095 | Unclassified | 3475 |
| 662 | Ga0207676_10666442 | 3300026095 | Bacteria | 1005 |
| 663 | Ga0207674_10000670 | 3300026116 | Bacteria | 44517 |
| 664 | Ga0207674_10022023 | 3300026116 | Bacteria | 6853 |
| 665 | Ga0207674_10029181 | 3300026116 | Bacteria | 5811 |
| 666 | Ga0207674_10036200 | 3300026116 | Bacteria | 5146 |
| 667 | Ga0207675_100010093 | 3300026118 | Bacteria | 8853 |
| 668 | Ga0207675_100297005 | 3300026118 | Bacteria | 1572 |
| 669 | Ga0207675_100514464 | 3300026118 | Unclassified | 1193 |
| 670 | Ga0207683_10001901 | 3300026121 | Bacteria | 18484 |
| 671 | Ga0207698_10064039 | 3300026142 | Bacteria | 2880 |
| 672 | Ga0207698_10462267 | 3300026142 | Bacteria | 1227 |
| 673 | Ga0207698_10490859 | 3300026142 | Unclassified | 1193 |
| 674 | Ga0265356_1003947 | 3300028017 | Unclassified | 1835 |
| 675 | Ga0265357_1030038 | 3300028023 | Unclassified | 619 |
| 676 | Ga0268266_10025946 | 3300028379 | Bacteria | 4985 |
| 677 | Ga0268266_10036165 | 3300028379 | Bacteria | 4202 |
| 678 | Ga0268266_10657495 | 3300028379 | Bacteria | 1009 |
| 679 | Ga0268265_10042850 | 3300028380 | Unclassified | 3361 |
| 680 | Ga0268265_10091846 | 3300028380 | Bacteria | 2428 |
| 681 | Ga0268265_10418419 | 3300028380 | Unclassified | 1243 |
| 682 | Ga0268265_10471841 | 3300028380 | Bacteria | 1177 |
| 683 | Ga0268264_10022618 | 3300028381 | Bacteria | 5130 |
| 684 | Ga0268264_10024495 | 3300028381 | Bacteria | 4927 |
| 685 | Ga0268264_10034827 | 3300028381 | Unclassified | 4144 |
| 686 | Ga0268264_10399933 | 3300028381 | Unclassified | 1320 |
| 687 | Ga0268264_10741278 | 3300028381 | Unclassified | 978 |
| 688 | Ga0268264_11565741 | 3300028381 | Bacteria | 670 |
| 689 | Ga0265338_10015238 | 3300028800 | Bacteria | 8468 |
| 690 | Ga0265338_10027752 | 3300028800 | Bacteria | 5670 |
| 691 | Ga0265338_10048630 | 3300028800 | Bacteria | 3856 |
| 692 | Ga0265338_10054343 | 3300028800 | Bacteria | 3573 |
| 693 | Ga0265338_10056053 | 3300028800 | Bacteria | 3500 |
| 694 | Ga0265338_10097773 | 3300028800 | Unclassified | 2403 |
| 695 | Ga0265762_1000267 | 3300030760 | Bacteria | 8682 |
| 696 | Ga0265762_1000706 | 3300030760 | Bacteria | 5909 |
| 697 | Ga0265762_1002225 | 3300030760 | Unclassified | 3511 |
| 698 | Ga0265762_1070665 | 3300030760 | Unclassified | 732 |
| 699 | Ga0265770_1013760 | 3300030878 | Bacteria | 1214 |
| 700 | Ga0265760_10000117 | 3300031090 | Bacteria | 20281 |
| 701 | Ga0265760_10003836 | 3300031090 | Bacteria | 4359 |
| 702 | Ga0265760_10006936 | 3300031090 | Bacteria | 3248 |
| 703 | Ga0265332_10048162 | 3300031238 | Bacteria | 1834 |
| 704 | Ga0265328_10073488 | 3300031239 | Bacteria | 1257 |
| 705 | Ga0265325_10003863 | 3300031241 | Bacteria | 9617 |
| 706 | Ga0265325_10046541 | 3300031241 | Bacteria | 2249 |
| 707 | Ga0265340_10052980 | 3300031247 | Unclassified | 1960 |
| 708 | Ga0265339_10010741 | 3300031249 | Bacteria | 5672 |
| 709 | Ga0265339_10031452 | 3300031249 | Bacteria | 2999 |
| 710 | Ga0265339_10090458 | 3300031249 | Bacteria | 1605 |
| 711 | Ga0265316_10062736 | 3300031344 | Bacteria | 2884 |
| 712 | Ga0265316_10064286 | 3300031344 | Unclassified | 2843 |
| 713 | Ga0265316_10071581 | 3300031344 | Bacteria | 2672 |
| 714 | Ga0265316_10647613 | 3300031344 | Unclassified | 747 |
| 715 | Ga0307408_100526426 | 3300031548 | Bacteria | 1039 |
| 716 | Ga0265314_10062459 | 3300031711 | Bacteria | 2532 |
| 717 | Ga0265314_10149781 | 3300031711 | Bacteria | 1432 |
| 718 | Ga0265342_10033401 | 3300031712 | Unclassified | 3164 |
| 719 | Ga0307405_10074415 | 3300031731 | Bacteria | 2197 |
| 720 | Ga0307410_10064758 | 3300031852 | Bacteria | 2512 |
| 721 | Ga0307410_10104420 | 3300031852 | Bacteria | 2037 |
| 722 | Ga0307412_10401241 | 3300031911 | Bacteria | 1116 |
| 723 | Ga0307416_100438412 | 3300032002 | Bacteria | 1356 |
| 724 | Ga0307411_10019305 | 3300032005 | Bacteria | 3935 |
| 725 | Ga0307415_100002600 | 3300032126 | Bacteria | 9009 |
| 726 | Ga0307415_100729967 | 3300032126 | Bacteria | 897 |
| 727 | Ga0316212_1007283 | 3300033547 | Unclassified | 1598 |
| 728 | Ga0373930_0004788 | 3300034816 | Bacteria | 2220 |
| 729 | Ga0373958_0012903 | 3300034819 | Bacteria | 1438 |
| 730 | Ga0373929_0062253 | 3300035085 | Unclassified | 876 |
| 731 | Ga0373934_0076687 | 3300035086 | Unclassified | 1341 |
| 732 | Ga0373940_0102809 | 3300035088 | Unclassified | 869 |
| 733 | Ga0373944_0012902 | 3300035089 | Bacteria | 2311 |
| 734 | Ga0373952_0012167 | 3300035092 | Unclassified | 1689 |
| 735 | Ga0373923_0084699 | 3300035111 | Bacteria | 1379 |
| 736 | Ga0373932_0023073 | 3300035112 | Unclassified | 1660 |
| 737 | Ga0373936_0002322 | 3300035113 | Bacteria | 7118 |
| 738 | Ga0373936_0068456 | 3300035113 | Bacteria | 1460 |
| 739 | Ga0373936_0237092 | 3300035113 | Bacteria | 812 |
| 740 | Ga0373941_0019831 | 3300035115 | Bacteria | 1878 |
| 741 | Ga0373956_0351440 | 3300035119 | Unclassified | 703 |
| 742 | Ga0373943_0000779 | 3300035170 | Bacteria | 13936 |
| 743 | Ga0373943_0148809 | 3300035170 | Bacteria | 1267 |
| 744 | Ga0373946_0000613 | 3300035171 | Bacteria | 11839 |
| 745 | Ga0373955_0024353 | 3300035172 | Unclassified | 3095 |
| 746 | Ga0373955_0373305 | 3300035172 | Bacteria | 865 |
| 747 | Ga0373942_0096634 | 3300035207 | Unclassified | 897 |
| 748 | Ga0373961_0030639 | 3300035241 | Bacteria | 1498 |
| 749 | Ga0373962_0008003 | 3300035242 | Bacteria | 2597 |
| 750 | Ga0373924_0021094 | 3300035410 | Bacteria | 2539 |
| 751 | Ga0373924_0024035 | 3300035410 | Unclassified | 2398 |
| 752 | Ga0373935_0006806 | 3300035692 | Bacteria | 6829 |
| 753 | Ga0373935_0116074 | 3300035692 | Bacteria | 1783 |
| 754 | Ga0373935_0228814 | 3300035692 | Bacteria | 1294 |
| 755 | Ga0373927_0000085 | 3300035695 | Bacteria | 70359 |
| 756 | Ga0373927_0333611 | 3300035695 | Bacteria | 999 |
| 757 | Ga0373933_0036263 | 3300035724 | Bacteria | 2885 |
| 758 | Ga0373947_0003515 | 3300035725 | Bacteria | 9254 |
| 759 | Ga0373947_0266536 | 3300035725 | Bacteria | 1136 |
| 760 | Ga0373937_0219637 | 3300036401 | Bacteria | 1789 |
| 761 | Ga0373937_0248845 | 3300036401 | Unclassified | 1675 |
| 762 | Ga0373937_0464780 | 3300036401 | Unclassified | 1202 |
| 763 | Ga0373937_0479114 | 3300036401 | Unclassified | 1182 |
| 764 | Ga0373937_1736420 | 3300036401 | Unclassified | 571 |
| 765 | Ga0373937_1811477 | 3300036401 | Bacteria | 557 |
| 766 | Ga0373925_0009268 | 3300037068 | Bacteria | 7163 |
| 767 | Ga0373925_0033615 | 3300037068 | Unclassified | 3778 |
| 768 | Ga0373925_0194405 | 3300037068 | Unclassified | 1611 |
| 769 | Ga0373925_0735088 | 3300037068 | Unclassified | 813 |
| 770 | Ga0395905_1600520 | 3300037471 | Bacteria | 556 |
| 771 | Ga0436361_0612533 | 3300039447 | Unclassified | 752 |
| 772 | Ga0436363_0628616 | 3300039450 | Bacteria | 824 |
| 773 | Ga0466963_0151097 | 3300044694 | Bacteria | 1612 |
| 774 | Ga0466963_1186534 | 3300044694 | Unclassified | 536 |
| 775 | Ga0466964_0093259 | 3300044706 | Unclassified | 1314 |
| 776 | Ga0453684_0731116 | 3300044712 | Bacteria | 1073 |
| 777 | Ga0451576_0081959 | 3300045051 | Unclassified | 3355 |
| 778 | Ga0451576_0235019 | 3300045051 | Unclassified | 1914 |
| 779 | Ga0466967_0812985 | 3300045976 | Unclassified | 928 |
| 780 | Ga0495592_0236376 | 3300046454 | Bacteria | 1214 |
| 781 | Ga0495592_0699443 | 3300046454 | Bacteria | 610 |
| 782 | Ga0495603_0262410 | 3300046455 | Bacteria | 994 |
| 783 | Ga0495629_0018361 | 3300046459 | Bacteria | 5007 |
| 784 | Ga0495580_0000349 | 3300046472 | Bacteria | 37675 |
| 785 | Ga0495580_0001198 | 3300046472 | Bacteria | 22803 |
| 786 | Ga0495580_0003361 | 3300046472 | Bacteria | 13673 |
| 787 | Ga0495580_0005033 | 3300046472 | Bacteria | 11020 |
| 788 | Ga0495580_0037248 | 3300046472 | Bacteria | 3492 |
| 789 | Ga0495580_0042811 | 3300046472 | Bacteria | 3224 |
| 790 | Ga0495580_0050893 | 3300046472 | Bacteria | 2928 |
| 791 | Ga0495580_0105094 | 3300046472 | Bacteria | 1962 |
| 792 | Ga0495580_0140471 | 3300046472 | Bacteria | 1674 |
| 793 | Ga0495580_0186121 | 3300046472 | Bacteria | 1433 |
| 794 | Ga0495580_0224300 | 3300046472 | Bacteria | 1291 |
| 795 | Ga0495582_0005458 | 3300046473 | Bacteria | 7089 |
| 796 | Ga0495664_0194851 | 3300046477 | Bacteria | 1228 |
| 797 | Ga0495594_0005014 | 3300046499 | Bacteria | 6815 |
| 798 | Ga0495628_0047983 | 3300046516 | Unclassified | 3386 |
| 799 | Ga0495630_0398730 | 3300046517 | Bacteria | 1054 |
| 800 | Ga0495630_0532188 | 3300046517 | Bacteria | 901 |
| 801 | Ga0495666_0252568 | 3300046526 | Bacteria | 803 |
| 802 | Ga0495665_0108705 | 3300046531 | Unclassified | 1455 |
| 803 | Ga0495665_0299860 | 3300046531 | Bacteria | 823 |
| 804 | Ga0495645_0096065 | 3300046543 | Bacteria | 2112 |
| 805 | Ga0495635_0622082 | 3300046663 | Unclassified | 704 |
| 806 | Ga0495599_0243862 | 3300046678 | Bacteria | 1095 |
| 807 | Ga0495624_0062475 | 3300046690 | Unclassified | 2330 |
| 808 | Ga0495624_0267018 | 3300046690 | Bacteria | 1034 |
| 809 | Ga0495670_0331172 | 3300046691 | Unclassified | 818 |
| 810 | Ga0495674_0067144 | 3300047319 | Bacteria | 3108 |
| 811 | Ga0495674_0235268 | 3300047319 | Bacteria | 1511 |
| 812 | Ga0495674_1027178 | 3300047319 | Unclassified | 630 |
| 813 | Ga0495674_1041024 | 3300047319 | Bacteria | 625 |
| 814 | Ga0495593_0032870 | 3300047673 | Unclassified | 2827 |
| 815 | Ga0496100_0063571 | 3300048903 | Unclassified | 2439 |
| 816 | Ga0496100_0065557 | 3300048903 | Bacteria | 2407 |
| 817 | Ga0496100_0120637 | 3300048903 | Bacteria | 1834 |
| 818 | Ga0496100_0154515 | 3300048903 | Unclassified | 1640 |
| 819 | Ga0496100_0190880 | 3300048903 | Bacteria | 1487 |
| 820 | Ga0496100_0231120 | 3300048903 | Bacteria | 1361 |
| 821 | Ga0496101_0012667 | 3300048904 | Bacteria | 5636 |
| 822 | Ga0496101_0060527 | 3300048904 | Bacteria | 2748 |
| 823 | Ga0496101_0471500 | 3300048904 | Unclassified | 991 |
| 824 | Ga0496101_0496278 | 3300048904 | Unclassified | 964 |
| 825 | Ga0496102_0003593 | 3300048905 | Bacteria | 13135 |
| 826 | Ga0496102_0015179 | 3300048905 | Bacteria | 6705 |
| 827 | Ga0496102_0035381 | 3300048905 | Unclassified | 4495 |
| 828 | Ga0496102_0060070 | 3300048905 | Bacteria | 3478 |
| 829 | Ga0496102_0323463 | 3300048905 | Bacteria | 1453 |
| 830 | Ga0496102_0345865 | 3300048905 | Bacteria | 1400 |
| 831 | Ga0496102_0784028 | 3300048905 | Unclassified | 875 |
| 832 | Ga0496103_0086381 | 3300048906 | Bacteria | 1977 |
| 833 | Ga0496103_0248197 | 3300048906 | Bacteria | 1145 |
| 834 | Ga0496103_0413713 | 3300048906 | Unclassified | 866 |
| 835 | Ga0496104_0008923 | 3300048907 | Bacteria | 8910 |
| 836 | Ga0496104_0090209 | 3300048907 | Unclassified | 2929 |
| 837 | Ga0496104_0143461 | 3300048907 | Unclassified | 2294 |
| 838 | Ga0496104_0164437 | 3300048907 | Bacteria | 2128 |
| 839 | Ga0496104_0262503 | 3300048907 | Bacteria | 1640 |
| 840 | Ga0496104_0433809 | 3300048907 | Bacteria | 1226 |
| 841 | Ga0496104_0500593 | 3300048907 | Unclassified | 1126 |
| 842 | Ga0496105_0199645 | 3300048908 | Bacteria | 1633 |
| 843 | Ga0496105_0852250 | 3300048908 | Unclassified | 690 |
| 844 | Ga0496106_0048312 | 3300048909 | Bacteria | 3205 |
| 845 | Ga0496106_0136745 | 3300048909 | Bacteria | 1925 |
| 846 | Ga0496106_0276918 | 3300048909 | Unclassified | 1344 |
| 847 | Ga0496108_0000304 | 3300048911 | Bacteria | 42250 |
| 848 | Ga0496108_0155177 | 3300048911 | Bacteria | 1977 |
| 849 | Ga0496108_0475096 | 3300048911 | Unclassified | 1092 |
| 850 | Ga0496108_0584016 | 3300048911 | Unclassified | 974 |
| 851 | Ga0496109_0000132 | 3300048912 | Bacteria | 76436 |
| 852 | Ga0496109_0037739 | 3300048912 | Unclassified | 4366 |
| 853 | Ga0496109_0145417 | 3300048912 | Bacteria | 2218 |
| 854 | Ga0496109_0718669 | 3300048912 | Unclassified | 936 |
| 855 | Ga0496109_1160915 | 3300048912 | Unclassified | 709 |
| 856 | Ga0496109_1322206 | 3300048912 | Unclassified | 657 |
| 857 | Ga0496110_0003639 | 3300048913 | Bacteria | 11855 |
| 858 | Ga0496110_0208999 | 3300048913 | Bacteria | 1774 |
| 859 | Ga0496110_0437838 | 3300048913 | Unclassified | 1191 |
| 860 | Ga0496111_0039281 | 3300048914 | Bacteria | 3393 |
| 861 | Ga0496111_0161367 | 3300048914 | Bacteria | 1664 |
| 862 | Ga0496112_0000724 | 3300048915 | Bacteria | 22889 |
| 863 | Ga0496112_0003918 | 3300048915 | Bacteria | 12457 |
| 864 | Ga0496112_0052762 | 3300048915 | Bacteria | 3991 |
| 865 | Ga0496112_0585500 | 3300048915 | Unclassified | 1048 |
| 866 | Ga0496112_0619482 | 3300048915 | Unclassified | 1013 |
| 867 | Ga0496112_0655201 | 3300048915 | Unclassified | 979 |
| 868 | Ga0496112_0906177 | 3300048915 | Bacteria | 803 |
| 869 | Ga0496113_0003443 | 3300048916 | Bacteria | 9473 |
| 870 | Ga0496113_0033740 | 3300048916 | Bacteria | 3729 |
| 871 | Ga0496114_0007439 | 3300048917 | Bacteria | 8659 |
| 872 | Ga0496114_0645314 | 3300048917 | Bacteria | 931 |
| 873 | Ga0496115_0015286 | 3300048918 | Bacteria | 5820 |
| 874 | Ga0496115_0164465 | 3300048918 | Bacteria | 1835 |
| 875 | Ga0496115_0649092 | 3300048918 | Unclassified | 834 |
| 876 | Ga0501224_008551 | 3300049664 | Bacteria | 1493 |
| 877 | Ga0501243_010114 | 3300049675 | Bacteria | 1470 |
| 878 | Ga0501249_075838 | 3300049679 | Bacteria | 788 |
| 879 | Ga0501225_0022264 | 3300049705 | Bacteria | 1750 |
| 880 | Ga0501234_014780 | 3300049707 | Bacteria | 1226 |
| 881 | Ga0501245_102973 | 3300049708 | Bacteria | 581 |
| 882 | Ga0501284_10831 | 3300050005 | Unclassified | 561 |
| 883 | nmdc:mga0n895_351824_c1 | 3300050512 | Unclassified | 1492 |
| 884 | nmdc:mga0rr50_212469_c1 | 3300050513 | Bacteria | 1594 |
| 885 | nmdc:mga0rr50_28025_c1 | 3300050513 | Bacteria | 3954 |
| 886 | nmdc:mga0rr50_290301_c1 | 3300050513 | Unclassified | 1366 |
| 887 | nmdc:mga08x19_238318_c1 | 3300050514 | Unclassified | 1253 |
| 888 | nmdc:mga08x19_471737_c1 | 3300050514 | Unclassified | 884 |
| 889 | nmdc:mga08x19_65499_c1 | 3300050514 | Bacteria | 2360 |
| 890 | nmdc:mga0a205_2659_c1 | 3300050515 | Bacteria | 15797 |
| 891 | Ga0495601_0094615 | 3300053077 | Unclassified | 1926 |
| 892 | Ga0500590_278060 | 3300053148 | Unclassified | 645 |
| 893 | Ga0495580_0431528 | |||
| 894 | MBSR1b_contig_12289486 | |||
| 895 | MBSR1b_contig_14142699 | |||
| 896 | MBSR1b_contig_14292732 | |||
| 897 | MBSR1b_contig_5587874 | |||
| 898 | LJNas_1001182 | |||
| 899 | JGI24737J22298_10063201 | |||
| 900 | JGI24743J22301_10012727 | |||
| 901 | JGI24034J26672_10017411 | |||
| 902 | JGI24751J29686_10004031 | |||
| 903 | rootH2_10227596 | |||
| 904 | rootH1_10403911 | |||
| 905 | Ga0065712_10092655 | |||
| 906 | Ga0065712_10352935 | |||
| 907 | Ga0065715_10119611 | |||
| 908 | Ga0065715_10140426 | |||
| 909 | Ga0065715_10187153 | |||
| 910 | Ga0070658_10115792 | |||
| 911 | Ga0070658_10305551 | |||
| 912 | Ga0070676_10047767 | |||
| 913 | Ga0070676_10114591 | |||
| 914 | Ga0070676_10240739 | |||
| 915 | Ga0070683_100104197 | |||
| 916 | Ga0070683_100107295 | |||
| 917 | Ga0070690_100019935 | |||
| 918 | Ga0070690_100151190 | |||
| 919 | Ga0070670_100026528 | |||
| 920 | Ga0070670_100452666 | |||
| 921 | Ga0070677_10012562 | |||
| 922 | Ga0070677_10034842 | |||
| 923 | Ga0068869_100002319 | |||
| 924 | Ga0068869_100026540 | |||
| 925 | Ga0068869_100073707 | |||
| 926 | Ga0070666_10013454 | |||
| 927 | Ga0070666_10034660 | |||
| 928 | Ga0070666_10141130 | |||
| 929 | Ga0070680_100063061 | |||
| 930 | Ga0070680_100076099 | |||
| 931 | Ga0070680_100515132 | |||
| 932 | Ga0070680_100625488 | |||
| 933 | Ga0070682_100008588 | |||
| 934 | Ga0070682_100125217 | |||
| 935 | Ga0070682_100438374 | |||
| 936 | Ga0070682_101053414 | |||
| 937 | Ga0068868_100004356 | |||
| 938 | Ga0068868_100006106 | |||
| 939 | Ga0068868_100006804 | |||
| 940 | Ga0068868_100049472 | |||
| 941 | Ga0068868_100265133 | |||
| 942 | Ga0068868_100322094 | |||
| 943 | Ga0070660_100071577 | |||
| 944 | Ga0070660_100134103 | |||
| 945 | Ga0070689_100009760 | |||
| 946 | Ga0070689_100763003 | |||
| 947 | Ga0070689_101009762 | |||
| 948 | Ga0070689_101016024 | |||
| 949 | Ga0070687_100006630 | |||
| 950 | Ga0070661_100013287 | |||
| 951 | Ga0070661_100043647 | |||
| 952 | Ga0070692_10112780 | |||
| 953 | Ga0070668_100026551 | |||
| 954 | Ga0070668_100141409 | |||
| 955 | Ga0070669_100143075 | |||
| 956 | Ga0070669_100243108 | |||
| 957 | Ga0070675_100021889 | |||
| 958 | Ga0070675_100439005 | |||
| 959 | Ga0070671_100096198 | |||
| 960 | Ga0070671_100337418 | |||
| 961 | Ga0070674_100018421 | |||
| 962 | Ga0070674_100586601 | |||
| 963 | Ga0070673_100010209 | |||
| 964 | Ga0070673_100550303 | |||
| 965 | Ga0070688_100065322 | |||
| 966 | Ga0070688_100079617 | |||
| 967 | Ga0070659_100003788 | |||
| 968 | Ga0070659_100004572 | |||
| 969 | Ga0070659_100023398 | |||
| 970 | Ga0070659_100396095 | |||
| 971 | Ga0070667_100024022 | |||
| 972 | Ga0070667_100097809 | |||
| 973 | Ga0070667_100460754 | |||
| 974 | Ga0070709_10000312 | |||
| 975 | Ga0070709_10011171 | |||
| 976 | Ga0070709_10095300 | |||
| 977 | Ga0070709_10186443 | |||
| 978 | Ga0070709_10197918 | |||
| 979 | Ga0070709_10211451 | |||
| 980 | Ga0070709_10261333 | |||
| 981 | Ga0070709_10505123 | |||
| 982 | Ga0070709_10667765 | |||
| 983 | Ga0070714_100000060 | |||
| 984 | Ga0070714_100003931 | |||
| 985 | Ga0070714_100290592 | |||
| 986 | Ga0070714_100494263 | |||
| 987 | Ga0070714_100549632 | |||
| 988 | Ga0070714_100717321 | |||
| 989 | Ga0070714_100862468 | |||
| 990 | Ga0070713_100000162 | |||
| 991 | Ga0070713_100000344 | |||
| 992 | Ga0070713_100018136 | |||
| 993 | Ga0070713_100028068 | |||
| 994 | Ga0070713_100031349 | |||
| 995 | Ga0070713_100091091 | |||
| 996 | Ga0070713_100191702 | |||
| 997 | Ga0070713_100197806 | |||
| 998 | Ga0070713_100681451 | |||
| 999 | Ga0070713_100712049 | |||
| 1000 | Ga0070710_10001044 | |||
| 1001 | Ga0070710_10009785 | |||
| 1002 | Ga0070710_10075136 | |||
| 1003 | Ga0070710_10085744 | |||
| 1004 | Ga0070710_10137689 | |||
| 1005 | Ga0070710_10204247 | |||
| 1006 | Ga0070710_10286213 | |||
| 1007 | Ga0070710_10619239 | |||
| 1008 | Ga0070711_100000231 | |||
| 1009 | Ga0070711_100004865 | |||
| 1010 | Ga0070711_100045235 | |||
| 1011 | Ga0070711_100051480 | |||
| 1012 | Ga0070711_100061715 | |||
| 1013 | Ga0070711_100079194 | |||
| 1014 | Ga0070711_100132561 | |||
| 1015 | Ga0070711_100372206 | |||
| 1016 | Ga0070711_100600854 | |||
| 1017 | Ga0070711_101334202 | |||
| 1018 | Ga0070700_101257518 | |||
| 1019 | Ga0070708_100001600 | |||
| 1020 | Ga0070708_100005188 | |||
| 1021 | Ga0070708_100115232 | |||
| 1022 | Ga0070708_100244435 | |||
| 1023 | Ga0070708_100391009 | |||
| 1024 | Ga0070708_100434497 | |||
| 1025 | Ga0070663_100006281 | |||
| 1026 | Ga0070678_100164903 | |||
| 1027 | Ga0070678_100691800 | |||
| 1028 | Ga0070678_100887980 | |||
| 1029 | Ga0070662_100005657 | |||
| 1030 | Ga0070662_100056787 | |||
| 1031 | Ga0070681_10005365 | |||
| 1032 | Ga0070681_10061088 | |||
| 1033 | Ga0070681_10119342 | |||
| 1034 | Ga0070681_10287040 | |||
| 1035 | Ga0070681_10855764 | |||
| 1036 | Ga0068867_100006383 | |||
| 1037 | Ga0068867_100040007 | |||
| 1038 | Ga0070685_10006397 | |||
| 1039 | Ga0070706_100005888 | |||
| 1040 | Ga0070706_100012684 | |||
| 1041 | Ga0070706_100015107 | |||
| 1042 | Ga0070706_100433856 | |||
| 1043 | Ga0070707_100021616 | |||
| 1044 | Ga0070707_100238876 | |||
| 1045 | Ga0070698_100016133 | |||
| 1046 | Ga0070698_100021148 | |||
| 1047 | Ga0070698_100068413 | |||
| 1048 | Ga0070699_100000358 | |||
| 1049 | Ga0070699_100006278 | |||
| 1050 | Ga0070699_100096103 | |||
| 1051 | Ga0070699_100223728 | |||
| 1052 | Ga0070679_100169393 | |||
| 1053 | Ga0070679_100196092 | |||
| 1054 | Ga0070679_100323076 | |||
| 1055 | Ga0070679_100352747 | |||
| 1056 | Ga0070679_100611566 | |||
| 1057 | Ga0070684_100005271 | |||
| 1058 | Ga0070684_100018826 | |||
| 1059 | Ga0070684_100182160 | |||
| 1060 | Ga0070684_100661047 | |||
| 1061 | Ga0070697_100000215 | |||
| 1062 | Ga0070697_100003842 | |||
| 1063 | Ga0070697_100012842 | |||
| 1064 | Ga0070697_100067026 | |||
| 1065 | Ga0070697_101152859 | |||
| 1066 | Ga0068853_100010295 | |||
| 1067 | Ga0068853_100118467 | |||
| 1068 | Ga0070672_100129698 | |||
| 1069 | Ga0070686_100070666 | |||
| 1070 | Ga0070686_100094723 | |||
| 1071 | Ga0070695_100069076 | |||
| 1072 | Ga0070695_100444174 | |||
| 1073 | Ga0070696_100037515 | |||
| 1074 | Ga0070696_100461306 | |||
| 1075 | Ga0070696_100862079 | |||
| 1076 | Ga0070693_100003903 | |||
| 1077 | Ga0070693_100078524 | |||
| 1078 | Ga0070693_100122555 | |||
| 1079 | Ga0070665_100037529 | |||
| 1080 | Ga0070704_100076031 | |||
| 1081 | Ga0068855_100111914 | |||
| 1082 | Ga0068855_100113376 | |||
| 1083 | Ga0068855_100373258 | |||
| 1084 | Ga0068855_100595659 | |||
| 1085 | Ga0068855_100932460 | |||
| 1086 | Ga0070664_100004094 | |||
| 1087 | Ga0070664_100027609 | |||
| 1088 | Ga0070664_100056026 | |||
| 1089 | Ga0070664_100469290 | |||
| 1090 | Ga0070664_100512197 | |||
| 1091 | Ga0068857_100003130 | |||
| 1092 | Ga0068857_100024228 | |||
| 1093 | Ga0068857_100060763 | |||
| 1094 | Ga0068857_100130026 | |||
| 1095 | Ga0068854_100014950 | |||
| 1096 | Ga0068854_100073787 | |||
| 1097 | Ga0068854_100078751 | |||
| 1098 | Ga0068854_100726560 | |||
| 1099 | Ga0068856_100003761 | |||
| 1100 | Ga0068856_100030810 | |||
| 1101 | Ga0068856_100080283 | |||
| 1102 | Ga0068856_100088279 | |||
| 1103 | Ga0068856_100113817 | |||
| 1104 | Ga0068856_100469647 | |||
| 1105 | Ga0068852_100188647 | |||
| 1106 | Ga0068852_100334874 | |||
| 1107 | Ga0068859_100009951 | |||
| 1108 | Ga0068859_100015798 | |||
| 1109 | Ga0068859_100054207 | |||
| 1110 | Ga0068859_101300422 | |||
| 1111 | Ga0068864_100020897 | |||
| 1112 | Ga0068864_100224521 | |||
| 1113 | Ga0068864_100286421 | |||
| 1114 | Ga0068864_100895035 | |||
| 1115 | Ga0068866_10002476 | |||
| 1116 | Ga0068866_10121646 | |||
| 1117 | Ga0068861_100020397 | |||
| 1118 | Ga0068861_100213710 | |||
| 1119 | Ga0068851_10005084 | |||
| 1120 | Ga0068851_10006223 | |||
| 1121 | Ga0068851_10012881 | |||
| 1122 | Ga0068870_10011230 | |||
| 1123 | Ga0068870_10397057 | |||
| 1124 | Ga0068863_100095190 | |||
| 1125 | Ga0068863_100117932 | |||
| 1126 | Ga0068863_100566847 | |||
| 1127 | Ga0068863_100646969 | |||
| 1128 | Ga0068858_100027977 | |||
| 1129 | Ga0068858_100083404 | |||
| 1130 | Ga0068858_100130378 | |||
| 1131 | Ga0068858_100283089 | |||
| 1132 | Ga0068858_100604996 | |||
| 1133 | Ga0068860_100004017 | |||
| 1134 | Ga0068860_100015666 | |||
| 1135 | Ga0068860_100104930 | |||
| 1136 | Ga0068860_100362505 | |||
| 1137 | Ga0068860_100369270 | |||
| 1138 | Ga0068860_100911128 | |||
| 1139 | Ga0068862_100027696 | |||
| 1140 | Ga0068862_100079452 | |||
| 1141 | Ga0068862_100238748 | |||
| 1142 | Ga0081540_1093958 | |||
| 1143 | Ga0070717_10007158 | |||
| 1144 | Ga0070717_10010694 | |||
| 1145 | Ga0070717_10015399 | |||
| 1146 | Ga0070717_10016305 | |||
| 1147 | Ga0070717_10041852 | |||
| 1148 | Ga0070717_10043343 | |||
| 1149 | Ga0070717_10157594 | |||
| 1150 | Ga0070717_10192149 | |||
| 1151 | Ga0070717_10198404 | |||
| 1152 | Ga0070717_10358992 | |||
| 1153 | Ga0070717_10433051 | |||
| 1154 | Ga0070717_10931203 | |||
| 1155 | Ga0070717_11498533 | |||
| 1156 | Ga0070715_10001994 | |||
| 1157 | Ga0070715_10004193 | |||
| 1158 | Ga0070715_10005218 | |||
| 1159 | Ga0070715_10014527 | |||
| 1160 | Ga0070715_10072340 | |||
| 1161 | Ga0070715_10263209 | |||
| 1162 | Ga0070716_100000233 | |||
| 1163 | Ga0070716_100001391 | |||
| 1164 | Ga0070716_100006726 | |||
| 1165 | Ga0070716_100048939 | |||
| 1166 | Ga0070716_100270760 | |||
| 1167 | Ga0070716_100275286 | |||
| 1168 | Ga0070716_100280667 | |||
| 1169 | Ga0070716_100352215 | |||
| 1170 | Ga0070716_100375424 | |||
| 1171 | Ga0070712_100000056 | |||
| 1172 | Ga0070712_100000057 | |||
| 1173 | Ga0070712_100002047 | |||
| 1174 | Ga0070712_100002910 | |||
| 1175 | Ga0070712_100074837 | |||
| 1176 | Ga0070712_100093069 | |||
| 1177 | Ga0070712_100097870 | |||
| 1178 | Ga0070712_100130157 | |||
| 1179 | Ga0070712_100182410 | |||
| 1180 | Ga0070712_100615593 | |||
| 1181 | Ga0097621_100000377 | |||
| 1182 | Ga0097621_100044023 | |||
| 1183 | Ga0097621_100165634 | |||
| 1184 | Ga0097621_100208616 | |||
| 1185 | Ga0097621_100375098 | |||
| 1186 | Ga0097621_100453225 | |||
| 1187 | Ga0068871_100002049 | |||
| 1188 | Ga0068871_100023357 | |||
| 1189 | Ga0068871_100177893 | |||
| 1190 | Ga0068871_100188451 | |||
| 1191 | Ga0068871_100193680 | |||
| 1192 | Ga0068871_101151461 | |||
| 1193 | Ga0068871_101353811 | |||
| 1194 | Ga0075434_100007390 | |||
| 1195 | Ga0075434_100490640 | |||
| 1196 | Ga0075434_100565087 | |||
| 1197 | Ga0075434_100651770 | |||
| 1198 | Ga0068865_100137269 | |||
| 1199 | Ga0068865_100170105 | |||
| 1200 | Ga0068865_100682906 | |||
| 1201 | Ga0075436_100008529 | |||
| 1202 | Ga0075436_100239868 | |||
| 1203 | Ga0075436_100474575 | |||
| 1204 | Ga0097620_100009951 | |||
| 1205 | Ga0097620_100015799 | |||
| 1206 | Ga0097620_100054205 | |||
| 1207 | Ga0097620_101300196 | |||
| 1208 | Ga0075435_101029556 | |||
| 1209 | Ga0099795_10174808 | |||
| 1210 | Ga0105250_10161329 | |||
| 1211 | Ga0105240_10011378 | |||
| 1212 | Ga0105240_10031271 | |||
| 1213 | Ga0105240_10285028 | |||
| 1214 | Ga0105240_10449204 | |||
| 1215 | Ga0105240_12194228 | |||
| 1216 | Ga0111539_10376001 | |||
| 1217 | Ga0105245_10001216 | |||
| 1218 | Ga0105245_10035352 | |||
| 1219 | Ga0105245_10112515 | |||
| 1220 | Ga0105245_10118505 | |||
| 1221 | Ga0105245_10219247 | |||
| 1222 | Ga0105245_10276642 | |||
| 1223 | Ga0105245_10403726 | |||
| 1224 | Ga0105247_10021502 | |||
| 1225 | Ga0105247_10168489 | |||
| 1226 | Ga0105247_10212387 | |||
| 1227 | Ga0105247_10270908 | |||
| 1228 | Ga0105247_11323312 | |||
| 1229 | Ga0105243_10012041 | |||
| 1230 | Ga0105243_10613233 | |||
| 1231 | Ga0105241_10010024 | |||
| 1232 | Ga0105241_10012439 | |||
| 1233 | Ga0105241_10036890 | |||
| 1234 | Ga0105241_10042011 | |||
| 1235 | Ga0105241_10093037 | |||
| 1236 | Ga0105242_10017682 | |||
| 1237 | Ga0105242_10020643 | |||
| 1238 | Ga0105242_10029598 | |||
| 1239 | Ga0105242_10391147 | |||
| 1240 | Ga0105248_10041125 | |||
| 1241 | Ga0105248_10067741 | |||
| 1242 | Ga0105248_10202179 | |||
| 1243 | Ga0105248_10503513 | |||
| 1244 | Ga0105248_10864405 | |||
| 1245 | Ga0105248_11039506 | |||
| 1246 | Ga0105248_11659201 | |||
| 1247 | Ga0105237_10005849 | |||
| 1248 | Ga0105237_10019096 | |||
| 1249 | Ga0105237_10023583 | |||
| 1250 | Ga0105237_10082241 | |||
| 1251 | Ga0105237_10147929 | |||
| 1252 | Ga0105237_10235879 | |||
| 1253 | Ga0105238_10009257 | |||
| 1254 | Ga0105238_10084826 | |||
| 1255 | Ga0105238_10085860 | |||
| 1256 | Ga0105238_10358871 | |||
| 1257 | Ga0105249_10006117 | |||
| 1258 | Ga0105249_10020166 | |||
| 1259 | Ga0105249_10142313 | |||
| 1260 | Ga0099796_10019102 | |||
| 1261 | Ga0105239_10005922 | |||
| 1262 | Ga0105239_10019624 | |||
| 1263 | Ga0105239_10030855 | |||
| 1264 | Ga0105239_10065312 | |||
| 1265 | Ga0105246_10018550 | |||
| 1266 | Ga0105246_10161701 | |||
| 1267 | Ga0105246_10373159 | |||
| 1268 | Ga0157324_1001777 | |||
| 1269 | Ga0157373_10002006 | |||
| 1270 | Ga0157371_10013493 | |||
| 1271 | Ga0157371_10039104 | |||
| 1272 | Ga0157370_10200977 | |||
| 1273 | Ga0157369_10020901 | |||
| 1274 | Ga0157369_10044713 | |||
| 1275 | Ga0157369_10080441 | |||
| 1276 | Ga0157369_10558690 | |||
| 1277 | Ga0157374_10006392 | |||
| 1278 | Ga0157374_10007905 | |||
| 1279 | Ga0157374_10009965 | |||
| 1280 | Ga0157374_10034699 | |||
| 1281 | Ga0157374_10043341 | |||
| 1282 | Ga0157374_10113184 | |||
| 1283 | Ga0157374_10147964 | |||
| 1284 | Ga0157374_10151797 | |||
| 1285 | Ga0157374_10755442 | |||
| 1286 | Ga0157374_11179862 | |||
| 1287 | Ga0157378_10000500 | |||
| 1288 | Ga0157378_10027150 | |||
| 1289 | Ga0157378_10031909 | |||
| 1290 | Ga0157378_10041884 | |||
| 1291 | Ga0157378_10051536 | |||
| 1292 | Ga0157378_10154534 | |||
| 1293 | Ga0157378_10335665 | |||
| 1294 | Ga0157378_10986657 | |||
| 1295 | Ga0163162_10004111 | |||
| 1296 | Ga0163162_10025814 | |||
| 1297 | Ga0163162_10028631 | |||
| 1298 | Ga0163162_10041900 | |||
| 1299 | Ga0163162_10052703 | |||
| 1300 | Ga0163162_10376726 | |||
| 1301 | Ga0163162_10738771 | |||
| 1302 | Ga0157372_10005010 | |||
| 1303 | Ga0157372_10017917 | |||
| 1304 | Ga0157372_10088321 | |||
| 1305 | Ga0157372_10164562 | |||
| 1306 | Ga0157372_10571909 | |||
| 1307 | Ga0157372_11145692 | |||
| 1308 | Ga0157375_10003750 | |||
| 1309 | Ga0157375_10004968 | |||
| 1310 | Ga0157375_10022457 | |||
| 1311 | Ga0157375_10214376 | |||
| 1312 | Ga0157375_11263325 | |||
| 1313 | Ga0163163_10003969 | |||
| 1314 | Ga0163163_10022798 | |||
| 1315 | Ga0163163_10070616 | |||
| 1316 | Ga0163163_10075760 | |||
| 1317 | Ga0163163_10076433 | |||
| 1318 | Ga0163163_10813774 | |||
| 1319 | Ga0157380_10590111 | |||
| 1320 | Ga0157380_10590888 | |||
| 1321 | Ga0182008_10011317 | |||
| 1322 | Ga0157377_10001238 | |||
| 1323 | Ga0157377_10679140 | |||
| 1324 | Ga0157379_10001079 | |||
| 1325 | Ga0157379_10029253 | |||
| 1326 | Ga0157379_10042037 | |||
| 1327 | Ga0157379_10092539 | |||
| 1328 | Ga0157379_10346130 | |||
| 1329 | Ga0157376_10016890 | |||
| 1330 | Ga0157376_10018776 | |||
| 1331 | Ga0157376_10020940 | |||
| 1332 | Ga0157376_10046901 | |||
| 1333 | Ga0157376_10087080 | |||
| 1334 | Ga0157376_10087229 | |||
| 1335 | Ga0157376_10285495 | |||
| 1336 | Ga0157376_10609695 | |||
| 1337 | Ga0157376_10774416 | |||
| 1338 | Ga0182006_1016501 | |||
| 1339 | Ga0182007_10002720 | |||
| 1340 | Ga0182005_1226137 | |||
| 1341 | Ga0163161_10012193 | |||
| 1342 | Ga0206356_11855300 | |||
| 1343 | Ga0213874_10145638 | |||
| 1344 | Ga0224569_100483 | |||
| 1345 | Ga0224572_1001830 | |||
| 1346 | Ga0224572_1001886 | |||
| 1347 | Ga0224572_1023503 | |||
| 1348 | Ga0228598_1000189 | |||
| 1349 | Ga0228598_1001276 | |||
| 1350 | Ga0228598_1001673 | |||
| 1351 | Ga0207697_10004521 | |||
| 1352 | Ga0207656_10010867 | |||
| 1353 | Ga0207656_10110733 | |||
| 1354 | Ga0207653_10407233 | |||
| 1355 | Ga0207682_10002451 | |||
| 1356 | Ga0207682_10161156 | |||
| 1357 | Ga0207692_10003629 | |||
| 1358 | Ga0207692_10013556 | |||
| 1359 | Ga0207692_10030890 | |||
| 1360 | Ga0207692_10032115 | |||
| 1361 | Ga0207692_10365983 | |||
| 1362 | Ga0207692_10819472 | |||
| 1363 | Ga0207642_10009961 | |||
| 1364 | Ga0207642_10010581 | |||
| 1365 | Ga0207710_10102404 | |||
| 1366 | Ga0207688_10000776 | |||
| 1367 | Ga0207680_10125010 | |||
| 1368 | Ga0207680_10292301 | |||
| 1369 | Ga0207647_10026923 | |||
| 1370 | Ga0207647_10040871 | |||
| 1371 | Ga0207647_10099104 | |||
| 1372 | Ga0207685_10002976 | |||
| 1373 | Ga0207685_10003636 | |||
| 1374 | Ga0207685_10022304 | |||
| 1375 | Ga0207685_10071377 | |||
| 1376 | Ga0207685_10103127 | |||
| 1377 | Ga0207685_10462334 | |||
| 1378 | Ga0207699_10000416 | |||
| 1379 | Ga0207699_10011990 | |||
| 1380 | Ga0207699_10042624 | |||
| 1381 | Ga0207699_10071103 | |||
| 1382 | Ga0207699_10080100 | |||
| 1383 | Ga0207699_10143920 | |||
| 1384 | Ga0207699_10216958 | |||
| 1385 | Ga0207699_10238902 | |||
| 1386 | Ga0207699_10441854 | |||
| 1387 | Ga0207699_10711116 | |||
| 1388 | Ga0207699_11281642 | |||
| 1389 | Ga0207645_10000073 | |||
| 1390 | Ga0207645_10006315 | |||
| 1391 | Ga0207643_10000501 | |||
| 1392 | Ga0207643_10243421 | |||
| 1393 | Ga0207705_10167895 | |||
| 1394 | Ga0207705_10445455 | |||
| 1395 | Ga0207684_10002508 | |||
| 1396 | Ga0207684_10010254 | |||
| 1397 | Ga0207684_10022651 | |||
| 1398 | Ga0207684_10262687 | |||
| 1399 | Ga0207654_10441625 | |||
| 1400 | Ga0207654_10672869 | |||
| 1401 | Ga0207707_10008829 | |||
| 1402 | Ga0207707_10122784 | |||
| 1403 | Ga0207707_10245761 | |||
| 1404 | Ga0207707_10310345 | |||
| 1405 | Ga0207695_10019060 | |||
| 1406 | Ga0207695_10053604 | |||
| 1407 | Ga0207695_10071484 | |||
| 1408 | Ga0207671_10095513 | |||
| 1409 | Ga0207671_10201857 | |||
| 1410 | Ga0207671_10654225 | |||
| 1411 | Ga0207693_10000096 | |||
| 1412 | Ga0207693_10000119 | |||
| 1413 | Ga0207693_10000850 | |||
| 1414 | Ga0207693_10002121 | |||
| 1415 | Ga0207693_10057014 | |||
| 1416 | Ga0207693_10057079 | |||
| 1417 | Ga0207693_10058329 | |||
| 1418 | Ga0207693_10266776 | |||
| 1419 | Ga0207693_10416953 | |||
| 1420 | Ga0207663_10003336 | |||
| 1421 | Ga0207663_10005024 | |||
| 1422 | Ga0207663_10012144 | |||
| 1423 | Ga0207663_10013106 | |||
| 1424 | Ga0207663_10014369 | |||
| 1425 | Ga0207663_10060021 | |||
| 1426 | Ga0207663_10555994 | |||
| 1427 | Ga0207663_10870510 | |||
| 1428 | Ga0207662_10003629 | |||
| 1429 | Ga0207657_10000321 | |||
| 1430 | Ga0207657_10000379 | |||
| 1431 | Ga0207657_10000845 | |||
| 1432 | Ga0207649_10000727 | |||
| 1433 | Ga0207649_10009574 | |||
| 1434 | Ga0207649_10461717 | |||
| 1435 | Ga0207652_10139421 | |||
| 1436 | Ga0207652_10173661 | |||
| 1437 | Ga0207652_10553520 | |||
| 1438 | Ga0207646_10020449 | |||
| 1439 | Ga0207646_10038531 | |||
| 1440 | Ga0207646_10070886 | |||
| 1441 | Ga0207681_10402794 | |||
| 1442 | Ga0207694_10034679 | |||
| 1443 | Ga0207694_10101208 | |||
| 1444 | Ga0207694_10218059 | |||
| 1445 | Ga0207650_10000045 | |||
| 1446 | Ga0207659_10017862 | |||
| 1447 | Ga0207659_11233041 | |||
| 1448 | Ga0207687_10028281 | |||
| 1449 | Ga0207687_10111038 | |||
| 1450 | Ga0207687_10135791 | |||
| 1451 | Ga0207687_10212054 | |||
| 1452 | Ga0207687_10297260 | |||
| 1453 | Ga0207700_10000467 | |||
| 1454 | Ga0207700_10000611 | |||
| 1455 | Ga0207700_10005967 | |||
| 1456 | Ga0207700_10014391 | |||
| 1457 | Ga0207700_10154866 | |||
| 1458 | Ga0207700_10227923 | |||
| 1459 | Ga0207700_10334467 | |||
| 1460 | Ga0207700_10553194 | |||
| 1461 | Ga0207700_10961835 | |||
| 1462 | Ga0207664_10000017 | |||
| 1463 | Ga0207664_10088293 | |||
| 1464 | Ga0207664_10093267 | |||
| 1465 | Ga0207664_10141353 | |||
| 1466 | Ga0207664_10267902 | |||
| 1467 | Ga0207664_11375053 | |||
| 1468 | Ga0207644_10002234 | |||
| 1469 | Ga0207644_10261836 | |||
| 1470 | Ga0207690_10077529 | |||
| 1471 | Ga0207706_10000213 | |||
| 1472 | Ga0207706_10000370 | |||
| 1473 | Ga0207706_10005630 | |||
| 1474 | Ga0207686_10034816 | |||
| 1475 | Ga0207686_10100284 | |||
| 1476 | Ga0207686_10253809 | |||
| 1477 | Ga0207686_10446941 | |||
| 1478 | Ga0207709_10275340 | |||
| 1479 | Ga0207670_10873783 | |||
| 1480 | Ga0207704_10022941 | |||
| 1481 | Ga0207704_10143193 | |||
| 1482 | Ga0207704_10451668 | |||
| 1483 | Ga0207665_10002537 | |||
| 1484 | Ga0207665_10006824 | |||
| 1485 | Ga0207665_10033174 | |||
| 1486 | Ga0207665_10034312 | |||
| 1487 | Ga0207665_10052282 | |||
| 1488 | Ga0207665_10131930 | |||
| 1489 | Ga0207665_10299447 | |||
| 1490 | Ga0207665_10556190 | |||
| 1491 | Ga0207665_10986915 | |||
| 1492 | Ga0207691_10000151 | |||
| 1493 | Ga0207711_10024010 | |||
| 1494 | Ga0207711_10030477 | |||
| 1495 | Ga0207711_10089953 | |||
| 1496 | Ga0207711_10133886 | |||
| 1497 | Ga0207711_10398925 | |||
| 1498 | Ga0207711_10437602 | |||
| 1499 | Ga0207689_10000129 | |||
| 1500 | Ga0207689_10000166 | |||
| 1501 | Ga0207689_10012861 | |||
| 1502 | Ga0207661_10000099 | |||
| 1503 | Ga0207661_10080027 | |||
| 1504 | Ga0207661_10232065 | |||
| 1505 | Ga0207679_10000096 | |||
| 1506 | Ga0207679_10151353 | |||
| 1507 | Ga0207679_10455970 | |||
| 1508 | Ga0207679_10503115 | |||
| 1509 | Ga0207667_10020353 | |||
| 1510 | Ga0207667_10042127 | |||
| 1511 | Ga0207667_10208166 | |||
| 1512 | Ga0207667_10333123 | |||
| 1513 | Ga0207667_10832018 | |||
| 1514 | Ga0207651_10062182 | |||
| 1515 | Ga0207651_10532036 | |||
| 1516 | Ga0207712_10071282 | |||
| 1517 | Ga0207712_10130650 | |||
| 1518 | Ga0207668_10034712 | |||
| 1519 | Ga0207640_10003526 | |||
| 1520 | Ga0207640_10009802 | |||
| 1521 | Ga0207640_10238081 | |||
| 1522 | Ga0207640_10608754 | |||
| 1523 | Ga0207658_10041272 | |||
| 1524 | Ga0207658_10891745 | |||
| 1525 | Ga0207677_10063083 | |||
| 1526 | Ga0207677_10483722 | |||
| 1527 | Ga0207677_10514646 | |||
| 1528 | Ga0207677_11040227 | |||
| 1529 | Ga0207703_10050074 | |||
| 1530 | Ga0207703_10066556 | |||
| 1531 | Ga0207703_10077224 | |||
| 1532 | Ga0207703_10139381 | |||
| 1533 | Ga0207703_11745599 | |||
| 1534 | Ga0207639_10018041 | |||
| 1535 | Ga0207639_10115151 | |||
| 1536 | Ga0207678_10000026 | |||
| 1537 | Ga0207678_10000381 | |||
| 1538 | Ga0207702_10000993 | |||
| 1539 | Ga0207702_10072869 | |||
| 1540 | Ga0207702_10082190 | |||
| 1541 | Ga0207702_10307456 | |||
| 1542 | Ga0207702_11639619 | |||
| 1543 | Ga0207702_11873587 | |||
| 1544 | Ga0207641_10000075 | |||
| 1545 | Ga0207641_10191705 | |||
| 1546 | Ga0207641_10244361 | |||
| 1547 | Ga0207641_10550873 | |||
| 1548 | Ga0207641_10590747 | |||
| 1549 | Ga0207648_10000890 | |||
| 1550 | Ga0207648_10041404 | |||
| 1551 | Ga0207648_10053396 | |||
| 1552 | Ga0207676_10000212 | |||
| 1553 | Ga0207676_10043033 | |||
| 1554 | Ga0207676_10666442 | |||
| 1555 | Ga0207674_10000670 | |||
| 1556 | Ga0207674_10022023 | |||
| 1557 | Ga0207674_10029181 | |||
| 1558 | Ga0207674_10036200 | |||
| 1559 | Ga0207675_100010093 | |||
| 1560 | Ga0207675_100297005 | |||
| 1561 | Ga0207675_100514464 | |||
| 1562 | Ga0207683_10001901 | |||
| 1563 | Ga0207698_10064039 | |||
| 1564 | Ga0207698_10462267 | |||
| 1565 | Ga0207698_10490859 | |||
| 1566 | Ga0265356_1003947 | |||
| 1567 | Ga0265357_1030038 | |||
| 1568 | Ga0268266_10025946 | |||
| 1569 | Ga0268266_10036165 | |||
| 1570 | Ga0268266_10657495 | |||
| 1571 | Ga0268265_10042850 | |||
| 1572 | Ga0268265_10091846 | |||
| 1573 | Ga0268265_10418419 | |||
| 1574 | Ga0268265_10471841 | |||
| 1575 | Ga0268264_10022618 | |||
| 1576 | Ga0268264_10024495 | |||
| 1577 | Ga0268264_10034827 | |||
| 1578 | Ga0268264_10399933 | |||
| 1579 | Ga0268264_10741278 | |||
| 1580 | Ga0268264_11565741 | |||
| 1581 | Ga0265338_10015238 | |||
| 1582 | Ga0265338_10027752 | |||
| 1583 | Ga0265338_10048630 | |||
| 1584 | Ga0265338_10054343 | |||
| 1585 | Ga0265338_10056053 | |||
| 1586 | Ga0265338_10097773 | |||
| 1587 | Ga0265762_1000267 | |||
| 1588 | Ga0265762_1000706 | |||
| 1589 | Ga0265762_1002225 | |||
| 1590 | Ga0265762_1070665 | |||
| 1591 | Ga0265770_1013760 | |||
| 1592 | Ga0265760_10000117 | |||
| 1593 | Ga0265760_10003836 | |||
| 1594 | Ga0265760_10006936 | |||
| 1595 | Ga0265332_10048162 | |||
| 1596 | Ga0265328_10073488 | |||
| 1597 | Ga0265325_10003863 | |||
| 1598 | Ga0265325_10046541 | |||
| 1599 | Ga0265340_10052980 | |||
| 1600 | Ga0265339_10010741 | |||
| 1601 | Ga0265339_10031452 | |||
| 1602 | Ga0265339_10090458 | |||
| 1603 | Ga0265316_10062736 | |||
| 1604 | Ga0265316_10064286 | |||
| 1605 | Ga0265316_10071581 | |||
| 1606 | Ga0265316_10647613 | |||
| 1607 | Ga0307408_100526426 | |||
| 1608 | Ga0265314_10062459 | |||
| 1609 | Ga0265314_10149781 | |||
| 1610 | Ga0265342_10033401 | |||
| 1611 | Ga0307405_10074415 | |||
| 1612 | Ga0307410_10064758 | |||
| 1613 | Ga0307410_10104420 | |||
| 1614 | Ga0307412_10401241 | |||
| 1615 | Ga0307416_100438412 | |||
| 1616 | Ga0307411_10019305 | |||
| 1617 | Ga0307415_100002600 | |||
| 1618 | Ga0307415_100729967 | |||
| 1619 | Ga0316212_1007283 | |||
| 1620 | Ga0373930_0004788 | |||
| 1621 | Ga0373958_0012903 | |||
| 1622 | Ga0373929_0062253 | |||
| 1623 | Ga0373934_0076687 | |||
| 1624 | Ga0373940_0102809 | |||
| 1625 | Ga0373944_0012902 | |||
| 1626 | Ga0373952_0012167 | |||
| 1627 | Ga0373923_0084699 | |||
| 1628 | Ga0373932_0023073 | |||
| 1629 | Ga0373936_0002322 | |||
| 1630 | Ga0373936_0068456 | |||
| 1631 | Ga0373936_0237092 | |||
| 1632 | Ga0373941_0019831 | |||
| 1633 | Ga0373956_0351440 | |||
| 1634 | Ga0373943_0000779 | |||
| 1635 | Ga0373943_0148809 | |||
| 1636 | Ga0373946_0000613 | |||
| 1637 | Ga0373955_0024353 | |||
| 1638 | Ga0373955_0373305 | |||
| 1639 | Ga0373942_0096634 | |||
| 1640 | Ga0373961_0030639 | |||
| 1641 | Ga0373962_0008003 | |||
| 1642 | Ga0373924_0021094 | |||
| 1643 | Ga0373924_0024035 | |||
| 1644 | Ga0373935_0006806 | |||
| 1645 | Ga0373935_0116074 | |||
| 1646 | Ga0373935_0228814 | |||
| 1647 | Ga0373927_0000085 | |||
| 1648 | Ga0373927_0333611 | |||
| 1649 | Ga0373933_0036263 | |||
| 1650 | Ga0373947_0003515 | |||
| 1651 | Ga0373947_0266536 | |||
| 1652 | Ga0373937_0219637 | |||
| 1653 | Ga0373937_0248845 | |||
| 1654 | Ga0373937_0464780 | |||
| 1655 | Ga0373937_0479114 | |||
| 1656 | Ga0373937_1736420 | |||
| 1657 | Ga0373937_1811477 | |||
| 1658 | Ga0373925_0009268 | |||
| 1659 | Ga0373925_0033615 | |||
| 1660 | Ga0373925_0194405 | |||
| 1661 | Ga0373925_0735088 | |||
| 1662 | Ga0395905_1600520 | |||
| 1663 | Ga0436361_0612533 | |||
| 1664 | Ga0436363_0628616 | |||
| 1665 | Ga0466963_0151097 | |||
| 1666 | Ga0466963_1186534 | |||
| 1667 | Ga0466964_0093259 | |||
| 1668 | Ga0453684_0731116 | |||
| 1669 | Ga0451576_0081959 | |||
| 1670 | Ga0451576_0235019 | |||
| 1671 | Ga0466967_0812985 | |||
| 1672 | Ga0495592_0236376 | |||
| 1673 | Ga0495592_0699443 | |||
| 1674 | Ga0495603_0262410 | |||
| 1675 | Ga0495629_0018361 | |||
| 1676 | Ga0495580_0000349 | |||
| 1677 | Ga0495580_0001198 | |||
| 1678 | Ga0495580_0003361 | |||
| 1679 | Ga0495580_0005033 | |||
| 1680 | Ga0495580_0037248 | |||
| 1681 | Ga0495580_0042811 | |||
| 1682 | Ga0495580_0050893 | |||
| 1683 | Ga0495580_0105094 | |||
| 1684 | Ga0495580_0140471 | |||
| 1685 | Ga0495580_0186121 | |||
| 1686 | Ga0495580_0224300 | |||
| 1687 | Ga0495582_0005458 | |||
| 1688 | Ga0495664_0194851 | |||
| 1689 | Ga0495594_0005014 | |||
| 1690 | Ga0495628_0047983 | |||
| 1691 | Ga0495630_0398730 | |||
| 1692 | Ga0495630_0532188 | |||
| 1693 | Ga0495666_0252568 | |||
| 1694 | Ga0495665_0108705 | |||
| 1695 | Ga0495665_0299860 | |||
| 1696 | Ga0495645_0096065 | |||
| 1697 | Ga0495635_0622082 | |||
| 1698 | Ga0495599_0243862 | |||
| 1699 | Ga0495624_0062475 | |||
| 1700 | Ga0495624_0267018 | |||
| 1701 | Ga0495670_0331172 | |||
| 1702 | Ga0495674_0067144 | |||
| 1703 | Ga0495674_0235268 | |||
| 1704 | Ga0495674_1027178 | |||
| 1705 | Ga0495674_1041024 | |||
| 1706 | Ga0495593_0032870 | |||
| 1707 | Ga0496100_0063571 | |||
| 1708 | Ga0496100_0065557 | |||
| 1709 | Ga0496100_0120637 | |||
| 1710 | Ga0496100_0154515 | |||
| 1711 | Ga0496100_0190880 | |||
| 1712 | Ga0496100_0231120 | |||
| 1713 | Ga0496101_0012667 | |||
| 1714 | Ga0496101_0060527 | |||
| 1715 | Ga0496101_0471500 | |||
| 1716 | Ga0496101_0496278 | |||
| 1717 | Ga0496102_0003593 | |||
| 1718 | Ga0496102_0015179 | |||
| 1719 | Ga0496102_0035381 | |||
| 1720 | Ga0496102_0060070 | |||
| 1721 | Ga0496102_0323463 | |||
| 1722 | Ga0496102_0345865 | |||
| 1723 | Ga0496102_0784028 | |||
| 1724 | Ga0496103_0086381 | |||
| 1725 | Ga0496103_0248197 | |||
| 1726 | Ga0496103_0413713 | |||
| 1727 | Ga0496104_0008923 | |||
| 1728 | Ga0496104_0090209 | |||
| 1729 | Ga0496104_0143461 | |||
| 1730 | Ga0496104_0164437 | |||
| 1731 | Ga0496104_0262503 | |||
| 1732 | Ga0496104_0433809 | |||
| 1733 | Ga0496104_0500593 | |||
| 1734 | Ga0496105_0199645 | |||
| 1735 | Ga0496105_0852250 | |||
| 1736 | Ga0496106_0048312 | |||
| 1737 | Ga0496106_0136745 | |||
| 1738 | Ga0496106_0276918 | |||
| 1739 | Ga0496108_0000304 | |||
| 1740 | Ga0496108_0155177 | |||
| 1741 | Ga0496108_0475096 | |||
| 1742 | Ga0496108_0584016 | |||
| 1743 | Ga0496109_0000132 | |||
| 1744 | Ga0496109_0037739 | |||
| 1745 | Ga0496109_0145417 | |||
| 1746 | Ga0496109_0718669 | |||
| 1747 | Ga0496109_1160915 | |||
| 1748 | Ga0496109_1322206 | |||
| 1749 | Ga0496110_0003639 | |||
| 1750 | Ga0496110_0208999 | |||
| 1751 | Ga0496110_0437838 | |||
| 1752 | Ga0496111_0039281 | |||
| 1753 | Ga0496111_0161367 | |||
| 1754 | Ga0496112_0000724 | |||
| 1755 | Ga0496112_0003918 | |||
| 1756 | Ga0496112_0052762 | |||
| 1757 | Ga0496112_0585500 | |||
| 1758 | Ga0496112_0619482 | |||
| 1759 | Ga0496112_0655201 | |||
| 1760 | Ga0496112_0906177 | |||
| 1761 | Ga0496113_0003443 | |||
| 1762 | Ga0496113_0033740 | |||
| 1763 | Ga0496114_0007439 | |||
| 1764 | Ga0496114_0645314 | |||
| 1765 | Ga0496115_0015286 | |||
| 1766 | Ga0496115_0164465 | |||
| 1767 | Ga0496115_0649092 | |||
| 1768 | Ga0501224_008551 | |||
| 1769 | Ga0501243_010114 | |||
| 1770 | Ga0501249_075838 | |||
| 1771 | Ga0501225_0022264 | |||
| 1772 | Ga0501234_014780 | |||
| 1773 | Ga0501245_102973 | |||
| 1774 | Ga0501284_10831 | |||
| 1775 | nmdc:mga0n895_351824_c1 | |||
| 1776 | nmdc:mga0rr50_212469_c1 | |||
| 1777 | nmdc:mga0rr50_28025_c1 | |||
| 1778 | nmdc:mga0rr50_290301_c1 | |||
| 1779 | nmdc:mga08x19_238318_c1 | |||
| 1780 | nmdc:mga08x19_471737_c1 | |||
| 1781 | nmdc:mga08x19_65499_c1 | |||
| 1782 | nmdc:mga0a205_2659_c1 | |||
| 1783 | Ga0495601_0094615 | |||
| 1784 | Ga0500590_278060 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mmn-assembly2.cif.gz_E | structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum | 0.9704 | 24 | 154 |
| 3rfb-assembly1.cif.gz_A | structure of frmsr | 0.9496 | 5 | 152 |
| 3ksf-assembly3.cif.gz_F | structure of frmsr of staphylococcus aureus (reduced form) | 0.9492 | 7 | 156 |
| 3mmh-assembly1.cif.gz_B | x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate | 0.9433 | 1 | 157 |
| 5hl6-assembly1.cif.gz_A | crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis | 0.9432 | 1 | 152 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3rfbA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9496 | 5 | 152 | 3.30.450.40 |
| af_Q8MTJ7_3_158_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9491 | 1 | 153 | 3.30.450.40 |
| 4mmnA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9407 | 24 | 157 | 3.30.450.40 |
| 1vhmA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9321 | 6 | 157 | 3.30.450.40 |
| af_A0A1D8PPZ9_7_175_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.9026 | 1 | 154 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V0T743-F1-model_v4 | GAF domain-containing protein | 0.9781 | 9 | 154 |
|
| AF-A0A0T6AN32-F1-model_v4 | GAF sensor protein, GAF domain-containing protein | 0.978 | 80 | 154 |
|
| AF-A0A3A0D2J3-F1-model_v4 | 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) | 0.9763 | 4 | 157 |
GO:0003855
GO:0008652 GO:0009073 GO:0009423 GO:0019631 |
| AF-A0A2V9ZCL0-F1-model_v4 | Diguanylate cyclase | 0.9715 | 65 | 159 |
|
| AF-A0A661U7B1-F1-model_v4 | GAF domain-containing protein | 0.9709 | 7 | 154 |
|