F484886

General Info

Members Datasets Scaffolds Average Seq Length
892 687 417 199

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10260299|Ga0157373_102602992
Length 201
Sequence MFYETGKNDHGLAHDPFKAIVAPRPIGWIGTLSETGVRNLGPYSFFNAVSDRPKLVMFSSSGGAKDSATNAERTGEFTCSFVSRNLVEAMNISSAAVPPETDEFALAGLTATPGRLVRAPYVGEAYAALECRVTEILQPKTLAGDPSSSVIVFGQVVAIHIREEVIREGRFDVALARPVTRMGYMDYSEVGEIFEMMRPTV

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
8 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
9 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
12 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
17 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
20 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
21 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
22 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
23 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
24 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
25 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
26 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
27 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
28 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
29 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
30 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
31 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
32 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
33 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
34 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
35 2516143018 Ensifer sp. BR816 Isolate Nodule
36 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
37 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
38 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
39 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
40 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
41 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
42 2519899620 Rhizobium sp. Pop5 Isolate Nodule
43 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
44 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
45 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
46 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
47 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
48 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
49 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
50 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
51 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
52 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
53 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
54 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
55 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
56 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
57 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
58 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
59 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
60 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
61 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
62 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
63 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
64 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
65 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
66 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
67 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
68 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
69 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
70 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
71 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
72 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
73 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
74 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
75 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
76 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
77 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
78 2643221557 Ensifer sp. Root558 Isolate Unclassified
79 2643221599 Rhizobium sp. Root708 Isolate Unclassified
80 2643221610 Ensifer sp. Root74 Isolate Unclassified
81 2643221618 Ensifer sp. Root231 Isolate Unclassified
82 2643221626 Ensifer sp. Root31 Isolate Unclassified
83 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
84 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
85 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
86 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
87 2643221655 Ensifer sp. Root1252 Isolate Unclassified
88 2643221659 Ensifer sp. Root127 Isolate Unclassified
89 2643221668 Ensifer sp. Root423 Isolate Unclassified
90 2643221675 Ensifer sp. Root1298 Isolate Unclassified
91 2643221680 Ensifer sp. Root1312 Isolate Unclassified
92 2643221698 Ensifer sp. Root142 Isolate Unclassified
93 2643221712 Ensifer sp. Root258 Isolate Unclassified
94 2643221718 Rhizobium sp. Root268 Isolate Unclassified
95 2643221719 Rhizobium sp. Root274 Isolate Unclassified
96 2643221723 Ensifer sp. Root278 Isolate Unclassified
97 2643221726 Ensifer sp. Root954 Isolate Unclassified
98 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
99 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
100 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
101 2718217882 Rhizobium sp. N741 Isolate Nodule
102 2718217927 Rhizobium sp. N324 Isolate Nodule
103 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
104 2718218009 Rhizobium sp. N561 Isolate Nodule
105 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
106 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
107 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
108 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
109 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
110 2718218363 Rhizobium sp. N113 Isolate Nodule
111 2718218365 Rhizobium sp. N731 Isolate Nodule
112 2718218366 Rhizobium sp. N621 Isolate Nodule
113 2718218423 Rhizobium sp. N941 Isolate Nodule
114 2721755514 Rhizobium sp. N6212 Isolate Nodule
115 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
116 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
117 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
118 2721755809 Rhizobium sp. N541 Isolate Nodule
119 2721755810 Rhizobium sp. N871 Isolate Nodule
120 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
121 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
122 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
123 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
124 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
125 2728369365 Rhizobium sp. N1341 Isolate Nodule
126 2728369397 Rhizobium sp. N1314 Isolate Nodule
127 2738541293 Rhizobium sp. GV031 Isolate Unclassified
128 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
129 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
130 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
131 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
132 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
133 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
134 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
135 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
136 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
137 2791355256 Rhizobium sp. M10 Isolate Nodule
138 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
139 2791355260 Rhizobium sp. L9 Isolate Nodule
140 2791355261 Rhizobium sp. J15 Isolate Nodule
141 2791355262 Rhizobium sp. M1 Isolate Nodule
142 2791355263 Rhizobium chutanense C5 Isolate Nodule
143 2791355264 Rhizobium sp. S9 Isolate Nodule
144 2791355265 Rhizobium sp. H4 Isolate Nodule
145 2791355266 Rhizobium sp. L43 Isolate Nodule
146 2791355267 Rhizobium sp. L18 Isolate Nodule
147 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
148 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
149 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
150 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
151 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
152 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
153 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
154 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
155 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
156 2802429633 Rhizobium anhuiense J3 Isolate Nodule
157 2802429634 Rhizobium anhuiense S10 Isolate Nodule
158 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
159 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
160 2802429637 Rhizobium anhuiense C15 Isolate Nodule
161 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
162 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
163 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
164 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
165 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
166 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
167 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
168 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
169 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
170 2838048938 Rhizobium pisi 27/80 Isolate Nodule
171 2838061910 Rhizobium phaseoli L15 Isolate Nodule
172 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
173 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
174 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
175 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
176 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
177 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
178 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
179 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
180 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
181 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
182 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
183 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
184 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
185 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
186 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
187 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
188 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
189 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
190 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
191 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
192 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
193 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
194 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
195 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
196 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
197 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
198 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
199 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
200 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
201 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
202 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
203 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
204 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
205 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
206 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
207 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
208 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
209 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
210 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
211 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
212 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
213 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
214 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
215 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
216 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
217 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
218 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
219 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
220 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
221 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
222 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
223 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
224 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
225 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
226 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
227 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
228 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
229 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
230 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
231 2844163670 Ensifer sp. 1H6 Isolate Unclassified
232 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
233 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
234 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
235 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
236 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
237 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
238 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
239 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
240 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
241 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
242 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
243 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
244 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
245 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
246 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
247 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
248 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
249 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
250 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
251 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
252 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
253 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
254 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
255 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
256 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
257 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
258 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
259 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
260 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
261 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
262 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
263 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
264 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
265 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
266 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
267 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
268 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
269 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
270 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
271 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
272 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
273 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
274 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
275 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
276 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
277 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
278 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
279 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
280 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
281 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
282 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
283 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
284 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
285 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
286 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
287 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
288 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
289 2933599457 Rhizobium phaseoli M3 Isolate Nodule
290 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
291 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
292 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
293 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
294 2936381700 Rhizobium chutanense C16 Isolate Unclassified
295 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
296 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
297 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
298 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
299 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
300 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
301 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
302 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
303 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
304 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
305 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
306 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
307 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
308 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
309 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
310 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
311 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
312 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
313 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
314 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
315 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
316 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
317 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
318 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
319 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
320 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
321 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
322 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
323 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
324 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
325 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
326 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
327 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
328 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
329 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
330 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
331 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
332 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
333 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
334 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
335 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
336 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
337 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
338 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
339 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
340 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
341 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
342 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
343 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
344 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
345 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
346 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
347 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
348 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
349 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
350 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
351 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
352 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
353 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
354 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
355 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
356 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
357 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
358 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
359 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
360 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
361 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
362 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
363 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
364 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
365 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
366 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
367 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
368 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
369 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
370 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
371 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
372 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
373 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
374 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
375 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
376 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
377 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
378 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
379 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
380 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
381 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
382 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
383 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
384 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
385 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
386 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
387 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
388 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
389 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
390 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
391 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
392 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
393 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
394 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
395 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
396 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
397 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
398 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
399 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
400 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
401 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
402 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
403 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
404 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
405 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
406 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
407 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
408 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
409 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
410 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
411 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
412 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
413 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
414 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
415 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
416 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
417 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
418 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
419 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
420 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
421 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
422 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
423 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
424 2996887358 Rhizobium sp. R711 Isolate Nodule
425 2996893221 Rhizobium sp. R635 Isolate Nodule
426 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
427 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
428 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
429 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
430 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
431 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
432 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
433 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
434 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
435 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
436 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
437 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
438 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
439 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
440 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
441 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
442 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
443 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
444 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
445 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
446 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
447 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
448 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
449 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
450 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
451 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
452 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
453 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
454 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
455 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
456 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
457 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
458 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
459 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
460 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
461 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
462 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
463 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
464 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
465 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
466 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
467 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
468 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
469 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
470 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
471 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
472 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
473 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
474 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
475 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
476 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
477 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
478 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
479 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
480 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
481 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
482 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
483 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
484 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
485 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
486 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
487 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
488 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
489 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
490 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
491 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
492 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
493 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
494 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
495 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
496 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
497 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
498 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
499 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
500 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
501 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
502 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
503 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
504 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
505 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
506 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
507 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
508 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
509 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
510 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
511 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
512 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
513 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
514 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
516 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
518 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
520 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
521 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
522 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
523 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
524 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
525 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
526 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
527 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
528 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
529 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
530 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
531 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
532 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
533 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
534 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
535 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
536 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
537 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
538 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
539 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
540 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
541 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
542 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
543 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
544 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
545 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
546 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
547 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
548 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
549 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
550 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
551 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
552 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
553 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
554 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
555 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
556 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
557 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
558 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
559 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
560 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
561 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
562 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
563 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
564 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
565 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
566 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
567 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
568 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
569 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
570 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
571 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
572 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
573 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
574 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
575 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
576 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
577 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
578 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
579 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
580 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
581 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
582 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
583 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
584 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
585 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
586 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
587 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
588 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
589 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
590 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
591 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
592 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
593 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
594 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
595 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
596 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
597 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
598 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
599 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
600 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
601 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
602 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
603 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
604 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
605 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
606 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
607 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
608 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
609 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
610 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
611 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
612 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
613 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
614 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
615 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
616 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
617 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
618 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
619 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
620 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
621 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
622 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
623 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
624 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
625 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
626 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
627 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
628 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
629 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
630 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
631 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
632 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
633 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
634 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
635 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
636 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
637 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
638 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
639 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
640 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
641 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
642 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
643 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
644 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
645 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
646 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
647 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
648 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
649 8005258706 Rhizobium sp. R693 Isolate Nodule
650 8005275841 Rhizobium sp. N4311 Isolate Nodule
651 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
652 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
653 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
654 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
655 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
656 8005321885 Rhizobium sp. R72 Isolate Nodule
657 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
658 8005382845 Rhizobium sp. R634 Isolate Nodule
659 8005395548 Rhizobium sp. R339 Isolate Nodule
660 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
661 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
662 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
663 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
664 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
665 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
666 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
667 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
668 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
669 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
670 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
671 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
672 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
673 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
674 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
675 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
676 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
677 8018176218 Rhizobium sp. N122 Isolate Nodule
678 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
679 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
680 8024501048 Rhizobium sp. H4 Isolate Nodule
681 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
682 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
683 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
684 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
685 8056382006 Rhizobium croatiense 13T Isolate Nodule
686 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
687 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.3
Metatranscriptomes 0.34
Isolates 53.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.39
Nodule 45.07
Rhizoplane 1.23
Rhizosphere 17.71
Stem 0
Stem Tuber 0
Unclassified 16.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10003156 3300001979 Bacteria 7272
2 JGI25155J39150_1000058 3300002704 Bacteria 72188
3 JGI25156J39149_1000080 3300002705 Bacteria 72430
4 JGI25162J39368_1000977 3300002737 Bacteria 18156
5 JGI25162J39368_1001303 3300002737 Bacteria 14078
6 JGI25162J39368_1002015 3300002737 Bacteria 9014
7 JGI25154J39366_1000224 3300002738 Bacteria 38440
8 JGI25158J39367_1000033 3300002739 Bacteria 30955
9 JGI25158J39367_1007156 3300002739 Bacteria 1580
10 JGI25157J39369_1000101 3300002741 Bacteria 72430
11 JGI25152J39213_1000526 3300002773 Bacteria 21222
12 JGI25152J39213_1001062 3300002773 Bacteria 13029
13 JGI25152J39213_1005549 3300002773 Bacteria 3638
14 JGI25152J39213_1006143 3300002773 Bacteria 3338
15 JGI25150J39212_1000010 3300002774 Bacteria 236260
16 JGI25150J39212_1003412 3300002774 Bacteria 3719
17 JGI25159J45721_1000006 3300002987 Bacteria 188201
18 JGI25159J45721_1000462 3300002987 Bacteria 18799
19 JGI25151J46595_10000026 3300003187 Bacteria 211045
20 JGI25151J46595_10000715 3300003187 Bacteria 27669
21 JGI25151J46595_10013494 3300003187 Bacteria 3675
22 JGI25151J46595_10034700 3300003187 Bacteria 1926
23 JGI25165J46597_1001138 3300003214 Bacteria 16671
24 JGI25165J46597_1001222 3300003214 Bacteria 15361
25 JGI25165J46597_1002937 3300003214 Bacteria 4780
26 JGI25153J46596_10005007 3300003215 Bacteria 7026
27 JGI25153J46596_10008801 3300003215 Bacteria 4776
28 JGI25153J46596_10021049 3300003215 Bacteria 2443
29 JGI25153J46596_10035627 3300003215 Bacteria 1609
30 rootH1_10096281 3300003316 Bacteria 3137
31 rootH1_10153970 3300003316 Bacteria 1272
32 rootH1_10006423 3300003316 Bacteria 27864
33 rootH1_10006423 3300003323 Bacteria 6985
34 JGI25160J50197_1000019 3300003354 Bacteria 233980
35 JGI25161J50226_1000157 3300003374 Bacteria 47443
36 JGI25161J50226_1000226 3300003374 Bacteria 34723
37 Ga0055526_1001814 3300003771 Bacteria 14793
38 Ga0055526_1002481 3300003771 Bacteria 12463
39 Ga0055526_1004744 3300003771 Bacteria 8055
40 Ga0055526_1007431 3300003771 Bacteria 5693
41 Ga0055524_1001008 3300003775 Bacteria 17483
42 Ga0055524_1001326 3300003775 Bacteria 14444
43 Ga0055524_1001365 3300003775 Bacteria 14165
44 Ga0055524_1005245 3300003775 Bacteria 5825
45 Ga0055524_1022708 3300003775 Bacteria 2041
46 Ga0055524_1039470 3300003775 Bacteria 1218
47 Ga0055536_1000916 3300003781 Bacteria 19072
48 Ga0055528_1002071 3300003790 Bacteria 11171
49 Ga0055528_1005556 3300003790 Bacteria 5841
50 Ga0055528_1006848 3300003790 Bacteria 5117
51 Ga0055528_1007086 3300003790 Bacteria 5007
52 Ga0055528_1013468 3300003790 Bacteria 3093
53 Ga0055528_1026843 3300003790 Bacteria 1640
54 Ga0055530_10046990 3300003791 Bacteria 1022
55 Ga0055540_1000425 3300003792 Bacteria 33781
56 Ga0055540_1017733 3300003792 Bacteria 1977
57 Ga0055540_1050743 3300003792 Bacteria 857
58 Ga0055531_10012280 3300003794 Bacteria 4044
59 Ga0055543_1000032 3300004625 Bacteria 130218
60 Ga0055543_1000145 3300004625 Bacteria 58910
61 Ga0055543_1000507 3300004625 Bacteria 22412
62 Ga0065165_1000180 3300005262 Bacteria 111768
63 Ga0065165_1007755 3300005262 Bacteria 5188
64 Ga0065165_1035500 3300005262 Bacteria 1531
65 Ga0065165_1035517 3300005262 Bacteria 1530
66 Ga0070658_10249348 3300005327 Bacteria 1506
67 Ga0070670_100000603 3300005331 Bacteria 28216
68 Ga0070663_100098408 3300005455 Bacteria 2179
69 Ga0070662_100659350 3300005457 Bacteria 883
70 Ga0070665_100415933 3300005548 Bacteria 1353
71 Ga0068855_100228571 3300005563 Bacteria 2084
72 Ga0068854_100562971 3300005578 Bacteria 968
73 Ga0068852_100559253 3300005616 Bacteria 1145
74 Ga0081455_10177247 3300005937 Bacteria 1617
75 Ga0075365_10006277 3300006038 Bacteria 6520
76 Ga0075363_100364009 3300006048 Bacteria 846
77 Ga0075367_10002991 3300006178 Bacteria 7910
78 Ga0075367_10097547 3300006178 Bacteria 1793
79 Ga0075369_10000893 3300006186 Bacteria 9905
80 Ga0075369_10078680 3300006186 Bacteria 1460
81 Ga0075369_10085771 3300006186 Bacteria 1401
82 Ga0075366_10003829 3300006195 Bacteria 8011
83 Ga0075370_10001366 3300006353 Bacteria 10509
84 Ga0075370_10266786 3300006353 Bacteria 1016
85 Ga0079104_1002527 3300006946 Bacteria 9684
86 Ga0079104_1004857 3300006946 Bacteria 5569
87 Ga0105240_10000005 3300009093 Bacteria 702630
88 Ga0105247_10320177 3300009101 Bacteria 1082
89 Ga0105243_10235252 3300009148 Bacteria 1627
90 Ga0105243_10772177 3300009148 Bacteria 944
91 Ga0105237_10001344 3300009545 Bacteria 32586
92 Ga0123341_1000039 3300009765 Bacteria 59474
93 Ga0123342_1012308 3300009766 Bacteria 8998
94 Ga0157373_10171918 3300013100 Bacteria 1524
95 Ga0157373_10260299 3300013100 Bacteria 1228
96 Ga0157373_10744589 3300013100 Bacteria 720
97 Ga0157370_10000948 3300013104 Bacteria 36781
98 Ga0157369_10263885 3300013105 Bacteria 1796
99 Ga0157378_10631010 3300013297 Bacteria 1085
100 Ga0182008_10011961 3300014497 Bacteria 4600
101 Ga0157376_11192358 3300014969 Bacteria 789
102 Ga0182007_10010312 3300015262 Bacteria 3702
103 Ga0183363_1120 3300015690 Bacteria 20646
104 Ga0214544_1000265 3300021320 Bacteria 87060
105 Ga0214542_1000015 3300021321 Bacteria 227912
106 Ga0214543_1000032 3300021327 Bacteria 200766
107 Ga0228711_1000012 3300022739 Bacteria 132594
108 Ga0228710_1000006 3300022740 Bacteria 209134
109 Ga0209435_100045 3300025206 Bacteria 96483
110 Ga0209760_103376 3300025207 Bacteria 1423
111 Ga0209436_100001 3300025208 Bacteria 304543
112 Ga0209436_101098 3300025208 Bacteria 10105
113 Ga0209437_100047 3300025233 Bacteria 405163
114 Ga0209437_100122 3300025233 Bacteria 201364
115 Ga0209437_113351 3300025233 Bacteria 1176
116 Ga0207425_1000010 3300025245 Bacteria 572898
117 Ga0207425_1003220 3300025245 Bacteria 5331
118 Ga0207425_1027605 3300025245 Bacteria 1157
119 Ga0209646_1000154 3300025246 Bacteria 96483
120 Ga0209646_1003764 3300025246 Bacteria 2909
121 Ga0209646_1022013 3300025246 Bacteria 912
122 Ga0209026_1000177 3300025250 Bacteria 96629
123 Ga0209677_100440 3300025253 Bacteria 24115
124 Ga0209759_1000274 3300025256 Bacteria 72593
125 Ga0209129_1000099 3300025258 Bacteria 162471
126 Ga0209129_1000127 3300025258 Bacteria 133263
127 Ga0209129_1000527 3300025258 Bacteria 26743
128 Ga0209129_1001982 3300025258 Bacteria 10647
129 Ga0209129_1005696 3300025258 Bacteria 4299
130 Ga0209129_1006832 3300025258 Bacteria 3565
131 Ga0209129_1007627 3300025258 Bacteria 3174
132 Ga0209129_1008900 3300025258 Bacteria 2721
133 Ga0209233_1000048 3300025261 Bacteria 453669
134 Ga0209233_1000170 3300025261 Bacteria 147527
135 Ga0209233_1000297 3300025261 Bacteria 61773
136 Ga0209565_1036308 3300025263 Bacteria 937
137 Ga0209455_1017910 3300025272 Bacteria 1469
138 Ga0209673_1000013 3300025273 Bacteria 571633
139 Ga0209673_1000048 3300025273 Bacteria 287976
140 Ga0209673_1000815 3300025273 Bacteria 41149
141 Ga0209673_1000841 3300025273 Bacteria 40004
142 Ga0209673_1001787 3300025273 Bacteria 17792
143 Ga0209673_1005205 3300025273 Bacteria 6636
144 Ga0209673_1020114 3300025273 Bacteria 2373
145 Ga0209673_1021310 3300025273 Bacteria 2271
146 Ga0209673_1033118 3300025273 Bacteria 1581
147 Ga0209673_1068942 3300025273 Bacteria 850
148 Ga0209130_1000004 3300025284 Bacteria 633436
149 Ga0209130_1000007 3300025284 Bacteria 591584
150 Ga0209130_1016654 3300025284 Bacteria 1772
151 Ga0209676_1000399 3300025292 Bacteria 79312
152 Ga0209676_1015074 3300025292 Bacteria 2866
153 Ga0209025_1000022 3300025294 Bacteria 574487
154 Ga0209025_1000042 3300025294 Bacteria 370577
155 Ga0209025_1000731 3300025294 Bacteria 55688
156 Ga0209025_1000870 3300025294 Bacteria 47707
157 Ga0209025_1001289 3300025294 Bacteria 34281
158 Ga0209025_1005829 3300025294 Bacteria 9867
159 Ga0209025_1008926 3300025294 Bacteria 7095
160 Ga0209025_1013468 3300025294 Bacteria 5134
161 Ga0209025_1022965 3300025294 Bacteria 3284
162 Ga0209025_1036227 3300025294 Bacteria 2214
163 Ga0209025_1068290 3300025294 Bacteria 1278
164 Ga0209564_1000140 3300025295 Bacteria 179856
165 Ga0209564_1000566 3300025295 Bacteria 58647
166 Ga0209564_1000906 3300025295 Bacteria 38845
167 Ga0209564_1003617 3300025295 Bacteria 10286
168 Ga0209564_1012010 3300025295 Bacteria 3818
169 Ga0209564_1021008 3300025295 Bacteria 2368
170 Ga0209564_1036501 3300025295 Bacteria 1401
171 Ga0209564_1054084 3300025295 Bacteria 951
172 Ga0209758_1000086 3300025297 Bacteria 254778
173 Ga0209758_1000821 3300025297 Bacteria 43465
174 Ga0209758_1000977 3300025297 Bacteria 38489
175 Ga0209758_1001420 3300025297 Bacteria 28346
176 Ga0209758_1002711 3300025297 Bacteria 17455
177 Ga0209758_1003834 3300025297 Bacteria 13193
178 Ga0209758_1030923 3300025297 Bacteria 2206
179 Ga0209758_1061094 3300025297 Bacteria 1243
180 Ga0209050_1000906 3300025298 Bacteria 39206
181 Ga0209050_1012680 3300025298 Bacteria 3835
182 Ga0209256_1000606 3300025299 Bacteria 49790
183 Ga0209256_1000747 3300025299 Bacteria 42440
184 Ga0209256_1000947 3300025299 Bacteria 35197
185 Ga0209256_1001218 3300025299 Bacteria 28678
186 Ga0209256_1004303 3300025299 Bacteria 9067
187 Ga0209256_1016997 3300025299 Bacteria 2444
188 Ga0209256_1019602 3300025299 Bacteria 2146
189 Ga0207426_1000003 3300025302 Bacteria 1063212
190 Ga0207426_1000111 3300025302 Bacteria 234032
191 Ga0207426_1000427 3300025302 Bacteria 68840
192 Ga0207426_1000868 3300025302 Bacteria 31613
193 Ga0209051_1000125 3300025303 Bacteria 142863
194 Ga0209051_1002127 3300025303 Bacteria 14763
195 Ga0209051_1003530 3300025303 Bacteria 10204
196 Ga0209051_1030050 3300025303 Bacteria 2115
197 Ga0209051_1076337 3300025303 Bacteria 985
198 Ga0209257_1001705 3300025304 Bacteria 24654
199 Ga0209257_1006108 3300025304 Bacteria 7994
200 Ga0209257_1018221 3300025304 Bacteria 2716
201 Ga0207695_10000011 3300025913 Bacteria 910221
202 Ga0207671_10008850 3300025914 Bacteria 8478
203 Ga0207681_10033987 3300025923 Bacteria 3349
204 Ga0207650_10025395 3300025925 Bacteria 4220
205 Ga0207709_10147022 3300025935 Bacteria 1627
206 Ga0207667_10190456 3300025949 Bacteria 2105
207 Ga0207640_10439760 3300025981 Bacteria 1072
208 Ga0207658_10395454 3300025986 Bacteria 1214
209 Ga0207678_10219106 3300026067 Bacteria 1629
210 Ga0207678_10430203 3300026067 Bacteria 1145
211 Ga0207702_10105590 3300026078 Bacteria 2495
212 Ga0209281_1000334 3300027111 Bacteria 81109
213 Ga0209281_1000361 3300027111 Bacteria 74287
214 Ga0209371_1006510 3300027312 Bacteria 4308
215 Ga0209282_1000073 3300027666 Bacteria 81125
216 Ga0268266_10896027 3300028379 Bacteria 858
217 Ga0307515_10112818 3300028794 Bacteria 3158
218 Ga0268256_1004910 3300030500 Bacteria 5395
219 Ga0307513_10015448 3300031456 Bacteria 9255
220 Ga0307405_10009269 3300031731 Bacteria 5038
221 Ga0307412_10038376 3300031911 Bacteria 3084
222 Ga0315914_1000008 3300031967 Bacteria 209133
223 Ga0315913_1000129 3300033430 Bacteria 48181
224 Ga0315915_1000014 3300033464 Bacteria 171068
225 Ga0439465_0003130 3300041413 Bacteria 5401
226 Ga0439465_0010775 3300041413 Bacteria 2868
227 Ga0439465_0131559 3300041413 Bacteria 883
228 Ga0439465_0174672 3300041413 Bacteria 775
229 Ga0451787_058342 3300041441 Bacteria 3857
230 Ga0451789_0941268 3300041443 Bacteria 930
231 Ga0451835_0193601 3300041492 Bacteria 2433
232 Ga0451837_0781737 3300041494 Bacteria 2229
233 Ga0451839_0052663 3300041496 Bacteria 2777
234 Ga0451845_0222495 3300041501 Bacteria 4391
235 Ga0451846_28043 3300041502 Bacteria 2803
236 Ga0451847_0823285 3300041503 Bacteria 943
237 Ga0451849_1377121 3300041505 Bacteria 1419
238 Ga0451850_49893 3300041506 Bacteria 1239
239 Ga0451851_0314625 3300041507 Bacteria 4588
240 Ga0451843_1456656 3300041509 Bacteria 2139
241 Ga0451855_0701931 3300041511 Bacteria 1163
242 Ga0451853_0414289 3300041512 Bacteria 1173
243 Ga0451853_3250539 3300041512 Bacteria 2756
244 Ga0452271_94748 3300041916 Bacteria 1191
245 Ga0439449_0012904 3300042007 Bacteria 3142
246 Ga0439449_0077718 3300042007 Bacteria 1224
247 Ga0439462_0047745 3300042015 Bacteria 1148
248 Ga0466963_0005123 3300044694 Bacteria 7658
249 Ga0466964_0289187 3300044706 Bacteria 822
250 Ga0466970_0003996 3300044765 Bacteria 7236
251 Ga0466959_0357432 3300045049 Bacteria 995
252 Ga0466967_0128143 3300045976 Bacteria 2353
253 Ga0495603_0217645 3300046455 Bacteria 1102
254 Ga0495590_0203634 3300046457 Bacteria 728
255 Ga0495638_0000597 3300046460 Bacteria 40647
256 Ga0495650_0119619 3300046471 Bacteria 971
257 Ga0495605_0001403 3300046474 Bacteria 15845
258 Ga0495605_0018994 3300046474 Bacteria 3679
259 Ga0495585_0012266 3300046492 Bacteria 5048
260 Ga0495585_0012976 3300046492 Bacteria 4894
261 Ga0495585_0028431 3300046492 Bacteria 3189
262 Ga0495607_0052723 3300046501 Bacteria 2354
263 Ga0495607_0236042 3300046501 Bacteria 887
264 Ga0495583_0006095 3300046506 Bacteria 7960
265 Ga0495583_0019195 3300046506 Bacteria 3575
266 Ga0495610_0001402 3300046512 Bacteria 21414
267 Ga0495610_0008396 3300046512 Bacteria 6697
268 Ga0495610_0236101 3300046512 Bacteria 731
269 Ga0495620_0006074 3300046515 Bacteria 6677
270 Ga0495620_0097074 3300046515 Bacteria 1177
271 Ga0495631_0007830 3300046518 Bacteria 5418
272 Ga0495631_0020728 3300046518 Bacteria 3068
273 Ga0495631_0066295 3300046518 Bacteria 1562
274 Ga0495632_0010335 3300046519 Bacteria 5537
275 Ga0495632_0026522 3300046519 Bacteria 3049
276 Ga0495643_0005194 3300046522 Bacteria 8879
277 Ga0495643_0014395 3300046522 Bacteria 4707
278 Ga0495648_0100714 3300046524 Bacteria 1595
279 Ga0495648_0372392 3300046524 Bacteria 646
280 Ga0495597_0006547 3300046542 Bacteria 6011
281 Ga0495597_0182396 3300046542 Bacteria 848
282 Ga0495633_0031951 3300046558 Bacteria 2546
283 Ga0495656_0019956 3300046615 Bacteria 2594
284 Ga0495668_0010903 3300046616 Bacteria 5473
285 Ga0495668_0049021 3300046616 Bacteria 2342
286 Ga0495668_0059345 3300046616 Bacteria 2111
287 Ga0495611_0046373 3300046648 Bacteria 1948
288 Ga0495625_0008243 3300046660 Bacteria 8913
289 Ga0495625_0014047 3300046660 Bacteria 6410
290 Ga0495625_0045535 3300046660 Bacteria 3171
291 Ga0495625_0065215 3300046660 Bacteria 2567
292 Ga0495625_0434895 3300046660 Bacteria 813
293 Ga0495625_0537736 3300046660 Bacteria 709
294 Ga0495661_0184332 3300046665 Bacteria 1104
295 Ga0495588_0093983 3300046674 Bacteria 1572
296 Ga0495588_0206643 3300046674 Bacteria 1037
297 Ga0495588_0371266 3300046674 Bacteria 751
298 Ga0495670_0022749 3300046691 Bacteria 3095
299 Ga0495670_0098174 3300046691 Bacteria 1506
300 Ga0495589_0082605 3300046794 Bacteria 1562
301 Ga0495660_0009520 3300046810 Bacteria 5663
302 Ga0495660_0070275 3300046810 Bacteria 1859
303 Ga0495672_0016542 3300047320 Bacteria 4964
304 Ga0495687_028055 3300047443 Bacteria 2623
305 Ga0495685_017831 3300047447 Bacteria 2433
306 Ga0495673_0079874 3300047469 Bacteria 1357
307 Ga0495673_0143798 3300047469 Bacteria 927
308 Ga0495681_0050782 3300047470 Bacteria 1953
309 Ga0495686_0037677 3300047472 Bacteria 3097
310 Ga0496100_0004551 3300048903 Bacteria 7369
311 Ga0496101_0076491 3300048904 Bacteria 2466
312 Ga0496102_0053909 3300048905 Bacteria 3665
313 Ga0496103_0010814 3300048906 Bacteria 5402
314 Ga0496106_0005616 3300048909 Bacteria 9282
315 Ga0496106_0096708 3300048909 Bacteria 2286
316 Ga0496107_0097574 3300048910 Bacteria 2152
317 Ga0496116_0006331 3300048919 Bacteria 10766
318 Ga0496116_0011460 3300048919 Bacteria 7332
319 Ga0496116_0013828 3300048919 Bacteria 6480
320 Ga0496116_0035100 3300048919 Bacteria 3526
321 Ga0496116_0125342 3300048919 Bacteria 1476
322 Ga0496116_0319561 3300048919 Bacteria 728
323 Ga0496117_0000641 3300048920 Bacteria 56335
324 Ga0496117_0013353 3300048920 Bacteria 7170
325 Ga0496117_0037171 3300048920 Bacteria 3631
326 Ga0496117_0062470 3300048920 Bacteria 2552
327 Ga0496117_0130394 3300048920 Bacteria 1525
328 Ga0496118_0002788 3300048921 Bacteria 22874
329 Ga0496118_0009154 3300048921 Bacteria 10064
330 Ga0496118_0012763 3300048921 Bacteria 8024
331 Ga0496118_0047556 3300048921 Bacteria 3323
332 Ga0496119_0006261 3300048922 Bacteria 11109
333 Ga0496119_0012968 3300048922 Bacteria 6700
334 Ga0496119_0067095 3300048922 Bacteria 2117
335 Ga0496119_0082479 3300048922 Bacteria 1849
336 Ga0496120_0045893 3300048923 Bacteria 2528
337 Ga0496120_0095203 3300048923 Bacteria 1583
338 Ga0496121_0003358 3300048924 Bacteria 22960
339 Ga0496121_0009404 3300048924 Bacteria 11241
340 Ga0496121_0016408 3300048924 Bacteria 7652
341 Ga0496121_0031738 3300048924 Bacteria 4818
342 Ga0496121_0117809 3300048924 Bacteria 2011
343 Ga0496121_0293212 3300048924 Bacteria 1107
344 Ga0496121_0474474 3300048924 Bacteria 800
345 Ga0496122_0000399 3300048925 Bacteria 92476
346 Ga0496122_0003165 3300048925 Bacteria 21967
347 Ga0496122_0006187 3300048925 Bacteria 13894
348 Ga0496122_0033877 3300048925 Bacteria 4192
349 Ga0496122_0034267 3300048925 Bacteria 4158
350 Ga0496122_0128755 3300048925 Bacteria 1614
351 Ga0496122_0183353 3300048925 Bacteria 1245
352 Ga0496122_0401699 3300048925 Bacteria 695
353 Ga0496123_0001759 3300048926 Bacteria 28592
354 Ga0496123_0004840 3300048926 Bacteria 13874
355 Ga0496123_0012186 3300048926 Bacteria 7359
356 Ga0496123_0012327 3300048926 Bacteria 7301
357 Ga0496123_0014891 3300048926 Bacteria 6414
358 Ga0496123_0058466 3300048926 Bacteria 2500
359 Ga0496123_0082521 3300048926 Bacteria 1948
360 Ga0496123_0169109 3300048926 Bacteria 1155
361 Ga0496124_0004513 3300048927 Bacteria 16225
362 Ga0496124_0014661 3300048927 Bacteria 7566
363 Ga0496124_0019673 3300048927 Bacteria 6272
364 Ga0496124_0045704 3300048927 Bacteria 3753
365 Ga0496124_0080485 3300048927 Bacteria 2680
366 Ga0496124_0154863 3300048927 Bacteria 1793
367 Ga0496124_0272565 3300048927 Bacteria 1238
368 Ga0496125_0013259 3300048928 Bacteria 8112
369 Ga0496125_0019191 3300048928 Bacteria 6459
370 Ga0496125_0019398 3300048928 Bacteria 6415
371 Ga0496125_0169774 3300048928 Bacteria 1468
372 Ga0496125_0193720 3300048928 Bacteria 1339
373 Ga0496125_0259437 3300048928 Bacteria 1090
374 Ga0496126_0001055 3300048929 Bacteria 46595
375 Ga0496126_0072252 3300048929 Bacteria 3069
376 Ga0496126_0163841 3300048929 Bacteria 1898
377 Ga0495678_026575 3300049459 Bacteria 2468
378 Ga0495678_098012 3300049459 Bacteria 1020
379 Ga0495682_0037693 3300049460 Bacteria 1778
380 Ga0501300_011702 3300049523 Bacteria 1277
381 Ga0501032_0209644 3300049569 Bacteria 1270
382 Ga0501032_0309493 3300049569 Bacteria 1020
383 Ga0501033_0388246 3300049570 Bacteria 975
384 Ga0501034_0058933 3300049571 Bacteria 3857
385 Ga0501034_0276247 3300049571 Bacteria 1620
386 Ga0501036_0038878 3300049572 Bacteria 4028
387 Ga0501037_0024266 3300049573 Bacteria 4485
388 Ga0501038_0021047 3300049574 Bacteria 5860
389 Ga0501039_0333758 3300049575 Bacteria 1191
390 Ga0501043_0389377 3300049579 Bacteria 1054
391 Ga0501047_0106843 3300049581 Bacteria 2680
392 Ga0501068_0117177 3300049584 Bacteria 1659
393 Ga0501083_0113981 3300049744 Bacteria 1775
394 nmdc:mga03683_29598_c1 3300050489 Bacteria 2184
395 nmdc:mga0yw44_26746_c1 3300050492 Bacteria 3299
396 nmdc:mga0k408_3620_c1 3300050493 Bacteria 8176
397 nmdc:mga07m45_151872_c1 3300050496 Bacteria 1343
398 nmdc:mga0sz30_13640_c2 3300050516 Bacteria 2765
399 nmdc:mga0sz30_27456_c2 3300050516 Bacteria 1716
400 Ga0500610_0016247 3300053079 Bacteria 3543
401 Ga0500651_0067910 3300053093 Bacteria 2220
402 Ga0500569_090103 3300053109 Bacteria 992
403 Ga0500594_0002605 3300053118 Bacteria 3917
404 Ga0500608_093386 3300053122 Bacteria 1403
405 Ga0500628_055560 3300053129 Bacteria 953
406 Ga0500658_0000162 3300053134 Bacteria 32065
407 Ga0500568_0003670 3300053139 Bacteria 8439
408 Ga0500568_0014422 3300053139 Bacteria 3569
409 Ga0500616_0001852 3300053153 Bacteria 19135
410 Ga0500616_0013425 3300053153 Bacteria 4755
411 Ga0500622_0003885 3300053156 Bacteria 9687
412 Ga0500633_0013077 3300053160 Bacteria 2314
413 Ga0500596_018233 3300053735 Bacteria 1053
414 Ga0500599_004611 3300053736 Bacteria 1708
415 Ga0501082_0038884 3300060353 Bacteria 4104
416 Ga0501082_0208096 3300060353 Bacteria 1702
417 Ga0466962_0058180 3300061719 Bacteria 1845

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2921201388 2921206722 172
2 3300049523 Ga0501300_011702 Ga0501300_011702_167_775 180
3 3300031456 Ga0307513_10015448 Ga0307513_100154489 188
4 iso_pu_bacteria 2615840698 2616556464 188
5 3300046524 Ga0495648_0372392 Ga0495648_0372392_10_579 189
6 3300048928 Ga0496125_0193720 Ga0496125_0193720_757_1329 190
7 iso_pu_bacteria 2513237138 2513866919 194
8 iso_pu_bacteria 3003930520 3003933362 194
9 iso_pu_bacteria 2509276033 2509442364 195
10 iso_pu_bacteria 2510065019 2510133170 195
11 iso_pu_bacteria 2513237084 2513572215 195
12 iso_pu_bacteria 2513237085 2513579585 195
13 iso_pu_bacteria 2513237093 2513634358 195
14 iso_pu_bacteria 2513237103 2513708866 195
15 iso_pu_bacteria 2515075009 2515112132 195
16 iso_pu_bacteria 2515154134 2515738720 195
17 iso_pu_bacteria 2516653085 2517076255 195
18 iso_pu_bacteria 2517093000 2517095012 195
19 iso_pu_bacteria 2529292951 2530645390 195
20 iso_pu_bacteria 2585427526 2585529833 195
21 iso_pu_bacteria 2718217997 2719665472 195
22 iso_pu_bacteria 2718218199 2720491892 195
23 iso_pu_bacteria 2718218232 2720613159 195
24 iso_pu_bacteria 2718218233 2720620014 195
25 iso_pu_bacteria 2718218235 2720631439 195
26 iso_pu_bacteria 2718218269 2720775167 195
27 iso_pu_bacteria 2721755556 2723026804 195
28 iso_pu_bacteria 2721755684 2723560421 195
29 iso_pu_bacteria 2721755685 2723566986 195
30 iso_pu_bacteria 2721755819 2724089774 195
31 iso_pu_bacteria 2721755822 2724104251 195
32 iso_pu_bacteria 2721755823 2724110065 195
33 iso_pu_bacteria 2724679232 2725951235 195
34 iso_pu_bacteria 2728369352 2730107740 195
35 iso_pu_bacteria 2765235942 2766063030 195
36 iso_pu_bacteria 2791355256 2793298170 195
37 iso_pu_bacteria 2791355259 2793313658 195
38 iso_pu_bacteria 2791355262 2793337205 195
39 iso_pu_bacteria 2791355263 2793341386 195
40 iso_pu_bacteria 2791355265 2793352481 195
41 iso_pu_bacteria 2791355266 2793361306 195
42 iso_pu_bacteria 2802429605 2805931079 195
43 iso_pu_bacteria 2802429606 2805938078 195
44 iso_pu_bacteria 2838016132 2838021051 195
45 iso_pu_bacteria 2838042994 2838043289 195
46 iso_pu_bacteria 2838048938 2838052563 195
47 iso_pu_bacteria 2838061910 2838066089 195
48 iso_pu_bacteria 2838068647 2838071573 195
49 iso_pu_bacteria 2838668709 2838673973 195
50 iso_pu_bacteria 2838680041 2838682366 195
51 iso_pu_bacteria 2838686498 2838689346 195
52 iso_pu_bacteria 2838694306 2838696937 195
53 iso_pu_bacteria 2838701080 2838706389 195
54 iso_pu_bacteria 2838707686 2838709822 195
55 iso_pu_bacteria 2838729681 2838730679 195
56 iso_pu_bacteria 2838742623 2838743620 195
57 iso_pu_bacteria 2841851746 2841854704 195
58 iso_pu_bacteria 2842077413 2842077996 195
59 iso_pu_bacteria 2842110456 2842110642 195
60 iso_pu_bacteria 2842118031 2842119496 195
61 iso_pu_bacteria 2842146304 2842148723 195
62 iso_pu_bacteria 2842156927 2842157567 195
63 iso_pu_bacteria 2842163707 2842164760 195
64 iso_pu_bacteria 2842180545 2842180848 195
65 iso_pu_bacteria 2842192696 2842196769 195
66 iso_pu_bacteria 2842205361 2842206192 195
67 iso_pu_bacteria 2842217011 2842217087 195
68 iso_pu_bacteria 2842229732 2842231094 195
69 iso_pu_bacteria 2842237096 2842239235 195
70 iso_pu_bacteria 2842243621 2842244799 195
71 iso_pu_bacteria 2842250916 2842256091 195
72 iso_pu_bacteria 2842257432 2842258612 195
73 iso_pu_bacteria 2842264693 2842268136 195
74 iso_pu_bacteria 2842271015 2842273366 195
75 iso_pu_bacteria 2842278818 2842279649 195
76 iso_pu_bacteria 2842285085 2842286290 195
77 iso_pu_bacteria 2842291075 2842291659 195
78 iso_pu_bacteria 2842304105 2842304143 195
79 iso_pu_bacteria 2842311132 2842313773 195
80 iso_pu_bacteria 2842317721 2842318063 195
81 iso_pu_bacteria 2842370503 2842372932 195
82 iso_pu_bacteria 2842377471 2842378055 195
83 iso_pu_bacteria 2842384541 2842386004 195
84 iso_pu_bacteria 2842402390 2842408031 195
85 iso_pu_bacteria 2842409023 2842414792 195
86 iso_pu_bacteria 2842415677 2842421325 195
87 iso_pu_bacteria 2842422224 2842424769 195
88 iso_pu_bacteria 2842428310 2842431629 195
89 iso_pu_bacteria 2842434925 2842438411 195
90 iso_pu_bacteria 2842441272 2842445041 195
91 iso_pu_bacteria 2842447887 2842452356 195
92 iso_pu_bacteria 2842462802 2842466001 195
93 iso_pu_bacteria 2842469257 2842473026 195
94 iso_pu_bacteria 2842489311 2842492972 195
95 iso_pu_bacteria 2842495871 2842496333 195
96 iso_pu_bacteria 2844454524 2844459314 195
97 iso_pu_bacteria 2857516855 2857518573 195
98 iso_pu_bacteria 2933570622 2933571422 195
99 iso_pu_bacteria 2933586486 2933586668 195
100 iso_pu_bacteria 2933599457 2933602372 195
101 iso_pu_bacteria 2935894831 2935897208 195
102 iso_pu_bacteria 2935901341 2935904593 195
103 iso_pu_bacteria 2936367885 2936372877 195
104 iso_pu_bacteria 2936375103 2936376750 195
105 iso_pu_bacteria 2936381700 2936388429 195
106 iso_pu_bacteria 639633055 639648401 195
107 iso_pu_bacteria 8005282627 8005285647 195
108 iso_pu_bacteria 8005289223 8005290745 195
109 iso_pu_bacteria 8005307578 8005314381 195
110 iso_pu_bacteria 8005376324 8005379041 195
111 iso_pu_bacteria 8005430974 8005433639 195
112 iso_pu_bacteria 8005460587 8005462792 195
113 iso_pu_bacteria 8005497431 8005500194 195
114 iso_pu_bacteria 8005556819 8005557863 195
115 iso_pu_bacteria 8005563573 8005569036 195
116 iso_pu_bacteria 8005619151 8005621485 195
117 iso_pu_bacteria 8005626139 8005631170 195
118 iso_pu_bacteria 8005668836 8005671610 195
119 iso_pu_bacteria 8018163183 8018166949 195
120 iso_pu_bacteria 8023680758 8023685541 195
121 iso_pu_bacteria 8024479707 8024482149 195
122 iso_pu_bacteria 8024501048 8024506751 195
123 iso_pu_bacteria 8056382006 8056388237 195
124 iso_pu_bacteria 2508501122 2509107906 196
125 iso_pu_bacteria 2509276019 2509375694 196
126 iso_pu_bacteria 2510917028 2511183819 196
127 iso_pu_bacteria 2510917030 2511195539 196
128 iso_pu_bacteria 2511231052 2511501336 196
129 iso_pu_bacteria 2512047086 2512532757 196
130 iso_pu_bacteria 2512875026 2512971915 196
131 iso_pu_bacteria 2513237086 2513587090 196
132 iso_pu_bacteria 2513237088 2513594463 196
133 iso_pu_bacteria 2513237089 2513606316 196
134 iso_pu_bacteria 2513237091 2513617832 196
135 iso_pu_bacteria 2513237140 2513880717 196
136 iso_pu_bacteria 2513237143 2513906736 196
137 iso_pu_bacteria 2513237156 2513986541 196
138 iso_pu_bacteria 2513237160 2514005465 196
139 iso_pu_bacteria 2515154107 2515611524 196
140 iso_pu_bacteria 2516143018 2516209211 196
141 iso_pu_bacteria 2516653046 2516892615 196
142 iso_pu_bacteria 2517487022 2517569425 196
143 iso_pu_bacteria 2524023207 2524452843 196
144 iso_pu_bacteria 2534681796 2535516348 196
145 iso_pu_bacteria 2551306084 2551682248 196
146 iso_pu_bacteria 2551306085 2551683761 196
147 iso_pu_bacteria 2551306086 2551690590 196
148 iso_pu_bacteria 2551306087 2551704812 196
149 iso_pu_bacteria 2551306089 2551709638 196
150 iso_pu_bacteria 2551306090 2551719580 196
151 iso_pu_bacteria 2551306091 2551728027 196
152 iso_pu_bacteria 2551306091 2551728069 196
153 iso_pu_bacteria 2551306092 2551733764 196
154 iso_pu_bacteria 2551306093 2551745859 196
155 iso_pu_bacteria 2558860100 2558863163 196
156 iso_pu_bacteria 2582581294 2585200035 196
157 iso_pu_bacteria 2582581298 2585224214 196
158 iso_pu_bacteria 2582581299 2585230192 196
159 iso_pu_bacteria 2582581304 2585254582 196
160 iso_pu_bacteria 2582581867 2585403534 196
161 iso_pu_bacteria 2585427529 2585546335 196
162 iso_pu_bacteria 2585427590 2585819498 196
163 iso_pu_bacteria 2585427594 2585845887 196
164 iso_pu_bacteria 2599185352 2600192275 196
165 iso_pu_bacteria 2643221557 2643808356 196
166 iso_pu_bacteria 2643221599 2644005794 196
167 iso_pu_bacteria 2643221610 2644066550 196
168 iso_pu_bacteria 2643221618 2644109579 196
169 iso_pu_bacteria 2643221626 2644145263 196
170 iso_pu_bacteria 2643221634 2644193021 196
171 iso_pu_bacteria 2643221637 2644207646 196
172 iso_pu_bacteria 2643221643 2644239451 196
173 iso_pu_bacteria 2643221655 2644310968 196
174 iso_pu_bacteria 2643221659 2644332620 196
175 iso_pu_bacteria 2643221668 2644378139 196
176 iso_pu_bacteria 2643221675 2644415237 196
177 iso_pu_bacteria 2643221680 2644450362 196
178 iso_pu_bacteria 2643221698 2644544366 196
179 iso_pu_bacteria 2643221712 2644613934 196
180 iso_pu_bacteria 2643221718 2644654547 196
181 iso_pu_bacteria 2643221723 2644677853 196
182 iso_pu_bacteria 2643221726 2644687914 196
183 iso_pu_bacteria 2657244999 2657683741 196
184 iso_pu_bacteria 2690316117 2692316470 196
185 iso_pu_bacteria 2738541293 2738799037 196
186 iso_pu_bacteria 2791355091 2792623239 196
187 iso_pu_bacteria 2791355092 2792627003 196
188 iso_pu_bacteria 2791355094 2792642460 196
189 iso_pu_bacteria 2802428858 2802718910 196
190 iso_pu_bacteria 2802428859 2802726520 196
191 iso_pu_bacteria 2802428860 2802733813 196
192 iso_pu_bacteria 2802428861 2802738419 196
193 iso_pu_bacteria 2802428862 2802744752 196
194 iso_pu_bacteria 2802428863 2802751042 196
195 iso_pu_bacteria 2802429268 2804751822 196
196 iso_pu_bacteria 2838074704 2838079286 196
197 iso_pu_bacteria 2844163670 2844170457 196
198 iso_pu_bacteria 2847417321 2847418464 196
199 iso_pu_bacteria 2848992105 2848993442 196
200 iso_pu_bacteria 2850079185 2850080764 196
201 iso_pu_bacteria 2855825444 2855831685 196
202 iso_pu_bacteria 2855839649 2855840804 196
203 iso_pu_bacteria 2855872281 2855873373 196
204 iso_pu_bacteria 2858800743 2858801328 196
205 iso_pu_bacteria 2896384573 2896386954 196
206 iso_pu_bacteria 2913295892 2913300370 196
207 iso_pu_bacteria 2915980308 2915985168 196
208 iso_pu_bacteria 2915986958 2915987662 196
209 iso_pu_bacteria 2915993759 2915997448 196
210 iso_pu_bacteria 2916000859 2916006398 196
211 iso_pu_bacteria 2916007675 2916012188 196
212 iso_pu_bacteria 2916014648 2916021014 196
213 iso_pu_bacteria 2916021584 2916025940 196
214 iso_pu_bacteria 2916028427 2916034712 196
215 iso_pu_bacteria 2916035215 2916041823 196
216 iso_pu_bacteria 2916041962 2916046267 196
217 iso_pu_bacteria 2916048683 2916051105 196
218 iso_pu_bacteria 2916055098 2916061069 196
219 iso_pu_bacteria 2916061851 2916066167 196
220 iso_pu_bacteria 2916076590 2916081332 196
221 iso_pu_bacteria 2919100787 2919106935 196
222 iso_pu_bacteria 2920822456 2920824164 196
223 iso_pu_bacteria 2921208531 2921209670 196
224 iso_pu_bacteria 2921237296 2921243491 196
225 iso_pu_bacteria 2921244191 2921249493 196
226 iso_pu_bacteria 2921250672 2921253075 196
227 iso_pu_bacteria 2921257292 2921262675 196
228 iso_pu_bacteria 2921263974 2921270320 196
229 iso_pu_bacteria 2921282425 2921288433 196
230 iso_pu_bacteria 2921289301 2921293530 196
231 iso_pu_bacteria 2921296804 2921304518 196
232 iso_pu_bacteria 2923556063 2923557786 196
233 iso_pu_bacteria 2924144063 2924147557 196
234 iso_pu_bacteria 2924150972 2924157073 196
235 iso_pu_bacteria 2924158325 2924165110 196
236 iso_pu_bacteria 2924165586 2924171930 196
237 iso_pu_bacteria 2924172951 2924179269 196
238 iso_pu_bacteria 2924179722 2924183872 196
239 iso_pu_bacteria 2924186466 2924192596 196
240 iso_pu_bacteria 2924193448 2924197879 196
241 iso_pu_bacteria 2924200457 2924205881 196
242 iso_pu_bacteria 2924207177 2924211575 196
243 iso_pu_bacteria 2924214083 2924217821 196
244 iso_pu_bacteria 2924221636 2924228269 196
245 iso_pu_bacteria 2924228884 2924234248 196
246 iso_pu_bacteria 2936996657 2936997696 196
247 iso_pu_bacteria 2937002841 2937007293 196
248 iso_pu_bacteria 2937009748 2937012401 196
249 iso_pu_bacteria 2937016420 2937021994 196
250 iso_pu_bacteria 2937029754 2937031143 196
251 iso_pu_bacteria 2937036028 2937040485 196
252 iso_pu_bacteria 2937042894 2937049410 196
253 iso_pu_bacteria 2937049772 2937056195 196
254 iso_pu_bacteria 2937056579 2937059698 196
255 iso_pu_bacteria 2937063883 2937064508 196
256 iso_pu_bacteria 2937071275 2937077487 196
257 iso_pu_bacteria 2937078374 2937079938 196
258 iso_pu_bacteria 2937084907 2937085989 196
259 iso_pu_bacteria 2937091812 2937097948 196
260 iso_pu_bacteria 2937098957 2937105109 196
261 iso_pu_bacteria 2937106411 2937107701 196
262 iso_pu_bacteria 2937113482 2937117243 196
263 iso_pu_bacteria 2937119839 2937124865 196
264 iso_pu_bacteria 2937126314 2937130418 196
265 iso_pu_bacteria 2941499720 2941499884 196
266 iso_pu_bacteria 2957375807 2957379750 196
267 iso_pu_bacteria 2957382221 2957387638 196
268 iso_pu_bacteria 2957388812 2957393457 196
269 iso_pu_bacteria 2957402308 2957408789 196
270 iso_pu_bacteria 2957408893 2957412600 196
271 iso_pu_bacteria 2957415311 2957415798 196
272 iso_pu_bacteria 2957422303 2957428819 196
273 iso_pu_bacteria 2957430029 2957436258 196
274 iso_pu_bacteria 2957437181 2957438143 196
275 iso_pu_bacteria 2957443900 2957449299 196
276 iso_pu_bacteria 2957450854 2957456660 196
277 iso_pu_bacteria 2957457609 2957463802 196
278 iso_pu_bacteria 2957464669 2957469173 196
279 iso_pu_bacteria 2957471148 2957477019 196
280 iso_pu_bacteria 2957478035 2957484005 196
281 iso_pu_bacteria 2957484790 2957490595 196
282 iso_pu_bacteria 2957491536 2957494993 196
283 iso_pu_bacteria 2957498199 2957504300 196
284 iso_pu_bacteria 2957505466 2957512087 196
285 iso_pu_bacteria 2960584000 2960590555 196
286 iso_pu_bacteria 2960591022 2960596103 196
287 iso_pu_bacteria 2960597568 2960601873 196
288 iso_pu_bacteria 2960603979 2960610080 196
289 iso_pu_bacteria 2960617483 2960621934 196
290 iso_pu_bacteria 2960624210 2960628839 196
291 iso_pu_bacteria 2960631154 2960634667 196
292 iso_pu_bacteria 2960637947 2960644364 196
293 iso_pu_bacteria 2960645483 2960645899 196
294 iso_pu_bacteria 2960652885 2960658965 196
295 iso_pu_bacteria 2960660292 2960665173 196
296 iso_pu_bacteria 2960667422 2960672661 196
297 iso_pu_bacteria 2960674078 2960679381 196
298 iso_pu_bacteria 2960680706 2960685115 196
299 iso_pu_bacteria 2960693952 2960698519 196
300 iso_pu_bacteria 2964607997 2964609847 196
301 iso_pu_bacteria 2964621998 2964622809 196
302 iso_pu_bacteria 2964628898 2964634431 196
303 iso_pu_bacteria 2964636051 2964636881 196
304 iso_pu_bacteria 2964643177 2964648617 196
305 iso_pu_bacteria 2964649959 2964654379 196
306 iso_pu_bacteria 2964656573 2964660244 196
307 iso_pu_bacteria 2964663802 2964666216 196
308 iso_pu_bacteria 2964678106 2964684165 196
309 iso_pu_bacteria 2964685014 2964691068 196
310 iso_pu_bacteria 2964691889 2964696385 196
311 iso_pu_bacteria 2964698721 2964699522 196
312 iso_pu_bacteria 2964705432 2964711703 196
313 iso_pu_bacteria 2964712639 2964717882 196
314 iso_pu_bacteria 2964719344 2964725929 196
315 iso_pu_bacteria 2967664464 2967668604 196
316 iso_pu_bacteria 2967671571 2967677831 196
317 iso_pu_bacteria 2967678726 2967683689 196
318 iso_pu_bacteria 2967686174 2967688791 196
319 iso_pu_bacteria 2967693043 2967698617 196
320 iso_pu_bacteria 2967699805 2967703448 196
321 iso_pu_bacteria 2967706974 2967707963 196
322 iso_pu_bacteria 2967714385 2967719070 196
323 iso_pu_bacteria 2967721400 2967726313 196
324 iso_pu_bacteria 2967728569 2967733050 196
325 iso_pu_bacteria 2967735183 2967740327 196
326 iso_pu_bacteria 2967742019 2967746687 196
327 iso_pu_bacteria 2967748971 2967753411 196
328 iso_pu_bacteria 2967762386 2967767421 196
329 iso_pu_bacteria 2967769361 2967772947 196
330 iso_pu_bacteria 2967775926 2967776495 196
331 iso_pu_bacteria 2970019648 2970024920 196
332 iso_pu_bacteria 2970026789 2970031553 196
333 iso_pu_bacteria 2970033650 2970040368 196
334 iso_pu_bacteria 2970040964 2970045347 196
335 iso_pu_bacteria 2970047711 2970054160 196
336 iso_pu_bacteria 2970054988 2970059468 196
337 iso_pu_bacteria 2970061556 2970065593 196
338 iso_pu_bacteria 2970068827 2970075012 196
339 iso_pu_bacteria 2970076120 2970081438 196
340 iso_pu_bacteria 2970082768 2970087937 196
341 iso_pu_bacteria 2970088815 2970094583 196
342 iso_pu_bacteria 2970095765 2970096563 196
343 iso_pu_bacteria 2970109326 2970112213 196
344 iso_pu_bacteria 2970116247 2970120408 196
345 iso_pu_bacteria 2970122695 2970127085 196
346 iso_pu_bacteria 2970129317 2970133356 196
347 iso_pu_bacteria 2970136068 2970136716 196
348 iso_pu_bacteria 2970143518 2970147782 196
349 iso_pu_bacteria 2970149975 2970155376 196
350 iso_pu_bacteria 2970156795 2970163185 196
351 iso_pu_bacteria 2970164137 2970168154 196
352 iso_pu_bacteria 2970170962 2970174796 196
353 iso_pu_bacteria 2970177841 2970181761 196
354 iso_pu_bacteria 2970184632 2970187976 196
355 iso_pu_bacteria 2970191845 2970197824 196
356 iso_pu_bacteria 2977523885 2977529526 196
357 iso_pu_bacteria 2977530762 2977533801 196
358 iso_pu_bacteria 2977537788 2977542183 196
359 iso_pu_bacteria 2977544691 2977547267 196
360 iso_pu_bacteria 2977551784 2977557439 196
361 iso_pu_bacteria 2977558990 2977564994 196
362 iso_pu_bacteria 2977565890 2977570384 196
363 iso_pu_bacteria 2977572785 2977575481 196
364 iso_pu_bacteria 2977579622 2977584152 196
365 iso_pu_bacteria 2996887358 2996889985 196
366 iso_pu_bacteria 3005445848 3005447374 196
367 iso_pu_bacteria 3005452660 3005454025 196
368 iso_pu_bacteria 643692032 643825470 196
369 iso_pu_bacteria 648276728 648740102 196
370 iso_pu_bacteria 8003992118 8003993303 196
371 iso_pu_bacteria 8003999396 8004000556 196
372 iso_pu_bacteria 8005258706 8005261705 196
373 iso_pu_bacteria 8005321885 8005324512 196
374 iso_pu_bacteria 8005542996 8005544998 196
375 iso_pu_bacteria 2509276021 2509386818 197
376 iso_pu_bacteria 2510065057 2510307019 197
377 iso_pu_bacteria 2510461076 2510894537 197
378 iso_pu_bacteria 2513237144 2513914002 197
379 iso_pu_bacteria 2513237146 2513926716 197
380 iso_pu_bacteria 2513237162 2514022794 197
381 iso_pu_bacteria 2515154113 2515635600 197
382 iso_pu_bacteria 2515154114 2515646201 197
383 iso_pu_bacteria 2515154116 2515657276 197
384 iso_pu_bacteria 2516653077 2517035867 197
385 iso_pu_bacteria 2517287029 2517406644 197
386 iso_pu_bacteria 2519899620 2520379381 197
387 iso_pu_bacteria 2582581308 2585277072 197
388 iso_pu_bacteria 2582581315 2585323920 197
389 iso_pu_bacteria 2582581316 2585333730 197
390 iso_pu_bacteria 2585427527 2585534190 197
391 iso_pu_bacteria 2585427528 2585542317 197
392 iso_pu_bacteria 2585427530 2585551957 197
393 iso_pu_bacteria 2585427593 2585838808 197
394 iso_pu_bacteria 2599185170 2599417857 197
395 iso_pu_bacteria 2615840624 2616292600 197
396 iso_pu_bacteria 2615840626 2616308448 197
397 iso_pu_bacteria 2617270742 2617385092 197
398 iso_pu_bacteria 2643221653 2644300374 197
399 iso_pu_bacteria 2643221719 2644658598 197
400 iso_pu_bacteria 2667528174 2671116428 197
401 iso_pu_bacteria 2718217882 2719181039 197
402 iso_pu_bacteria 2718217927 2719385651 197
403 iso_pu_bacteria 2718218009 2719731788 197
404 iso_pu_bacteria 2718218363 2721147133 197
405 iso_pu_bacteria 2718218365 2721158667 197
406 iso_pu_bacteria 2718218366 2721164051 197
407 iso_pu_bacteria 2718218423 2721399433 197
408 iso_pu_bacteria 2721755514 2722840221 197
409 iso_pu_bacteria 2721755809 2724038246 197
410 iso_pu_bacteria 2721755810 2724044544 197
411 iso_pu_bacteria 2728369365 2730164276 197
412 iso_pu_bacteria 2728369397 2730298299 197
413 iso_pu_bacteria 2738541317 2738945457 197
414 iso_pu_bacteria 2738541333 2739038095 197
415 iso_pu_bacteria 2775507266 2778177789 197
416 iso_pu_bacteria 2791355082 2792581233 197
417 iso_pu_bacteria 2791355253 2793279434 197
418 iso_pu_bacteria 2791355260 2793322171 197
419 iso_pu_bacteria 2791355261 2793326535 197
420 iso_pu_bacteria 2791355264 2793350489 197
421 iso_pu_bacteria 2791355267 2793369573 197
422 iso_pu_bacteria 2802429633 2806047907 197
423 iso_pu_bacteria 2802429634 2806056342 197
424 iso_pu_bacteria 2802429635 2806061589 197
425 iso_pu_bacteria 2802429636 2806070136 197
426 iso_pu_bacteria 2802429637 2806072513 197
427 iso_pu_bacteria 2818991272 2819242007 197
428 iso_pu_bacteria 2818991448 2819612859 197
429 iso_pu_bacteria 2818991453 2819638038 197
430 iso_pu_bacteria 2838022645 2838027994 197
431 iso_pu_bacteria 2838029111 2838030225 197
432 iso_pu_bacteria 2838035591 2838041635 197
433 iso_pu_bacteria 2838661181 2838666362 197
434 iso_pu_bacteria 2841864319 2841864700 197
435 iso_pu_bacteria 2842198810 2842203888 197
436 iso_pu_bacteria 2842341865 2842345978 197
437 iso_pu_bacteria 2842363717 2842364395 197
438 iso_pu_bacteria 2842395702 2842397521 197
439 iso_pu_bacteria 2842475841 2842476490 197
440 iso_pu_bacteria 2842482326 2842488404 197
441 iso_pu_bacteria 2842502639 2842503753 197
442 iso_pu_bacteria 2842509118 2842510323 197
443 iso_pu_bacteria 2852387548 2852389761 197
444 iso_pu_bacteria 2913308742 2913310163 197
445 iso_pu_bacteria 2919408235 2919411820 197
446 iso_pu_bacteria 2937023124 2937028245 197
447 iso_pu_bacteria 2957395598 2957400945 197
448 iso_pu_bacteria 2960610863 2960615010 197
449 iso_pu_bacteria 2960687367 2960693216 197
450 iso_pu_bacteria 2964615318 2964619486 197
451 iso_pu_bacteria 2967755722 2967761114 197
452 iso_pu_bacteria 2970102677 2970107226 197
453 iso_pu_bacteria 2977516862 2977520691 197
454 iso_pu_bacteria 2989771324 2989773674 197
455 iso_pu_bacteria 2996893221 2996898285 197
456 iso_pu_bacteria 3005409236 3005415288 197
457 iso_pu_bacteria 8005246636 8005250709 197
458 iso_pu_bacteria 8005275841 8005280426 197
459 iso_pu_bacteria 8005301065 8005302296 197
460 iso_pu_bacteria 8005382845 8005388191 197
461 iso_pu_bacteria 8005395548 8005397283 197
462 iso_pu_bacteria 8005484373 8005485016 197
463 iso_pu_bacteria 8005570704 8005572175 197
464 iso_pu_bacteria 8005645114 8005648753 197
465 iso_pu_bacteria 8005682033 8005683323 197
466 iso_pu_bacteria 8005688590 8005689869 197
467 iso_pu_bacteria 8005695170 8005700171 197
468 iso_pu_bacteria 8018127388 8018129770 197
469 iso_pu_bacteria 8018176218 8018179982 197
470 iso_pu_bacteria 8046767195 8046769436 197
471 iso_pu_bacteria 8049293176 8049294356 197
472 iso_pu_bacteria 8057575449 8057578897 197
473 iso_pu_bacteria 8057874678 8057875213 197
474 3300002737 JGI25162J39368_1000977 JGI25162J39368_10009779 198
475 3300003214 JGI25165J46597_1001138 JGI25165J46597_10011389 198
476 3300025207 Ga0209760_103376 Ga0209760_1033762 198
477 3300025233 Ga0209437_100122 Ga0209437_10012239 198
478 3300025261 Ga0209233_1000170 Ga0209233_100017039 198
479 iso_pu_bacteria 2837678835 2837680292 198
480 iso_pu_bacteria 3005416602 3005420233 198
481 iso_pu_bacteria 8005314921 8005317184 198
482 iso_pu_bacteria 8056375014 8056377283 198
483 3300003215 JGI25153J46596_10021049 JGI25153J46596_100210491 199
484 3300003790 Ga0055528_1026843 Ga0055528_10268432 199
485 3300009765 Ga0123341_1000039 Ga0123341_100003956 199
486 3300025273 Ga0209673_1005205 Ga0209673_10052056 199
487 3300025295 Ga0209564_1036501 Ga0209564_10365012 199
488 3300025297 Ga0209758_1002711 Ga0209758_10027112 199
489 3300025297 Ga0209758_1061094 Ga0209758_10610942 199
490 3300025303 Ga0209051_1076337 Ga0209051_10763371 199
491 3300028794 Ga0307515_10112818 Ga0307515_101128182 199
492 3300041413 Ga0439465_0010775 Ga0439465_0010775_2008_2616 199
493 3300041509 Ga0451843_1456656 Ga0451843_1456656_456_1058 199
494 3300041512 Ga0451853_0414289 Ga0451853_0414289_86_697 199
495 3300042007 Ga0439449_0077718 Ga0439449_0077718_192_800 199
496 3300042015 Ga0439462_0047745 Ga0439462_0047745_50_658 199
497 3300046457 Ga0495590_0203634 Ga0495590_0203634_43_642 199
498 3300046474 Ga0495605_0018994 Ga0495605_0018994_556_1167 199
499 3300046501 Ga0495607_0052723 Ga0495607_0052723_1486_2097 199
500 3300046512 Ga0495610_0008396 Ga0495610_0008396_2464_3075 199
501 3300046515 Ga0495620_0006074 Ga0495620_0006074_4739_5350 199
502 3300046518 Ga0495631_0066295 Ga0495631_0066295_897_1508 199
503 3300046519 Ga0495632_0010335 Ga0495632_0010335_274_885 199
504 3300046522 Ga0495643_0005194 Ga0495643_0005194_5256_5867 199
505 3300046542 Ga0495597_0006547 Ga0495597_0006547_2873_3484 199
506 3300046616 Ga0495668_0049021 Ga0495668_0049021_1561_2172 199
507 3300046660 Ga0495625_0014047 Ga0495625_0014047_589_1200 199
508 3300046665 Ga0495661_0184332 Ga0495661_0184332_394_1005 199
509 3300046810 Ga0495660_0009520 Ga0495660_0009520_4694_5305 199
510 3300047447 Ga0495685_017831 Ga0495685_017831_1770_2381 199
511 3300049459 Ga0495678_098012 Ga0495678_098012_109_720 199
512 3300053093 Ga0500651_0067910 Ga0500651_0067910_1222_1833 199
513 3300053134 Ga0500658_0000162 Ga0500658_0000162_18831_19442 199
514 3300053153 Ga0500616_0013425 Ga0500616_0013425_2237_2848 199
515 3300002739 JGI25158J39367_1000033 JGI25158J39367_10000337 200
516 3300002739 JGI25158J39367_1007156 JGI25158J39367_10071562 200
517 3300002773 JGI25152J39213_1000526 JGI25152J39213_100052622 200
518 3300002773 JGI25152J39213_1001062 JGI25152J39213_10010625 200
519 3300002773 JGI25152J39213_1005549 JGI25152J39213_10055493 200
520 3300002774 JGI25150J39212_1000010 JGI25150J39212_1000010135 200
521 3300002774 JGI25150J39212_1003412 JGI25150J39212_10034124 200
522 3300002987 JGI25159J45721_1000006 JGI25159J45721_100000634 200
523 3300002987 JGI25159J45721_1000462 JGI25159J45721_100046215 200
524 3300003187 JGI25151J46595_10000026 JGI25151J46595_10000026115 200
525 3300003187 JGI25151J46595_10013494 JGI25151J46595_100134943 200
526 3300003215 JGI25153J46596_10005007 JGI25153J46596_100050075 200
527 3300003215 JGI25153J46596_10008801 JGI25153J46596_100088015 200
528 3300003354 JGI25160J50197_1000019 JGI25160J50197_100001939 200
529 3300003374 JGI25161J50226_1000157 JGI25161J50226_100015722 200
530 3300003374 JGI25161J50226_1000226 JGI25161J50226_10002265 200
531 3300003771 Ga0055526_1001814 Ga0055526_10018147 200
532 3300003771 Ga0055526_1002481 Ga0055526_100248110 200
533 3300003771 Ga0055526_1007431 Ga0055526_10074315 200
534 3300003775 Ga0055524_1001008 Ga0055524_10010083 200
535 3300003775 Ga0055524_1001365 Ga0055524_10013651 200
536 3300003775 Ga0055524_1039470 Ga0055524_10394702 200
537 3300003781 Ga0055536_1000916 Ga0055536_100091618 200
538 3300003790 Ga0055528_1006848 Ga0055528_10068483 200
539 3300003790 Ga0055528_1013468 Ga0055528_10134682 200
540 3300003791 Ga0055530_10046990 Ga0055530_100469902 200
541 3300003792 Ga0055540_1017733 Ga0055540_10177333 200
542 3300003794 Ga0055531_10012280 Ga0055531_100122802 200
543 3300004625 Ga0055543_1000032 Ga0055543_100003224 200
544 3300004625 Ga0055543_1000145 Ga0055543_100014533 200
545 3300005262 Ga0065165_1000180 Ga0065165_100018039 200
546 3300005262 Ga0065165_1007755 Ga0065165_10077553 200
547 3300005331 Ga0070670_100000603 Ga0070670_10000060323 200
548 3300005455 Ga0070663_100098408 Ga0070663_1000984082 200
549 3300005457 Ga0070662_100659350 Ga0070662_1006593502 200
550 3300005937 Ga0081455_10177247 Ga0081455_101772473 200
551 3300006178 Ga0075367_10097547 Ga0075367_100975472 200
552 3300006186 Ga0075369_10078680 Ga0075369_100786801 200
553 3300006186 Ga0075369_10085771 Ga0075369_100857712 200
554 3300006353 Ga0075370_10266786 Ga0075370_102667862 200
555 3300006946 Ga0079104_1002527 Ga0079104_10025278 200
556 3300006946 Ga0079104_1004857 Ga0079104_10048574 200
557 3300009766 Ga0123342_1012308 Ga0123342_10123085 200
558 3300013100 Ga0157373_10260299 Ga0157373_102602992 200
559 3300013100 Ga0157373_10744589 Ga0157373_107445891 200
560 3300015690 Ga0183363_1120 Ga0183363_11207 200
561 3300021320 Ga0214544_1000265 Ga0214544_100026556 200
562 3300021321 Ga0214542_1000015 Ga0214542_1000015217 200
563 3300021327 Ga0214543_1000032 Ga0214543_1000032107 200
564 3300022739 Ga0228711_1000012 Ga0228711_100001237 200
565 3300022740 Ga0228710_1000006 Ga0228710_100000637 200
566 3300025208 Ga0209436_100001 Ga0209436_10000165 200
567 3300025208 Ga0209436_101098 Ga0209436_1010984 200
568 3300025245 Ga0207425_1000010 Ga0207425_1000010463 200
569 3300025245 Ga0207425_1003220 Ga0207425_10032202 200
570 3300025245 Ga0207425_1027605 Ga0207425_10276052 200
571 3300025258 Ga0209129_1000099 Ga0209129_100009939 200
572 3300025258 Ga0209129_1001982 Ga0209129_10019822 200
573 3300025258 Ga0209129_1005696 Ga0209129_10056962 200
574 3300025258 Ga0209129_1006832 Ga0209129_10068322 200
575 3300025258 Ga0209129_1007627 Ga0209129_10076272 200
576 3300025258 Ga0209129_1008900 Ga0209129_10089001 200
577 3300025263 Ga0209565_1036308 Ga0209565_10363082 200
578 3300025273 Ga0209673_1001787 Ga0209673_100178713 200
579 3300025273 Ga0209673_1020114 Ga0209673_10201141 200
580 3300025273 Ga0209673_1033118 Ga0209673_10331182 200
581 3300025273 Ga0209673_1068942 Ga0209673_10689422 200
582 3300025284 Ga0209130_1000004 Ga0209130_100000447 200
583 3300025284 Ga0209130_1000007 Ga0209130_1000007395 200
584 3300025292 Ga0209676_1000399 Ga0209676_100039957 200
585 3300025294 Ga0209025_1000022 Ga0209025_1000022120 200
586 3300025294 Ga0209025_1000870 Ga0209025_100087017 200
587 3300025294 Ga0209025_1008926 Ga0209025_10089265 200
588 3300025294 Ga0209025_1013468 Ga0209025_10134685 200
589 3300025294 Ga0209025_1022965 Ga0209025_10229654 200
590 3300025294 Ga0209025_1036227 Ga0209025_10362272 200
591 3300025294 Ga0209025_1068290 Ga0209025_10682902 200
592 3300025295 Ga0209564_1000140 Ga0209564_1000140103 200
593 3300025295 Ga0209564_1000566 Ga0209564_100056654 200
594 3300025295 Ga0209564_1012010 Ga0209564_10120103 200
595 3300025297 Ga0209758_1000086 Ga0209758_1000086139 200
596 3300025297 Ga0209758_1000977 Ga0209758_10009773 200
597 3300025297 Ga0209758_1001420 Ga0209758_10014205 200
598 3300025297 Ga0209758_1003834 Ga0209758_10038345 200
599 3300025297 Ga0209758_1030923 Ga0209758_10309232 200
600 3300025298 Ga0209050_1000906 Ga0209050_100090634 200
601 3300025299 Ga0209256_1000606 Ga0209256_100060620 200
602 3300025299 Ga0209256_1004303 Ga0209256_10043039 200
603 3300025299 Ga0209256_1016997 Ga0209256_10169971 200
604 3300025299 Ga0209256_1019602 Ga0209256_10196021 200
605 3300025302 Ga0207426_1000003 Ga0207426_1000003681 200
606 3300025302 Ga0207426_1000111 Ga0207426_100011136 200
607 3300025302 Ga0207426_1000868 Ga0207426_100086821 200
608 3300025303 Ga0209051_1002127 Ga0209051_100212710 200
609 3300025304 Ga0209257_1006108 Ga0209257_10061086 200
610 3300025304 Ga0209257_1018221 Ga0209257_10182212 200
611 3300025923 Ga0207681_10033987 Ga0207681_100339874 200
612 3300025925 Ga0207650_10025395 Ga0207650_100253954 200
613 3300025986 Ga0207658_10395454 Ga0207658_103954542 200
614 3300026067 Ga0207678_10219106 Ga0207678_102191062 200
615 3300026067 Ga0207678_10430203 Ga0207678_104302032 200
616 3300027111 Ga0209281_1000334 Ga0209281_100033436 200
617 3300027111 Ga0209281_1000361 Ga0209281_100036138 200
618 3300027666 Ga0209282_1000073 Ga0209282_100007336 200
619 3300031731 Ga0307405_10009269 Ga0307405_100092694 200
620 3300031911 Ga0307412_10038376 Ga0307412_100383762 200
621 3300031967 Ga0315914_1000008 Ga0315914_100000837 200
622 3300033430 Ga0315913_1000129 Ga0315913_100012937 200
623 3300033464 Ga0315915_1000014 Ga0315915_1000014139 200
624 3300041413 Ga0439465_0003130 Ga0439465_0003130_1873_2475 200
625 3300041413 Ga0439465_0131559 Ga0439465_0131559_250_852 200
626 3300041413 Ga0439465_0174672 Ga0439465_0174672_14_616 200
627 3300041511 Ga0451855_0701931 Ga0451855_0701931_230_838 200
628 3300042007 Ga0439449_0012904 Ga0439449_0012904_902_1504 200
629 3300046455 Ga0495603_0217645 Ga0495603_0217645_128_730 200
630 3300046460 Ga0495638_0000597 Ga0495638_0000597_30406_31008 200
631 3300046474 Ga0495605_0001403 Ga0495605_0001403_9599_10201 200
632 3300046492 Ga0495585_0012266 Ga0495585_0012266_1894_2496 200
633 3300046492 Ga0495585_0028431 Ga0495585_0028431_1856_2458 200
634 3300046501 Ga0495607_0236042 Ga0495607_0236042_115_717 200
635 3300046506 Ga0495583_0006095 Ga0495583_0006095_2264_2866 200
636 3300046506 Ga0495583_0019195 Ga0495583_0019195_1235_1837 200
637 3300046512 Ga0495610_0001402 Ga0495610_0001402_18589_19191 200
638 3300046512 Ga0495610_0236101 Ga0495610_0236101_116_718 200
639 3300046518 Ga0495631_0007830 Ga0495631_0007830_3555_4157 200
640 3300046519 Ga0495632_0026522 Ga0495632_0026522_691_1293 200
641 3300046522 Ga0495643_0014395 Ga0495643_0014395_26_628 200
642 3300046542 Ga0495597_0182396 Ga0495597_0182396_171_773 200
643 3300046615 Ga0495656_0019956 Ga0495656_0019956_1402_2004 200
644 3300046616 Ga0495668_0010903 Ga0495668_0010903_2422_3024 200
645 3300046616 Ga0495668_0059345 Ga0495668_0059345_397_999 200
646 3300046648 Ga0495611_0046373 Ga0495611_0046373_365_967 200
647 3300046660 Ga0495625_0008243 Ga0495625_0008243_3085_3687 200
648 3300046660 Ga0495625_0045535 Ga0495625_0045535_2032_2634 200
649 3300046660 Ga0495625_0434895 Ga0495625_0434895_199_801 200
650 3300046660 Ga0495625_0537736 Ga0495625_0537736_29_631 200
651 3300046674 Ga0495588_0206643 Ga0495588_0206643_390_992 200
652 3300046674 Ga0495588_0371266 Ga0495588_0371266_133_735 200
653 3300046691 Ga0495670_0022749 Ga0495670_0022749_939_1541 200
654 3300046794 Ga0495589_0082605 Ga0495589_0082605_866_1468 200
655 3300046810 Ga0495660_0070275 Ga0495660_0070275_993_1595 200
656 3300047320 Ga0495672_0016542 Ga0495672_0016542_60_662 200
657 3300047443 Ga0495687_028055 Ga0495687_028055_1175_1777 200
658 3300047469 Ga0495673_0079874 Ga0495673_0079874_104_706 200
659 3300047469 Ga0495673_0143798 Ga0495673_0143798_161_763 200
660 3300047472 Ga0495686_0037677 Ga0495686_0037677_331_933 200
661 3300048904 Ga0496101_0076491 Ga0496101_0076491_1409_2011 200
662 3300048909 Ga0496106_0005616 Ga0496106_0005616_5255_5857 200
663 3300048919 Ga0496116_0006331 Ga0496116_0006331_9384_9986 200
664 3300048919 Ga0496116_0011460 Ga0496116_0011460_1774_2376 200
665 3300048919 Ga0496116_0013828 Ga0496116_0013828_5293_5895 200
666 3300048919 Ga0496116_0125342 Ga0496116_0125342_190_792 200
667 3300048920 Ga0496117_0062470 Ga0496117_0062470_728_1330 200
668 3300048921 Ga0496118_0012763 Ga0496118_0012763_4817_5419 200
669 3300048921 Ga0496118_0047556 Ga0496118_0047556_2082_2684 200
670 3300048922 Ga0496119_0082479 Ga0496119_0082479_211_813 200
671 3300048924 Ga0496121_0009404 Ga0496121_0009404_4926_5528 200
672 3300048924 Ga0496121_0016408 Ga0496121_0016408_4884_5486 200
673 3300048924 Ga0496121_0117809 Ga0496121_0117809_231_833 200
674 3300048925 Ga0496122_0006187 Ga0496122_0006187_5352_5954 200
675 3300048925 Ga0496122_0033877 Ga0496122_0033877_1284_1886 200
676 3300048925 Ga0496122_0183353 Ga0496122_0183353_79_681 200
677 3300048926 Ga0496123_0004840 Ga0496123_0004840_12569_13171 200
678 3300048926 Ga0496123_0012186 Ga0496123_0012186_4607_5209 200
679 3300048926 Ga0496123_0012327 Ga0496123_0012327_4431_5033 200
680 3300048926 Ga0496123_0014891 Ga0496123_0014891_5353_5955 200
681 3300048927 Ga0496124_0004513 Ga0496124_0004513_6872_7474 200
682 3300048927 Ga0496124_0019673 Ga0496124_0019673_113_715 200
683 3300048927 Ga0496124_0045704 Ga0496124_0045704_1154_1756 200
684 3300048927 Ga0496124_0154863 Ga0496124_0154863_341_943 200
685 3300048927 Ga0496124_0272565 Ga0496124_0272565_542_1144 200
686 3300048928 Ga0496125_0013259 Ga0496125_0013259_5296_5898 200
687 3300048928 Ga0496125_0019191 Ga0496125_0019191_5372_5974 200
688 3300048928 Ga0496125_0259437 Ga0496125_0259437_276_878 200
689 3300048929 Ga0496126_0163841 Ga0496126_0163841_208_810 200
690 3300049459 Ga0495678_026575 Ga0495678_026575_1745_2347 200
691 3300049460 Ga0495682_0037693 Ga0495682_0037693_785_1387 200
692 3300049569 Ga0501032_0309493 Ga0501032_0309493_43_645 200
693 3300049579 Ga0501043_0389377 Ga0501043_0389377_59_661 200
694 3300049584 Ga0501068_0117177 Ga0501068_0117177_763_1365 200
695 3300049744 Ga0501083_0113981 Ga0501083_0113981_812_1414 200
696 3300050516 nmdc:mga0sz30_27456_c2 nmdc:mga0sz30_27456_c2_1069_1671 200
697 3300053079 Ga0500610_0016247 Ga0500610_0016247_2069_2671 200
698 3300053109 Ga0500569_090103 Ga0500569_090103_337_939 200
699 3300053118 Ga0500594_0002605 Ga0500594_0002605_784_1386 200
700 3300053129 Ga0500628_055560 Ga0500628_055560_27_629 200
701 3300053139 Ga0500568_0003670 Ga0500568_0003670_2510_3112 200
702 3300053139 Ga0500568_0014422 Ga0500568_0014422_278_880 200
703 3300053153 Ga0500616_0001852 Ga0500616_0001852_4745_5347 200
704 3300053156 Ga0500622_0003885 Ga0500622_0003885_3674_4276 200
705 3300053160 Ga0500633_0013077 Ga0500633_0013077_247_849 200
706 3300053736 Ga0500599_004611 Ga0500599_004611_468_1070 200
707 3300060353 Ga0501082_0038884 Ga0501082_0038884_1805_2407 200
708 3300001979 JGI24740J21852_10003156 JGI24740J21852_100031563 201
709 3300002704 JGI25155J39150_1000058 JGI25155J39150_100005839 201
710 3300002705 JGI25156J39149_1000080 JGI25156J39149_100008039 201
711 3300002737 JGI25162J39368_1001303 JGI25162J39368_10013031 201
712 3300002737 JGI25162J39368_1002015 JGI25162J39368_10020158 201
713 3300002738 JGI25154J39366_1000224 JGI25154J39366_10002248 201
714 3300002741 JGI25157J39369_1000101 JGI25157J39369_100010142 201
715 3300002773 JGI25152J39213_1006143 JGI25152J39213_10061432 201
716 3300003187 JGI25151J46595_10000715 JGI25151J46595_1000071520 201
717 3300003187 JGI25151J46595_10034700 JGI25151J46595_100347002 201
718 3300003214 JGI25165J46597_1001222 JGI25165J46597_10012228 201
719 3300003214 JGI25165J46597_1002937 JGI25165J46597_10029373 201
720 3300003215 JGI25153J46596_10035627 JGI25153J46596_100356273 201
721 3300003316 rootH1_10096281 rootH1_100962813 201
722 3300003316 rootH1_10153970 rootH1_101539702 201
723 3300003323 rootH1_10006423 rootH1_100064233 201
724 3300003771 Ga0055526_1004744 Ga0055526_10047445 201
725 3300003775 Ga0055524_1001326 Ga0055524_10013262 201
726 3300003775 Ga0055524_1005245 Ga0055524_10052455 201
727 3300003775 Ga0055524_1022708 Ga0055524_10227082 201
728 3300003790 Ga0055528_1002071 Ga0055528_100207110 201
729 3300003790 Ga0055528_1005556 Ga0055528_10055563 201
730 3300003790 Ga0055528_1007086 Ga0055528_10070866 201
731 3300003792 Ga0055540_1000425 Ga0055540_10004252 201
732 3300003792 Ga0055540_1050743 Ga0055540_10507431 201
733 3300004625 Ga0055543_1000507 Ga0055543_100050724 201
734 3300005262 Ga0065165_1035500 Ga0065165_10355002 201
735 3300005262 Ga0065165_1035517 Ga0065165_10355172 201
736 3300005327 Ga0070658_10249348 Ga0070658_102493482 201
737 3300005548 Ga0070665_100415933 Ga0070665_1004159331 201
738 3300005563 Ga0068855_100228571 Ga0068855_1002285712 201
739 3300005578 Ga0068854_100562971 Ga0068854_1005629711 201
740 3300005616 Ga0068852_100559253 Ga0068852_1005592531 201
741 3300006038 Ga0075365_10006277 Ga0075365_100062775 201
742 3300006048 Ga0075363_100364009 Ga0075363_1003640091 201
743 3300006178 Ga0075367_10002991 Ga0075367_100029913 201
744 3300006186 Ga0075369_10000893 Ga0075369_100008932 201
745 3300006195 Ga0075366_10003829 Ga0075366_100038292 201
746 3300006353 Ga0075370_10001366 Ga0075370_100013668 201
747 3300009093 Ga0105240_10000005 Ga0105240_10000005463 201
748 3300009101 Ga0105247_10320177 Ga0105247_103201771 201
749 3300009148 Ga0105243_10235252 Ga0105243_102352521 201
750 3300009148 Ga0105243_10772177 Ga0105243_107721772 201
751 3300009545 Ga0105237_10001344 Ga0105237_1000134415 201
752 3300013100 Ga0157373_10171918 Ga0157373_101719182 201
753 3300013104 Ga0157370_10000948 Ga0157370_1000094821 201
754 3300013105 Ga0157369_10263885 Ga0157369_102638852 201
755 3300013297 Ga0157378_10631010 Ga0157378_106310102 201
756 3300014497 Ga0182008_10011961 Ga0182008_100119615 201
757 3300014969 Ga0157376_11192358 Ga0157376_111923581 201
758 3300015262 Ga0182007_10010312 Ga0182007_100103122 201
759 3300025206 Ga0209435_100045 Ga0209435_10004562 201
760 3300025233 Ga0209437_100047 Ga0209437_100047355 201
761 3300025233 Ga0209437_113351 Ga0209437_1133512 201
762 3300025246 Ga0209646_1000154 Ga0209646_100015462 201
763 3300025246 Ga0209646_1003764 Ga0209646_10037642 201
764 3300025246 Ga0209646_1022013 Ga0209646_10220131 201
765 3300025250 Ga0209026_1000177 Ga0209026_100017762 201
766 3300025253 Ga0209677_100440 Ga0209677_10044014 201
767 3300025256 Ga0209759_1000274 Ga0209759_100027436 201
768 3300025258 Ga0209129_1000127 Ga0209129_100012717 201
769 3300025258 Ga0209129_1000527 Ga0209129_100052716 201
770 3300025261 Ga0209233_1000048 Ga0209233_100004848 201
771 3300025261 Ga0209233_1000297 Ga0209233_100029762 201
772 3300025272 Ga0209455_1017910 Ga0209455_10179102 201
773 3300025273 Ga0209673_1000013 Ga0209673_1000013579 201
774 3300025273 Ga0209673_1000048 Ga0209673_100004843 201
775 3300025273 Ga0209673_1000815 Ga0209673_100081537 201
776 3300025273 Ga0209673_1000841 Ga0209673_100084136 201
777 3300025273 Ga0209673_1021310 Ga0209673_10213102 201
778 3300025284 Ga0209130_1016654 Ga0209130_10166543 201
779 3300025292 Ga0209676_1015074 Ga0209676_10150743 201
780 3300025294 Ga0209025_1000042 Ga0209025_100004225 201
781 3300025294 Ga0209025_1000731 Ga0209025_100073159 201
782 3300025294 Ga0209025_1001289 Ga0209025_10012891 201
783 3300025294 Ga0209025_1005829 Ga0209025_10058295 201
784 3300025295 Ga0209564_1000906 Ga0209564_100090610 201
785 3300025295 Ga0209564_1003617 Ga0209564_10036174 201
786 3300025295 Ga0209564_1021008 Ga0209564_10210082 201
787 3300025295 Ga0209564_1054084 Ga0209564_10540842 201
788 3300025297 Ga0209758_1000821 Ga0209758_100082110 201
789 3300025298 Ga0209050_1012680 Ga0209050_10126803 201
790 3300025299 Ga0209256_1000747 Ga0209256_10007474 201
791 3300025299 Ga0209256_1000947 Ga0209256_100094729 201
792 3300025299 Ga0209256_1001218 Ga0209256_100121812 201
793 3300025302 Ga0207426_1000427 Ga0207426_100042738 201
794 3300025303 Ga0209051_1000125 Ga0209051_1000125111 201
795 3300025303 Ga0209051_1003530 Ga0209051_10035306 201
796 3300025303 Ga0209051_1030050 Ga0209051_10300502 201
797 3300025304 Ga0209257_1001705 Ga0209257_100170525 201
798 3300025913 Ga0207695_10000011 Ga0207695_10000011454 201
799 3300025914 Ga0207671_10008850 Ga0207671_100088506 201
800 3300025935 Ga0207709_10147022 Ga0207709_101470223 201
801 3300025949 Ga0207667_10190456 Ga0207667_101904562 201
802 3300025981 Ga0207640_10439760 Ga0207640_104397602 201
803 3300026078 Ga0207702_10105590 Ga0207702_101055903 201
804 3300027312 Ga0209371_1006510 Ga0209371_10065103 201
805 3300028379 Ga0268266_10896027 Ga0268266_108960272 201
806 3300030500 Ga0268256_1004910 Ga0268256_10049105 201
807 3300041441 Ga0451787_058342 Ga0451787_058342_1849_2466 201
808 3300041443 Ga0451789_0941268 Ga0451789_0941268_261_878 201
809 3300041492 Ga0451835_0193601 Ga0451835_0193601_1517_2134 201
810 3300041494 Ga0451837_0781737 Ga0451837_0781737_102_719 201
811 3300041496 Ga0451839_0052663 Ga0451839_0052663_652_1269 201
812 3300041501 Ga0451845_0222495 Ga0451845_0222495_3050_3667 201
813 3300041502 Ga0451846_28043 Ga0451846_28043_397_1014 201
814 3300041503 Ga0451847_0823285 Ga0451847_0823285_168_785 201
815 3300041505 Ga0451849_1377121 Ga0451849_1377121_701_1318 201
816 3300041506 Ga0451850_49893 Ga0451850_49893_278_895 201
817 3300041507 Ga0451851_0314625 Ga0451851_0314625_437_1054 201
818 3300041512 Ga0451853_3250539 Ga0451853_3250539_660_1277 201
819 3300041916 Ga0452271_94748 Ga0452271_94748_275_892 201
820 3300044694 Ga0466963_0005123 Ga0466963_0005123_3841_4446 201
821 3300044706 Ga0466964_0289187 Ga0466964_0289187_98_703 201
822 3300044765 Ga0466970_0003996 Ga0466970_0003996_3079_3684 201
823 3300045049 Ga0466959_0357432 Ga0466959_0357432_138_743 201
824 3300045976 Ga0466967_0128143 Ga0466967_0128143_121_726 201
825 3300046471 Ga0495650_0119619 Ga0495650_0119619_38_655 201
826 3300046492 Ga0495585_0012976 Ga0495585_0012976_1209_1826 201
827 3300046515 Ga0495620_0097074 Ga0495620_0097074_329_946 201
828 3300046518 Ga0495631_0020728 Ga0495631_0020728_1017_1634 201
829 3300046524 Ga0495648_0100714 Ga0495648_0100714_278_895 201
830 3300046558 Ga0495633_0031951 Ga0495633_0031951_485_1102 201
831 3300046660 Ga0495625_0065215 Ga0495625_0065215_1209_1826 201
832 3300046674 Ga0495588_0093983 Ga0495588_0093983_833_1450 201
833 3300046691 Ga0495670_0098174 Ga0495670_0098174_11_628 201
834 3300047470 Ga0495681_0050782 Ga0495681_0050782_49_666 201
835 3300048903 Ga0496100_0004551 Ga0496100_0004551_2132_2737 201
836 3300048905 Ga0496102_0053909 Ga0496102_0053909_684_1289 201
837 3300048906 Ga0496103_0010814 Ga0496103_0010814_4386_4991 201
838 3300048909 Ga0496106_0096708 Ga0496106_0096708_355_960 201
839 3300048910 Ga0496107_0097574 Ga0496107_0097574_251_856 201
840 3300048919 Ga0496116_0035100 Ga0496116_0035100_2428_3033 201
841 3300048919 Ga0496116_0319561 Ga0496116_0319561_106_711 201
842 3300048920 Ga0496117_0000641 Ga0496117_0000641_51172_51777 201
843 3300048920 Ga0496117_0013353 Ga0496117_0013353_2952_3572 201
844 3300048920 Ga0496117_0037171 Ga0496117_0037171_1794_2402 201
845 3300048920 Ga0496117_0130394 Ga0496117_0130394_68_673 201
846 3300048921 Ga0496118_0002788 Ga0496118_0002788_17711_18316 201
847 3300048921 Ga0496118_0009154 Ga0496118_0009154_2734_3342 201
848 3300048922 Ga0496119_0006261 Ga0496119_0006261_5946_6551 201
849 3300048922 Ga0496119_0012968 Ga0496119_0012968_2264_2869 201
850 3300048922 Ga0496119_0067095 Ga0496119_0067095_184_804 201
851 3300048923 Ga0496120_0045893 Ga0496120_0045893_1413_2018 201
852 3300048923 Ga0496120_0095203 Ga0496120_0095203_468_1073 201
853 3300048924 Ga0496121_0003358 Ga0496121_0003358_22158_22763 201
854 3300048924 Ga0496121_0031738 Ga0496121_0031738_3470_4075 201
855 3300048924 Ga0496121_0293212 Ga0496121_0293212_69_680 201
856 3300048924 Ga0496121_0474474 Ga0496121_0474474_71_676 201
857 3300048925 Ga0496122_0000399 Ga0496122_0000399_65662_66282 201
858 3300048925 Ga0496122_0003165 Ga0496122_0003165_16592_17197 201
859 3300048925 Ga0496122_0034267 Ga0496122_0034267_394_999 201
860 3300048925 Ga0496122_0128755 Ga0496122_0128755_613_1218 201
861 3300048925 Ga0496122_0401699 Ga0496122_0401699_65_670 201
862 3300048926 Ga0496123_0001759 Ga0496123_0001759_2162_2782 201
863 3300048926 Ga0496123_0058466 Ga0496123_0058466_511_1116 201
864 3300048926 Ga0496123_0082521 Ga0496123_0082521_1296_1901 201
865 3300048926 Ga0496123_0169109 Ga0496123_0169109_528_1133 201
866 3300048927 Ga0496124_0014661 Ga0496124_0014661_3735_4340 201
867 3300048927 Ga0496124_0080485 Ga0496124_0080485_632_1255 201
868 3300048928 Ga0496125_0019398 Ga0496125_0019398_4738_5343 201
869 3300048928 Ga0496125_0169774 Ga0496125_0169774_371_994 201
870 3300048929 Ga0496126_0001055 Ga0496126_0001055_2955_3578 201
871 3300048929 Ga0496126_0072252 Ga0496126_0072252_1468_2073 201
872 3300049569 Ga0501032_0209644 Ga0501032_0209644_236_856 201
873 3300049570 Ga0501033_0388246 Ga0501033_0388246_287_907 201
874 3300049571 Ga0501034_0058933 Ga0501034_0058933_994_1614 201
875 3300049571 Ga0501034_0276247 Ga0501034_0276247_690_1298 201
876 3300049572 Ga0501036_0038878 Ga0501036_0038878_2188_2808 201
877 3300049573 Ga0501037_0024266 Ga0501037_0024266_1822_2442 201
878 3300049574 Ga0501038_0021047 Ga0501038_0021047_4917_5537 201
879 3300049575 Ga0501039_0333758 Ga0501039_0333758_62_682 201
880 3300049581 Ga0501047_0106843 Ga0501047_0106843_226_846 201
881 3300050489 nmdc:mga03683_29598_c1 nmdc:mga03683_29598_c1_1288_1905 201
882 3300050492 nmdc:mga0yw44_26746_c1 nmdc:mga0yw44_26746_c1_1013_1630 201
883 3300050493 nmdc:mga0k408_3620_c1 nmdc:mga0k408_3620_c1_1884_2501 201
884 3300050496 nmdc:mga07m45_151872_c1 nmdc:mga07m45_151872_c1_547_1152 201
885 3300050516 nmdc:mga0sz30_13640_c2 nmdc:mga0sz30_13640_c2_1170_1787 201
886 3300053122 Ga0500608_093386 Ga0500608_093386_653_1264 201
887 3300053735 Ga0500596_018233 Ga0500596_018233_329_934 201
888 3300060353 Ga0501082_0208096 Ga0501082_0208096_410_1030 201
889 3300061719 Ga0466962_0058180 Ga0466962_0058180_643_1248 201
890 iso_pu_bacteria 2891373044 2891374362 201
891 iso_pu_bacteria 2989349275 2989353151 201
892 iso_pu_bacteria 8054558443 8054559707 201

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

21

180

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.8806 20 195
3bnk-assembly1.cif.gz_A x-ray crystal structure of flavoredoxin from methanosarcina acetivorans 0.879 24 195
4z85-assembly1.cif.gz_A-2 crystal structur of pseudomonas fluorescens 2-nitrobenzoate 2-nitroreductase nbaa 0.8685 18 198
3bpk-assembly1.cif.gz_B crystal structure of nitrilotriacetate monooxygenase component b from bacillus cereus 0.8658 15 195
3zoe-assembly1.cif.gz_A crystal structure of fmn-binding protein (yp_005476) from thermus thermophilus with bound p-hydroxybenzaldehyde 0.8597 25 195
ID Description Score Start End Superfamily
af_A0A1D8PHY8_124_333_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8845 17 199 2.30.110.10
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8806 20 195 2.30.110.10
3bnkA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.879 24 195 2.30.110.10
4z85A00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8685 18 198 2.30.110.10
af_O53254_5_167_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8468 25 162 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A1M2YJ27-F1-model_v4 deleted 0.9685 28 201
AF-A0A1M2YJ27-F1-model_v4 deleted 0.9631 28 201
AF-A0A844W947-F1-model_v4 deleted 0.9606 57 188
AF-A0A4R6VTU9-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.9551 57 200 GO:0010181
GO:0016646
AF-A0A7W9E6N0-F1-model_v4 Flavin reductase (DIM6/NTAB) family NADH-FMN oxidoreductase RutF 0.9539 30 197 GO:0010181
GO:0016646

Feature Viewer

pLDDT pTM Quality
90.36 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map