F484895

General Info

Members Datasets Scaffolds Average Seq Length
892 301 1784 161

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0431528|Ga0495580_0431528_208_765
Length 185
Sequence MYYRFASGNGRVPVDVTCSHLMTPSPTFSDVKKEIDRLNQAAGSVEDFMWETVKLLHDRMLKYNWVGFYMLEDKSPDSQPRMLALGPFQGAMTPHTRIPLNQGICGAAATTGKTIVVDDVTLDNRYLACSTETKSEIVVPVFVRNKVVGELDVDSHFPAAFGDQDRELVEYCASLVGKQLEKLPG

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
85 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
132 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
133 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
134 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
200 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
201 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
209 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
210 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
211 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
212 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
213 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
214 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
215 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
216 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
217 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
218 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
221 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
222 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
223 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
224 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
225 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
226 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
227 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
228 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
229 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
230 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
231 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
232 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
233 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
236 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
237 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
238 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
239 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
240 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
241 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
242 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
243 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
244 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
245 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
250 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
251 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
254 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
268 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
269 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
270 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
271 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
272 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
273 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
278 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
279 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
280 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
285 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
286 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
287 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
288 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
289 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
290 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
293 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
294 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
295 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.99
Metatranscriptomes 1.01
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 6.84
Rhizosphere 92.49
Stem 0
Stem Tuber 0
Unclassified 26.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0431528 3300046472 Bacteria 886
2 MBSR1b_contig_12289486 2162886012 Unclassified 934
3 MBSR1b_contig_14142699 2162886012 Bacteria 1307
4 MBSR1b_contig_14292732 2162886012 Bacteria 1095
5 MBSR1b_contig_5587874 2162886012 Bacteria 2114
6 LJNas_1001182 3300000546 Bacteria 3955
7 JGI24737J22298_10063201 3300001990 Bacteria 1111
8 JGI24743J22301_10012727 3300001991 Bacteria 1535
9 JGI24034J26672_10017411 3300002239 Bacteria 1112
10 JGI24751J29686_10004031 3300002459 Bacteria 2973
11 rootH2_10227596 3300003320 Unclassified 1232
12 rootH1_10403911 3300003323 Bacteria 1331
13 Ga0065712_10092655 3300005290 Bacteria 2323
14 Ga0065712_10352935 3300005290 Unclassified 785
15 Ga0065715_10119611 3300005293 Bacteria 2282
16 Ga0065715_10140426 3300005293 Bacteria 1862
17 Ga0065715_10187153 3300005293 Bacteria 1438
18 Ga0070658_10115792 3300005327 Bacteria 2224
19 Ga0070658_10305551 3300005327 Unclassified 1357
20 Ga0070676_10047767 3300005328 Bacteria 2501
21 Ga0070676_10114591 3300005328 Bacteria 1683
22 Ga0070676_10240739 3300005328 Unclassified 1203
23 Ga0070683_100104197 3300005329 Bacteria 2673
24 Ga0070683_100107295 3300005329 Bacteria 2633
25 Ga0070690_100019935 3300005330 Bacteria 4080
26 Ga0070690_100151190 3300005330 Bacteria 1584
27 Ga0070670_100026528 3300005331 Bacteria 4984
28 Ga0070670_100452666 3300005331 Unclassified 1138
29 Ga0070677_10012562 3300005333 Bacteria 2943
30 Ga0070677_10034842 3300005333 Bacteria 1947
31 Ga0068869_100002319 3300005334 Bacteria 11450
32 Ga0068869_100026540 3300005334 Bacteria 4033
33 Ga0068869_100073707 3300005334 Bacteria 2532
34 Ga0070666_10013454 3300005335 Bacteria 5193
35 Ga0070666_10034660 3300005335 Bacteria 3345
36 Ga0070666_10141130 3300005335 Bacteria 1678
37 Ga0070680_100063061 3300005336 Bacteria 3035
38 Ga0070680_100076099 3300005336 Bacteria 2763
39 Ga0070680_100515132 3300005336 Bacteria 1024
40 Ga0070680_100625488 3300005336 Unclassified 924
41 Ga0070682_100008588 3300005337 Bacteria 5767
42 Ga0070682_100125217 3300005337 Bacteria 1731
43 Ga0070682_100438374 3300005337 Unclassified 997
44 Ga0070682_101053414 3300005337 Unclassified 678
45 Ga0068868_100004356 3300005338 Bacteria 9923
46 Ga0068868_100006106 3300005338 Bacteria 8511
47 Ga0068868_100006804 3300005338 Bacteria 8118
48 Ga0068868_100049472 3300005338 Bacteria 3299
49 Ga0068868_100265133 3300005338 Unclassified 1450
50 Ga0068868_100322094 3300005338 Unclassified 1317
51 Ga0070660_100071577 3300005339 Bacteria 2707
52 Ga0070660_100134103 3300005339 Bacteria 1983
53 Ga0070689_100009760 3300005340 Bacteria 6818
54 Ga0070689_100763003 3300005340 Unclassified 848
55 Ga0070689_101009762 3300005340 Unclassified 740
56 Ga0070689_101016024 3300005340 Bacteria 738
57 Ga0070687_100006630 3300005343 Bacteria 4758
58 Ga0070661_100013287 3300005344 Bacteria 5779
59 Ga0070661_100043647 3300005344 Unclassified 3275
60 Ga0070692_10112780 3300005345 Bacteria 1506
61 Ga0070668_100026551 3300005347 Unclassified 4395
62 Ga0070668_100141409 3300005347 Bacteria 1939
63 Ga0070669_100143075 3300005353 Bacteria 1845
64 Ga0070669_100243108 3300005353 Bacteria 1431
65 Ga0070675_100021889 3300005354 Bacteria 5108
66 Ga0070675_100439005 3300005354 Bacteria 1169
67 Ga0070671_100096198 3300005355 Unclassified 2483
68 Ga0070671_100337418 3300005355 Bacteria 1285
69 Ga0070674_100018421 3300005356 Bacteria 4415
70 Ga0070674_100586601 3300005356 Unclassified 940
71 Ga0070673_100010209 3300005364 Bacteria 6344
72 Ga0070673_100550303 3300005364 Bacteria 1048
73 Ga0070688_100065322 3300005365 Bacteria 2312
74 Ga0070688_100079617 3300005365 Bacteria 2117
75 Ga0070659_100003788 3300005366 Bacteria 10791
76 Ga0070659_100004572 3300005366 Bacteria 9894
77 Ga0070659_100023398 3300005366 Bacteria 4727
78 Ga0070659_100396095 3300005366 Bacteria 1165
79 Ga0070667_100024022 3300005367 Bacteria 5063
80 Ga0070667_100097809 3300005367 Bacteria 2532
81 Ga0070667_100460754 3300005367 Bacteria 1162
82 Ga0070709_10000312 3300005434 Bacteria 30748
83 Ga0070709_10011171 3300005434 Bacteria 4995
84 Ga0070709_10095300 3300005434 Bacteria 1971
85 Ga0070709_10186443 3300005434 Unclassified 1461
86 Ga0070709_10197918 3300005434 Bacteria 1421
87 Ga0070709_10211451 3300005434 Unclassified 1379
88 Ga0070709_10261333 3300005434 Bacteria 1251
89 Ga0070709_10505123 3300005434 Bacteria 919
90 Ga0070709_10667765 3300005434 Unclassified 806
91 Ga0070714_100000060 3300005435 Bacteria 100913
92 Ga0070714_100003931 3300005435 Bacteria 11172
93 Ga0070714_100290592 3300005435 Bacteria 1521
94 Ga0070714_100494263 3300005435 Bacteria 1166
95 Ga0070714_100549632 3300005435 Unclassified 1105
96 Ga0070714_100717321 3300005435 Unclassified 965
97 Ga0070714_100862468 3300005435 Unclassified 878
98 Ga0070713_100000162 3300005436 Bacteria 45425
99 Ga0070713_100000344 3300005436 Bacteria 30312
100 Ga0070713_100018136 3300005436 Bacteria 5347
101 Ga0070713_100028068 3300005436 Bacteria 4440
102 Ga0070713_100031349 3300005436 Unclassified 4234
103 Ga0070713_100091091 3300005436 Bacteria 2622
104 Ga0070713_100191702 3300005436 Bacteria 1842
105 Ga0070713_100197806 3300005436 Bacteria 1814
106 Ga0070713_100681451 3300005436 Bacteria 981
107 Ga0070713_100712049 3300005436 Bacteria 959
108 Ga0070710_10001044 3300005437 Bacteria 13170
109 Ga0070710_10009785 3300005437 Bacteria 4697
110 Ga0070710_10075136 3300005437 Unclassified 1957
111 Ga0070710_10085744 3300005437 Bacteria 1848
112 Ga0070710_10137689 3300005437 Bacteria 1494
113 Ga0070710_10204247 3300005437 Bacteria 1249
114 Ga0070710_10286213 3300005437 Unclassified 1071
115 Ga0070710_10619239 3300005437 Bacteria 755
116 Ga0070711_100000231 3300005439 Bacteria 29031
117 Ga0070711_100004865 3300005439 Bacteria 7973
118 Ga0070711_100045235 3300005439 Unclassified 2993
119 Ga0070711_100051480 3300005439 Bacteria 2828
120 Ga0070711_100061715 3300005439 Bacteria 2610
121 Ga0070711_100079194 3300005439 Bacteria 2336
122 Ga0070711_100132561 3300005439 Bacteria 1858
123 Ga0070711_100372206 3300005439 Unclassified 1153
124 Ga0070711_100600854 3300005439 Bacteria 918
125 Ga0070711_101334202 3300005439 Unclassified 623
126 Ga0070700_101257518 3300005441 Unclassified 620
127 Ga0070708_100001600 3300005445 Bacteria 17349
128 Ga0070708_100005188 3300005445 Bacteria 10314
129 Ga0070708_100115232 3300005445 Unclassified 2474
130 Ga0070708_100244435 3300005445 Bacteria 1685
131 Ga0070708_100391009 3300005445 Bacteria 1311
132 Ga0070708_100434497 3300005445 Bacteria 1238
133 Ga0070663_100006281 3300005455 Bacteria 7129
134 Ga0070678_100164903 3300005456 Bacteria 1799
135 Ga0070678_100691800 3300005456 Unclassified 918
136 Ga0070678_100887980 3300005456 Bacteria 814
137 Ga0070662_100005657 3300005457 Bacteria 7997
138 Ga0070662_100056787 3300005457 Bacteria 2842
139 Ga0070681_10005365 3300005458 Bacteria 12377
140 Ga0070681_10061088 3300005458 Bacteria 3745
141 Ga0070681_10119342 3300005458 Bacteria 2573
142 Ga0070681_10287040 3300005458 Bacteria 1556
143 Ga0070681_10855764 3300005458 Unclassified 827
144 Ga0068867_100006383 3300005459 Bacteria 8334
145 Ga0068867_100040007 3300005459 Bacteria 3420
146 Ga0070685_10006397 3300005466 Bacteria 6004
147 Ga0070706_100005888 3300005467 Bacteria 11620
148 Ga0070706_100012684 3300005467 Bacteria 7797
149 Ga0070706_100015107 3300005467 Bacteria 7131
150 Ga0070706_100433856 3300005467 Bacteria 1223
151 Ga0070707_100021616 3300005468 Bacteria 6083
152 Ga0070707_100238876 3300005468 Unclassified 1769
153 Ga0070698_100016133 3300005471 Bacteria 7888
154 Ga0070698_100021148 3300005471 Bacteria 6817
155 Ga0070698_100068413 3300005471 Bacteria 3569
156 Ga0070699_100000358 3300005518 Bacteria 44500
157 Ga0070699_100006278 3300005518 Bacteria 10370
158 Ga0070699_100096103 3300005518 Unclassified 2595
159 Ga0070699_100223728 3300005518 Bacteria 1677
160 Ga0070679_100169393 3300005530 Unclassified 2157
161 Ga0070679_100196092 3300005530 Bacteria 1987
162 Ga0070679_100323076 3300005530 Bacteria 1492
163 Ga0070679_100352747 3300005530 Bacteria 1419
164 Ga0070679_100611566 3300005530 Bacteria 1033
165 Ga0070684_100005271 3300005535 Bacteria 9892
166 Ga0070684_100018826 3300005535 Bacteria 5698
167 Ga0070684_100182160 3300005535 Bacteria 1910
168 Ga0070684_100661047 3300005535 Unclassified 973
169 Ga0070697_100000215 3300005536 Bacteria 47439
170 Ga0070697_100003842 3300005536 Bacteria 11532
171 Ga0070697_100012842 3300005536 Bacteria 6562
172 Ga0070697_100067026 3300005536 Bacteria 2935
173 Ga0070697_101152859 3300005536 Unclassified 690
174 Ga0068853_100010295 3300005539 Bacteria 7564
175 Ga0068853_100118467 3300005539 Bacteria 2359
176 Ga0070672_100129698 3300005543 Bacteria 2071
177 Ga0070686_100070666 3300005544 Bacteria 2283
178 Ga0070686_100094723 3300005544 Bacteria 2004
179 Ga0070695_100069076 3300005545 Bacteria 2308
180 Ga0070695_100444174 3300005545 Unclassified 992
181 Ga0070696_100037515 3300005546 Unclassified 3343
182 Ga0070696_100461306 3300005546 Unclassified 1004
183 Ga0070696_100862079 3300005546 Unclassified 749
184 Ga0070693_100003903 3300005547 Bacteria 6990
185 Ga0070693_100078524 3300005547 Bacteria 1962
186 Ga0070693_100122555 3300005547 Bacteria 1614
187 Ga0070665_100037529 3300005548 Bacteria 4872
188 Ga0070704_100076031 3300005549 Bacteria 2455
189 Ga0068855_100111914 3300005563 Bacteria 3133
190 Ga0068855_100113376 3300005563 Bacteria 3110
191 Ga0068855_100373258 3300005563 Bacteria 1567
192 Ga0068855_100595659 3300005563 Bacteria 1192
193 Ga0068855_100932460 3300005563 Bacteria 916
194 Ga0070664_100004094 3300005564 Bacteria 11710
195 Ga0070664_100027609 3300005564 Bacteria 4717
196 Ga0070664_100056026 3300005564 Bacteria 3349
197 Ga0070664_100469290 3300005564 Bacteria 1157
198 Ga0070664_100512197 3300005564 Bacteria 1107
199 Ga0068857_100003130 3300005577 Bacteria 13691
200 Ga0068857_100024228 3300005577 Bacteria 5341
201 Ga0068857_100060763 3300005577 Unclassified 3356
202 Ga0068857_100130026 3300005577 Bacteria 2270
203 Ga0068854_100014950 3300005578 Bacteria 5127
204 Ga0068854_100073787 3300005578 Bacteria 2502
205 Ga0068854_100078751 3300005578 Bacteria 2429
206 Ga0068854_100726560 3300005578 Unclassified 859
207 Ga0068856_100003761 3300005614 Bacteria 15218
208 Ga0068856_100030810 3300005614 Bacteria 5245
209 Ga0068856_100080283 3300005614 Bacteria 3235
210 Ga0068856_100088279 3300005614 Bacteria 3083
211 Ga0068856_100113817 3300005614 Bacteria 2704
212 Ga0068856_100469647 3300005614 Bacteria 1279
213 Ga0068852_100188647 3300005616 Bacteria 1944
214 Ga0068852_100334874 3300005616 Bacteria 1473
215 Ga0068859_100009951 3300005617 Bacteria 9591
216 Ga0068859_100015798 3300005617 Bacteria 7585
217 Ga0068859_100054207 3300005617 Bacteria 4032
218 Ga0068859_101300422 3300005617 Unclassified 801
219 Ga0068864_100020897 3300005618 Bacteria 5480
220 Ga0068864_100224521 3300005618 Bacteria 1734
221 Ga0068864_100286421 3300005618 Bacteria 1539
222 Ga0068864_100895035 3300005618 Unclassified 876
223 Ga0068866_10002476 3300005718 Bacteria 7615
224 Ga0068866_10121646 3300005718 Bacteria 1472
225 Ga0068861_100020397 3300005719 Bacteria 4748
226 Ga0068861_100213710 3300005719 Bacteria 1626
227 Ga0068851_10005084 3300005834 Bacteria 5965
228 Ga0068851_10006223 3300005834 Bacteria 5446
229 Ga0068851_10012881 3300005834 Bacteria 3950
230 Ga0068870_10011230 3300005840 Bacteria 4145
231 Ga0068870_10397057 3300005840 Unclassified 896
232 Ga0068863_100095190 3300005841 Unclassified 2826
233 Ga0068863_100117932 3300005841 Bacteria 2529
234 Ga0068863_100566847 3300005841 Unclassified 1122
235 Ga0068863_100646969 3300005841 Unclassified 1048
236 Ga0068858_100027977 3300005842 Bacteria 5238
237 Ga0068858_100083404 3300005842 Bacteria 2972
238 Ga0068858_100130378 3300005842 Bacteria 2357
239 Ga0068858_100283089 3300005842 Bacteria 1579
240 Ga0068858_100604996 3300005842 Bacteria 1063
241 Ga0068860_100004017 3300005843 Bacteria 15108
242 Ga0068860_100015666 3300005843 Bacteria 7401
243 Ga0068860_100104930 3300005843 Bacteria 2698
244 Ga0068860_100362505 3300005843 Unclassified 1428
245 Ga0068860_100369270 3300005843 Unclassified 1415
246 Ga0068860_100911128 3300005843 Unclassified 895
247 Ga0068862_100027696 3300005844 Unclassified 4771
248 Ga0068862_100079452 3300005844 Bacteria 2843
249 Ga0068862_100238748 3300005844 Bacteria 1651
250 Ga0081540_1093958 3300005983 Bacteria 1311
251 Ga0070717_10007158 3300006028 Bacteria 8269
252 Ga0070717_10010694 3300006028 Bacteria 6940
253 Ga0070717_10015399 3300006028 Bacteria 5908
254 Ga0070717_10016305 3300006028 Bacteria 5758
255 Ga0070717_10041852 3300006028 Bacteria 3735
256 Ga0070717_10043343 3300006028 Unclassified 3672
257 Ga0070717_10157594 3300006028 Bacteria 1968
258 Ga0070717_10192149 3300006028 Bacteria 1784
259 Ga0070717_10198404 3300006028 Bacteria 1757
260 Ga0070717_10358992 3300006028 Bacteria 1304
261 Ga0070717_10433051 3300006028 Bacteria 1184
262 Ga0070717_10931203 3300006028 Unclassified 791
263 Ga0070717_11498533 3300006028 Unclassified 612
264 Ga0070715_10001994 3300006163 Bacteria 6153
265 Ga0070715_10004193 3300006163 Unclassified 4695
266 Ga0070715_10005218 3300006163 Unclassified 4317
267 Ga0070715_10014527 3300006163 Bacteria 2918
268 Ga0070715_10072340 3300006163 Bacteria 1543
269 Ga0070715_10263209 3300006163 Unclassified 907
270 Ga0070716_100000233 3300006173 Bacteria 22241
271 Ga0070716_100001391 3300006173 Bacteria 10730
272 Ga0070716_100006726 3300006173 Bacteria 5630
273 Ga0070716_100048939 3300006173 Bacteria 2393
274 Ga0070716_100270760 3300006173 Unclassified 1167
275 Ga0070716_100275286 3300006173 Unclassified 1159
276 Ga0070716_100280667 3300006173 Bacteria 1149
277 Ga0070716_100352215 3300006173 Bacteria 1043
278 Ga0070716_100375424 3300006173 Unclassified 1014
279 Ga0070712_100000056 3300006175 Bacteria 56756
280 Ga0070712_100000057 3300006175 Bacteria 56727
281 Ga0070712_100002047 3300006175 Bacteria 12338
282 Ga0070712_100002910 3300006175 Bacteria 10609
283 Ga0070712_100074837 3300006175 Unclassified 2434
284 Ga0070712_100093069 3300006175 Unclassified 2212
285 Ga0070712_100097870 3300006175 Bacteria 2163
286 Ga0070712_100130157 3300006175 Bacteria 1906
287 Ga0070712_100182410 3300006175 Unclassified 1637
288 Ga0070712_100615593 3300006175 Unclassified 920
289 Ga0097621_100000377 3300006237 Bacteria 31025
290 Ga0097621_100044023 3300006237 Bacteria 3600
291 Ga0097621_100165634 3300006237 Bacteria 1903
292 Ga0097621_100208616 3300006237 Unclassified 1699
293 Ga0097621_100375098 3300006237 Bacteria 1270
294 Ga0097621_100453225 3300006237 Unclassified 1156
295 Ga0068871_100002049 3300006358 Bacteria 13655
296 Ga0068871_100023357 3300006358 Bacteria 4781
297 Ga0068871_100177893 3300006358 Bacteria 1827
298 Ga0068871_100188451 3300006358 Unclassified 1776
299 Ga0068871_100193680 3300006358 Bacteria 1752
300 Ga0068871_101151461 3300006358 Bacteria 726
301 Ga0068871_101353811 3300006358 Bacteria 670
302 Ga0075434_100007390 3300006871 Bacteria 10174
303 Ga0075434_100490640 3300006871 Bacteria 1249
304 Ga0075434_100565087 3300006871 Unclassified 1157
305 Ga0075434_100651770 3300006871 Bacteria 1071
306 Ga0068865_100137269 3300006881 Bacteria 1839
307 Ga0068865_100170105 3300006881 Unclassified 1670
308 Ga0068865_100682906 3300006881 Unclassified 876
309 Ga0075436_100008529 3300006914 Bacteria 7005
310 Ga0075436_100239868 3300006914 Bacteria 1289
311 Ga0075436_100474575 3300006914 Unclassified 913
312 Ga0097620_100009951 3300006931 Bacteria 9591
313 Ga0097620_100015799 3300006931 Bacteria 7585
314 Ga0097620_100054205 3300006931 Bacteria 4032
315 Ga0097620_101300196 3300006931 Unclassified 801
316 Ga0075435_101029556 3300007076 Unclassified 719
317 Ga0099795_10174808 3300007788 Bacteria 894
318 Ga0105250_10161329 3300009092 Unclassified 936
319 Ga0105240_10011378 3300009093 Bacteria 12393
320 Ga0105240_10031271 3300009093 Bacteria 6905
321 Ga0105240_10285028 3300009093 Bacteria 1896
322 Ga0105240_10449204 3300009093 Bacteria 1443
323 Ga0105240_12194228 3300009093 Unclassified 573
324 Ga0111539_10376001 3300009094 Bacteria 1654
325 Ga0105245_10001216 3300009098 Bacteria 23271
326 Ga0105245_10035352 3300009098 Unclassified 4434
327 Ga0105245_10112515 3300009098 Bacteria 2534
328 Ga0105245_10118505 3300009098 Bacteria 2470
329 Ga0105245_10219247 3300009098 Bacteria 1835
330 Ga0105245_10276642 3300009098 Bacteria 1639
331 Ga0105245_10403726 3300009098 Bacteria 1366
332 Ga0105247_10021502 3300009101 Bacteria 3882
333 Ga0105247_10168489 3300009101 Bacteria 1455
334 Ga0105247_10212387 3300009101 Bacteria 1306
335 Ga0105247_10270908 3300009101 Bacteria 1168
336 Ga0105247_11323312 3300009101 Unclassified 579
337 Ga0105243_10012041 3300009148 Bacteria 6541
338 Ga0105243_10613233 3300009148 Bacteria 1049
339 Ga0105241_10010024 3300009174 Bacteria 6959
340 Ga0105241_10012439 3300009174 Bacteria 6238
341 Ga0105241_10036890 3300009174 Bacteria 3680
342 Ga0105241_10042011 3300009174 Bacteria 3457
343 Ga0105241_10093037 3300009174 Bacteria 2382
344 Ga0105242_10017682 3300009176 Bacteria 5561
345 Ga0105242_10020643 3300009176 Bacteria 5168
346 Ga0105242_10029598 3300009176 Bacteria 4368
347 Ga0105242_10391147 3300009176 Bacteria 1295
348 Ga0105248_10041125 3300009177 Bacteria 5182
349 Ga0105248_10067741 3300009177 Bacteria 4008
350 Ga0105248_10202179 3300009177 Bacteria 2238
351 Ga0105248_10503513 3300009177 Bacteria 1365
352 Ga0105248_10864405 3300009177 Bacteria 1021
353 Ga0105248_11039506 3300009177 Unclassified 925
354 Ga0105248_11659201 3300009177 Unclassified 724
355 Ga0105237_10005849 3300009545 Bacteria 13799
356 Ga0105237_10019096 3300009545 Bacteria 7086
357 Ga0105237_10023583 3300009545 Bacteria 6302
358 Ga0105237_10082241 3300009545 Unclassified 3211
359 Ga0105237_10147929 3300009545 Unclassified 2344
360 Ga0105237_10235879 3300009545 Bacteria 1830
361 Ga0105238_10009257 3300009551 Bacteria 9858
362 Ga0105238_10084826 3300009551 Bacteria 3157
363 Ga0105238_10085860 3300009551 Unclassified 3135
364 Ga0105238_10358871 3300009551 Bacteria 1447
365 Ga0105249_10006117 3300009553 Bacteria 10441
366 Ga0105249_10020166 3300009553 Bacteria 5957
367 Ga0105249_10142313 3300009553 Unclassified 2301
368 Ga0099796_10019102 3300010159 Unclassified 2072
369 Ga0105239_10005922 3300010375 Bacteria 14234
370 Ga0105239_10019624 3300010375 Bacteria 7462
371 Ga0105239_10030855 3300010375 Bacteria 5896
372 Ga0105239_10065312 3300010375 Bacteria 3996
373 Ga0105246_10018550 3300011119 Bacteria 4436
374 Ga0105246_10161701 3300011119 Bacteria 1706
375 Ga0105246_10373159 3300011119 Bacteria 1176
376 Ga0157324_1001777 3300012506 Bacteria 1238
377 Ga0157373_10002006 3300013100 Bacteria 15426
378 Ga0157371_10013493 3300013102 Bacteria 6202
379 Ga0157371_10039104 3300013102 Bacteria 3393
380 Ga0157370_10200977 3300013104 Bacteria 1849
381 Ga0157369_10020901 3300013105 Bacteria 7318
382 Ga0157369_10044713 3300013105 Bacteria 4818
383 Ga0157369_10080441 3300013105 Bacteria 3489
384 Ga0157369_10558690 3300013105 Unclassified 1183
385 Ga0157374_10006392 3300013296 Bacteria 10001
386 Ga0157374_10007905 3300013296 Bacteria 9080
387 Ga0157374_10009965 3300013296 Bacteria 8158
388 Ga0157374_10034699 3300013296 Bacteria 4611
389 Ga0157374_10043341 3300013296 Unclassified 4156
390 Ga0157374_10113184 3300013296 Unclassified 2612
391 Ga0157374_10147964 3300013296 Unclassified 2282
392 Ga0157374_10151797 3300013296 Bacteria 2252
393 Ga0157374_10755442 3300013296 Unclassified 987
394 Ga0157374_11179862 3300013296 Unclassified 787
395 Ga0157378_10000500 3300013297 Bacteria 37186
396 Ga0157378_10027150 3300013297 Bacteria 5051
397 Ga0157378_10031909 3300013297 Bacteria 4653
398 Ga0157378_10041884 3300013297 Bacteria 4063
399 Ga0157378_10051536 3300013297 Bacteria 3662
400 Ga0157378_10154534 3300013297 Bacteria 2140
401 Ga0157378_10335665 3300013297 Bacteria 1472
402 Ga0157378_10986657 3300013297 Unclassified 876
403 Ga0163162_10004111 3300013306 Bacteria 13961
404 Ga0163162_10025814 3300013306 Bacteria 5807
405 Ga0163162_10028631 3300013306 Bacteria 5513
406 Ga0163162_10041900 3300013306 Bacteria 4581
407 Ga0163162_10052703 3300013306 Bacteria 4087
408 Ga0163162_10376726 3300013306 Unclassified 1552
409 Ga0163162_10738771 3300013306 Unclassified 1104
410 Ga0157372_10005010 3300013307 Bacteria 14071
411 Ga0157372_10017917 3300013307 Bacteria 7611
412 Ga0157372_10088321 3300013307 Bacteria 3519
413 Ga0157372_10164562 3300013307 Bacteria 2564
414 Ga0157372_10571909 3300013307 Unclassified 1317
415 Ga0157372_11145692 3300013307 Bacteria 899
416 Ga0157375_10003750 3300013308 Bacteria 13180
417 Ga0157375_10004968 3300013308 Bacteria 11566
418 Ga0157375_10022457 3300013308 Bacteria 5807
419 Ga0157375_10214376 3300013308 Bacteria 2083
420 Ga0157375_11263325 3300013308 Unclassified 867
421 Ga0163163_10003969 3300014325 Bacteria 12633
422 Ga0163163_10022798 3300014325 Bacteria 5934
423 Ga0163163_10070616 3300014325 Bacteria 3478
424 Ga0163163_10075760 3300014325 Unclassified 3358
425 Ga0163163_10076433 3300014325 Unclassified 3343
426 Ga0163163_10813774 3300014325 Unclassified 998
427 Ga0157380_10590111 3300014326 Bacteria 1097
428 Ga0157380_10590888 3300014326 Bacteria 1097
429 Ga0182008_10011317 3300014497 Bacteria 4751
430 Ga0157377_10001238 3300014745 Bacteria 10917
431 Ga0157377_10679140 3300014745 Unclassified 745
432 Ga0157379_10001079 3300014968 Bacteria 22250
433 Ga0157379_10029253 3300014968 Bacteria 4900
434 Ga0157379_10042037 3300014968 Unclassified 4080
435 Ga0157379_10092539 3300014968 Bacteria 2712
436 Ga0157379_10346130 3300014968 Unclassified 1360
437 Ga0157376_10016890 3300014969 Bacteria 5553
438 Ga0157376_10018776 3300014969 Bacteria 5312
439 Ga0157376_10020940 3300014969 Bacteria 5069
440 Ga0157376_10046901 3300014969 Bacteria 3565
441 Ga0157376_10087080 3300014969 Bacteria 2694
442 Ga0157376_10087229 3300014969 Bacteria 2692
443 Ga0157376_10285495 3300014969 Bacteria 1556
444 Ga0157376_10609695 3300014969 Unclassified 1087
445 Ga0157376_10774416 3300014969 Bacteria 970
446 Ga0182006_1016501 3300015261 Bacteria 3150
447 Ga0182007_10002720 3300015262 Bacteria 8652
448 Ga0182005_1226137 3300015265 Unclassified 571
449 Ga0163161_10012193 3300017792 Bacteria 5962
450 Ga0206356_11855300 3300020070 Unclassified 569
451 Ga0213874_10145638 3300021377 Bacteria 823
452 Ga0224569_100483 3300022732 Unclassified 3438
453 Ga0224572_1001830 3300024225 Bacteria 3273
454 Ga0224572_1001886 3300024225 Bacteria 3243
455 Ga0224572_1023503 3300024225 Bacteria 1184
456 Ga0228598_1000189 3300024227 Bacteria 11193
457 Ga0228598_1001276 3300024227 Bacteria 5541
458 Ga0228598_1001673 3300024227 Bacteria 4849
459 Ga0207697_10004521 3300025315 Bacteria 6631
460 Ga0207656_10010867 3300025321 Bacteria 3424
461 Ga0207656_10110733 3300025321 Bacteria 1268
462 Ga0207653_10407233 3300025885 Unclassified 533
463 Ga0207682_10002451 3300025893 Bacteria 8310
464 Ga0207682_10161156 3300025893 Unclassified 1016
465 Ga0207692_10003629 3300025898 Bacteria 6039
466 Ga0207692_10013556 3300025898 Bacteria 3539
467 Ga0207692_10030890 3300025898 Unclassified 2560
468 Ga0207692_10032115 3300025898 Bacteria 2520
469 Ga0207692_10365983 3300025898 Bacteria 892
470 Ga0207692_10819472 3300025898 Unclassified 609
471 Ga0207642_10009961 3300025899 Bacteria 3329
472 Ga0207642_10010581 3300025899 Bacteria 3260
473 Ga0207710_10102404 3300025900 Bacteria 1352
474 Ga0207688_10000776 3300025901 Bacteria 15893
475 Ga0207680_10125010 3300025903 Unclassified 1687
476 Ga0207680_10292301 3300025903 Bacteria 1134
477 Ga0207647_10026923 3300025904 Unclassified 3754
478 Ga0207647_10040871 3300025904 Bacteria 2918
479 Ga0207647_10099104 3300025904 Bacteria 1731
480 Ga0207685_10002976 3300025905 Bacteria 4018
481 Ga0207685_10003636 3300025905 Bacteria 3781
482 Ga0207685_10022304 3300025905 Bacteria 2137
483 Ga0207685_10071377 3300025905 Bacteria 1409
484 Ga0207685_10103127 3300025905 Bacteria 1223
485 Ga0207685_10462334 3300025905 Unclassified 662
486 Ga0207699_10000416 3300025906 Bacteria 21815
487 Ga0207699_10011990 3300025906 Bacteria 4396
488 Ga0207699_10042624 3300025906 Unclassified 2631
489 Ga0207699_10071103 3300025906 Bacteria 2127
490 Ga0207699_10080100 3300025906 Bacteria 2023
491 Ga0207699_10143920 3300025906 Bacteria 1569
492 Ga0207699_10216958 3300025906 Bacteria 1304
493 Ga0207699_10238902 3300025906 Bacteria 1247
494 Ga0207699_10441854 3300025906 Unclassified 932
495 Ga0207699_10711116 3300025906 Unclassified 736
496 Ga0207699_11281642 3300025906 Unclassified 542
497 Ga0207645_10000073 3300025907 Bacteria 71786
498 Ga0207645_10006315 3300025907 Bacteria 8523
499 Ga0207643_10000501 3300025908 Bacteria 25007
500 Ga0207643_10243421 3300025908 Unclassified 1106
501 Ga0207705_10167895 3300025909 Bacteria 1651
502 Ga0207705_10445455 3300025909 Bacteria 1004
503 Ga0207684_10002508 3300025910 Bacteria 18472
504 Ga0207684_10010254 3300025910 Bacteria 8248
505 Ga0207684_10022651 3300025910 Bacteria 5363
506 Ga0207684_10262687 3300025910 Bacteria 1490
507 Ga0207654_10441625 3300025911 Unclassified 911
508 Ga0207654_10672869 3300025911 Bacteria 742
509 Ga0207707_10008829 3300025912 Bacteria 8753
510 Ga0207707_10122784 3300025912 Bacteria 2271
511 Ga0207707_10245761 3300025912 Bacteria 1555
512 Ga0207707_10310345 3300025912 Bacteria 1363
513 Ga0207695_10019060 3300025913 Bacteria 7912
514 Ga0207695_10053604 3300025913 Bacteria 4217
515 Ga0207695_10071484 3300025913 Bacteria 3544
516 Ga0207671_10095513 3300025914 Bacteria 2245
517 Ga0207671_10201857 3300025914 Bacteria 1553
518 Ga0207671_10654225 3300025914 Bacteria 837
519 Ga0207693_10000096 3300025915 Bacteria 78447
520 Ga0207693_10000119 3300025915 Bacteria 69804
521 Ga0207693_10000850 3300025915 Bacteria 27261
522 Ga0207693_10002121 3300025915 Bacteria 17309
523 Ga0207693_10057014 3300025915 Bacteria 3062
524 Ga0207693_10057079 3300025915 Bacteria 3060
525 Ga0207693_10058329 3300025915 Bacteria 3024
526 Ga0207693_10266776 3300025915 Unclassified 1342
527 Ga0207693_10416953 3300025915 Unclassified 1050
528 Ga0207663_10003336 3300025916 Bacteria 7839
529 Ga0207663_10005024 3300025916 Bacteria 6640
530 Ga0207663_10012144 3300025916 Bacteria 4646
531 Ga0207663_10013106 3300025916 Unclassified 4499
532 Ga0207663_10014369 3300025916 Unclassified 4330
533 Ga0207663_10060021 3300025916 Bacteria 2408
534 Ga0207663_10555994 3300025916 Unclassified 898
535 Ga0207663_10870510 3300025916 Bacteria 720
536 Ga0207662_10003629 3300025918 Bacteria 7982
537 Ga0207657_10000321 3300025919 Bacteria 51030
538 Ga0207657_10000379 3300025919 Bacteria 47118
539 Ga0207657_10000845 3300025919 Bacteria 32438
540 Ga0207649_10000727 3300025920 Bacteria 21654
541 Ga0207649_10009574 3300025920 Bacteria 5306
542 Ga0207649_10461717 3300025920 Unclassified 960
543 Ga0207652_10139421 3300025921 Bacteria 2168
544 Ga0207652_10173661 3300025921 Bacteria 1934
545 Ga0207652_10553520 3300025921 Bacteria 1034
546 Ga0207646_10020449 3300025922 Bacteria 6132
547 Ga0207646_10038531 3300025922 Unclassified 4305
548 Ga0207646_10070886 3300025922 Unclassified 3113
549 Ga0207681_10402794 3300025923 Unclassified 1105
550 Ga0207694_10034679 3300025924 Bacteria 3870
551 Ga0207694_10101208 3300025924 Bacteria 2283
552 Ga0207694_10218059 3300025924 Bacteria 1555
553 Ga0207650_10000045 3300025925 Bacteria 181507
554 Ga0207659_10017862 3300025926 Bacteria 4641
555 Ga0207659_11233041 3300025926 Unclassified 643
556 Ga0207687_10028281 3300025927 Bacteria 3767
557 Ga0207687_10111038 3300025927 Bacteria 2035
558 Ga0207687_10135791 3300025927 Unclassified 1860
559 Ga0207687_10212054 3300025927 Unclassified 1520
560 Ga0207687_10297260 3300025927 Unclassified 1299
561 Ga0207700_10000467 3300025928 Bacteria 23733
562 Ga0207700_10000611 3300025928 Bacteria 20908
563 Ga0207700_10005967 3300025928 Bacteria 7332
564 Ga0207700_10014391 3300025928 Bacteria 5182
565 Ga0207700_10154866 3300025928 Bacteria 1898
566 Ga0207700_10227923 3300025928 Bacteria 1583
567 Ga0207700_10334467 3300025928 Bacteria 1315
568 Ga0207700_10553194 3300025928 Bacteria 1021
569 Ga0207700_10961835 3300025928 Bacteria 764
570 Ga0207664_10000017 3300025929 Bacteria 230967
571 Ga0207664_10088293 3300025929 Bacteria 2537
572 Ga0207664_10093267 3300025929 Bacteria 2472
573 Ga0207664_10141353 3300025929 Unclassified 2036
574 Ga0207664_10267902 3300025929 Unclassified 1495
575 Ga0207664_11375053 3300025929 Unclassified 626
576 Ga0207644_10002234 3300025931 Bacteria 12557
577 Ga0207644_10261836 3300025931 Bacteria 1383
578 Ga0207690_10077529 3300025932 Bacteria 2310
579 Ga0207706_10000213 3300025933 Bacteria 63821
580 Ga0207706_10000370 3300025933 Bacteria 48701
581 Ga0207706_10005630 3300025933 Bacteria 11671
582 Ga0207686_10034816 3300025934 Bacteria 3017
583 Ga0207686_10100284 3300025934 Bacteria 1932
584 Ga0207686_10253809 3300025934 Bacteria 1286
585 Ga0207686_10446941 3300025934 Unclassified 994
586 Ga0207709_10275340 3300025935 Bacteria 1241
587 Ga0207670_10873783 3300025936 Unclassified 752
588 Ga0207704_10022941 3300025938 Bacteria 3354
589 Ga0207704_10143193 3300025938 Unclassified 1675
590 Ga0207704_10451668 3300025938 Unclassified 1026
591 Ga0207665_10002537 3300025939 Bacteria 12279
592 Ga0207665_10006824 3300025939 Bacteria 7562
593 Ga0207665_10033174 3300025939 Bacteria 3421
594 Ga0207665_10034312 3300025939 Bacteria 3367
595 Ga0207665_10052282 3300025939 Bacteria 2752
596 Ga0207665_10131930 3300025939 Unclassified 1774
597 Ga0207665_10299447 3300025939 Bacteria 1202
598 Ga0207665_10556190 3300025939 Bacteria 892
599 Ga0207665_10986915 3300025939 Bacteria 670
600 Ga0207691_10000151 3300025940 Bacteria 64391
601 Ga0207711_10024010 3300025941 Bacteria 5103
602 Ga0207711_10030477 3300025941 Bacteria 4549
603 Ga0207711_10089953 3300025941 Bacteria 2698
604 Ga0207711_10133886 3300025941 Bacteria 2224
605 Ga0207711_10398925 3300025941 Bacteria 1278
606 Ga0207711_10437602 3300025941 Unclassified 1217
607 Ga0207689_10000129 3300025942 Bacteria 63859
608 Ga0207689_10000166 3300025942 Bacteria 57369
609 Ga0207689_10012861 3300025942 Bacteria 7148
610 Ga0207661_10000099 3300025944 Bacteria 54986
611 Ga0207661_10080027 3300025944 Bacteria 2695
612 Ga0207661_10232065 3300025944 Bacteria 1634
613 Ga0207679_10000096 3300025945 Bacteria 76971
614 Ga0207679_10151353 3300025945 Bacteria 1889
615 Ga0207679_10455970 3300025945 Bacteria 1135
616 Ga0207679_10503115 3300025945 Bacteria 1081
617 Ga0207667_10020353 3300025949 Bacteria 7383
618 Ga0207667_10042127 3300025949 Bacteria 4855
619 Ga0207667_10208166 3300025949 Bacteria 2005
620 Ga0207667_10333123 3300025949 Unclassified 1549
621 Ga0207667_10832018 3300025949 Bacteria 918
622 Ga0207651_10062182 3300025960 Bacteria 2600
623 Ga0207651_10532036 3300025960 Bacteria 1020
624 Ga0207712_10071282 3300025961 Bacteria 2499
625 Ga0207712_10130650 3300025961 Unclassified 1913
626 Ga0207668_10034712 3300025972 Bacteria 3351
627 Ga0207640_10003526 3300025981 Bacteria 8432
628 Ga0207640_10009802 3300025981 Bacteria 5372
629 Ga0207640_10238081 3300025981 Bacteria 1405
630 Ga0207640_10608754 3300025981 Unclassified 926
631 Ga0207658_10041272 3300025986 Unclassified 3340
632 Ga0207658_10891745 3300025986 Unclassified 809
633 Ga0207677_10063083 3300026023 Bacteria 2574
634 Ga0207677_10483722 3300026023 Bacteria 1067
635 Ga0207677_10514646 3300026023 Unclassified 1037
636 Ga0207677_11040227 3300026023 Unclassified 744
637 Ga0207703_10050074 3300026035 Unclassified 3379
638 Ga0207703_10066556 3300026035 Bacteria 2964
639 Ga0207703_10077224 3300026035 Bacteria 2764
640 Ga0207703_10139381 3300026035 Bacteria 2103
641 Ga0207703_11745599 3300026035 Unclassified 598
642 Ga0207639_10018041 3300026041 Bacteria 5007
643 Ga0207639_10115151 3300026041 Bacteria 2198
644 Ga0207678_10000026 3300026067 Bacteria 116850
645 Ga0207678_10000381 3300026067 Bacteria 40336
646 Ga0207702_10000993 3300026078 Bacteria 29058
647 Ga0207702_10072869 3300026078 Unclassified 2961
648 Ga0207702_10082190 3300026078 Bacteria 2800
649 Ga0207702_10307456 3300026078 Unclassified 1506
650 Ga0207702_11639619 3300026078 Unclassified 636
651 Ga0207702_11873587 3300026078 Unclassified 591
652 Ga0207641_10000075 3300026088 Bacteria 145149
653 Ga0207641_10191705 3300026088 Unclassified 1879
654 Ga0207641_10244361 3300026088 Bacteria 1674
655 Ga0207641_10550873 3300026088 Unclassified 1125
656 Ga0207641_10590747 3300026088 Unclassified 1086
657 Ga0207648_10000890 3300026089 Bacteria 33695
658 Ga0207648_10041404 3300026089 Bacteria 4045
659 Ga0207648_10053396 3300026089 Bacteria 3532
660 Ga0207676_10000212 3300026095 Bacteria 50034
661 Ga0207676_10043033 3300026095 Unclassified 3475
662 Ga0207676_10666442 3300026095 Bacteria 1005
663 Ga0207674_10000670 3300026116 Bacteria 44517
664 Ga0207674_10022023 3300026116 Bacteria 6853
665 Ga0207674_10029181 3300026116 Bacteria 5811
666 Ga0207674_10036200 3300026116 Bacteria 5146
667 Ga0207675_100010093 3300026118 Bacteria 8853
668 Ga0207675_100297005 3300026118 Bacteria 1572
669 Ga0207675_100514464 3300026118 Unclassified 1193
670 Ga0207683_10001901 3300026121 Bacteria 18484
671 Ga0207698_10064039 3300026142 Bacteria 2880
672 Ga0207698_10462267 3300026142 Bacteria 1227
673 Ga0207698_10490859 3300026142 Unclassified 1193
674 Ga0265356_1003947 3300028017 Unclassified 1835
675 Ga0265357_1030038 3300028023 Unclassified 619
676 Ga0268266_10025946 3300028379 Bacteria 4985
677 Ga0268266_10036165 3300028379 Bacteria 4202
678 Ga0268266_10657495 3300028379 Bacteria 1009
679 Ga0268265_10042850 3300028380 Unclassified 3361
680 Ga0268265_10091846 3300028380 Bacteria 2428
681 Ga0268265_10418419 3300028380 Unclassified 1243
682 Ga0268265_10471841 3300028380 Bacteria 1177
683 Ga0268264_10022618 3300028381 Bacteria 5130
684 Ga0268264_10024495 3300028381 Bacteria 4927
685 Ga0268264_10034827 3300028381 Unclassified 4144
686 Ga0268264_10399933 3300028381 Unclassified 1320
687 Ga0268264_10741278 3300028381 Unclassified 978
688 Ga0268264_11565741 3300028381 Bacteria 670
689 Ga0265338_10015238 3300028800 Bacteria 8468
690 Ga0265338_10027752 3300028800 Bacteria 5670
691 Ga0265338_10048630 3300028800 Bacteria 3856
692 Ga0265338_10054343 3300028800 Bacteria 3573
693 Ga0265338_10056053 3300028800 Bacteria 3500
694 Ga0265338_10097773 3300028800 Unclassified 2403
695 Ga0265762_1000267 3300030760 Bacteria 8682
696 Ga0265762_1000706 3300030760 Bacteria 5909
697 Ga0265762_1002225 3300030760 Unclassified 3511
698 Ga0265762_1070665 3300030760 Unclassified 732
699 Ga0265770_1013760 3300030878 Bacteria 1214
700 Ga0265760_10000117 3300031090 Bacteria 20281
701 Ga0265760_10003836 3300031090 Bacteria 4359
702 Ga0265760_10006936 3300031090 Bacteria 3248
703 Ga0265332_10048162 3300031238 Bacteria 1834
704 Ga0265328_10073488 3300031239 Bacteria 1257
705 Ga0265325_10003863 3300031241 Bacteria 9617
706 Ga0265325_10046541 3300031241 Bacteria 2249
707 Ga0265340_10052980 3300031247 Unclassified 1960
708 Ga0265339_10010741 3300031249 Bacteria 5672
709 Ga0265339_10031452 3300031249 Bacteria 2999
710 Ga0265339_10090458 3300031249 Bacteria 1605
711 Ga0265316_10062736 3300031344 Bacteria 2884
712 Ga0265316_10064286 3300031344 Unclassified 2843
713 Ga0265316_10071581 3300031344 Bacteria 2672
714 Ga0265316_10647613 3300031344 Unclassified 747
715 Ga0307408_100526426 3300031548 Bacteria 1039
716 Ga0265314_10062459 3300031711 Bacteria 2532
717 Ga0265314_10149781 3300031711 Bacteria 1432
718 Ga0265342_10033401 3300031712 Unclassified 3164
719 Ga0307405_10074415 3300031731 Bacteria 2197
720 Ga0307410_10064758 3300031852 Bacteria 2512
721 Ga0307410_10104420 3300031852 Bacteria 2037
722 Ga0307412_10401241 3300031911 Bacteria 1116
723 Ga0307416_100438412 3300032002 Bacteria 1356
724 Ga0307411_10019305 3300032005 Bacteria 3935
725 Ga0307415_100002600 3300032126 Bacteria 9009
726 Ga0307415_100729967 3300032126 Bacteria 897
727 Ga0316212_1007283 3300033547 Unclassified 1598
728 Ga0373930_0004788 3300034816 Bacteria 2220
729 Ga0373958_0012903 3300034819 Bacteria 1438
730 Ga0373929_0062253 3300035085 Unclassified 876
731 Ga0373934_0076687 3300035086 Unclassified 1341
732 Ga0373940_0102809 3300035088 Unclassified 869
733 Ga0373944_0012902 3300035089 Bacteria 2311
734 Ga0373952_0012167 3300035092 Unclassified 1689
735 Ga0373923_0084699 3300035111 Bacteria 1379
736 Ga0373932_0023073 3300035112 Unclassified 1660
737 Ga0373936_0002322 3300035113 Bacteria 7118
738 Ga0373936_0068456 3300035113 Bacteria 1460
739 Ga0373936_0237092 3300035113 Bacteria 812
740 Ga0373941_0019831 3300035115 Bacteria 1878
741 Ga0373956_0351440 3300035119 Unclassified 703
742 Ga0373943_0000779 3300035170 Bacteria 13936
743 Ga0373943_0148809 3300035170 Bacteria 1267
744 Ga0373946_0000613 3300035171 Bacteria 11839
745 Ga0373955_0024353 3300035172 Unclassified 3095
746 Ga0373955_0373305 3300035172 Bacteria 865
747 Ga0373942_0096634 3300035207 Unclassified 897
748 Ga0373961_0030639 3300035241 Bacteria 1498
749 Ga0373962_0008003 3300035242 Bacteria 2597
750 Ga0373924_0021094 3300035410 Bacteria 2539
751 Ga0373924_0024035 3300035410 Unclassified 2398
752 Ga0373935_0006806 3300035692 Bacteria 6829
753 Ga0373935_0116074 3300035692 Bacteria 1783
754 Ga0373935_0228814 3300035692 Bacteria 1294
755 Ga0373927_0000085 3300035695 Bacteria 70359
756 Ga0373927_0333611 3300035695 Bacteria 999
757 Ga0373933_0036263 3300035724 Bacteria 2885
758 Ga0373947_0003515 3300035725 Bacteria 9254
759 Ga0373947_0266536 3300035725 Bacteria 1136
760 Ga0373937_0219637 3300036401 Bacteria 1789
761 Ga0373937_0248845 3300036401 Unclassified 1675
762 Ga0373937_0464780 3300036401 Unclassified 1202
763 Ga0373937_0479114 3300036401 Unclassified 1182
764 Ga0373937_1736420 3300036401 Unclassified 571
765 Ga0373937_1811477 3300036401 Bacteria 557
766 Ga0373925_0009268 3300037068 Bacteria 7163
767 Ga0373925_0033615 3300037068 Unclassified 3778
768 Ga0373925_0194405 3300037068 Unclassified 1611
769 Ga0373925_0735088 3300037068 Unclassified 813
770 Ga0395905_1600520 3300037471 Bacteria 556
771 Ga0436361_0612533 3300039447 Unclassified 752
772 Ga0436363_0628616 3300039450 Bacteria 824
773 Ga0466963_0151097 3300044694 Bacteria 1612
774 Ga0466963_1186534 3300044694 Unclassified 536
775 Ga0466964_0093259 3300044706 Unclassified 1314
776 Ga0453684_0731116 3300044712 Bacteria 1073
777 Ga0451576_0081959 3300045051 Unclassified 3355
778 Ga0451576_0235019 3300045051 Unclassified 1914
779 Ga0466967_0812985 3300045976 Unclassified 928
780 Ga0495592_0236376 3300046454 Bacteria 1214
781 Ga0495592_0699443 3300046454 Bacteria 610
782 Ga0495603_0262410 3300046455 Bacteria 994
783 Ga0495629_0018361 3300046459 Bacteria 5007
784 Ga0495580_0000349 3300046472 Bacteria 37675
785 Ga0495580_0001198 3300046472 Bacteria 22803
786 Ga0495580_0003361 3300046472 Bacteria 13673
787 Ga0495580_0005033 3300046472 Bacteria 11020
788 Ga0495580_0037248 3300046472 Bacteria 3492
789 Ga0495580_0042811 3300046472 Bacteria 3224
790 Ga0495580_0050893 3300046472 Bacteria 2928
791 Ga0495580_0105094 3300046472 Bacteria 1962
792 Ga0495580_0140471 3300046472 Bacteria 1674
793 Ga0495580_0186121 3300046472 Bacteria 1433
794 Ga0495580_0224300 3300046472 Bacteria 1291
795 Ga0495582_0005458 3300046473 Bacteria 7089
796 Ga0495664_0194851 3300046477 Bacteria 1228
797 Ga0495594_0005014 3300046499 Bacteria 6815
798 Ga0495628_0047983 3300046516 Unclassified 3386
799 Ga0495630_0398730 3300046517 Bacteria 1054
800 Ga0495630_0532188 3300046517 Bacteria 901
801 Ga0495666_0252568 3300046526 Bacteria 803
802 Ga0495665_0108705 3300046531 Unclassified 1455
803 Ga0495665_0299860 3300046531 Bacteria 823
804 Ga0495645_0096065 3300046543 Bacteria 2112
805 Ga0495635_0622082 3300046663 Unclassified 704
806 Ga0495599_0243862 3300046678 Bacteria 1095
807 Ga0495624_0062475 3300046690 Unclassified 2330
808 Ga0495624_0267018 3300046690 Bacteria 1034
809 Ga0495670_0331172 3300046691 Unclassified 818
810 Ga0495674_0067144 3300047319 Bacteria 3108
811 Ga0495674_0235268 3300047319 Bacteria 1511
812 Ga0495674_1027178 3300047319 Unclassified 630
813 Ga0495674_1041024 3300047319 Bacteria 625
814 Ga0495593_0032870 3300047673 Unclassified 2827
815 Ga0496100_0063571 3300048903 Unclassified 2439
816 Ga0496100_0065557 3300048903 Bacteria 2407
817 Ga0496100_0120637 3300048903 Bacteria 1834
818 Ga0496100_0154515 3300048903 Unclassified 1640
819 Ga0496100_0190880 3300048903 Bacteria 1487
820 Ga0496100_0231120 3300048903 Bacteria 1361
821 Ga0496101_0012667 3300048904 Bacteria 5636
822 Ga0496101_0060527 3300048904 Bacteria 2748
823 Ga0496101_0471500 3300048904 Unclassified 991
824 Ga0496101_0496278 3300048904 Unclassified 964
825 Ga0496102_0003593 3300048905 Bacteria 13135
826 Ga0496102_0015179 3300048905 Bacteria 6705
827 Ga0496102_0035381 3300048905 Unclassified 4495
828 Ga0496102_0060070 3300048905 Bacteria 3478
829 Ga0496102_0323463 3300048905 Bacteria 1453
830 Ga0496102_0345865 3300048905 Bacteria 1400
831 Ga0496102_0784028 3300048905 Unclassified 875
832 Ga0496103_0086381 3300048906 Bacteria 1977
833 Ga0496103_0248197 3300048906 Bacteria 1145
834 Ga0496103_0413713 3300048906 Unclassified 866
835 Ga0496104_0008923 3300048907 Bacteria 8910
836 Ga0496104_0090209 3300048907 Unclassified 2929
837 Ga0496104_0143461 3300048907 Unclassified 2294
838 Ga0496104_0164437 3300048907 Bacteria 2128
839 Ga0496104_0262503 3300048907 Bacteria 1640
840 Ga0496104_0433809 3300048907 Bacteria 1226
841 Ga0496104_0500593 3300048907 Unclassified 1126
842 Ga0496105_0199645 3300048908 Bacteria 1633
843 Ga0496105_0852250 3300048908 Unclassified 690
844 Ga0496106_0048312 3300048909 Bacteria 3205
845 Ga0496106_0136745 3300048909 Bacteria 1925
846 Ga0496106_0276918 3300048909 Unclassified 1344
847 Ga0496108_0000304 3300048911 Bacteria 42250
848 Ga0496108_0155177 3300048911 Bacteria 1977
849 Ga0496108_0475096 3300048911 Unclassified 1092
850 Ga0496108_0584016 3300048911 Unclassified 974
851 Ga0496109_0000132 3300048912 Bacteria 76436
852 Ga0496109_0037739 3300048912 Unclassified 4366
853 Ga0496109_0145417 3300048912 Bacteria 2218
854 Ga0496109_0718669 3300048912 Unclassified 936
855 Ga0496109_1160915 3300048912 Unclassified 709
856 Ga0496109_1322206 3300048912 Unclassified 657
857 Ga0496110_0003639 3300048913 Bacteria 11855
858 Ga0496110_0208999 3300048913 Bacteria 1774
859 Ga0496110_0437838 3300048913 Unclassified 1191
860 Ga0496111_0039281 3300048914 Bacteria 3393
861 Ga0496111_0161367 3300048914 Bacteria 1664
862 Ga0496112_0000724 3300048915 Bacteria 22889
863 Ga0496112_0003918 3300048915 Bacteria 12457
864 Ga0496112_0052762 3300048915 Bacteria 3991
865 Ga0496112_0585500 3300048915 Unclassified 1048
866 Ga0496112_0619482 3300048915 Unclassified 1013
867 Ga0496112_0655201 3300048915 Unclassified 979
868 Ga0496112_0906177 3300048915 Bacteria 803
869 Ga0496113_0003443 3300048916 Bacteria 9473
870 Ga0496113_0033740 3300048916 Bacteria 3729
871 Ga0496114_0007439 3300048917 Bacteria 8659
872 Ga0496114_0645314 3300048917 Bacteria 931
873 Ga0496115_0015286 3300048918 Bacteria 5820
874 Ga0496115_0164465 3300048918 Bacteria 1835
875 Ga0496115_0649092 3300048918 Unclassified 834
876 Ga0501224_008551 3300049664 Bacteria 1493
877 Ga0501243_010114 3300049675 Bacteria 1470
878 Ga0501249_075838 3300049679 Bacteria 788
879 Ga0501225_0022264 3300049705 Bacteria 1750
880 Ga0501234_014780 3300049707 Bacteria 1226
881 Ga0501245_102973 3300049708 Bacteria 581
882 Ga0501284_10831 3300050005 Unclassified 561
883 nmdc:mga0n895_351824_c1 3300050512 Unclassified 1492
884 nmdc:mga0rr50_212469_c1 3300050513 Bacteria 1594
885 nmdc:mga0rr50_28025_c1 3300050513 Bacteria 3954
886 nmdc:mga0rr50_290301_c1 3300050513 Unclassified 1366
887 nmdc:mga08x19_238318_c1 3300050514 Unclassified 1253
888 nmdc:mga08x19_471737_c1 3300050514 Unclassified 884
889 nmdc:mga08x19_65499_c1 3300050514 Bacteria 2360
890 nmdc:mga0a205_2659_c1 3300050515 Bacteria 15797
891 Ga0495601_0094615 3300053077 Unclassified 1926
892 Ga0500590_278060 3300053148 Unclassified 645
893 Ga0495580_0431528
894 MBSR1b_contig_12289486
895 MBSR1b_contig_14142699
896 MBSR1b_contig_14292732
897 MBSR1b_contig_5587874
898 LJNas_1001182
899 JGI24737J22298_10063201
900 JGI24743J22301_10012727
901 JGI24034J26672_10017411
902 JGI24751J29686_10004031
903 rootH2_10227596
904 rootH1_10403911
905 Ga0065712_10092655
906 Ga0065712_10352935
907 Ga0065715_10119611
908 Ga0065715_10140426
909 Ga0065715_10187153
910 Ga0070658_10115792
911 Ga0070658_10305551
912 Ga0070676_10047767
913 Ga0070676_10114591
914 Ga0070676_10240739
915 Ga0070683_100104197
916 Ga0070683_100107295
917 Ga0070690_100019935
918 Ga0070690_100151190
919 Ga0070670_100026528
920 Ga0070670_100452666
921 Ga0070677_10012562
922 Ga0070677_10034842
923 Ga0068869_100002319
924 Ga0068869_100026540
925 Ga0068869_100073707
926 Ga0070666_10013454
927 Ga0070666_10034660
928 Ga0070666_10141130
929 Ga0070680_100063061
930 Ga0070680_100076099
931 Ga0070680_100515132
932 Ga0070680_100625488
933 Ga0070682_100008588
934 Ga0070682_100125217
935 Ga0070682_100438374
936 Ga0070682_101053414
937 Ga0068868_100004356
938 Ga0068868_100006106
939 Ga0068868_100006804
940 Ga0068868_100049472
941 Ga0068868_100265133
942 Ga0068868_100322094
943 Ga0070660_100071577
944 Ga0070660_100134103
945 Ga0070689_100009760
946 Ga0070689_100763003
947 Ga0070689_101009762
948 Ga0070689_101016024
949 Ga0070687_100006630
950 Ga0070661_100013287
951 Ga0070661_100043647
952 Ga0070692_10112780
953 Ga0070668_100026551
954 Ga0070668_100141409
955 Ga0070669_100143075
956 Ga0070669_100243108
957 Ga0070675_100021889
958 Ga0070675_100439005
959 Ga0070671_100096198
960 Ga0070671_100337418
961 Ga0070674_100018421
962 Ga0070674_100586601
963 Ga0070673_100010209
964 Ga0070673_100550303
965 Ga0070688_100065322
966 Ga0070688_100079617
967 Ga0070659_100003788
968 Ga0070659_100004572
969 Ga0070659_100023398
970 Ga0070659_100396095
971 Ga0070667_100024022
972 Ga0070667_100097809
973 Ga0070667_100460754
974 Ga0070709_10000312
975 Ga0070709_10011171
976 Ga0070709_10095300
977 Ga0070709_10186443
978 Ga0070709_10197918
979 Ga0070709_10211451
980 Ga0070709_10261333
981 Ga0070709_10505123
982 Ga0070709_10667765
983 Ga0070714_100000060
984 Ga0070714_100003931
985 Ga0070714_100290592
986 Ga0070714_100494263
987 Ga0070714_100549632
988 Ga0070714_100717321
989 Ga0070714_100862468
990 Ga0070713_100000162
991 Ga0070713_100000344
992 Ga0070713_100018136
993 Ga0070713_100028068
994 Ga0070713_100031349
995 Ga0070713_100091091
996 Ga0070713_100191702
997 Ga0070713_100197806
998 Ga0070713_100681451
999 Ga0070713_100712049
1000 Ga0070710_10001044
1001 Ga0070710_10009785
1002 Ga0070710_10075136
1003 Ga0070710_10085744
1004 Ga0070710_10137689
1005 Ga0070710_10204247
1006 Ga0070710_10286213
1007 Ga0070710_10619239
1008 Ga0070711_100000231
1009 Ga0070711_100004865
1010 Ga0070711_100045235
1011 Ga0070711_100051480
1012 Ga0070711_100061715
1013 Ga0070711_100079194
1014 Ga0070711_100132561
1015 Ga0070711_100372206
1016 Ga0070711_100600854
1017 Ga0070711_101334202
1018 Ga0070700_101257518
1019 Ga0070708_100001600
1020 Ga0070708_100005188
1021 Ga0070708_100115232
1022 Ga0070708_100244435
1023 Ga0070708_100391009
1024 Ga0070708_100434497
1025 Ga0070663_100006281
1026 Ga0070678_100164903
1027 Ga0070678_100691800
1028 Ga0070678_100887980
1029 Ga0070662_100005657
1030 Ga0070662_100056787
1031 Ga0070681_10005365
1032 Ga0070681_10061088
1033 Ga0070681_10119342
1034 Ga0070681_10287040
1035 Ga0070681_10855764
1036 Ga0068867_100006383
1037 Ga0068867_100040007
1038 Ga0070685_10006397
1039 Ga0070706_100005888
1040 Ga0070706_100012684
1041 Ga0070706_100015107
1042 Ga0070706_100433856
1043 Ga0070707_100021616
1044 Ga0070707_100238876
1045 Ga0070698_100016133
1046 Ga0070698_100021148
1047 Ga0070698_100068413
1048 Ga0070699_100000358
1049 Ga0070699_100006278
1050 Ga0070699_100096103
1051 Ga0070699_100223728
1052 Ga0070679_100169393
1053 Ga0070679_100196092
1054 Ga0070679_100323076
1055 Ga0070679_100352747
1056 Ga0070679_100611566
1057 Ga0070684_100005271
1058 Ga0070684_100018826
1059 Ga0070684_100182160
1060 Ga0070684_100661047
1061 Ga0070697_100000215
1062 Ga0070697_100003842
1063 Ga0070697_100012842
1064 Ga0070697_100067026
1065 Ga0070697_101152859
1066 Ga0068853_100010295
1067 Ga0068853_100118467
1068 Ga0070672_100129698
1069 Ga0070686_100070666
1070 Ga0070686_100094723
1071 Ga0070695_100069076
1072 Ga0070695_100444174
1073 Ga0070696_100037515
1074 Ga0070696_100461306
1075 Ga0070696_100862079
1076 Ga0070693_100003903
1077 Ga0070693_100078524
1078 Ga0070693_100122555
1079 Ga0070665_100037529
1080 Ga0070704_100076031
1081 Ga0068855_100111914
1082 Ga0068855_100113376
1083 Ga0068855_100373258
1084 Ga0068855_100595659
1085 Ga0068855_100932460
1086 Ga0070664_100004094
1087 Ga0070664_100027609
1088 Ga0070664_100056026
1089 Ga0070664_100469290
1090 Ga0070664_100512197
1091 Ga0068857_100003130
1092 Ga0068857_100024228
1093 Ga0068857_100060763
1094 Ga0068857_100130026
1095 Ga0068854_100014950
1096 Ga0068854_100073787
1097 Ga0068854_100078751
1098 Ga0068854_100726560
1099 Ga0068856_100003761
1100 Ga0068856_100030810
1101 Ga0068856_100080283
1102 Ga0068856_100088279
1103 Ga0068856_100113817
1104 Ga0068856_100469647
1105 Ga0068852_100188647
1106 Ga0068852_100334874
1107 Ga0068859_100009951
1108 Ga0068859_100015798
1109 Ga0068859_100054207
1110 Ga0068859_101300422
1111 Ga0068864_100020897
1112 Ga0068864_100224521
1113 Ga0068864_100286421
1114 Ga0068864_100895035
1115 Ga0068866_10002476
1116 Ga0068866_10121646
1117 Ga0068861_100020397
1118 Ga0068861_100213710
1119 Ga0068851_10005084
1120 Ga0068851_10006223
1121 Ga0068851_10012881
1122 Ga0068870_10011230
1123 Ga0068870_10397057
1124 Ga0068863_100095190
1125 Ga0068863_100117932
1126 Ga0068863_100566847
1127 Ga0068863_100646969
1128 Ga0068858_100027977
1129 Ga0068858_100083404
1130 Ga0068858_100130378
1131 Ga0068858_100283089
1132 Ga0068858_100604996
1133 Ga0068860_100004017
1134 Ga0068860_100015666
1135 Ga0068860_100104930
1136 Ga0068860_100362505
1137 Ga0068860_100369270
1138 Ga0068860_100911128
1139 Ga0068862_100027696
1140 Ga0068862_100079452
1141 Ga0068862_100238748
1142 Ga0081540_1093958
1143 Ga0070717_10007158
1144 Ga0070717_10010694
1145 Ga0070717_10015399
1146 Ga0070717_10016305
1147 Ga0070717_10041852
1148 Ga0070717_10043343
1149 Ga0070717_10157594
1150 Ga0070717_10192149
1151 Ga0070717_10198404
1152 Ga0070717_10358992
1153 Ga0070717_10433051
1154 Ga0070717_10931203
1155 Ga0070717_11498533
1156 Ga0070715_10001994
1157 Ga0070715_10004193
1158 Ga0070715_10005218
1159 Ga0070715_10014527
1160 Ga0070715_10072340
1161 Ga0070715_10263209
1162 Ga0070716_100000233
1163 Ga0070716_100001391
1164 Ga0070716_100006726
1165 Ga0070716_100048939
1166 Ga0070716_100270760
1167 Ga0070716_100275286
1168 Ga0070716_100280667
1169 Ga0070716_100352215
1170 Ga0070716_100375424
1171 Ga0070712_100000056
1172 Ga0070712_100000057
1173 Ga0070712_100002047
1174 Ga0070712_100002910
1175 Ga0070712_100074837
1176 Ga0070712_100093069
1177 Ga0070712_100097870
1178 Ga0070712_100130157
1179 Ga0070712_100182410
1180 Ga0070712_100615593
1181 Ga0097621_100000377
1182 Ga0097621_100044023
1183 Ga0097621_100165634
1184 Ga0097621_100208616
1185 Ga0097621_100375098
1186 Ga0097621_100453225
1187 Ga0068871_100002049
1188 Ga0068871_100023357
1189 Ga0068871_100177893
1190 Ga0068871_100188451
1191 Ga0068871_100193680
1192 Ga0068871_101151461
1193 Ga0068871_101353811
1194 Ga0075434_100007390
1195 Ga0075434_100490640
1196 Ga0075434_100565087
1197 Ga0075434_100651770
1198 Ga0068865_100137269
1199 Ga0068865_100170105
1200 Ga0068865_100682906
1201 Ga0075436_100008529
1202 Ga0075436_100239868
1203 Ga0075436_100474575
1204 Ga0097620_100009951
1205 Ga0097620_100015799
1206 Ga0097620_100054205
1207 Ga0097620_101300196
1208 Ga0075435_101029556
1209 Ga0099795_10174808
1210 Ga0105250_10161329
1211 Ga0105240_10011378
1212 Ga0105240_10031271
1213 Ga0105240_10285028
1214 Ga0105240_10449204
1215 Ga0105240_12194228
1216 Ga0111539_10376001
1217 Ga0105245_10001216
1218 Ga0105245_10035352
1219 Ga0105245_10112515
1220 Ga0105245_10118505
1221 Ga0105245_10219247
1222 Ga0105245_10276642
1223 Ga0105245_10403726
1224 Ga0105247_10021502
1225 Ga0105247_10168489
1226 Ga0105247_10212387
1227 Ga0105247_10270908
1228 Ga0105247_11323312
1229 Ga0105243_10012041
1230 Ga0105243_10613233
1231 Ga0105241_10010024
1232 Ga0105241_10012439
1233 Ga0105241_10036890
1234 Ga0105241_10042011
1235 Ga0105241_10093037
1236 Ga0105242_10017682
1237 Ga0105242_10020643
1238 Ga0105242_10029598
1239 Ga0105242_10391147
1240 Ga0105248_10041125
1241 Ga0105248_10067741
1242 Ga0105248_10202179
1243 Ga0105248_10503513
1244 Ga0105248_10864405
1245 Ga0105248_11039506
1246 Ga0105248_11659201
1247 Ga0105237_10005849
1248 Ga0105237_10019096
1249 Ga0105237_10023583
1250 Ga0105237_10082241
1251 Ga0105237_10147929
1252 Ga0105237_10235879
1253 Ga0105238_10009257
1254 Ga0105238_10084826
1255 Ga0105238_10085860
1256 Ga0105238_10358871
1257 Ga0105249_10006117
1258 Ga0105249_10020166
1259 Ga0105249_10142313
1260 Ga0099796_10019102
1261 Ga0105239_10005922
1262 Ga0105239_10019624
1263 Ga0105239_10030855
1264 Ga0105239_10065312
1265 Ga0105246_10018550
1266 Ga0105246_10161701
1267 Ga0105246_10373159
1268 Ga0157324_1001777
1269 Ga0157373_10002006
1270 Ga0157371_10013493
1271 Ga0157371_10039104
1272 Ga0157370_10200977
1273 Ga0157369_10020901
1274 Ga0157369_10044713
1275 Ga0157369_10080441
1276 Ga0157369_10558690
1277 Ga0157374_10006392
1278 Ga0157374_10007905
1279 Ga0157374_10009965
1280 Ga0157374_10034699
1281 Ga0157374_10043341
1282 Ga0157374_10113184
1283 Ga0157374_10147964
1284 Ga0157374_10151797
1285 Ga0157374_10755442
1286 Ga0157374_11179862
1287 Ga0157378_10000500
1288 Ga0157378_10027150
1289 Ga0157378_10031909
1290 Ga0157378_10041884
1291 Ga0157378_10051536
1292 Ga0157378_10154534
1293 Ga0157378_10335665
1294 Ga0157378_10986657
1295 Ga0163162_10004111
1296 Ga0163162_10025814
1297 Ga0163162_10028631
1298 Ga0163162_10041900
1299 Ga0163162_10052703
1300 Ga0163162_10376726
1301 Ga0163162_10738771
1302 Ga0157372_10005010
1303 Ga0157372_10017917
1304 Ga0157372_10088321
1305 Ga0157372_10164562
1306 Ga0157372_10571909
1307 Ga0157372_11145692
1308 Ga0157375_10003750
1309 Ga0157375_10004968
1310 Ga0157375_10022457
1311 Ga0157375_10214376
1312 Ga0157375_11263325
1313 Ga0163163_10003969
1314 Ga0163163_10022798
1315 Ga0163163_10070616
1316 Ga0163163_10075760
1317 Ga0163163_10076433
1318 Ga0163163_10813774
1319 Ga0157380_10590111
1320 Ga0157380_10590888
1321 Ga0182008_10011317
1322 Ga0157377_10001238
1323 Ga0157377_10679140
1324 Ga0157379_10001079
1325 Ga0157379_10029253
1326 Ga0157379_10042037
1327 Ga0157379_10092539
1328 Ga0157379_10346130
1329 Ga0157376_10016890
1330 Ga0157376_10018776
1331 Ga0157376_10020940
1332 Ga0157376_10046901
1333 Ga0157376_10087080
1334 Ga0157376_10087229
1335 Ga0157376_10285495
1336 Ga0157376_10609695
1337 Ga0157376_10774416
1338 Ga0182006_1016501
1339 Ga0182007_10002720
1340 Ga0182005_1226137
1341 Ga0163161_10012193
1342 Ga0206356_11855300
1343 Ga0213874_10145638
1344 Ga0224569_100483
1345 Ga0224572_1001830
1346 Ga0224572_1001886
1347 Ga0224572_1023503
1348 Ga0228598_1000189
1349 Ga0228598_1001276
1350 Ga0228598_1001673
1351 Ga0207697_10004521
1352 Ga0207656_10010867
1353 Ga0207656_10110733
1354 Ga0207653_10407233
1355 Ga0207682_10002451
1356 Ga0207682_10161156
1357 Ga0207692_10003629
1358 Ga0207692_10013556
1359 Ga0207692_10030890
1360 Ga0207692_10032115
1361 Ga0207692_10365983
1362 Ga0207692_10819472
1363 Ga0207642_10009961
1364 Ga0207642_10010581
1365 Ga0207710_10102404
1366 Ga0207688_10000776
1367 Ga0207680_10125010
1368 Ga0207680_10292301
1369 Ga0207647_10026923
1370 Ga0207647_10040871
1371 Ga0207647_10099104
1372 Ga0207685_10002976
1373 Ga0207685_10003636
1374 Ga0207685_10022304
1375 Ga0207685_10071377
1376 Ga0207685_10103127
1377 Ga0207685_10462334
1378 Ga0207699_10000416
1379 Ga0207699_10011990
1380 Ga0207699_10042624
1381 Ga0207699_10071103
1382 Ga0207699_10080100
1383 Ga0207699_10143920
1384 Ga0207699_10216958
1385 Ga0207699_10238902
1386 Ga0207699_10441854
1387 Ga0207699_10711116
1388 Ga0207699_11281642
1389 Ga0207645_10000073
1390 Ga0207645_10006315
1391 Ga0207643_10000501
1392 Ga0207643_10243421
1393 Ga0207705_10167895
1394 Ga0207705_10445455
1395 Ga0207684_10002508
1396 Ga0207684_10010254
1397 Ga0207684_10022651
1398 Ga0207684_10262687
1399 Ga0207654_10441625
1400 Ga0207654_10672869
1401 Ga0207707_10008829
1402 Ga0207707_10122784
1403 Ga0207707_10245761
1404 Ga0207707_10310345
1405 Ga0207695_10019060
1406 Ga0207695_10053604
1407 Ga0207695_10071484
1408 Ga0207671_10095513
1409 Ga0207671_10201857
1410 Ga0207671_10654225
1411 Ga0207693_10000096
1412 Ga0207693_10000119
1413 Ga0207693_10000850
1414 Ga0207693_10002121
1415 Ga0207693_10057014
1416 Ga0207693_10057079
1417 Ga0207693_10058329
1418 Ga0207693_10266776
1419 Ga0207693_10416953
1420 Ga0207663_10003336
1421 Ga0207663_10005024
1422 Ga0207663_10012144
1423 Ga0207663_10013106
1424 Ga0207663_10014369
1425 Ga0207663_10060021
1426 Ga0207663_10555994
1427 Ga0207663_10870510
1428 Ga0207662_10003629
1429 Ga0207657_10000321
1430 Ga0207657_10000379
1431 Ga0207657_10000845
1432 Ga0207649_10000727
1433 Ga0207649_10009574
1434 Ga0207649_10461717
1435 Ga0207652_10139421
1436 Ga0207652_10173661
1437 Ga0207652_10553520
1438 Ga0207646_10020449
1439 Ga0207646_10038531
1440 Ga0207646_10070886
1441 Ga0207681_10402794
1442 Ga0207694_10034679
1443 Ga0207694_10101208
1444 Ga0207694_10218059
1445 Ga0207650_10000045
1446 Ga0207659_10017862
1447 Ga0207659_11233041
1448 Ga0207687_10028281
1449 Ga0207687_10111038
1450 Ga0207687_10135791
1451 Ga0207687_10212054
1452 Ga0207687_10297260
1453 Ga0207700_10000467
1454 Ga0207700_10000611
1455 Ga0207700_10005967
1456 Ga0207700_10014391
1457 Ga0207700_10154866
1458 Ga0207700_10227923
1459 Ga0207700_10334467
1460 Ga0207700_10553194
1461 Ga0207700_10961835
1462 Ga0207664_10000017
1463 Ga0207664_10088293
1464 Ga0207664_10093267
1465 Ga0207664_10141353
1466 Ga0207664_10267902
1467 Ga0207664_11375053
1468 Ga0207644_10002234
1469 Ga0207644_10261836
1470 Ga0207690_10077529
1471 Ga0207706_10000213
1472 Ga0207706_10000370
1473 Ga0207706_10005630
1474 Ga0207686_10034816
1475 Ga0207686_10100284
1476 Ga0207686_10253809
1477 Ga0207686_10446941
1478 Ga0207709_10275340
1479 Ga0207670_10873783
1480 Ga0207704_10022941
1481 Ga0207704_10143193
1482 Ga0207704_10451668
1483 Ga0207665_10002537
1484 Ga0207665_10006824
1485 Ga0207665_10033174
1486 Ga0207665_10034312
1487 Ga0207665_10052282
1488 Ga0207665_10131930
1489 Ga0207665_10299447
1490 Ga0207665_10556190
1491 Ga0207665_10986915
1492 Ga0207691_10000151
1493 Ga0207711_10024010
1494 Ga0207711_10030477
1495 Ga0207711_10089953
1496 Ga0207711_10133886
1497 Ga0207711_10398925
1498 Ga0207711_10437602
1499 Ga0207689_10000129
1500 Ga0207689_10000166
1501 Ga0207689_10012861
1502 Ga0207661_10000099
1503 Ga0207661_10080027
1504 Ga0207661_10232065
1505 Ga0207679_10000096
1506 Ga0207679_10151353
1507 Ga0207679_10455970
1508 Ga0207679_10503115
1509 Ga0207667_10020353
1510 Ga0207667_10042127
1511 Ga0207667_10208166
1512 Ga0207667_10333123
1513 Ga0207667_10832018
1514 Ga0207651_10062182
1515 Ga0207651_10532036
1516 Ga0207712_10071282
1517 Ga0207712_10130650
1518 Ga0207668_10034712
1519 Ga0207640_10003526
1520 Ga0207640_10009802
1521 Ga0207640_10238081
1522 Ga0207640_10608754
1523 Ga0207658_10041272
1524 Ga0207658_10891745
1525 Ga0207677_10063083
1526 Ga0207677_10483722
1527 Ga0207677_10514646
1528 Ga0207677_11040227
1529 Ga0207703_10050074
1530 Ga0207703_10066556
1531 Ga0207703_10077224
1532 Ga0207703_10139381
1533 Ga0207703_11745599
1534 Ga0207639_10018041
1535 Ga0207639_10115151
1536 Ga0207678_10000026
1537 Ga0207678_10000381
1538 Ga0207702_10000993
1539 Ga0207702_10072869
1540 Ga0207702_10082190
1541 Ga0207702_10307456
1542 Ga0207702_11639619
1543 Ga0207702_11873587
1544 Ga0207641_10000075
1545 Ga0207641_10191705
1546 Ga0207641_10244361
1547 Ga0207641_10550873
1548 Ga0207641_10590747
1549 Ga0207648_10000890
1550 Ga0207648_10041404
1551 Ga0207648_10053396
1552 Ga0207676_10000212
1553 Ga0207676_10043033
1554 Ga0207676_10666442
1555 Ga0207674_10000670
1556 Ga0207674_10022023
1557 Ga0207674_10029181
1558 Ga0207674_10036200
1559 Ga0207675_100010093
1560 Ga0207675_100297005
1561 Ga0207675_100514464
1562 Ga0207683_10001901
1563 Ga0207698_10064039
1564 Ga0207698_10462267
1565 Ga0207698_10490859
1566 Ga0265356_1003947
1567 Ga0265357_1030038
1568 Ga0268266_10025946
1569 Ga0268266_10036165
1570 Ga0268266_10657495
1571 Ga0268265_10042850
1572 Ga0268265_10091846
1573 Ga0268265_10418419
1574 Ga0268265_10471841
1575 Ga0268264_10022618
1576 Ga0268264_10024495
1577 Ga0268264_10034827
1578 Ga0268264_10399933
1579 Ga0268264_10741278
1580 Ga0268264_11565741
1581 Ga0265338_10015238
1582 Ga0265338_10027752
1583 Ga0265338_10048630
1584 Ga0265338_10054343
1585 Ga0265338_10056053
1586 Ga0265338_10097773
1587 Ga0265762_1000267
1588 Ga0265762_1000706
1589 Ga0265762_1002225
1590 Ga0265762_1070665
1591 Ga0265770_1013760
1592 Ga0265760_10000117
1593 Ga0265760_10003836
1594 Ga0265760_10006936
1595 Ga0265332_10048162
1596 Ga0265328_10073488
1597 Ga0265325_10003863
1598 Ga0265325_10046541
1599 Ga0265340_10052980
1600 Ga0265339_10010741
1601 Ga0265339_10031452
1602 Ga0265339_10090458
1603 Ga0265316_10062736
1604 Ga0265316_10064286
1605 Ga0265316_10071581
1606 Ga0265316_10647613
1607 Ga0307408_100526426
1608 Ga0265314_10062459
1609 Ga0265314_10149781
1610 Ga0265342_10033401
1611 Ga0307405_10074415
1612 Ga0307410_10064758
1613 Ga0307410_10104420
1614 Ga0307412_10401241
1615 Ga0307416_100438412
1616 Ga0307411_10019305
1617 Ga0307415_100002600
1618 Ga0307415_100729967
1619 Ga0316212_1007283
1620 Ga0373930_0004788
1621 Ga0373958_0012903
1622 Ga0373929_0062253
1623 Ga0373934_0076687
1624 Ga0373940_0102809
1625 Ga0373944_0012902
1626 Ga0373952_0012167
1627 Ga0373923_0084699
1628 Ga0373932_0023073
1629 Ga0373936_0002322
1630 Ga0373936_0068456
1631 Ga0373936_0237092
1632 Ga0373941_0019831
1633 Ga0373956_0351440
1634 Ga0373943_0000779
1635 Ga0373943_0148809
1636 Ga0373946_0000613
1637 Ga0373955_0024353
1638 Ga0373955_0373305
1639 Ga0373942_0096634
1640 Ga0373961_0030639
1641 Ga0373962_0008003
1642 Ga0373924_0021094
1643 Ga0373924_0024035
1644 Ga0373935_0006806
1645 Ga0373935_0116074
1646 Ga0373935_0228814
1647 Ga0373927_0000085
1648 Ga0373927_0333611
1649 Ga0373933_0036263
1650 Ga0373947_0003515
1651 Ga0373947_0266536
1652 Ga0373937_0219637
1653 Ga0373937_0248845
1654 Ga0373937_0464780
1655 Ga0373937_0479114
1656 Ga0373937_1736420
1657 Ga0373937_1811477
1658 Ga0373925_0009268
1659 Ga0373925_0033615
1660 Ga0373925_0194405
1661 Ga0373925_0735088
1662 Ga0395905_1600520
1663 Ga0436361_0612533
1664 Ga0436363_0628616
1665 Ga0466963_0151097
1666 Ga0466963_1186534
1667 Ga0466964_0093259
1668 Ga0453684_0731116
1669 Ga0451576_0081959
1670 Ga0451576_0235019
1671 Ga0466967_0812985
1672 Ga0495592_0236376
1673 Ga0495592_0699443
1674 Ga0495603_0262410
1675 Ga0495629_0018361
1676 Ga0495580_0000349
1677 Ga0495580_0001198
1678 Ga0495580_0003361
1679 Ga0495580_0005033
1680 Ga0495580_0037248
1681 Ga0495580_0042811
1682 Ga0495580_0050893
1683 Ga0495580_0105094
1684 Ga0495580_0140471
1685 Ga0495580_0186121
1686 Ga0495580_0224300
1687 Ga0495582_0005458
1688 Ga0495664_0194851
1689 Ga0495594_0005014
1690 Ga0495628_0047983
1691 Ga0495630_0398730
1692 Ga0495630_0532188
1693 Ga0495666_0252568
1694 Ga0495665_0108705
1695 Ga0495665_0299860
1696 Ga0495645_0096065
1697 Ga0495635_0622082
1698 Ga0495599_0243862
1699 Ga0495624_0062475
1700 Ga0495624_0267018
1701 Ga0495670_0331172
1702 Ga0495674_0067144
1703 Ga0495674_0235268
1704 Ga0495674_1027178
1705 Ga0495674_1041024
1706 Ga0495593_0032870
1707 Ga0496100_0063571
1708 Ga0496100_0065557
1709 Ga0496100_0120637
1710 Ga0496100_0154515
1711 Ga0496100_0190880
1712 Ga0496100_0231120
1713 Ga0496101_0012667
1714 Ga0496101_0060527
1715 Ga0496101_0471500
1716 Ga0496101_0496278
1717 Ga0496102_0003593
1718 Ga0496102_0015179
1719 Ga0496102_0035381
1720 Ga0496102_0060070
1721 Ga0496102_0323463
1722 Ga0496102_0345865
1723 Ga0496102_0784028
1724 Ga0496103_0086381
1725 Ga0496103_0248197
1726 Ga0496103_0413713
1727 Ga0496104_0008923
1728 Ga0496104_0090209
1729 Ga0496104_0143461
1730 Ga0496104_0164437
1731 Ga0496104_0262503
1732 Ga0496104_0433809
1733 Ga0496104_0500593
1734 Ga0496105_0199645
1735 Ga0496105_0852250
1736 Ga0496106_0048312
1737 Ga0496106_0136745
1738 Ga0496106_0276918
1739 Ga0496108_0000304
1740 Ga0496108_0155177
1741 Ga0496108_0475096
1742 Ga0496108_0584016
1743 Ga0496109_0000132
1744 Ga0496109_0037739
1745 Ga0496109_0145417
1746 Ga0496109_0718669
1747 Ga0496109_1160915
1748 Ga0496109_1322206
1749 Ga0496110_0003639
1750 Ga0496110_0208999
1751 Ga0496110_0437838
1752 Ga0496111_0039281
1753 Ga0496111_0161367
1754 Ga0496112_0000724
1755 Ga0496112_0003918
1756 Ga0496112_0052762
1757 Ga0496112_0585500
1758 Ga0496112_0619482
1759 Ga0496112_0655201
1760 Ga0496112_0906177
1761 Ga0496113_0003443
1762 Ga0496113_0033740
1763 Ga0496114_0007439
1764 Ga0496114_0645314
1765 Ga0496115_0015286
1766 Ga0496115_0164465
1767 Ga0496115_0649092
1768 Ga0501224_008551
1769 Ga0501243_010114
1770 Ga0501249_075838
1771 Ga0501225_0022264
1772 Ga0501234_014780
1773 Ga0501245_102973
1774 Ga0501284_10831
1775 nmdc:mga0n895_351824_c1
1776 nmdc:mga0rr50_212469_c1
1777 nmdc:mga0rr50_28025_c1
1778 nmdc:mga0rr50_290301_c1
1779 nmdc:mga08x19_238318_c1
1780 nmdc:mga08x19_471737_c1
1781 nmdc:mga08x19_65499_c1
1782 nmdc:mga0a205_2659_c1
1783 Ga0495601_0094615
1784 Ga0500590_278060

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01590

GAF

GAF domain

44

180

0.81

PF13185

GAF_2

GAF domain

42

181

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmn-assembly2.cif.gz_E structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.9704 24 154
3rfb-assembly1.cif.gz_A structure of frmsr 0.9496 5 152
3ksf-assembly3.cif.gz_F structure of frmsr of staphylococcus aureus (reduced form) 0.9492 7 156
3mmh-assembly1.cif.gz_B x-ray structure of free methionine-r-sulfoxide reductase from neisseria meningitidis in complex with its substrate 0.9433 1 157
5hl6-assembly1.cif.gz_A crystal structure of a putative gaf sensor protein from burkholderia vietnamiensis 0.9432 1 152
ID Description Score Start End Superfamily
3rfbA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9496 5 152 3.30.450.40
af_Q8MTJ7_3_158_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9491 1 153 3.30.450.40
4mmnA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9407 24 157 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9321 6 157 3.30.450.40
af_A0A1D8PPZ9_7_175_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.9026 1 154 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A7V0T743-F1-model_v4 GAF domain-containing protein 0.9781 9 154
AF-A0A0T6AN32-F1-model_v4 GAF sensor protein, GAF domain-containing protein 0.978 80 154
AF-A0A3A0D2J3-F1-model_v4 3-dehydroquinate dehydratase (3-dehydroquinase) (EC 4.2.1.10) (Type II DHQase) 0.9763 4 157 GO:0003855
GO:0008652
GO:0009073
GO:0009423
GO:0019631
AF-A0A2V9ZCL0-F1-model_v4 Diguanylate cyclase 0.9715 65 159
AF-A0A661U7B1-F1-model_v4 GAF domain-containing protein 0.9709 7 154

Map