F484735

General Info

Members Datasets Scaffolds Average Seq Length
887 288 870 491

Family's Representative Sequence

Representative Sequence 3300044735|Ga0466968_0011086|Ga0466968_0011086_1725_3182
Length 485
Sequence MSSYRIQGDTGEWEVVIGLEVHAQVTSQSKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIRQAVRTGMALDAQINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSILIEPEGAEPKTIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSRPDMRSPAEAGAYVKKLRAILRYVGSCDGNMEQGSMRADVNVSVRKPGEPFGTRTETKNVNSIRFVMAAIEYEARRQVELIEDGGTVVQETRLFDPDRGVTRSMRSKEDAHDYRYFPDPDLLPVELDDAFLEEARASLPELPDAKRRRYEEVLGISAYNADVLTADVETARWFEAMLAEGAPAKQASNWVMSELFGALNRLGKDITESPVSPADAAALIGLVADGTLSGSLAKQVFELMLETGDAPAKIVEERGLKQTSDTGAIEAEIAKILEANPDKVADYRGGKDKLFGFFVGQTMRAMGGKANPGVVNELLKKALG

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
5 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
6 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
7 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
8 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
11 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
12 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
13 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
14 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
15 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
16 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
17 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
18 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
22 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
23 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
24 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
25 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
29 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
30 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
36 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
37 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
38 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
46 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
49 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
121 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
174 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
208 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
221 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
224 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
229 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
230 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
231 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
238 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
241 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
246 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
247 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
248 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
249 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
250 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
251 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
254 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
260 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
268 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
282 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
283 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
284 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
285 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
286 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.08
Metatranscriptomes 0
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 4.96
Nodule 0.11
Rhizoplane 4.4
Rhizosphere 87.94
Stem 0
Stem Tuber 0.11
Unclassified 2.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000431 3300001915 Bacteria 12681
2 JGI24740J21852_10005606 3300001979 Bacteria 5288
3 JGI24740J21852_10006044 3300001979 Bacteria 5061
4 JGI24739J22299_10007482 3300001989 Bacteria 4095
5 JGI24739J22299_10012411 3300001989 Bacteria 3130
6 JGI24737J22298_10002753 3300001990 Bacteria 6217
7 JGI24737J22298_10008497 3300001990 Bacteria 3433
8 JGI24737J22298_10008534 3300001990 Bacteria 3426
9 JGI24737J22298_10008709 3300001990 Bacteria 3389
10 JGI24737J22298_10034006 3300001990 Bacteria 1581
11 JGI24735J21928_10013571 3300002067 Bacteria 2558
12 JGI24738J21930_10001196 3300002075 Bacteria 7269
13 JGI25165J46597_1000012 3300003214 Bacteria 421074
14 Ga0055525_1000104 3300003759 Bacteria 134560
15 Ga0055542_1000025 3300003762 Bacteria 263538
16 Ga0055529_1000014 3300003763 Bacteria 367283
17 Ga0055536_1001462 3300003781 Bacteria 14195
18 Ga0055536_1005390 3300003781 Bacteria 6268
19 Ga0055531_10001396 3300003794 Bacteria 17890
20 Ga0065712_10075956 3300005290 Bacteria 3748
21 Ga0065715_10140700 3300005293 Bacteria 1858
22 Ga0070658_10000001 3300005327 Bacteria 856789
23 Ga0070658_10000453 3300005327 Bacteria 35538
24 Ga0070658_10000608 3300005327 Bacteria 31026
25 Ga0070658_10013798 3300005327 Bacteria 6483
26 Ga0070658_10014330 3300005327 Bacteria 6360
27 Ga0070658_10046392 3300005327 Bacteria 3516
28 Ga0070658_10048136 3300005327 Bacteria 3451
29 Ga0070658_10053350 3300005327 Bacteria 3281
30 Ga0070658_10059310 3300005327 Bacteria 3116
31 Ga0070658_10062122 3300005327 Bacteria 3044
32 Ga0070683_100015274 3300005329 Bacteria 6742
33 Ga0070683_100015500 3300005329 Bacteria 6697
34 Ga0070683_100033164 3300005329 Bacteria 4707
35 Ga0070683_100073969 3300005329 Bacteria 3182
36 Ga0070683_100083739 3300005329 Bacteria 2988
37 Ga0070690_100057999 3300005330 Bacteria 2485
38 Ga0070670_100000926 3300005331 Bacteria 23049
39 Ga0070670_100004560 3300005331 Bacteria 11619
40 Ga0070670_100006393 3300005331 Bacteria 9974
41 Ga0070670_100010746 3300005331 Bacteria 7820
42 Ga0070670_100014788 3300005331 Bacteria 6697
43 Ga0070670_100036425 3300005331 Bacteria 4234
44 Ga0070670_100095328 3300005331 Bacteria 2560
45 Ga0070670_100108435 3300005331 Bacteria 2392
46 Ga0070666_10000215 3300005335 Bacteria 39675
47 Ga0070666_10003971 3300005335 Bacteria 8972
48 Ga0070666_10006651 3300005335 Bacteria 7108
49 Ga0070666_10068267 3300005335 Bacteria 2415
50 Ga0070680_100001375 3300005336 Bacteria 17594
51 Ga0070680_100006192 3300005336 Bacteria 9075
52 Ga0070680_100073235 3300005336 Bacteria 2816
53 Ga0070680_100135257 3300005336 Bacteria 2064
54 Ga0070682_100009672 3300005337 Bacteria 5458
55 Ga0070682_100010477 3300005337 Bacteria 5263
56 Ga0068868_100136713 3300005338 Bacteria 2009
57 Ga0070660_100000196 3300005339 Bacteria 40291
58 Ga0070660_100000488 3300005339 Bacteria 26536
59 Ga0070660_100000678 3300005339 Bacteria 22503
60 Ga0070660_100001380 3300005339 Bacteria 16499
61 Ga0070660_100002721 3300005339 Bacteria 12144
62 Ga0070660_100002844 3300005339 Bacteria 11917
63 Ga0070660_100039724 3300005339 Bacteria 3577
64 Ga0070660_100062123 3300005339 Bacteria 2901
65 Ga0070660_100083550 3300005339 Bacteria 2508
66 Ga0070660_100117032 3300005339 Bacteria 2125
67 Ga0070691_10006411 3300005341 Bacteria 5379
68 Ga0070661_100000010 3300005344 Bacteria 175777
69 Ga0070661_100000311 3300005344 Bacteria 39261
70 Ga0070661_100001265 3300005344 Bacteria 17761
71 Ga0070661_100015558 3300005344 Bacteria 5369
72 Ga0070661_100021108 3300005344 Bacteria 4650
73 Ga0070661_100052614 3300005344 Bacteria 2980
74 Ga0070661_100125974 3300005344 Bacteria 1921
75 Ga0070692_10007634 3300005345 Bacteria 4776
76 Ga0070668_100000417 3300005347 Bacteria 28255
77 Ga0070668_100029835 3300005347 Bacteria 4143
78 Ga0070668_100112446 3300005347 Bacteria 2169
79 Ga0070669_100010847 3300005353 Bacteria 6467
80 Ga0070669_100021625 3300005353 Bacteria 4598
81 Ga0070669_100025889 3300005353 Bacteria 4217
82 Ga0070669_100028833 3300005353 Bacteria 3998
83 Ga0070669_100127546 3300005353 Bacteria 1948
84 Ga0070675_100127201 3300005354 Bacteria 2169
85 Ga0070671_100000229 3300005355 Bacteria 37462
86 Ga0070671_100005401 3300005355 Bacteria 10190
87 Ga0070671_100008028 3300005355 Bacteria 8448
88 Ga0070671_100172787 3300005355 Bacteria 1828
89 Ga0070674_100003585 3300005356 Bacteria 8728
90 Ga0070674_100046815 3300005356 Bacteria 2961
91 Ga0070673_100001123 3300005364 Bacteria 15365
92 Ga0070673_100001517 3300005364 Bacteria 13659
93 Ga0070673_100014284 3300005364 Bacteria 5523
94 Ga0070673_100028934 3300005364 Bacteria 4127
95 Ga0070673_100048393 3300005364 Bacteria 3314
96 Ga0070659_100000594 3300005366 Bacteria 26514
97 Ga0070659_100002859 3300005366 Bacteria 12291
98 Ga0070659_100004759 3300005366 Bacteria 9700
99 Ga0070659_100020708 3300005366 Bacteria 5000
100 Ga0070659_100028630 3300005366 Bacteria 4304
101 Ga0070659_100032584 3300005366 Bacteria 4043
102 Ga0070659_100036427 3300005366 Bacteria 3837
103 Ga0070659_100121668 3300005366 Bacteria 2115
104 Ga0070667_100002846 3300005367 Bacteria 14931
105 Ga0070667_100009607 3300005367 Bacteria 8021
106 Ga0070667_100020527 3300005367 Bacteria 5485
107 Ga0070667_100022365 3300005367 Bacteria 5244
108 Ga0070667_100065626 3300005367 Bacteria 3082
109 Ga0070667_100075673 3300005367 Bacteria 2874
110 Ga0070667_100080108 3300005367 Bacteria 2793
111 Ga0070667_100127294 3300005367 Bacteria 2220
112 Ga0070667_100151447 3300005367 Bacteria 2038
113 Ga0070714_100170522 3300005435 Bacteria 1975
114 Ga0070663_100003678 3300005455 Bacteria 8890
115 Ga0070663_100016977 3300005455 Bacteria 4739
116 Ga0070678_100004545 3300005456 Bacteria 7878
117 Ga0070662_100000198 3300005457 Bacteria 35360
118 Ga0070662_100001444 3300005457 Bacteria 14651
119 Ga0070662_100001885 3300005457 Bacteria 12853
120 Ga0070662_100006163 3300005457 Bacteria 7711
121 Ga0070662_100010186 3300005457 Bacteria 6163
122 Ga0070662_100022776 3300005457 Bacteria 4293
123 Ga0070662_100024316 3300005457 Bacteria 4172
124 Ga0070662_100045053 3300005457 Bacteria 3163
125 Ga0070681_10063695 3300005458 Bacteria 3659
126 Ga0070681_10079160 3300005458 Bacteria 3243
127 Ga0068867_100015941 3300005459 Bacteria 5334
128 Ga0070679_100000005 3300005530 Bacteria 263201
129 Ga0070679_100001379 3300005530 Bacteria 21458
130 Ga0070684_100052323 3300005535 Bacteria 3551
131 Ga0068853_100000630 3300005539 Bacteria 24214
132 Ga0068853_100071507 3300005539 Bacteria 3021
133 Ga0068853_100195898 3300005539 Bacteria 1838
134 Ga0068853_100247135 3300005539 Bacteria 1636
135 Ga0070672_100001700 3300005543 Bacteria 13736
136 Ga0070672_100003232 3300005543 Bacteria 10550
137 Ga0070672_100015400 3300005543 Bacteria 5442
138 Ga0070672_100024535 3300005543 Bacteria 4459
139 Ga0070672_100133624 3300005543 Bacteria 2041
140 Ga0070686_100070721 3300005544 Bacteria 2282
141 Ga0070693_100003956 3300005547 Bacteria 6952
142 Ga0070665_100000186 3300005548 Bacteria 110750
143 Ga0070665_100000820 3300005548 Bacteria 40672
144 Ga0070665_100002788 3300005548 Bacteria 18950
145 Ga0070665_100004669 3300005548 Bacteria 14305
146 Ga0070665_100004787 3300005548 Bacteria 14086
147 Ga0070665_100020745 3300005548 Bacteria 6603
148 Ga0070665_100036998 3300005548 Bacteria 4909
149 Ga0070665_100057110 3300005548 Bacteria 3913
150 Ga0068855_100000408 3300005563 Bacteria 53275
151 Ga0068855_100029819 3300005563 Bacteria 6523
152 Ga0068855_100030382 3300005563 Bacteria 6463
153 Ga0068855_100034006 3300005563 Bacteria 6080
154 Ga0068855_100064376 3300005563 Bacteria 4276
155 Ga0068855_100070013 3300005563 Bacteria 4082
156 Ga0068855_100142452 3300005563 Bacteria 2731
157 Ga0070664_100000259 3300005564 Bacteria 38210
158 Ga0070664_100001404 3300005564 Bacteria 19225
159 Ga0070664_100001633 3300005564 Bacteria 17950
160 Ga0070664_100031112 3300005564 Bacteria 4456
161 Ga0070664_100047266 3300005564 Bacteria 3635
162 Ga0070664_100109851 3300005564 Bacteria 2405
163 Ga0068857_100014903 3300005577 Bacteria 6780
164 Ga0068857_100035949 3300005577 Bacteria 4388
165 Ga0068857_100088738 3300005577 Bacteria 2766
166 Ga0068854_100002023 3300005578 Bacteria 12419
167 Ga0068854_100010331 3300005578 Bacteria 6049
168 Ga0068854_100070394 3300005578 Bacteria 2557
169 Ga0068856_100000315 3300005614 Bacteria 53098
170 Ga0068856_100040015 3300005614 Bacteria 4603
171 Ga0068852_100000548 3300005616 Bacteria 24613
172 Ga0068852_100002347 3300005616 Bacteria 13030
173 Ga0068852_100011651 3300005616 Bacteria 6631
174 Ga0068852_100012894 3300005616 Bacteria 6372
175 Ga0068852_100032154 3300005616 Bacteria 4341
176 Ga0068852_100070909 3300005616 Bacteria 3058
177 Ga0068852_100245050 3300005616 Bacteria 1715
178 Ga0068859_100002810 3300005617 Bacteria 17638
179 Ga0068859_100010651 3300005617 Bacteria 9255
180 Ga0068859_100013157 3300005617 Bacteria 8312
181 Ga0068859_100030985 3300005617 Bacteria 5367
182 Ga0068859_100047383 3300005617 Bacteria 4318
183 Ga0068859_100047416 3300005617 Bacteria 4317
184 Ga0068859_100086348 3300005617 Bacteria 3184
185 Ga0068859_100121610 3300005617 Bacteria 2677
186 Ga0068859_100136416 3300005617 Bacteria 2527
187 Ga0068864_100002676 3300005618 Bacteria 14708
188 Ga0068864_100015545 3300005618 Bacteria 6329
189 Ga0068864_100019523 3300005618 Bacteria 5668
190 Ga0068864_100032751 3300005618 Bacteria 4417
191 Ga0068864_100034668 3300005618 Bacteria 4294
192 Ga0068864_100037717 3300005618 Bacteria 4126
193 Ga0068861_100000342 3300005719 Bacteria 26513
194 Ga0068861_100107843 3300005719 Bacteria 2227
195 Ga0068851_10003735 3300005834 Bacteria 6802
196 Ga0068851_10007915 3300005834 Bacteria 4898
197 Ga0068851_10027670 3300005834 Bacteria 2795
198 Ga0068863_100002668 3300005841 Bacteria 17638
199 Ga0068863_100018056 3300005841 Bacteria 6755
200 Ga0068863_100048238 3300005841 Bacteria 4038
201 Ga0068863_100089450 3300005841 Bacteria 2919
202 Ga0068863_100135628 3300005841 Bacteria 2351
203 Ga0068858_100000292 3300005842 Bacteria 54217
204 Ga0068858_100004640 3300005842 Bacteria 13458
205 Ga0068858_100005553 3300005842 Bacteria 12339
206 Ga0068858_100016460 3300005842 Bacteria 6943
207 Ga0068858_100020597 3300005842 Bacteria 6161
208 Ga0068858_100048106 3300005842 Bacteria 3952
209 Ga0068858_100087420 3300005842 Bacteria 2899
210 Ga0068858_100134254 3300005842 Bacteria 2321
211 Ga0068858_100139963 3300005842 Bacteria 2271
212 Ga0068860_100009099 3300005843 Bacteria 9883
213 Ga0068860_100034282 3300005843 Bacteria 4868
214 Ga0068860_100056677 3300005843 Bacteria 3724
215 Ga0068862_100010452 3300005844 Bacteria 7664
216 Ga0068862_100049681 3300005844 Bacteria 3583
217 Ga0081539_10012045 3300005985 Bacteria 6725
218 Ga0075368_10002482 3300006042 Bacteria 6035
219 Ga0075363_100011628 3300006048 Bacteria 4220
220 Ga0075362_10000018 3300006177 Bacteria 75123
221 Ga0075362_10000985 3300006177 Bacteria 8708
222 Ga0075366_10000303 3300006195 Bacteria 22259
223 Ga0097621_100055225 3300006237 Bacteria 3243
224 Ga0068871_100029468 3300006358 Bacteria 4311
225 Ga0068871_100049418 3300006358 Bacteria 3399
226 Ga0068871_100139332 3300006358 Bacteria 2062
227 Ga0075431_100006263 3300006847 Bacteria 11821
228 Ga0068865_100038232 3300006881 Bacteria 3247
229 Ga0068865_100040472 3300006881 Bacteria 3167
230 Ga0068865_100083442 3300006881 Bacteria 2300
231 Ga0097620_100002811 3300006931 Bacteria 17638
232 Ga0097620_100010651 3300006931 Bacteria 9255
233 Ga0097620_100013157 3300006931 Bacteria 8312
234 Ga0097620_100030985 3300006931 Bacteria 5367
235 Ga0097620_100047384 3300006931 Bacteria 4318
236 Ga0097620_100047417 3300006931 Bacteria 4317
237 Ga0097620_100086352 3300006931 Bacteria 3184
238 Ga0097620_100121611 3300006931 Bacteria 2677
239 Ga0097620_100136420 3300006931 Bacteria 2527
240 Ga0105250_10006682 3300009092 Bacteria 5018
241 Ga0111539_10102475 3300009094 Bacteria 3360
242 Ga0105245_10006292 3300009098 Bacteria 10451
243 Ga0105245_10049672 3300009098 Bacteria 3757
244 Ga0105243_10000917 3300009148 Bacteria 27647
245 Ga0105241_10004599 3300009174 Bacteria 10207
246 Ga0105242_10123637 3300009176 Bacteria 2224
247 Ga0105248_10000362 3300009177 Bacteria 53018
248 Ga0105248_10000395 3300009177 Bacteria 50389
249 Ga0105248_10000774 3300009177 Bacteria 35872
250 Ga0105248_10004323 3300009177 Bacteria 15711
251 Ga0105248_10006715 3300009177 Bacteria 12620
252 Ga0105248_10007122 3300009177 Bacteria 12257
253 Ga0105248_10010911 3300009177 Bacteria 10025
254 Ga0105248_10023147 3300009177 Bacteria 6900
255 Ga0105248_10024612 3300009177 Bacteria 6694
256 Ga0105248_10086313 3300009177 Bacteria 3531
257 Ga0105248_10107601 3300009177 Bacteria 3144
258 Ga0105248_10110921 3300009177 Bacteria 3093
259 Ga0105248_10140777 3300009177 Bacteria 2721
260 Ga0105237_10073188 3300009545 Bacteria 3419
261 Ga0105238_10001671 3300009551 Bacteria 22298
262 Ga0105238_10016618 3300009551 Bacteria 7452
263 Ga0105249_10051014 3300009553 Bacteria 3773
264 Ga0105239_10110493 3300010375 Bacteria 3047
265 Ga0157373_10016724 3300013100 Bacteria 5346
266 Ga0157373_10017322 3300013100 Bacteria 5246
267 Ga0157373_10071828 3300013100 Bacteria 2443
268 Ga0157371_10000183 3300013102 Bacteria 92426
269 Ga0157371_10005239 3300013102 Bacteria 11011
270 Ga0157371_10010681 3300013102 Bacteria 7131
271 Ga0157370_10048117 3300013104 Bacteria 4086
272 Ga0157369_10000635 3300013105 Bacteria 45411
273 Ga0157369_10003132 3300013105 Bacteria 19773
274 Ga0157369_10056072 3300013105 Bacteria 4252
275 Ga0157369_10206667 3300013105 Bacteria 2059
276 Ga0157378_10279066 3300013297 Bacteria 1610
277 Ga0163162_10006899 3300013306 Bacteria 11017
278 Ga0163162_10006918 3300013306 Bacteria 10996
279 Ga0163162_10037036 3300013306 Bacteria 4865
280 Ga0163162_10117940 3300013306 Bacteria 2756
281 Ga0157375_10000296 3300013308 Bacteria 45207
282 Ga0157375_10017638 3300013308 Bacteria 6448
283 Ga0157375_10090319 3300013308 Bacteria 3121
284 Ga0157375_10375573 3300013308 Bacteria 1588
285 Ga0163163_10002099 3300014325 Bacteria 16824
286 Ga0163163_10002393 3300014325 Bacteria 15879
287 Ga0163163_10011403 3300014325 Bacteria 8060
288 Ga0157380_10106562 3300014326 Bacteria 2346
289 Ga0157380_10120042 3300014326 Bacteria 2225
290 Ga0157379_10003233 3300014968 Bacteria 13810
291 Ga0157379_10044281 3300014968 Bacteria 3972
292 Ga0183363_1004 3300015690 Bacteria 416766
293 Ga0163161_10003370 3300017792 Bacteria 11209
294 Ga0213873_10000015 3300021358 Bacteria 131343
295 Ga0213876_10000005 3300021384 Bacteria 727326
296 Ga0213876_10000263 3300021384 Bacteria 48650
297 Ga0213875_10002419 3300021388 Bacteria 11208
298 Ga0209563_100116 3300025230 Bacteria 134661
299 Ga0209148_1000011 3300025254 Bacteria 1196503
300 Ga0209233_1000058 3300025261 Bacteria 421872
301 Ga0209455_1000006 3300025272 Bacteria 1196503
302 Ga0209675_1000126 3300025291 Bacteria 104792
303 Ga0209676_1000060 3300025292 Bacteria 338238
304 Ga0209676_1000148 3300025292 Bacteria 172161
305 Ga0209758_1000001 3300025297 Bacteria 1981790
306 Ga0209050_1000047 3300025298 Bacteria 380561
307 Ga0209050_1003236 3300025298 Bacteria 12273
308 Ga0209257_1000076 3300025304 Bacteria 324617
309 Ga0207697_10007831 3300025315 Bacteria 4726
310 Ga0207697_10040015 3300025315 Bacteria 1924
311 Ga0207656_10001128 3300025321 Bacteria 8776
312 Ga0207656_10011235 3300025321 Bacteria 3378
313 Ga0207656_10012022 3300025321 Bacteria 3284
314 Ga0207682_10003135 3300025893 Bacteria 7244
315 Ga0207682_10005730 3300025893 Bacteria 5038
316 Ga0207642_10013595 3300025899 Bacteria 2974
317 Ga0207680_10001423 3300025903 Bacteria 11336
318 Ga0207680_10003548 3300025903 Bacteria 7346
319 Ga0207680_10008878 3300025903 Bacteria 4956
320 Ga0207647_10000339 3300025904 Bacteria 38180
321 Ga0207647_10001091 3300025904 Bacteria 20920
322 Ga0207647_10017322 3300025904 Bacteria 4898
323 Ga0207647_10017780 3300025904 Bacteria 4825
324 Ga0207647_10025267 3300025904 Bacteria 3906
325 Ga0207647_10041128 3300025904 Bacteria 2908
326 Ga0207705_10000002 3300025909 Bacteria 2046852
327 Ga0207705_10000070 3300025909 Bacteria 130733
328 Ga0207705_10000166 3300025909 Bacteria 71368
329 Ga0207705_10000205 3300025909 Bacteria 59773
330 Ga0207705_10000449 3300025909 Bacteria 35420
331 Ga0207705_10005655 3300025909 Bacteria 9332
332 Ga0207705_10007530 3300025909 Bacteria 8000
333 Ga0207705_10008658 3300025909 Bacteria 7416
334 Ga0207705_10016594 3300025909 Bacteria 5275
335 Ga0207705_10018815 3300025909 Bacteria 4940
336 Ga0207705_10030837 3300025909 Bacteria 3826
337 Ga0207705_10034881 3300025909 Bacteria 3598
338 Ga0207705_10037372 3300025909 Bacteria 3475
339 Ga0207705_10049564 3300025909 Bacteria 3022
340 Ga0207705_10053486 3300025909 Bacteria 2908
341 Ga0207705_10115890 3300025909 Bacteria 1983
342 Ga0207654_10000986 3300025911 Bacteria 15594
343 Ga0207707_10024686 3300025912 Bacteria 5260
344 Ga0207707_10080778 3300025912 Bacteria 2839
345 Ga0207707_10108299 3300025912 Bacteria 2429
346 Ga0207695_10005871 3300025913 Bacteria 16113
347 Ga0207695_10014084 3300025913 Bacteria 9497
348 Ga0207695_10233529 3300025913 Bacteria 1743
349 Ga0207671_10010288 3300025914 Bacteria 7731
350 Ga0207671_10065049 3300025914 Bacteria 2712
351 Ga0207671_10115233 3300025914 Bacteria 2049
352 Ga0207660_10004430 3300025917 Bacteria 9156
353 Ga0207657_10000471 3300025919 Bacteria 42534
354 Ga0207657_10001304 3300025919 Bacteria 26485
355 Ga0207657_10002320 3300025919 Bacteria 20619
356 Ga0207657_10003326 3300025919 Bacteria 17195
357 Ga0207657_10003700 3300025919 Bacteria 16257
358 Ga0207657_10005851 3300025919 Bacteria 12809
359 Ga0207657_10008974 3300025919 Bacteria 10102
360 Ga0207657_10009473 3300025919 Bacteria 9784
361 Ga0207657_10009727 3300025919 Bacteria 9642
362 Ga0207657_10011984 3300025919 Bacteria 8577
363 Ga0207657_10032585 3300025919 Bacteria 4706
364 Ga0207657_10064793 3300025919 Bacteria 3118
365 Ga0207657_10073458 3300025919 Bacteria 2890
366 Ga0207657_10177273 3300025919 Bacteria 1724
367 Ga0207649_10000165 3300025920 Bacteria 54047
368 Ga0207649_10000225 3300025920 Bacteria 46073
369 Ga0207649_10001363 3300025920 Bacteria 14500
370 Ga0207649_10003505 3300025920 Bacteria 8577
371 Ga0207649_10041672 3300025920 Bacteria 2796
372 Ga0207649_10042593 3300025920 Bacteria 2770
373 Ga0207649_10046859 3300025920 Bacteria 2658
374 Ga0207649_10077909 3300025920 Bacteria 2137
375 Ga0207652_10000036 3300025921 Bacteria 134949
376 Ga0207652_10000270 3300025921 Bacteria 54010
377 Ga0207652_10074640 3300025921 Bacteria 2953
378 Ga0207652_10228722 3300025921 Bacteria 1676
379 Ga0207681_10000713 3300025923 Bacteria 21863
380 Ga0207681_10003725 3300025923 Bacteria 9474
381 Ga0207681_10006050 3300025923 Bacteria 7422
382 Ga0207681_10010338 3300025923 Bacteria 5709
383 Ga0207681_10057402 3300025923 Bacteria 2660
384 Ga0207694_10001620 3300025924 Bacteria 18931
385 Ga0207694_10016301 3300025924 Bacteria 5609
386 Ga0207650_10004433 3300025925 Bacteria 9590
387 Ga0207650_10021458 3300025925 Bacteria 4564
388 Ga0207650_10064988 3300025925 Bacteria 2732
389 Ga0207659_10008129 3300025926 Bacteria 6492
390 Ga0207687_10000564 3300025927 Bacteria 25021
391 Ga0207700_10112013 3300025928 Bacteria 2198
392 Ga0207644_10000324 3300025931 Bacteria 31071
393 Ga0207644_10007290 3300025931 Bacteria 7198
394 Ga0207644_10011303 3300025931 Bacteria 5903
395 Ga0207644_10019091 3300025931 Bacteria 4647
396 Ga0207644_10034849 3300025931 Bacteria 3523
397 Ga0207644_10120667 3300025931 Bacteria 1995
398 Ga0207690_10000257 3300025932 Bacteria 38401
399 Ga0207690_10026021 3300025932 Bacteria 3683
400 Ga0207706_10001159 3300025933 Bacteria 26723
401 Ga0207706_10001176 3300025933 Bacteria 26479
402 Ga0207706_10004436 3300025933 Bacteria 13190
403 Ga0207706_10012485 3300025933 Bacteria 7739
404 Ga0207706_10015297 3300025933 Bacteria 6937
405 Ga0207706_10027130 3300025933 Bacteria 5122
406 Ga0207706_10028341 3300025933 Bacteria 5002
407 Ga0207706_10041704 3300025933 Bacteria 4068
408 Ga0207706_10075584 3300025933 Bacteria 2962
409 Ga0207706_10194421 3300025933 Bacteria 1780
410 Ga0207709_10000018 3300025935 Bacteria 431545
411 Ga0207669_10000068 3300025937 Bacteria 52240
412 Ga0207669_10003287 3300025937 Bacteria 6992
413 Ga0207669_10006639 3300025937 Bacteria 5304
414 Ga0207669_10061470 3300025937 Bacteria 2308
415 Ga0207704_10028858 3300025938 Bacteria 3085
416 Ga0207704_10038739 3300025938 Bacteria 2768
417 Ga0207704_10124861 3300025938 Bacteria 1769
418 Ga0207691_10000696 3300025940 Bacteria 33255
419 Ga0207691_10000915 3300025940 Bacteria 29231
420 Ga0207691_10018796 3300025940 Bacteria 6546
421 Ga0207691_10035119 3300025940 Bacteria 4658
422 Ga0207691_10036542 3300025940 Bacteria 4552
423 Ga0207691_10050290 3300025940 Bacteria 3816
424 Ga0207691_10052924 3300025940 Bacteria 3707
425 Ga0207691_10129294 3300025940 Bacteria 2232
426 Ga0207691_10199239 3300025940 Bacteria 1743
427 Ga0207711_10000427 3300025941 Bacteria 44194
428 Ga0207711_10000429 3300025941 Bacteria 43981
429 Ga0207711_10001486 3300025941 Bacteria 21831
430 Ga0207711_10001903 3300025941 Bacteria 18980
431 Ga0207711_10008656 3300025941 Bacteria 8510
432 Ga0207711_10011424 3300025941 Bacteria 7383
433 Ga0207711_10011831 3300025941 Bacteria 7250
434 Ga0207711_10018883 3300025941 Bacteria 5732
435 Ga0207711_10059984 3300025941 Bacteria 3277
436 Ga0207689_10014695 3300025942 Bacteria 6649
437 Ga0207661_10001889 3300025944 Bacteria 14357
438 Ga0207661_10020291 3300025944 Bacteria 4964
439 Ga0207661_10048483 3300025944 Bacteria 3376
440 Ga0207661_10092528 3300025944 Bacteria 2521
441 Ga0207661_10150014 3300025944 Bacteria 2014
442 Ga0207679_10000463 3300025945 Bacteria 28581
443 Ga0207679_10008055 3300025945 Bacteria 6700
444 Ga0207679_10014006 3300025945 Bacteria 5260
445 Ga0207667_10000107 3300025949 Bacteria 133066
446 Ga0207667_10001086 3300025949 Bacteria 34513
447 Ga0207667_10011124 3300025949 Bacteria 10475
448 Ga0207667_10011437 3300025949 Bacteria 10315
449 Ga0207667_10022885 3300025949 Bacteria 6890
450 Ga0207667_10032459 3300025949 Bacteria 5626
451 Ga0207667_10038356 3300025949 Bacteria 5118
452 Ga0207667_10054554 3300025949 Bacteria 4203
453 Ga0207667_10166349 3300025949 Bacteria 2267
454 Ga0207667_10210158 3300025949 Bacteria 1994
455 Ga0207651_10001281 3300025960 Bacteria 11309
456 Ga0207651_10018709 3300025960 Bacteria 4131
457 Ga0207651_10029319 3300025960 Bacteria 3485
458 Ga0207651_10032768 3300025960 Bacteria 3342
459 Ga0207651_10088707 3300025960 Bacteria 2255
460 Ga0207651_10119364 3300025960 Bacteria 1996
461 Ga0207712_10001479 3300025961 Bacteria 16004
462 Ga0207668_10000193 3300025972 Bacteria 41849
463 Ga0207668_10006265 3300025972 Bacteria 7029
464 Ga0207668_10021104 3300025972 Bacteria 4150
465 Ga0207668_10024698 3300025972 Bacteria 3882
466 Ga0207668_10094671 3300025972 Bacteria 2203
467 Ga0207668_10204693 3300025972 Bacteria 1574
468 Ga0207640_10007283 3300025981 Bacteria 6104
469 Ga0207640_10015302 3300025981 Bacteria 4438
470 Ga0207640_10041766 3300025981 Bacteria 2919
471 Ga0207658_10003493 3300025986 Bacteria 11092
472 Ga0207658_10003904 3300025986 Bacteria 10483
473 Ga0207658_10012446 3300025986 Bacteria 5812
474 Ga0207658_10032938 3300025986 Bacteria 3693
475 Ga0207658_10043745 3300025986 Bacteria 3257
476 Ga0207658_10046834 3300025986 Bacteria 3160
477 Ga0207677_10018010 3300026023 Bacteria 4230
478 Ga0207677_10058563 3300026023 Bacteria 2653
479 Ga0207677_10113305 3300026023 Bacteria 2024
480 Ga0207703_10000314 3300026035 Bacteria 52654
481 Ga0207703_10001377 3300026035 Bacteria 22204
482 Ga0207703_10002355 3300026035 Bacteria 16457
483 Ga0207703_10004554 3300026035 Bacteria 11363
484 Ga0207703_10006290 3300026035 Bacteria 9494
485 Ga0207703_10022775 3300026035 Bacteria 4921
486 Ga0207703_10097238 3300026035 Bacteria 2487
487 Ga0207639_10000725 3300026041 Bacteria 22513
488 Ga0207639_10002865 3300026041 Bacteria 11588
489 Ga0207639_10006890 3300026041 Bacteria 7741
490 Ga0207639_10113263 3300026041 Bacteria 2215
491 Ga0207678_10000766 3300026067 Bacteria 29323
492 Ga0207678_10001860 3300026067 Bacteria 19290
493 Ga0207678_10003559 3300026067 Bacteria 14013
494 Ga0207678_10005883 3300026067 Bacteria 10934
495 Ga0207678_10018453 3300026067 Bacteria 6126
496 Ga0207678_10019547 3300026067 Bacteria 5952
497 Ga0207678_10028351 3300026067 Bacteria 4888
498 Ga0207678_10056767 3300026067 Bacteria 3370
499 Ga0207678_10087586 3300026067 Bacteria 2661
500 Ga0207678_10114328 3300026067 Bacteria 2303
501 Ga0207678_10136169 3300026067 Bacteria 2095
502 Ga0207702_10002349 3300026078 Bacteria 18050
503 Ga0207702_10009679 3300026078 Bacteria 8092
504 Ga0207702_10020040 3300026078 Bacteria 5542
505 Ga0207702_10024826 3300026078 Bacteria 4972
506 Ga0207702_10036416 3300026078 Bacteria 4116
507 Ga0207641_10002148 3300026088 Bacteria 18577
508 Ga0207641_10015693 3300026088 Bacteria 6206
509 Ga0207641_10015705 3300026088 Bacteria 6204
510 Ga0207641_10030647 3300026088 Bacteria 4456
511 Ga0207648_10008226 3300026089 Bacteria 10127
512 Ga0207648_10015674 3300026089 Bacteria 6959
513 Ga0207648_10036614 3300026089 Bacteria 4323
514 Ga0207648_10038444 3300026089 Bacteria 4210
515 Ga0207648_10108607 3300026089 Bacteria 2435
516 Ga0207676_10000266 3300026095 Bacteria 45449
517 Ga0207676_10001670 3300026095 Bacteria 16351
518 Ga0207676_10015413 3300026095 Bacteria 5513
519 Ga0207676_10029323 3300026095 Bacteria 4118
520 Ga0207676_10119298 3300026095 Bacteria 2221
521 Ga0207674_10000347 3300026116 Bacteria 59568
522 Ga0207674_10001348 3300026116 Bacteria 31762
523 Ga0207674_10006876 3300026116 Bacteria 13329
524 Ga0207674_10007182 3300026116 Bacteria 13002
525 Ga0207674_10015096 3300026116 Bacteria 8501
526 Ga0207675_100000078 3300026118 Bacteria 75565
527 Ga0207675_100012623 3300026118 Bacteria 7893
528 Ga0207683_10002012 3300026121 Bacteria 17987
529 Ga0207683_10007048 3300026121 Bacteria 9638
530 Ga0207683_10039360 3300026121 Bacteria 4124
531 Ga0207698_10000435 3300026142 Bacteria 24060
532 Ga0207698_10001498 3300026142 Bacteria 13598
533 Ga0207698_10001522 3300026142 Bacteria 13500
534 Ga0207698_10002732 3300026142 Bacteria 10512
535 Ga0207698_10003563 3300026142 Bacteria 9392
536 Ga0207698_10004314 3300026142 Bacteria 8662
537 Ga0207698_10016372 3300026142 Bacteria 4994
538 Ga0207698_10037815 3300026142 Bacteria 3559
539 Ga0207698_10059612 3300026142 Bacteria 2964
540 Ga0207698_10073087 3300026142 Bacteria 2729
541 Ga0207698_10083458 3300026142 Bacteria 2586
542 Ga0207698_10172312 3300026142 Bacteria 1907
543 Ga0209281_1010293 3300027111 Bacteria 2149
544 Ga0209813_10000122 3300027866 Bacteria 28118
545 Ga0268266_10000002 3300028379 Bacteria 3059047
546 Ga0268266_10001757 3300028379 Bacteria 24717
547 Ga0268266_10002440 3300028379 Bacteria 19956
548 Ga0268266_10006728 3300028379 Bacteria 10483
549 Ga0268266_10068949 3300028379 Bacteria 3063
550 Ga0268265_10008726 3300028380 Bacteria 6854
551 Ga0268265_10056551 3300028380 Bacteria 2985
552 Ga0268265_10179982 3300028380 Bacteria 1815
553 Ga0268264_10002233 3300028381 Bacteria 17176
554 Ga0268264_10003251 3300028381 Bacteria 14056
555 Ga0268264_10006977 3300028381 Bacteria 9481
556 Ga0307517_10042939 3300028786 Bacteria 4831
557 Ga0307408_100003140 3300031548 Bacteria 11380
558 Ga0307408_100004067 3300031548 Bacteria 9974
559 Ga0307408_100018685 3300031548 Bacteria 4658
560 Ga0307408_100032161 3300031548 Bacteria 3657
561 Ga0307408_100039634 3300031548 Bacteria 3332
562 Ga0307408_100054972 3300031548 Bacteria 2880
563 Ga0307405_10024034 3300031731 Bacteria 3475
564 Ga0307405_10114775 3300031731 Bacteria 1831
565 Ga0307413_10000139 3300031824 Bacteria 19243
566 Ga0307413_10002683 3300031824 Bacteria 7294
567 Ga0307413_10009251 3300031824 Bacteria 4706
568 Ga0307413_10020505 3300031824 Bacteria 3517
569 Ga0307413_10030085 3300031824 Bacteria 3046
570 Ga0307413_10059049 3300031824 Bacteria 2355
571 Ga0307413_10118389 3300031824 Bacteria 1788
572 Ga0307410_10000619 3300031852 Bacteria 14637
573 Ga0307410_10000651 3300031852 Bacteria 14307
574 Ga0307410_10003266 3300031852 Bacteria 8093
575 Ga0307410_10009790 3300031852 Bacteria 5395
576 Ga0307410_10012640 3300031852 Bacteria 4891
577 Ga0307410_10019193 3300031852 Bacteria 4153
578 Ga0307410_10034526 3300031852 Bacteria 3276
579 Ga0307410_10068799 3300031852 Bacteria 2446
580 Ga0307410_10069875 3300031852 Bacteria 2430
581 Ga0307410_10072899 3300031852 Bacteria 2386
582 Ga0307410_10087122 3300031852 Bacteria 2208
583 Ga0307406_10012877 3300031901 Bacteria 4777
584 Ga0307406_10035147 3300031901 Bacteria 3079
585 Ga0307406_10058971 3300031901 Bacteria 2468
586 Ga0307406_10120451 3300031901 Bacteria 1823
587 Ga0307407_10005544 3300031903 Bacteria 5490
588 Ga0307407_10006410 3300031903 Bacteria 5225
589 Ga0307407_10007250 3300031903 Bacteria 5010
590 Ga0307407_10108338 3300031903 Bacteria 1739
591 Ga0307412_10001209 3300031911 Bacteria 14667
592 Ga0307412_10001748 3300031911 Bacteria 12005
593 Ga0307412_10005139 3300031911 Bacteria 7328
594 Ga0307412_10033365 3300031911 Bacteria 3271
595 Ga0307412_10101613 3300031911 Bacteria 2035
596 Ga0307409_100003140 3300031995 Bacteria 8876
597 Ga0307409_100004723 3300031995 Bacteria 7713
598 Ga0307409_100013078 3300031995 Bacteria 5322
599 Ga0307409_100017882 3300031995 Bacteria 4742
600 Ga0307409_100035225 3300031995 Bacteria 3665
601 Ga0307409_100087147 3300031995 Bacteria 2543
602 Ga0307416_100024325 3300032002 Bacteria 4418
603 Ga0307416_100033774 3300032002 Bacteria 3883
604 Ga0307416_100048350 3300032002 Bacteria 3374
605 Ga0307416_100103978 3300032002 Bacteria 2481
606 Ga0307416_100145905 3300032002 Bacteria 2160
607 Ga0307414_10004677 3300032004 Bacteria 7462
608 Ga0307414_10022460 3300032004 Bacteria 3979
609 Ga0307414_10080880 3300032004 Bacteria 2377
610 Ga0307414_10086395 3300032004 Bacteria 2314
611 Ga0307414_10117535 3300032004 Bacteria 2037
612 Ga0307411_10000463 3300032005 Bacteria 14041
613 Ga0307411_10001218 3300032005 Bacteria 10212
614 Ga0307411_10007038 3300032005 Bacteria 5688
615 Ga0307411_10015109 3300032005 Bacteria 4323
616 Ga0307411_10019087 3300032005 Bacteria 3950
617 Ga0307411_10021157 3300032005 Bacteria 3800
618 Ga0307411_10030333 3300032005 Bacteria 3313
619 Ga0307411_10068395 3300032005 Bacteria 2393
620 Ga0307411_10076033 3300032005 Bacteria 2294
621 Ga0307415_100000243 3300032126 Bacteria 23624
622 Ga0307415_100005402 3300032126 Bacteria 6781
623 Ga0307415_100011470 3300032126 Bacteria 5074
624 Ga0307415_100013777 3300032126 Bacteria 4730
625 Ga0307415_100026221 3300032126 Bacteria 3672
626 Ga0373923_0004243 3300035111 Bacteria 4734
627 Ga0373953_0036630 3300035117 Bacteria 1933
628 Ga0373943_0011615 3300035170 Bacteria 3963
629 Ga0373961_0005268 3300035241 Bacteria 3111
630 Ga0373931_0006860 3300035691 Bacteria 5353
631 Ga0373931_0052663 3300035691 Bacteria 2170
632 Ga0373937_0026424 3300036401 Bacteria 5246
633 Ga0395899_0000387 3300037312 Bacteria 52472
634 Ga0395899_0000419 3300037312 Bacteria 49177
635 Ga0395899_0001750 3300037312 Bacteria 18054
636 Ga0395899_0006476 3300037312 Bacteria 9073
637 Ga0395899_0008340 3300037312 Bacteria 7978
638 Ga0395899_0013085 3300037312 Bacteria 6345
639 Ga0395899_0023263 3300037312 Bacteria 4696
640 Ga0395899_0033818 3300037312 Bacteria 3839
641 Ga0395899_0035634 3300037312 Bacteria 3735
642 Ga0395899_0037193 3300037312 Bacteria 3649
643 Ga0395899_0078520 3300037312 Bacteria 2406
644 Ga0395899_0127337 3300037312 Bacteria 1820
645 Ga0395900_0000130 3300037418 Bacteria 126231
646 Ga0395900_0000572 3300037418 Bacteria 50991
647 Ga0395900_0003659 3300037418 Bacteria 16533
648 Ga0395900_0005352 3300037418 Bacteria 13449
649 Ga0395900_0012536 3300037418 Bacteria 8672
650 Ga0395900_0022296 3300037418 Bacteria 6478
651 Ga0395900_0039940 3300037418 Bacteria 4836
652 Ga0395900_0052994 3300037418 Bacteria 4176
653 Ga0395900_0062610 3300037418 Bacteria 3824
654 Ga0395900_0063941 3300037418 Bacteria 3782
655 Ga0395900_0069065 3300037418 Bacteria 3631
656 Ga0395900_0081908 3300037418 Bacteria 3315
657 Ga0395900_0086409 3300037418 Bacteria 3223
658 Ga0395900_0101234 3300037418 Bacteria 2959
659 Ga0395900_0106565 3300037418 Bacteria 2879
660 Ga0395900_0120555 3300037418 Bacteria 2691
661 Ga0395900_0155414 3300037418 Bacteria 2336
662 Ga0395900_0190501 3300037418 Bacteria 2080
663 Ga0395900_0204971 3300037418 Bacteria 1993
664 Ga0395900_0259911 3300037418 Bacteria 1734
665 Ga0395900_0315448 3300037418 Bacteria 1545
666 Ga0395898_0000274 3300037466 Bacteria 125922
667 Ga0395898_0002801 3300037466 Bacteria 19982
668 Ga0395898_0007664 3300037466 Bacteria 11462
669 Ga0395898_0011442 3300037466 Bacteria 9216
670 Ga0395898_0045955 3300037466 Bacteria 4290
671 Ga0395898_0061837 3300037466 Bacteria 3637
672 Ga0395898_0067016 3300037466 Bacteria 3477
673 Ga0395898_0067930 3300037466 Bacteria 3450
674 Ga0395898_0070029 3300037466 Bacteria 3392
675 Ga0395898_0075486 3300037466 Bacteria 3256
676 Ga0395898_0079117 3300037466 Bacteria 3171
677 Ga0395905_0000165 3300037471 Bacteria 109385
678 Ga0395905_0000287 3300037471 Bacteria 73803
679 Ga0395905_0001408 3300037471 Bacteria 29105
680 Ga0395905_0001429 3300037471 Bacteria 28769
681 Ga0395905_0003581 3300037471 Bacteria 16529
682 Ga0395905_0005698 3300037471 Bacteria 12656
683 Ga0395905_0006659 3300037471 Bacteria 11584
684 Ga0395905_0006715 3300037471 Bacteria 11520
685 Ga0395905_0015997 3300037471 Bacteria 7130
686 Ga0395905_0020773 3300037471 Bacteria 6217
687 Ga0395905_0021508 3300037471 Bacteria 6099
688 Ga0395905_0023872 3300037471 Bacteria 5773
689 Ga0395905_0024929 3300037471 Bacteria 5643
690 Ga0395905_0027305 3300037471 Bacteria 5383
691 Ga0395905_0042894 3300037471 Bacteria 4244
692 Ga0395905_0043776 3300037471 Bacteria 4199
693 Ga0395905_0048914 3300037471 Bacteria 3961
694 Ga0395905_0060357 3300037471 Bacteria 3546
695 Ga0395905_0067605 3300037471 Bacteria 3347
696 Ga0395905_0077351 3300037471 Bacteria 3117
697 Ga0395905_0077877 3300037471 Bacteria 3106
698 Ga0395905_0082270 3300037471 Bacteria 3017
699 Ga0395905_0098434 3300037471 Bacteria 2747
700 Ga0395905_0102064 3300037471 Bacteria 2693
701 Ga0395905_0116785 3300037471 Bacteria 2508
702 Ga0395905_0135281 3300037471 Bacteria 2318
703 Ga0395905_0185166 3300037471 Bacteria 1954
704 Ga0436364_1265496 3300037853 Bacteria 15678
705 Ga0395901_0000030 3300038443 Bacteria 241916
706 Ga0395901_0000243 3300038443 Bacteria 68039
707 Ga0395901_0002288 3300038443 Bacteria 19530
708 Ga0395901_0004432 3300038443 Bacteria 14163
709 Ga0395901_0005970 3300038443 Bacteria 12329
710 Ga0395901_0012772 3300038443 Bacteria 8518
711 Ga0395901_0019952 3300038443 Bacteria 6858
712 Ga0395901_0023876 3300038443 Bacteria 6271
713 Ga0395901_0024647 3300038443 Bacteria 6177
714 Ga0395901_0031909 3300038443 Bacteria 5432
715 Ga0395901_0053302 3300038443 Bacteria 4202
716 Ga0395901_0066737 3300038443 Bacteria 3747
717 Ga0395901_0075085 3300038443 Bacteria 3526
718 Ga0395901_0079078 3300038443 Bacteria 3434
719 Ga0395901_0092319 3300038443 Bacteria 3169
720 Ga0395901_0095193 3300038443 Bacteria 3120
721 Ga0395901_0115813 3300038443 Bacteria 2815
722 Ga0395901_0120109 3300038443 Bacteria 2762
723 Ga0395901_0156287 3300038443 Bacteria 2395
724 Ga0436365_0011005 3300039437 Bacteria 74317
725 Ga0436365_1526301 3300039437 Bacteria 136420
726 Ga0436362_0287059 3300039453 Bacteria 76995
727 Ga0439458_0000668 3300042157 Bacteria 8838
728 Ga0439458_0000796 3300042157 Bacteria 8089
729 Ga0439464_0000946 3300042439 Bacteria 6549
730 Ga0466969_0006087 3300044656 Bacteria 6420
731 Ga0466969_0027746 3300044656 Bacteria 2898
732 Ga0466972_0045216 3300044658 Bacteria 2135
733 Ga0466966_0000709 3300044684 Bacteria 21117
734 Ga0466966_0005040 3300044684 Bacteria 8684
735 Ga0466966_0009822 3300044684 Bacteria 6342
736 Ga0466966_0014240 3300044684 Bacteria 5266
737 Ga0466966_0022956 3300044684 Bacteria 4087
738 Ga0466961_0001728 3300044693 Bacteria 13588
739 Ga0466963_0014177 3300044694 Bacteria 4911
740 Ga0466963_0029887 3300044694 Bacteria 3511
741 Ga0466963_0070474 3300044694 Bacteria 2351
742 Ga0466971_0000339 3300044719 Bacteria 17936
743 Ga0466968_0011086 3300044735 Bacteria 3507
744 Ga0466970_0003618 3300044765 Bacteria 7535
745 Ga0466970_0020876 3300044765 Bacteria 3408
746 Ga0466970_0126176 3300044765 Bacteria 1404
747 Ga0466957_0008392 3300044842 Bacteria 5875
748 Ga0466959_0017818 3300045049 Bacteria 5209
749 Ga0466958_0000054 3300045836 Bacteria 34351
750 Ga0466958_0120131 3300045836 Bacteria 1645
751 Ga0466967_0010874 3300045976 Bacteria 6856
752 Ga0466967_0026271 3300045976 Bacteria 4820
753 Ga0466967_0064773 3300045976 Bacteria 3251
754 Ga0466967_0189952 3300045976 Bacteria 1941
755 Ga0466967_0263509 3300045976 Bacteria 1649
756 Ga0495638_0000336 3300046460 Bacteria 59114
757 Ga0495585_0017532 3300046492 Bacteria 4137
758 Ga0495583_0002396 3300046506 Bacteria 16129
759 Ga0495583_0015943 3300046506 Bacteria 4062
760 Ga0495606_0002746 3300046507 Bacteria 19754
761 Ga0495643_0005356 3300046522 Bacteria 8689
762 Ga0495643_0006655 3300046522 Bacteria 7576
763 Ga0495648_0001627 3300046524 Bacteria 21807
764 Ga0495663_0003377 3300046525 Bacteria 4614
765 Ga0495598_0001515 3300046537 Bacteria 4635
766 Ga0495598_0002001 3300046537 Bacteria 4143
767 Ga0495621_0003177 3300046539 Bacteria 4502
768 Ga0495621_0015273 3300046539 Bacteria 2446
769 Ga0495622_0003984 3300046557 Bacteria 6897
770 Ga0495633_0001647 3300046558 Bacteria 16862
771 Ga0495633_0003068 3300046558 Bacteria 11362
772 Ga0495668_0000024 3300046616 Bacteria 359469
773 Ga0495668_0000325 3300046616 Bacteria 65404
774 Ga0495625_0000112 3300046660 Bacteria 124365
775 Ga0495625_0000727 3300046660 Bacteria 46264
776 Ga0495625_0002224 3300046660 Bacteria 21448
777 Ga0495659_0017344 3300046664 Bacteria 2385
778 Ga0495623_0056334 3300046679 Bacteria 2475
779 Ga0495669_0000221 3300046684 Bacteria 34153
780 Ga0495669_0000293 3300046684 Bacteria 28317
781 Ga0495669_0002650 3300046684 Bacteria 7328
782 Ga0495669_0006355 3300046684 Bacteria 4936
783 Ga0495669_0021682 3300046684 Bacteria 2790
784 Ga0495670_0005527 3300046691 Bacteria 6201
785 Ga0495670_0026043 3300046691 Bacteria 2895
786 Ga0495600_0009475 3300046809 Bacteria 6018
787 Ga0495683_0002822 3300047323 Bacteria 10294
788 Ga0495687_000513 3300047443 Bacteria 46650
789 Ga0495687_005979 3300047443 Bacteria 7585
790 Ga0495681_0002815 3300047470 Bacteria 12305
791 Ga0495686_0000185 3300047472 Bacteria 116495
792 Ga0495686_0100864 3300047472 Bacteria 1741
793 Ga0495602_0014578 3300048088 Bacteria 7974
794 Ga0496100_0005041 3300048903 Bacteria 7066
795 Ga0496101_0208146 3300048904 Bacteria 1514
796 Ga0496102_0003117 3300048905 Bacteria 14065
797 Ga0496102_0077395 3300048905 Bacteria 3061
798 Ga0496105_0000481 3300048908 Bacteria 26219
799 Ga0496106_0014816 3300048909 Bacteria 5766
800 Ga0496106_0053256 3300048909 Bacteria 3056
801 Ga0496107_0058599 3300048910 Bacteria 2785
802 Ga0496107_0117944 3300048910 Bacteria 1954
803 Ga0496108_0001272 3300048911 Bacteria 19736
804 Ga0496108_0008736 3300048911 Bacteria 8214
805 Ga0496108_0031252 3300048911 Bacteria 4416
806 Ga0496109_0003815 3300048912 Bacteria 12585
807 Ga0496109_0037089 3300048912 Bacteria 4403
808 Ga0496109_0059815 3300048912 Bacteria 3481
809 Ga0496109_0078167 3300048912 Bacteria 3046
810 Ga0496109_0109985 3300048912 Bacteria 2562
811 Ga0496110_0001131 3300048913 Bacteria 18835
812 Ga0496110_0005464 3300048913 Bacteria 9968
813 Ga0496110_0019874 3300048913 Bacteria 5661
814 Ga0496110_0061837 3300048913 Bacteria 3306
815 Ga0496111_0002242 3300048914 Bacteria 11611
816 Ga0496111_0004595 3300048914 Bacteria 8738
817 Ga0496111_0125961 3300048914 Bacteria 1893
818 Ga0496112_0008275 3300048915 Bacteria 9307
819 Ga0496112_0091300 3300048915 Bacteria 3014
820 Ga0496112_0140527 3300048915 Bacteria 2384
821 Ga0496113_0004166 3300048916 Bacteria 8831
822 Ga0496113_0009708 3300048916 Bacteria 6323
823 Ga0496113_0084883 3300048916 Bacteria 2431
824 Ga0496113_0182741 3300048916 Bacteria 1662
825 Ga0496114_0000019 3300048917 Bacteria 244365
826 Ga0496114_0015261 3300048917 Bacteria 6176
827 Ga0496114_0026195 3300048917 Bacteria 4773
828 Ga0496114_0041852 3300048917 Bacteria 3796
829 Ga0496115_0002119 3300048918 Bacteria 14187
830 Ga0496115_0015645 3300048918 Bacteria 5759
831 Ga0496115_0026170 3300048918 Bacteria 4550
832 Ga0496117_0004108 3300048920 Bacteria 16312
833 Ga0496118_0000989 3300048921 Bacteria 44266
834 Ga0496121_0000367 3300048924 Bacteria 92745
835 Ga0496121_0006798 3300048924 Bacteria 14014
836 Ga0496124_0000050 3300048927 Bacteria 258041
837 Ga0496125_0002189 3300048928 Bacteria 26097
838 Ga0496126_0005697 3300048929 Bacteria 14113
839 Ga0501031_0077556 3300049568 Bacteria 2164
840 Ga0501033_0013635 3300049570 Bacteria 6185
841 Ga0501034_0007685 3300049571 Bacteria 11471
842 Ga0501036_0047084 3300049572 Bacteria 3652
843 Ga0501043_0023159 3300049579 Bacteria 4872
844 Ga0501074_0039006 3300049590 Bacteria 3440
845 Ga0501080_0012158 3300049742 Bacteria 7889
846 Ga0501035_0021879 3300049822 Bacteria 5874
847 Ga0501044_0023393 3300049823 Bacteria 6571
848 nmdc:mga03683_130_c1 3300050489 Bacteria 24999
849 nmdc:mga03683_8_c1 3300050489 Bacteria 138266
850 nmdc:mga03n38_704_c1 3300050490 Bacteria 8762
851 nmdc:mga0k408_101712_c1 3300050493 Bacteria 1695
852 nmdc:mga0k408_212_c1 3300050493 Bacteria 31209
853 nmdc:mga06z11_8620_c1 3300050494 Bacteria 4264
854 nmdc:mga04h51_548_c1 3300050495 Bacteria 8962
855 nmdc:mga07m45_1249_c1 3300050496 Bacteria 11550
856 nmdc:mga0a205_1890_c1 3300050515 Bacteria 18175
857 nmdc:mga0sz30_2721_c1 3300050516 Bacteria 6307
858 nmdc:mga0sz30_6989_c1 3300050516 Bacteria 4218
859 Ga0500610_0000595 3300053079 Bacteria 11091
860 Ga0500643_000702 3300053087 Bacteria 22236
861 Ga0500595_000166 3300053119 Bacteria 43537
862 Ga0500607_002050 3300053121 Bacteria 16931
863 Ga0500658_0001416 3300053134 Bacteria 9661
864 Ga0500559_0002752 3300053136 Bacteria 8923
865 Ga0500559_0004233 3300053136 Bacteria 6866
866 Ga0500627_0000068 3300053158 Bacteria 44198
867 Ga0500645_000138 3300053730 Bacteria 57099
868 Ga0500645_004660 3300053730 Bacteria 5219
869 Ga0466962_0004642 3300061719 Bacteria 6599
870 Ga0466962_0008135 3300061719 Bacteria 5028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0127337 Ga0395899_0127337_457_1782 441
2 3300037471 Ga0395905_0102064 Ga0395905_0102064_36_1361 441
3 3300044765 Ga0466970_0126176 Ga0466970_0126176_52_1377 441
4 3300009177 Ga0105248_10004323 Ga0105248_1000432317 448
5 3300035241 Ga0373961_0005268 Ga0373961_0005268_557_1975 472
6 3300005347 Ga0070668_100000417 Ga0070668_1000004174 473
7 3300005353 Ga0070669_100021625 Ga0070669_1000216252 473
8 3300005364 Ga0070673_100048393 Ga0070673_1000483932 473
9 3300005367 Ga0070667_100075673 Ga0070667_1000756732 473
10 3300025923 Ga0207681_10010338 Ga0207681_100103382 473
11 3300025960 Ga0207651_10032768 Ga0207651_100327682 473
12 3300025972 Ga0207668_10000193 Ga0207668_1000019318 473
13 3300026089 Ga0207648_10038444 Ga0207648_100384443 473
14 3300026121 Ga0207683_10039360 Ga0207683_100393603 473
15 3300031824 Ga0307413_10002683 Ga0307413_100026832 473
16 3300031824 Ga0307413_10030085 Ga0307413_100300852 473
17 3300031852 Ga0307410_10072899 Ga0307410_100728992 473
18 3300032004 Ga0307414_10086395 Ga0307414_100863952 473
19 3300032005 Ga0307411_10007038 Ga0307411_100070384 473
20 3300032005 Ga0307411_10030333 Ga0307411_100303332 473
21 3300003759 Ga0055525_1000104 Ga0055525_100010478 475
22 3300025230 Ga0209563_100116 Ga0209563_10011660 475
23 3300025931 Ga0207644_10019091 Ga0207644_100190911 477
24 3300025941 Ga0207711_10059984 Ga0207711_100599842 477
25 3300026095 Ga0207676_10119298 Ga0207676_101192982 477
26 3300048916 Ga0496113_0009708 Ga0496113_0009708_2067_3545 477
27 3300005347 Ga0070668_100112446 Ga0070668_1001124461 478
28 3300025937 Ga0207669_10003287 Ga0207669_100032873 478
29 3300025972 Ga0207668_10204693 Ga0207668_102046931 478
30 3300046616 Ga0495668_0000325 Ga0495668_0000325_15424_16911 478
31 iso_pu_bacteria 8057101203 8057103107 479
32 3300037312 Ga0395899_0013085 Ga0395899_0013085_2411_3859 481
33 3300037471 Ga0395905_0077351 Ga0395905_0077351_1059_2507 481
34 3300044735 Ga0466968_0011086 Ga0466968_0011086_1725_3182 481
35 3300045976 Ga0466967_0263509 Ga0466967_0263509_51_1502 482
36 iso_pu_bacteria 2643221560 2643822464 482
37 iso_pu_bacteria 2643221563 2643833518 482
38 iso_pu_bacteria 2643221608 2644054445 482
39 iso_pu_bacteria 2852653556 2852656775 482
40 iso_pu_bacteria 2852680915 2852682023 482
41 3300005719 Ga0068861_100107843 Ga0068861_1001078432 483
42 3300006881 Ga0068865_100083442 Ga0068865_1000834422 483
43 3300013100 Ga0157373_10017322 Ga0157373_100173222 483
44 3300025938 Ga0207704_10124861 Ga0207704_101248611 483
45 3300025940 Ga0207691_10052924 Ga0207691_100529242 483
46 3300026118 Ga0207675_100012623 Ga0207675_1000126239 483
47 iso_pu_bacteria 2739367664 2739648774 483
48 iso_pu_bacteria 2739367865 2740027247 483
49 iso_pu_bacteria 2885427238 2885428263 483
50 iso_pu_bacteria 2885429604 2885429645 483
51 iso_pu_bacteria 2896429255 2896430168 483
52 iso_pu_bacteria 2946787523 2946789064 483
53 iso_pu_bacteria 2990265787 2990266635 483
54 iso_pu_bacteria 2993693658 2993695566 483
55 3300001990 JGI24737J22298_10008534 JGI24737J22298_100085342 484
56 3300002067 JGI24735J21928_10013571 JGI24735J21928_100135712 484
57 3300002075 JGI24738J21930_10001196 JGI24738J21930_100011965 484
58 3300003214 JGI25165J46597_1000012 JGI25165J46597_1000012328 484
59 3300005327 Ga0070658_10000001 Ga0070658_10000001549 484
60 3300005327 Ga0070658_10000453 Ga0070658_1000045331 484
61 3300005327 Ga0070658_10046392 Ga0070658_100463923 484
62 3300005329 Ga0070683_100015500 Ga0070683_1000155008 484
63 3300005335 Ga0070666_10006651 Ga0070666_100066514 484
64 3300005336 Ga0070680_100006192 Ga0070680_1000061921 484
65 3300005336 Ga0070680_100135257 Ga0070680_1001352572 484
66 3300005337 Ga0070682_100009672 Ga0070682_1000096725 484
67 3300005339 Ga0070660_100000488 Ga0070660_1000004886 484
68 3300005339 Ga0070660_100002721 Ga0070660_10000272110 484
69 3300005339 Ga0070660_100002844 Ga0070660_10000284410 484
70 3300005344 Ga0070661_100000010 Ga0070661_10000001093 484
71 3300005344 Ga0070661_100000311 Ga0070661_1000003116 484
72 3300005344 Ga0070661_100125974 Ga0070661_1001259741 484
73 3300005345 Ga0070692_10007634 Ga0070692_100076343 484
74 3300005366 Ga0070659_100000594 Ga0070659_10000059425 484
75 3300005367 Ga0070667_100022365 Ga0070667_1000223655 484
76 3300005435 Ga0070714_100170522 Ga0070714_1001705221 484
77 3300005457 Ga0070662_100000198 Ga0070662_1000001986 484
78 3300005458 Ga0070681_10063695 Ga0070681_100636953 484
79 3300005530 Ga0070679_100000005 Ga0070679_10000000545 484
80 3300005539 Ga0068853_100000630 Ga0068853_1000006304 484
81 3300005547 Ga0070693_100003956 Ga0070693_1000039563 484
82 3300005548 Ga0070665_100002788 Ga0070665_10000278811 484
83 3300005563 Ga0068855_100030382 Ga0068855_1000303827 484
84 3300005563 Ga0068855_100142452 Ga0068855_1001424522 484
85 3300005564 Ga0070664_100000259 Ga0070664_1000002597 484
86 3300005577 Ga0068857_100014903 Ga0068857_1000149033 484
87 3300005614 Ga0068856_100000315 Ga0068856_10000031532 484
88 3300005616 Ga0068852_100000548 Ga0068852_10000054823 484
89 3300005616 Ga0068852_100002347 Ga0068852_10000234715 484
90 3300005617 Ga0068859_100010651 Ga0068859_1000106513 484
91 3300005618 Ga0068864_100002676 Ga0068864_1000026769 484
92 3300005719 Ga0068861_100000342 Ga0068861_10000034212 484
93 3300005842 Ga0068858_100000292 Ga0068858_10000029213 484
94 3300005842 Ga0068858_100004640 Ga0068858_1000046406 484
95 3300005844 Ga0068862_100010452 Ga0068862_1000104525 484
96 3300006881 Ga0068865_100038232 Ga0068865_1000382322 484
97 3300006931 Ga0097620_100010651 Ga0097620_1000106513 484
98 3300009177 Ga0105248_10000395 Ga0105248_1000039531 484
99 3300009177 Ga0105248_10000774 Ga0105248_1000077420 484
100 3300009545 Ga0105237_10073188 Ga0105237_100731882 484
101 3300009551 Ga0105238_10001671 Ga0105238_100016713 484
102 3300009551 Ga0105238_10016618 Ga0105238_100166183 484
103 3300013104 Ga0157370_10048117 Ga0157370_100481173 484
104 3300013105 Ga0157369_10003132 Ga0157369_1000313219 484
105 3300013306 Ga0163162_10037036 Ga0163162_100370366 484
106 3300014325 Ga0163163_10002393 Ga0163163_100023939 484
107 3300014968 Ga0157379_10044281 Ga0157379_100442813 484
108 3300015690 Ga0183363_1004 Ga0183363_100428 484
109 3300017792 Ga0163161_10003370 Ga0163161_1000337012 484
110 3300021358 Ga0213873_10000015 Ga0213873_10000015109 484
111 3300021384 Ga0213876_10000005 Ga0213876_10000005627 484
112 3300021384 Ga0213876_10000263 Ga0213876_1000026351 484
113 3300025261 Ga0209233_1000058 Ga0209233_100005890 484
114 3300025321 Ga0207656_10011235 Ga0207656_100112353 484
115 3300025903 Ga0207680_10001423 Ga0207680_100014234 484
116 3300025904 Ga0207647_10017322 Ga0207647_100173223 484
117 3300025909 Ga0207705_10000002 Ga0207705_100000021332 484
118 3300025909 Ga0207705_10000449 Ga0207705_100004497 484
119 3300025909 Ga0207705_10037372 Ga0207705_100373722 484
120 3300025912 Ga0207707_10080778 Ga0207707_100807783 484
121 3300025913 Ga0207695_10014084 Ga0207695_100140842 484
122 3300025914 Ga0207671_10065049 Ga0207671_100650492 484
123 3300025917 Ga0207660_10004430 Ga0207660_100044309 484
124 3300025919 Ga0207657_10001304 Ga0207657_1000130425 484
125 3300025919 Ga0207657_10002320 Ga0207657_1000232015 484
126 3300025919 Ga0207657_10003700 Ga0207657_1000370017 484
127 3300025920 Ga0207649_10000165 Ga0207649_1000016526 484
128 3300025920 Ga0207649_10003505 Ga0207649_100035056 484
129 3300025921 Ga0207652_10000036 Ga0207652_1000003644 484
130 3300025924 Ga0207694_10001620 Ga0207694_100016208 484
131 3300025924 Ga0207694_10016301 Ga0207694_100163012 484
132 3300025927 Ga0207687_10000564 Ga0207687_1000056418 484
133 3300025931 Ga0207644_10011303 Ga0207644_100113034 484
134 3300025932 Ga0207690_10000257 Ga0207690_1000025716 484
135 3300025933 Ga0207706_10001176 Ga0207706_100011766 484
136 3300025938 Ga0207704_10028858 Ga0207704_100288582 484
137 3300025941 Ga0207711_10000427 Ga0207711_1000042732 484
138 3300025941 Ga0207711_10001486 Ga0207711_1000148613 484
139 3300025944 Ga0207661_10001889 Ga0207661_100018898 484
140 3300025945 Ga0207679_10000463 Ga0207679_1000046319 484
141 3300025949 Ga0207667_10011124 Ga0207667_100111248 484
142 3300025949 Ga0207667_10011437 Ga0207667_1001143711 484
143 3300025949 Ga0207667_10032459 Ga0207667_100324592 484
144 3300025986 Ga0207658_10043745 Ga0207658_100437452 484
145 3300026035 Ga0207703_10000314 Ga0207703_1000031432 484
146 3300026035 Ga0207703_10004554 Ga0207703_1000455410 484
147 3300026035 Ga0207703_10006290 Ga0207703_100062908 484
148 3300026041 Ga0207639_10000725 Ga0207639_1000072516 484
149 3300026067 Ga0207678_10028351 Ga0207678_100283514 484
150 3300026078 Ga0207702_10002349 Ga0207702_1000234910 484
151 3300026078 Ga0207702_10036416 Ga0207702_100364163 484
152 3300026095 Ga0207676_10000266 Ga0207676_1000026612 484
153 3300026116 Ga0207674_10001348 Ga0207674_1000134812 484
154 3300026116 Ga0207674_10015096 Ga0207674_100150966 484
155 3300026118 Ga0207675_100000078 Ga0207675_10000007812 484
156 3300026142 Ga0207698_10000435 Ga0207698_100004353 484
157 3300026142 Ga0207698_10001522 Ga0207698_100015224 484
158 3300026142 Ga0207698_10002732 Ga0207698_100027322 484
159 3300026142 Ga0207698_10003563 Ga0207698_100035638 484
160 3300027111 Ga0209281_1010293 Ga0209281_10102932 484
161 3300028379 Ga0268266_10006728 Ga0268266_100067287 484
162 3300028380 Ga0268265_10008726 Ga0268265_100087263 484
163 3300031911 Ga0307412_10101613 Ga0307412_101016132 484
164 3300032002 Ga0307416_100145905 Ga0307416_1001459052 484
165 3300035691 Ga0373931_0052663 Ga0373931_0052663_95_1561 484
166 3300037312 Ga0395899_0006476 Ga0395899_0006476_3342_4811 484
167 3300037312 Ga0395899_0035634 Ga0395899_0035634_2086_3555 484
168 3300037418 Ga0395900_0005352 Ga0395900_0005352_7437_8906 484
169 3300037418 Ga0395900_0052994 Ga0395900_0052994_198_1664 484
170 3300037418 Ga0395900_0081908 Ga0395900_0081908_1118_2584 484
171 3300037418 Ga0395900_0101234 Ga0395900_0101234_924_2390 484
172 3300037418 Ga0395900_0155414 Ga0395900_0155414_370_1836 484
173 3300037418 Ga0395900_0259911 Ga0395900_0259911_65_1534 484
174 3300037466 Ga0395898_0002801 Ga0395898_0002801_7802_9271 484
175 3300037466 Ga0395898_0067016 Ga0395898_0067016_1998_3467 484
176 3300037471 Ga0395905_0027305 Ga0395905_0027305_2823_4289 484
177 3300037471 Ga0395905_0043776 Ga0395905_0043776_1163_2632 484
178 3300037471 Ga0395905_0135281 Ga0395905_0135281_735_2201 484
179 3300038443 Ga0395901_0000243 Ga0395901_0000243_56698_58167 484
180 3300038443 Ga0395901_0002288 Ga0395901_0002288_10094_11563 484
181 3300038443 Ga0395901_0031909 Ga0395901_0031909_3306_4775 484
182 3300038443 Ga0395901_0095193 Ga0395901_0095193_521_1993 484
183 3300039437 Ga0436365_0011005 Ga0436365_0011005_48168_49643 484
184 3300039437 Ga0436365_1526301 Ga0436365_1526301_39788_41266 484
185 3300039453 Ga0436362_0287059 Ga0436362_0287059_48168_49643 484
186 3300044684 Ga0466966_0022956 Ga0466966_0022956_441_1910 484
187 3300044694 Ga0466963_0014177 Ga0466963_0014177_2348_3817 484
188 3300045836 Ga0466958_0120131 Ga0466958_0120131_49_1521 484
189 3300045976 Ga0466967_0064773 Ga0466967_0064773_596_2065 484
190 3300046660 Ga0495625_0000112 Ga0495625_0000112_115735_117216 484
191 3300047472 Ga0495686_0100864 Ga0495686_0100864_66_1538 484
192 3300048924 Ga0496121_0000367 Ga0496121_0000367_41239_42711 484
193 3300049590 Ga0501074_0039006 Ga0501074_0039006_1460_2926 484
194 3300049742 Ga0501080_0012158 Ga0501080_0012158_2589_4055 484
195 3300053087 Ga0500643_000702 Ga0500643_000702_12299_13774 484
196 iso_pu_bacteria 2599185354 2600200579 484
197 iso_pu_bacteria 2751185897 2753763640 484
198 iso_pu_bacteria 2830075706 2830076582 484
199 3300005366 Ga0070659_100032584 Ga0070659_1000325844 485
200 3300013308 Ga0157375_10090319 Ga0157375_100903192 485
201 3300048917 Ga0496114_0026195 Ga0496114_0026195_821_2290 485
202 3300001989 JGI24739J22299_10007482 JGI24739J22299_100074822 486
203 3300003762 Ga0055542_1000025 Ga0055542_1000025244 486
204 3300003763 Ga0055529_1000014 Ga0055529_10000149 486
205 3300003781 Ga0055536_1001462 Ga0055536_10014627 486
206 3300003781 Ga0055536_1005390 Ga0055536_10053904 486
207 3300003794 Ga0055531_10001396 Ga0055531_1000139613 486
208 3300005293 Ga0065715_10140700 Ga0065715_101407001 486
209 3300005327 Ga0070658_10000608 Ga0070658_1000060819 486
210 3300005331 Ga0070670_100000926 Ga0070670_1000009264 486
211 3300005344 Ga0070661_100001265 Ga0070661_1000012656 486
212 3300005356 Ga0070674_100003585 Ga0070674_1000035854 486
213 3300005457 Ga0070662_100006163 Ga0070662_1000061638 486
214 3300005543 Ga0070672_100001700 Ga0070672_10000170012 486
215 3300005548 Ga0070665_100000186 Ga0070665_10000018699 486
216 3300005563 Ga0068855_100070013 Ga0068855_1000700132 486
217 3300005617 Ga0068859_100013157 Ga0068859_1000131575 486
218 3300005834 Ga0068851_10027670 Ga0068851_100276702 486
219 3300006847 Ga0075431_100006263 Ga0075431_1000062634 486
220 3300006931 Ga0097620_100013157 Ga0097620_1000131575 486
221 3300009094 Ga0111539_10102475 Ga0111539_101024752 486
222 3300009148 Ga0105243_10000917 Ga0105243_1000091720 486
223 3300009174 Ga0105241_10004599 Ga0105241_100045996 486
224 3300013100 Ga0157373_10016724 Ga0157373_100167246 486
225 3300013102 Ga0157371_10000183 Ga0157371_100001835 486
226 3300014326 Ga0157380_10106562 Ga0157380_101065622 486
227 3300025254 Ga0209148_1000011 Ga0209148_100001111 486
228 3300025272 Ga0209455_1000006 Ga0209455_10000061183 486
229 3300025291 Ga0209675_1000126 Ga0209675_100012627 486
230 3300025292 Ga0209676_1000060 Ga0209676_1000060298 486
231 3300025292 Ga0209676_1000148 Ga0209676_1000148137 486
232 3300025297 Ga0209758_1000001 Ga0209758_1000001859 486
233 3300025298 Ga0209050_1000047 Ga0209050_100004750 486
234 3300025298 Ga0209050_1003236 Ga0209050_10032367 486
235 3300025304 Ga0209257_1000076 Ga0209257_10000766 486
236 3300025315 Ga0207697_10040015 Ga0207697_100400152 486
237 3300025321 Ga0207656_10001128 Ga0207656_100011285 486
238 3300025893 Ga0207682_10005730 Ga0207682_100057302 486
239 3300025904 Ga0207647_10025267 Ga0207647_100252674 486
240 3300025911 Ga0207654_10000986 Ga0207654_100009867 486
241 3300025914 Ga0207671_10010288 Ga0207671_100102882 486
242 3300025919 Ga0207657_10064793 Ga0207657_100647933 486
243 3300025920 Ga0207649_10000225 Ga0207649_1000022515 486
244 3300025923 Ga0207681_10000713 Ga0207681_100007132 486
245 3300025933 Ga0207706_10004436 Ga0207706_1000443611 486
246 3300025933 Ga0207706_10041704 Ga0207706_100417044 486
247 3300025935 Ga0207709_10000018 Ga0207709_1000001864 486
248 3300025937 Ga0207669_10000068 Ga0207669_1000006816 486
249 3300025940 Ga0207691_10000696 Ga0207691_1000069633 486
250 3300025949 Ga0207667_10000107 Ga0207667_1000010796 486
251 3300025972 Ga0207668_10006265 Ga0207668_100062655 486
252 3300025981 Ga0207640_10007283 Ga0207640_100072835 486
253 3300026041 Ga0207639_10006890 Ga0207639_100068907 486
254 3300026067 Ga0207678_10018453 Ga0207678_100184533 486
255 3300026078 Ga0207702_10024826 Ga0207702_100248262 486
256 3300026089 Ga0207648_10008226 Ga0207648_100082268 486
257 3300026121 Ga0207683_10007048 Ga0207683_100070487 486
258 3300028379 Ga0268266_10000002 Ga0268266_100000021856 486
259 3300028786 Ga0307517_10042939 Ga0307517_100429393 486
260 3300031824 Ga0307413_10000139 Ga0307413_1000013915 486
261 3300031824 Ga0307413_10059049 Ga0307413_100590492 486
262 3300031852 Ga0307410_10000651 Ga0307410_100006512 486
263 3300031911 Ga0307412_10001209 Ga0307412_1000120912 486
264 3300031995 Ga0307409_100017882 Ga0307409_1000178823 486
265 3300032004 Ga0307414_10004677 Ga0307414_100046772 486
266 3300032005 Ga0307411_10000463 Ga0307411_100004637 486
267 3300035170 Ga0373943_0011615 Ga0373943_0011615_1489_2997 486
268 3300037471 Ga0395905_0116785 Ga0395905_0116785_860_2335 486
269 3300046460 Ga0495638_0000336 Ga0495638_0000336_33703_35199 486
270 3300046492 Ga0495585_0017532 Ga0495585_0017532_1580_3067 486
271 3300046506 Ga0495583_0002396 Ga0495583_0002396_8031_9518 486
272 3300046506 Ga0495583_0015943 Ga0495583_0015943_880_2367 486
273 3300046507 Ga0495606_0002746 Ga0495606_0002746_13349_14836 486
274 3300046522 Ga0495643_0005356 Ga0495643_0005356_6101_7588 486
275 3300046522 Ga0495643_0006655 Ga0495643_0006655_2234_3721 486
276 3300046524 Ga0495648_0001627 Ga0495648_0001627_8957_10444 486
277 3300046525 Ga0495663_0003377 Ga0495663_0003377_88_1554 486
278 3300046557 Ga0495622_0003984 Ga0495622_0003984_4310_5797 486
279 3300046558 Ga0495633_0003068 Ga0495633_0003068_1977_3464 486
280 3300046616 Ga0495668_0000024 Ga0495668_0000024_99659_101131 486
281 3300046660 Ga0495625_0000727 Ga0495625_0000727_39592_41058 486
282 3300046660 Ga0495625_0002224 Ga0495625_0002224_13312_14799 486
283 3300046664 Ga0495659_0017344 Ga0495659_0017344_398_1873 486
284 3300046684 Ga0495669_0000221 Ga0495669_0000221_4700_6187 486
285 3300046809 Ga0495600_0009475 Ga0495600_0009475_89_1576 486
286 3300047323 Ga0495683_0002822 Ga0495683_0002822_6033_7520 486
287 3300047443 Ga0495687_000513 Ga0495687_000513_9128_10615 486
288 3300047443 Ga0495687_005979 Ga0495687_005979_2156_3643 486
289 3300047470 Ga0495681_0002815 Ga0495681_0002815_6751_8238 486
290 3300047472 Ga0495686_0000185 Ga0495686_0000185_97318_98805 486
291 3300048905 Ga0496102_0003117 Ga0496102_0003117_4824_6311 486
292 3300048918 Ga0496115_0002119 Ga0496115_0002119_7790_9277 486
293 3300048920 Ga0496117_0004108 Ga0496117_0004108_4940_6427 486
294 3300048921 Ga0496118_0000989 Ga0496118_0000989_38528_40015 486
295 3300048924 Ga0496121_0006798 Ga0496121_0006798_4781_6268 486
296 3300048927 Ga0496124_0000050 Ga0496124_0000050_8974_10461 486
297 3300048928 Ga0496125_0002189 Ga0496125_0002189_11246_12733 486
298 3300048929 Ga0496126_0005697 Ga0496126_0005697_4945_6432 486
299 3300049568 Ga0501031_0077556 Ga0501031_0077556_609_2081 486
300 3300049570 Ga0501033_0013635 Ga0501033_0013635_2242_3708 486
301 3300049571 Ga0501034_0007685 Ga0501034_0007685_6495_7961 486
302 3300049572 Ga0501036_0047084 Ga0501036_0047084_1000_2466 486
303 3300049579 Ga0501043_0023159 Ga0501043_0023159_191_1657 486
304 3300049822 Ga0501035_0021879 Ga0501035_0021879_2376_3842 486
305 3300049823 Ga0501044_0023393 Ga0501044_0023393_4374_5840 486
306 3300053079 Ga0500610_0000595 Ga0500610_0000595_3696_5183 486
307 3300053119 Ga0500595_000166 Ga0500595_000166_4925_6412 486
308 3300053134 Ga0500658_0001416 Ga0500658_0001416_4727_6190 486
309 3300053158 Ga0500627_0000068 Ga0500627_0000068_28678_30144 486
310 3300053730 Ga0500645_000138 Ga0500645_000138_15447_16934 486
311 3300001915 JGI24741J21665_1000431 JGI24741J21665_100043110 487
312 3300001979 JGI24740J21852_10005606 JGI24740J21852_100056063 487
313 3300001979 JGI24740J21852_10006044 JGI24740J21852_100060442 487
314 3300001989 JGI24739J22299_10012411 JGI24739J22299_100124113 487
315 3300001990 JGI24737J22298_10002753 JGI24737J22298_100027534 487
316 3300001990 JGI24737J22298_10008497 JGI24737J22298_100084973 487
317 3300001990 JGI24737J22298_10008709 JGI24737J22298_100087092 487
318 3300001990 JGI24737J22298_10034006 JGI24737J22298_100340061 487
319 3300005290 Ga0065712_10075956 Ga0065712_100759564 487
320 3300005327 Ga0070658_10013798 Ga0070658_100137982 487
321 3300005327 Ga0070658_10014330 Ga0070658_100143303 487
322 3300005327 Ga0070658_10048136 Ga0070658_100481363 487
323 3300005327 Ga0070658_10053350 Ga0070658_100533502 487
324 3300005327 Ga0070658_10059310 Ga0070658_100593102 487
325 3300005327 Ga0070658_10062122 Ga0070658_100621222 487
326 3300005329 Ga0070683_100015274 Ga0070683_1000152745 487
327 3300005329 Ga0070683_100033164 Ga0070683_1000331644 487
328 3300005329 Ga0070683_100073969 Ga0070683_1000739692 487
329 3300005329 Ga0070683_100083739 Ga0070683_1000837392 487
330 3300005330 Ga0070690_100057999 Ga0070690_1000579992 487
331 3300005331 Ga0070670_100004560 Ga0070670_1000045606 487
332 3300005331 Ga0070670_100006393 Ga0070670_1000063935 487
333 3300005331 Ga0070670_100010746 Ga0070670_1000107466 487
334 3300005331 Ga0070670_100014788 Ga0070670_1000147882 487
335 3300005331 Ga0070670_100036425 Ga0070670_1000364253 487
336 3300005331 Ga0070670_100095328 Ga0070670_1000953281 487
337 3300005331 Ga0070670_100108435 Ga0070670_1001084353 487
338 3300005335 Ga0070666_10000215 Ga0070666_100002158 487
339 3300005335 Ga0070666_10003971 Ga0070666_100039719 487
340 3300005335 Ga0070666_10068267 Ga0070666_100682672 487
341 3300005336 Ga0070680_100001375 Ga0070680_10000137515 487
342 3300005336 Ga0070680_100073235 Ga0070680_1000732352 487
343 3300005337 Ga0070682_100010477 Ga0070682_1000104773 487
344 3300005338 Ga0068868_100136713 Ga0068868_1001367132 487
345 3300005339 Ga0070660_100000196 Ga0070660_1000001966 487
346 3300005339 Ga0070660_100000678 Ga0070660_10000067821 487
347 3300005339 Ga0070660_100001380 Ga0070660_1000013801 487
348 3300005339 Ga0070660_100039724 Ga0070660_1000397242 487
349 3300005339 Ga0070660_100062123 Ga0070660_1000621233 487
350 3300005339 Ga0070660_100083550 Ga0070660_1000835502 487
351 3300005339 Ga0070660_100117032 Ga0070660_1001170322 487
352 3300005341 Ga0070691_10006411 Ga0070691_100064114 487
353 3300005344 Ga0070661_100015558 Ga0070661_1000155582 487
354 3300005344 Ga0070661_100021108 Ga0070661_1000211082 487
355 3300005344 Ga0070661_100052614 Ga0070661_1000526142 487
356 3300005347 Ga0070668_100029835 Ga0070668_1000298354 487
357 3300005353 Ga0070669_100010847 Ga0070669_1000108475 487
358 3300005353 Ga0070669_100025889 Ga0070669_1000258894 487
359 3300005353 Ga0070669_100028833 Ga0070669_1000288334 487
360 3300005353 Ga0070669_100127546 Ga0070669_1001275462 487
361 3300005354 Ga0070675_100127201 Ga0070675_1001272012 487
362 3300005355 Ga0070671_100000229 Ga0070671_10000022910 487
363 3300005355 Ga0070671_100005401 Ga0070671_1000054018 487
364 3300005355 Ga0070671_100008028 Ga0070671_1000080282 487
365 3300005355 Ga0070671_100172787 Ga0070671_1001727871 487
366 3300005356 Ga0070674_100046815 Ga0070674_1000468152 487
367 3300005364 Ga0070673_100001123 Ga0070673_1000011233 487
368 3300005364 Ga0070673_100001517 Ga0070673_10000151712 487
369 3300005364 Ga0070673_100014284 Ga0070673_1000142842 487
370 3300005364 Ga0070673_100028934 Ga0070673_1000289342 487
371 3300005366 Ga0070659_100002859 Ga0070659_1000028593 487
372 3300005366 Ga0070659_100004759 Ga0070659_1000047594 487
373 3300005366 Ga0070659_100020708 Ga0070659_1000207085 487
374 3300005366 Ga0070659_100028630 Ga0070659_1000286304 487
375 3300005366 Ga0070659_100036427 Ga0070659_1000364272 487
376 3300005366 Ga0070659_100121668 Ga0070659_1001216682 487
377 3300005367 Ga0070667_100002846 Ga0070667_1000028463 487
378 3300005367 Ga0070667_100009607 Ga0070667_1000096076 487
379 3300005367 Ga0070667_100020527 Ga0070667_1000205274 487
380 3300005367 Ga0070667_100065626 Ga0070667_1000656263 487
381 3300005367 Ga0070667_100080108 Ga0070667_1000801082 487
382 3300005367 Ga0070667_100127294 Ga0070667_1001272941 487
383 3300005367 Ga0070667_100151447 Ga0070667_1001514473 487
384 3300005455 Ga0070663_100003678 Ga0070663_1000036788 487
385 3300005455 Ga0070663_100016977 Ga0070663_1000169772 487
386 3300005456 Ga0070678_100004545 Ga0070678_1000045457 487
387 3300005457 Ga0070662_100001444 Ga0070662_1000014449 487
388 3300005457 Ga0070662_100001885 Ga0070662_1000018857 487
389 3300005457 Ga0070662_100010186 Ga0070662_1000101866 487
390 3300005457 Ga0070662_100022776 Ga0070662_1000227762 487
391 3300005457 Ga0070662_100024316 Ga0070662_1000243164 487
392 3300005457 Ga0070662_100045053 Ga0070662_1000450532 487
393 3300005458 Ga0070681_10079160 Ga0070681_100791602 487
394 3300005459 Ga0068867_100015941 Ga0068867_1000159414 487
395 3300005530 Ga0070679_100001379 Ga0070679_1000013793 487
396 3300005535 Ga0070684_100052323 Ga0070684_1000523232 487
397 3300005539 Ga0068853_100071507 Ga0068853_1000715073 487
398 3300005539 Ga0068853_100195898 Ga0068853_1001958981 487
399 3300005539 Ga0068853_100247135 Ga0068853_1002471351 487
400 3300005543 Ga0070672_100003232 Ga0070672_1000032322 487
401 3300005543 Ga0070672_100015400 Ga0070672_1000154003 487
402 3300005543 Ga0070672_100024535 Ga0070672_1000245351 487
403 3300005543 Ga0070672_100133624 Ga0070672_1001336242 487
404 3300005544 Ga0070686_100070721 Ga0070686_1000707212 487
405 3300005548 Ga0070665_100000820 Ga0070665_10000082030 487
406 3300005548 Ga0070665_100004669 Ga0070665_10000466910 487
407 3300005548 Ga0070665_100004787 Ga0070665_10000478710 487
408 3300005548 Ga0070665_100020745 Ga0070665_1000207455 487
409 3300005548 Ga0070665_100036998 Ga0070665_1000369984 487
410 3300005548 Ga0070665_100057110 Ga0070665_1000571102 487
411 3300005563 Ga0068855_100000408 Ga0068855_1000004086 487
412 3300005563 Ga0068855_100029819 Ga0068855_1000298193 487
413 3300005563 Ga0068855_100034006 Ga0068855_1000340064 487
414 3300005563 Ga0068855_100064376 Ga0068855_1000643762 487
415 3300005564 Ga0070664_100001404 Ga0070664_1000014043 487
416 3300005564 Ga0070664_100001633 Ga0070664_10000163312 487
417 3300005564 Ga0070664_100031112 Ga0070664_1000311123 487
418 3300005564 Ga0070664_100047266 Ga0070664_1000472662 487
419 3300005564 Ga0070664_100109851 Ga0070664_1001098512 487
420 3300005577 Ga0068857_100035949 Ga0068857_1000359492 487
421 3300005577 Ga0068857_100088738 Ga0068857_1000887381 487
422 3300005578 Ga0068854_100002023 Ga0068854_1000020239 487
423 3300005578 Ga0068854_100010331 Ga0068854_1000103315 487
424 3300005578 Ga0068854_100070394 Ga0068854_1000703942 487
425 3300005614 Ga0068856_100040015 Ga0068856_1000400152 487
426 3300005616 Ga0068852_100011651 Ga0068852_1000116513 487
427 3300005616 Ga0068852_100012894 Ga0068852_1000128943 487
428 3300005616 Ga0068852_100032154 Ga0068852_1000321543 487
429 3300005616 Ga0068852_100070909 Ga0068852_1000709092 487
430 3300005616 Ga0068852_100245050 Ga0068852_1002450501 487
431 3300005617 Ga0068859_100002810 Ga0068859_1000028104 487
432 3300005617 Ga0068859_100030985 Ga0068859_1000309853 487
433 3300005617 Ga0068859_100047383 Ga0068859_1000473832 487
434 3300005617 Ga0068859_100047416 Ga0068859_1000474162 487
435 3300005617 Ga0068859_100086348 Ga0068859_1000863483 487
436 3300005617 Ga0068859_100121610 Ga0068859_1001216102 487
437 3300005617 Ga0068859_100136416 Ga0068859_1001364162 487
438 3300005618 Ga0068864_100015545 Ga0068864_1000155454 487
439 3300005618 Ga0068864_100019523 Ga0068864_1000195234 487
440 3300005618 Ga0068864_100032751 Ga0068864_1000327513 487
441 3300005618 Ga0068864_100034668 Ga0068864_1000346682 487
442 3300005618 Ga0068864_100037717 Ga0068864_1000377172 487
443 3300005834 Ga0068851_10003735 Ga0068851_100037352 487
444 3300005834 Ga0068851_10007915 Ga0068851_100079152 487
445 3300005841 Ga0068863_100002668 Ga0068863_10000266812 487
446 3300005841 Ga0068863_100018056 Ga0068863_1000180568 487
447 3300005841 Ga0068863_100048238 Ga0068863_1000482382 487
448 3300005841 Ga0068863_100089450 Ga0068863_1000894502 487
449 3300005841 Ga0068863_100135628 Ga0068863_1001356282 487
450 3300005842 Ga0068858_100005553 Ga0068858_1000055532 487
451 3300005842 Ga0068858_100016460 Ga0068858_1000164604 487
452 3300005842 Ga0068858_100020597 Ga0068858_1000205975 487
453 3300005842 Ga0068858_100048106 Ga0068858_1000481063 487
454 3300005842 Ga0068858_100087420 Ga0068858_1000874202 487
455 3300005842 Ga0068858_100134254 Ga0068858_1001342542 487
456 3300005842 Ga0068858_100139963 Ga0068858_1001399632 487
457 3300005843 Ga0068860_100009099 Ga0068860_1000090996 487
458 3300005843 Ga0068860_100034282 Ga0068860_1000342822 487
459 3300005843 Ga0068860_100056677 Ga0068860_1000566772 487
460 3300005844 Ga0068862_100049681 Ga0068862_1000496812 487
461 3300005985 Ga0081539_10012045 Ga0081539_100120452 487
462 3300006042 Ga0075368_10002482 Ga0075368_100024826 487
463 3300006048 Ga0075363_100011628 Ga0075363_1000116285 487
464 3300006177 Ga0075362_10000018 Ga0075362_1000001857 487
465 3300006177 Ga0075362_10000985 Ga0075362_100009859 487
466 3300006195 Ga0075366_10000303 Ga0075366_1000030311 487
467 3300006237 Ga0097621_100055225 Ga0097621_1000552252 487
468 3300006358 Ga0068871_100029468 Ga0068871_1000294684 487
469 3300006358 Ga0068871_100049418 Ga0068871_1000494184 487
470 3300006358 Ga0068871_100139332 Ga0068871_1001393321 487
471 3300006881 Ga0068865_100040472 Ga0068865_1000404722 487
472 3300006931 Ga0097620_100002811 Ga0097620_1000028114 487
473 3300006931 Ga0097620_100030985 Ga0097620_1000309853 487
474 3300006931 Ga0097620_100047384 Ga0097620_1000473842 487
475 3300006931 Ga0097620_100047417 Ga0097620_1000474172 487
476 3300006931 Ga0097620_100086352 Ga0097620_1000863523 487
477 3300006931 Ga0097620_100121611 Ga0097620_1001216113 487
478 3300006931 Ga0097620_100136420 Ga0097620_1001364202 487
479 3300009092 Ga0105250_10006682 Ga0105250_100066823 487
480 3300009098 Ga0105245_10006292 Ga0105245_1000629210 487
481 3300009098 Ga0105245_10049672 Ga0105245_100496722 487
482 3300009176 Ga0105242_10123637 Ga0105242_101236372 487
483 3300009177 Ga0105248_10000362 Ga0105248_1000036247 487
484 3300009177 Ga0105248_10006715 Ga0105248_100067155 487
485 3300009177 Ga0105248_10007122 Ga0105248_100071224 487
486 3300009177 Ga0105248_10010911 Ga0105248_100109113 487
487 3300009177 Ga0105248_10023147 Ga0105248_100231476 487
488 3300009177 Ga0105248_10024612 Ga0105248_100246126 487
489 3300009177 Ga0105248_10086313 Ga0105248_100863132 487
490 3300009177 Ga0105248_10107601 Ga0105248_101076012 487
491 3300009177 Ga0105248_10110921 Ga0105248_101109213 487
492 3300009177 Ga0105248_10140777 Ga0105248_101407772 487
493 3300009553 Ga0105249_10051014 Ga0105249_100510142 487
494 3300010375 Ga0105239_10110493 Ga0105239_101104932 487
495 3300013100 Ga0157373_10071828 Ga0157373_100718282 487
496 3300013102 Ga0157371_10005239 Ga0157371_100052397 487
497 3300013102 Ga0157371_10010681 Ga0157371_100106814 487
498 3300013105 Ga0157369_10000635 Ga0157369_1000063541 487
499 3300013105 Ga0157369_10056072 Ga0157369_100560724 487
500 3300013105 Ga0157369_10206667 Ga0157369_102066671 487
501 3300013297 Ga0157378_10279066 Ga0157378_102790661 487
502 3300013306 Ga0163162_10006899 Ga0163162_100068992 487
503 3300013306 Ga0163162_10006918 Ga0163162_100069185 487
504 3300013306 Ga0163162_10117940 Ga0163162_101179403 487
505 3300013308 Ga0157375_10000296 Ga0157375_100002966 487
506 3300013308 Ga0157375_10017638 Ga0157375_100176383 487
507 3300013308 Ga0157375_10375573 Ga0157375_103755731 487
508 3300014325 Ga0163163_10002099 Ga0163163_1000209911 487
509 3300014325 Ga0163163_10011403 Ga0163163_100114033 487
510 3300014326 Ga0157380_10120042 Ga0157380_101200423 487
511 3300014968 Ga0157379_10003233 Ga0157379_1000323310 487
512 3300021388 Ga0213875_10002419 Ga0213875_100024191 487
513 3300025315 Ga0207697_10007831 Ga0207697_100078314 487
514 3300025321 Ga0207656_10012022 Ga0207656_100120222 487
515 3300025893 Ga0207682_10003135 Ga0207682_100031357 487
516 3300025899 Ga0207642_10013595 Ga0207642_100135952 487
517 3300025903 Ga0207680_10003548 Ga0207680_100035482 487
518 3300025903 Ga0207680_10008878 Ga0207680_100088783 487
519 3300025904 Ga0207647_10000339 Ga0207647_1000033923 487
520 3300025904 Ga0207647_10001091 Ga0207647_1000109112 487
521 3300025904 Ga0207647_10017780 Ga0207647_100177802 487
522 3300025904 Ga0207647_10041128 Ga0207647_100411282 487
523 3300025909 Ga0207705_10000070 Ga0207705_10000070108 487
524 3300025909 Ga0207705_10000166 Ga0207705_100001666 487
525 3300025909 Ga0207705_10000205 Ga0207705_1000020528 487
526 3300025909 Ga0207705_10005655 Ga0207705_100056552 487
527 3300025909 Ga0207705_10007530 Ga0207705_100075302 487
528 3300025909 Ga0207705_10008658 Ga0207705_100086586 487
529 3300025909 Ga0207705_10016594 Ga0207705_100165944 487
530 3300025909 Ga0207705_10018815 Ga0207705_100188152 487
531 3300025909 Ga0207705_10030837 Ga0207705_100308373 487
532 3300025909 Ga0207705_10034881 Ga0207705_100348812 487
533 3300025909 Ga0207705_10049564 Ga0207705_100495643 487
534 3300025909 Ga0207705_10053486 Ga0207705_100534861 487
535 3300025909 Ga0207705_10115890 Ga0207705_101158901 487
536 3300025912 Ga0207707_10024686 Ga0207707_100246862 487
537 3300025912 Ga0207707_10108299 Ga0207707_101082992 487
538 3300025913 Ga0207695_10005871 Ga0207695_1000587111 487
539 3300025913 Ga0207695_10233529 Ga0207695_102335292 487
540 3300025914 Ga0207671_10115233 Ga0207671_101152332 487
541 3300025919 Ga0207657_10000471 Ga0207657_100004712 487
542 3300025919 Ga0207657_10003326 Ga0207657_100033262 487
543 3300025919 Ga0207657_10005851 Ga0207657_100058516 487
544 3300025919 Ga0207657_10008974 Ga0207657_100089748 487
545 3300025919 Ga0207657_10009473 Ga0207657_100094733 487
546 3300025919 Ga0207657_10009727 Ga0207657_100097273 487
547 3300025919 Ga0207657_10011984 Ga0207657_100119846 487
548 3300025919 Ga0207657_10032585 Ga0207657_100325853 487
549 3300025919 Ga0207657_10073458 Ga0207657_100734582 487
550 3300025919 Ga0207657_10177273 Ga0207657_101772731 487
551 3300025920 Ga0207649_10001363 Ga0207649_1000136314 487
552 3300025920 Ga0207649_10041672 Ga0207649_100416722 487
553 3300025920 Ga0207649_10042593 Ga0207649_100425932 487
554 3300025920 Ga0207649_10046859 Ga0207649_100468592 487
555 3300025920 Ga0207649_10077909 Ga0207649_100779091 487
556 3300025921 Ga0207652_10000270 Ga0207652_1000027027 487
557 3300025921 Ga0207652_10074640 Ga0207652_100746402 487
558 3300025921 Ga0207652_10228722 Ga0207652_102287222 487
559 3300025923 Ga0207681_10003725 Ga0207681_100037257 487
560 3300025923 Ga0207681_10006050 Ga0207681_100060507 487
561 3300025923 Ga0207681_10057402 Ga0207681_100574022 487
562 3300025925 Ga0207650_10004433 Ga0207650_100044336 487
563 3300025925 Ga0207650_10021458 Ga0207650_100214582 487
564 3300025925 Ga0207650_10064988 Ga0207650_100649882 487
565 3300025926 Ga0207659_10008129 Ga0207659_100081294 487
566 3300025928 Ga0207700_10112013 Ga0207700_101120132 487
567 3300025931 Ga0207644_10000324 Ga0207644_100003241 487
568 3300025931 Ga0207644_10007290 Ga0207644_100072904 487
569 3300025931 Ga0207644_10034849 Ga0207644_100348494 487
570 3300025931 Ga0207644_10120667 Ga0207644_101206672 487
571 3300025932 Ga0207690_10026021 Ga0207690_100260213 487
572 3300025933 Ga0207706_10001159 Ga0207706_1000115913 487
573 3300025933 Ga0207706_10012485 Ga0207706_100124857 487
574 3300025933 Ga0207706_10015297 Ga0207706_100152975 487
575 3300025933 Ga0207706_10027130 Ga0207706_100271305 487
576 3300025933 Ga0207706_10028341 Ga0207706_100283412 487
577 3300025933 Ga0207706_10075584 Ga0207706_100755842 487
578 3300025933 Ga0207706_10194421 Ga0207706_101944212 487
579 3300025937 Ga0207669_10006639 Ga0207669_100066394 487
580 3300025937 Ga0207669_10061470 Ga0207669_100614702 487
581 3300025938 Ga0207704_10038739 Ga0207704_100387393 487
582 3300025940 Ga0207691_10000915 Ga0207691_1000091511 487
583 3300025940 Ga0207691_10018796 Ga0207691_100187963 487
584 3300025940 Ga0207691_10035119 Ga0207691_100351194 487
585 3300025940 Ga0207691_10036542 Ga0207691_100365421 487
586 3300025940 Ga0207691_10050290 Ga0207691_100502902 487
587 3300025940 Ga0207691_10129294 Ga0207691_101292942 487
588 3300025940 Ga0207691_10199239 Ga0207691_101992392 487
589 3300025941 Ga0207711_10000429 Ga0207711_1000042915 487
590 3300025941 Ga0207711_10001903 Ga0207711_1000190316 487
591 3300025941 Ga0207711_10008656 Ga0207711_100086567 487
592 3300025941 Ga0207711_10011424 Ga0207711_100114242 487
593 3300025941 Ga0207711_10011831 Ga0207711_100118316 487
594 3300025941 Ga0207711_10018883 Ga0207711_100188835 487
595 3300025942 Ga0207689_10014695 Ga0207689_100146952 487
596 3300025944 Ga0207661_10020291 Ga0207661_100202912 487
597 3300025944 Ga0207661_10048483 Ga0207661_100484832 487
598 3300025944 Ga0207661_10092528 Ga0207661_100925282 487
599 3300025944 Ga0207661_10150014 Ga0207661_101500142 487
600 3300025945 Ga0207679_10008055 Ga0207679_100080554 487
601 3300025945 Ga0207679_10014006 Ga0207679_100140064 487
602 3300025949 Ga0207667_10001086 Ga0207667_1000108630 487
603 3300025949 Ga0207667_10022885 Ga0207667_100228854 487
604 3300025949 Ga0207667_10038356 Ga0207667_100383564 487
605 3300025949 Ga0207667_10054554 Ga0207667_100545542 487
606 3300025949 Ga0207667_10166349 Ga0207667_101663491 487
607 3300025949 Ga0207667_10210158 Ga0207667_102101582 487
608 3300025960 Ga0207651_10001281 Ga0207651_100012816 487
609 3300025960 Ga0207651_10018709 Ga0207651_100187093 487
610 3300025960 Ga0207651_10029319 Ga0207651_100293194 487
611 3300025960 Ga0207651_10088707 Ga0207651_100887072 487
612 3300025960 Ga0207651_10119364 Ga0207651_101193641 487
613 3300025961 Ga0207712_10001479 Ga0207712_1000147917 487
614 3300025972 Ga0207668_10021104 Ga0207668_100211042 487
615 3300025972 Ga0207668_10024698 Ga0207668_100246984 487
616 3300025972 Ga0207668_10094671 Ga0207668_100946712 487
617 3300025981 Ga0207640_10015302 Ga0207640_100153023 487
618 3300025981 Ga0207640_10041766 Ga0207640_100417662 487
619 3300025986 Ga0207658_10003493 Ga0207658_100034937 487
620 3300025986 Ga0207658_10003904 Ga0207658_100039044 487
621 3300025986 Ga0207658_10012446 Ga0207658_100124464 487
622 3300025986 Ga0207658_10032938 Ga0207658_100329382 487
623 3300025986 Ga0207658_10046834 Ga0207658_100468342 487
624 3300026023 Ga0207677_10018010 Ga0207677_100180104 487
625 3300026023 Ga0207677_10058563 Ga0207677_100585632 487
626 3300026023 Ga0207677_10113305 Ga0207677_101133052 487
627 3300026035 Ga0207703_10001377 Ga0207703_100013778 487
628 3300026035 Ga0207703_10002355 Ga0207703_100023557 487
629 3300026035 Ga0207703_10022775 Ga0207703_100227751 487
630 3300026035 Ga0207703_10097238 Ga0207703_100972382 487
631 3300026041 Ga0207639_10002865 Ga0207639_100028658 487
632 3300026041 Ga0207639_10113263 Ga0207639_101132632 487
633 3300026067 Ga0207678_10000766 Ga0207678_1000076627 487
634 3300026067 Ga0207678_10001860 Ga0207678_1000186013 487
635 3300026067 Ga0207678_10003559 Ga0207678_1000355912 487
636 3300026067 Ga0207678_10005883 Ga0207678_100058835 487
637 3300026067 Ga0207678_10019547 Ga0207678_100195477 487
638 3300026067 Ga0207678_10056767 Ga0207678_100567672 487
639 3300026067 Ga0207678_10087586 Ga0207678_100875862 487
640 3300026067 Ga0207678_10114328 Ga0207678_101143282 487
641 3300026067 Ga0207678_10136169 Ga0207678_101361692 487
642 3300026078 Ga0207702_10009679 Ga0207702_100096795 487
643 3300026078 Ga0207702_10020040 Ga0207702_100200401 487
644 3300026088 Ga0207641_10002148 Ga0207641_100021482 487
645 3300026088 Ga0207641_10015693 Ga0207641_100156935 487
646 3300026088 Ga0207641_10015705 Ga0207641_100157058 487
647 3300026088 Ga0207641_10030647 Ga0207641_100306472 487
648 3300026089 Ga0207648_10015674 Ga0207648_100156746 487
649 3300026089 Ga0207648_10036614 Ga0207648_100366144 487
650 3300026089 Ga0207648_10108607 Ga0207648_101086071 487
651 3300026095 Ga0207676_10001670 Ga0207676_100016704 487
652 3300026095 Ga0207676_10015413 Ga0207676_100154132 487
653 3300026095 Ga0207676_10029323 Ga0207676_100293231 487
654 3300026116 Ga0207674_10000347 Ga0207674_1000034732 487
655 3300026116 Ga0207674_10006876 Ga0207674_100068765 487
656 3300026116 Ga0207674_10007182 Ga0207674_1000718210 487
657 3300026121 Ga0207683_10002012 Ga0207683_1000201211 487
658 3300026142 Ga0207698_10001498 Ga0207698_100014988 487
659 3300026142 Ga0207698_10004314 Ga0207698_100043149 487
660 3300026142 Ga0207698_10016372 Ga0207698_100163722 487
661 3300026142 Ga0207698_10037815 Ga0207698_100378153 487
662 3300026142 Ga0207698_10059612 Ga0207698_100596122 487
663 3300026142 Ga0207698_10073087 Ga0207698_100730872 487
664 3300026142 Ga0207698_10083458 Ga0207698_100834582 487
665 3300026142 Ga0207698_10172312 Ga0207698_101723122 487
666 3300027866 Ga0209813_10000122 Ga0209813_100001227 487
667 3300028379 Ga0268266_10001757 Ga0268266_1000175715 487
668 3300028379 Ga0268266_10002440 Ga0268266_100024407 487
669 3300028379 Ga0268266_10068949 Ga0268266_100689492 487
670 3300028380 Ga0268265_10056551 Ga0268265_100565513 487
671 3300028380 Ga0268265_10179982 Ga0268265_101799821 487
672 3300028381 Ga0268264_10002233 Ga0268264_1000223310 487
673 3300028381 Ga0268264_10003251 Ga0268264_100032514 487
674 3300028381 Ga0268264_10006977 Ga0268264_100069779 487
675 3300031548 Ga0307408_100003140 Ga0307408_10000314013 487
676 3300031548 Ga0307408_100004067 Ga0307408_1000040676 487
677 3300031548 Ga0307408_100018685 Ga0307408_1000186854 487
678 3300031548 Ga0307408_100032161 Ga0307408_1000321612 487
679 3300031548 Ga0307408_100039634 Ga0307408_1000396343 487
680 3300031548 Ga0307408_100054972 Ga0307408_1000549722 487
681 3300031731 Ga0307405_10024034 Ga0307405_100240343 487
682 3300031731 Ga0307405_10114775 Ga0307405_101147752 487
683 3300031824 Ga0307413_10009251 Ga0307413_100092512 487
684 3300031824 Ga0307413_10020505 Ga0307413_100205051 487
685 3300031824 Ga0307413_10118389 Ga0307413_101183892 487
686 3300031852 Ga0307410_10000619 Ga0307410_100006197 487
687 3300031852 Ga0307410_10003266 Ga0307410_100032668 487
688 3300031852 Ga0307410_10009790 Ga0307410_100097904 487
689 3300031852 Ga0307410_10012640 Ga0307410_100126402 487
690 3300031852 Ga0307410_10019193 Ga0307410_100191932 487
691 3300031852 Ga0307410_10034526 Ga0307410_100345262 487
692 3300031852 Ga0307410_10068799 Ga0307410_100687992 487
693 3300031852 Ga0307410_10069875 Ga0307410_100698752 487
694 3300031852 Ga0307410_10087122 Ga0307410_100871222 487
695 3300031901 Ga0307406_10012877 Ga0307406_100128772 487
696 3300031901 Ga0307406_10035147 Ga0307406_100351472 487
697 3300031901 Ga0307406_10058971 Ga0307406_100589712 487
698 3300031901 Ga0307406_10120451 Ga0307406_101204511 487
699 3300031903 Ga0307407_10005544 Ga0307407_100055442 487
700 3300031903 Ga0307407_10006410 Ga0307407_100064103 487
701 3300031903 Ga0307407_10007250 Ga0307407_100072505 487
702 3300031903 Ga0307407_10108338 Ga0307407_101083382 487
703 3300031911 Ga0307412_10001748 Ga0307412_1000174812 487
704 3300031911 Ga0307412_10005139 Ga0307412_100051392 487
705 3300031911 Ga0307412_10033365 Ga0307412_100333652 487
706 3300031995 Ga0307409_100003140 Ga0307409_1000031404 487
707 3300031995 Ga0307409_100004723 Ga0307409_1000047232 487
708 3300031995 Ga0307409_100013078 Ga0307409_1000130782 487
709 3300031995 Ga0307409_100035225 Ga0307409_1000352252 487
710 3300031995 Ga0307409_100087147 Ga0307409_1000871472 487
711 3300032002 Ga0307416_100024325 Ga0307416_1000243252 487
712 3300032002 Ga0307416_100033774 Ga0307416_1000337742 487
713 3300032002 Ga0307416_100048350 Ga0307416_1000483502 487
714 3300032002 Ga0307416_100103978 Ga0307416_1001039783 487
715 3300032004 Ga0307414_10022460 Ga0307414_100224602 487
716 3300032004 Ga0307414_10080880 Ga0307414_100808802 487
717 3300032004 Ga0307414_10117535 Ga0307414_101175352 487
718 3300032005 Ga0307411_10001218 Ga0307411_100012188 487
719 3300032005 Ga0307411_10015109 Ga0307411_100151092 487
720 3300032005 Ga0307411_10019087 Ga0307411_100190872 487
721 3300032005 Ga0307411_10021157 Ga0307411_100211573 487
722 3300032005 Ga0307411_10068395 Ga0307411_100683952 487
723 3300032005 Ga0307411_10076033 Ga0307411_100760332 487
724 3300032126 Ga0307415_100000243 Ga0307415_1000002433 487
725 3300032126 Ga0307415_100005402 Ga0307415_1000054022 487
726 3300032126 Ga0307415_100011470 Ga0307415_1000114702 487
727 3300032126 Ga0307415_100013777 Ga0307415_1000137772 487
728 3300032126 Ga0307415_100026221 Ga0307415_1000262212 487
729 3300035111 Ga0373923_0004243 Ga0373923_0004243_1184_2659 487
730 3300035117 Ga0373953_0036630 Ga0373953_0036630_362_1837 487
731 3300035691 Ga0373931_0006860 Ga0373931_0006860_1493_2986 487
732 3300036401 Ga0373937_0026424 Ga0373937_0026424_2094_3569 487
733 3300037312 Ga0395899_0000387 Ga0395899_0000387_48809_50302 487
734 3300037312 Ga0395899_0000419 Ga0395899_0000419_1514_2989 487
735 3300037312 Ga0395899_0001750 Ga0395899_0001750_14453_15946 487
736 3300037312 Ga0395899_0008340 Ga0395899_0008340_1333_2811 487
737 3300037312 Ga0395899_0023263 Ga0395899_0023263_1784_3274 487
738 3300037312 Ga0395899_0033818 Ga0395899_0033818_1596_3071 487
739 3300037312 Ga0395899_0037193 Ga0395899_0037193_1276_2754 487
740 3300037312 Ga0395899_0078520 Ga0395899_0078520_19_1497 487
741 3300037418 Ga0395900_0000130 Ga0395900_0000130_102281_103774 487
742 3300037418 Ga0395900_0000572 Ga0395900_0000572_22776_24245 487
743 3300037418 Ga0395900_0003659 Ga0395900_0003659_9960_11435 487
744 3300037418 Ga0395900_0012536 Ga0395900_0012536_4927_6405 487
745 3300037418 Ga0395900_0022296 Ga0395900_0022296_4451_5929 487
746 3300037418 Ga0395900_0039940 Ga0395900_0039940_1071_2549 487
747 3300037418 Ga0395900_0062610 Ga0395900_0062610_1406_2884 487
748 3300037418 Ga0395900_0063941 Ga0395900_0063941_1457_2935 487
749 3300037418 Ga0395900_0069065 Ga0395900_0069065_1074_2552 487
750 3300037418 Ga0395900_0086409 Ga0395900_0086409_59_1534 487
751 3300037418 Ga0395900_0106565 Ga0395900_0106565_1201_2679 487
752 3300037418 Ga0395900_0120555 Ga0395900_0120555_702_2168 487
753 3300037418 Ga0395900_0190501 Ga0395900_0190501_273_1751 487
754 3300037418 Ga0395900_0204971 Ga0395900_0204971_427_1905 487
755 3300037418 Ga0395900_0315448 Ga0395900_0315448_38_1510 487
756 3300037466 Ga0395898_0000274 Ga0395898_0000274_55285_56778 487
757 3300037466 Ga0395898_0007664 Ga0395898_0007664_5108_6586 487
758 3300037466 Ga0395898_0011442 Ga0395898_0011442_4040_5515 487
759 3300037466 Ga0395898_0045955 Ga0395898_0045955_2076_3551 487
760 3300037466 Ga0395898_0061837 Ga0395898_0061837_1854_3332 487
761 3300037466 Ga0395898_0067930 Ga0395898_0067930_414_1895 487
762 3300037466 Ga0395898_0070029 Ga0395898_0070029_1265_2743 487
763 3300037466 Ga0395898_0075486 Ga0395898_0075486_670_2142 487
764 3300037466 Ga0395898_0079117 Ga0395898_0079117_1257_2735 487
765 3300037471 Ga0395905_0000165 Ga0395905_0000165_62774_64243 487
766 3300037471 Ga0395905_0000287 Ga0395905_0000287_70140_71633 487
767 3300037471 Ga0395905_0001408 Ga0395905_0001408_15896_17374 487
768 3300037471 Ga0395905_0001429 Ga0395905_0001429_12260_13738 487
769 3300037471 Ga0395905_0003581 Ga0395905_0003581_1313_2800 487
770 3300037471 Ga0395905_0005698 Ga0395905_0005698_6524_8002 487
771 3300037471 Ga0395905_0006659 Ga0395905_0006659_127_1605 487
772 3300037471 Ga0395905_0006715 Ga0395905_0006715_1198_2676 487
773 3300037471 Ga0395905_0015997 Ga0395905_0015997_2830_4308 487
774 3300037471 Ga0395905_0020773 Ga0395905_0020773_1837_3315 487
775 3300037471 Ga0395905_0021508 Ga0395905_0021508_4461_5927 487
776 3300037471 Ga0395905_0023872 Ga0395905_0023872_2186_3679 487
777 3300037471 Ga0395905_0024929 Ga0395905_0024929_4065_5543 487
778 3300037471 Ga0395905_0042894 Ga0395905_0042894_819_2297 487
779 3300037471 Ga0395905_0048914 Ga0395905_0048914_2426_3904 487
780 3300037471 Ga0395905_0060357 Ga0395905_0060357_1041_2522 487
781 3300037471 Ga0395905_0067605 Ga0395905_0067605_298_1776 487
782 3300037471 Ga0395905_0077877 Ga0395905_0077877_1159_2634 487
783 3300037471 Ga0395905_0082270 Ga0395905_0082270_950_2413 487
784 3300037471 Ga0395905_0098434 Ga0395905_0098434_836_2314 487
785 3300037471 Ga0395905_0185166 Ga0395905_0185166_163_1641 487
786 3300037853 Ga0436364_1265496 Ga0436364_1265496_61_1563 487
787 3300038443 Ga0395901_0000030 Ga0395901_0000030_129377_130852 487
788 3300038443 Ga0395901_0004432 Ga0395901_0004432_83_1561 487
789 3300038443 Ga0395901_0005970 Ga0395901_0005970_2849_4342 487
790 3300038443 Ga0395901_0012772 Ga0395901_0012772_6154_7632 487
791 3300038443 Ga0395901_0019952 Ga0395901_0019952_442_1929 487
792 3300038443 Ga0395901_0023876 Ga0395901_0023876_3010_4479 487
793 3300038443 Ga0395901_0024647 Ga0395901_0024647_2715_4208 487
794 3300038443 Ga0395901_0053302 Ga0395901_0053302_387_1865 487
795 3300038443 Ga0395901_0066737 Ga0395901_0066737_2082_3560 487
796 3300038443 Ga0395901_0075085 Ga0395901_0075085_491_1969 487
797 3300038443 Ga0395901_0079078 Ga0395901_0079078_290_1768 487
798 3300038443 Ga0395901_0092319 Ga0395901_0092319_1269_2747 487
799 3300038443 Ga0395901_0115813 Ga0395901_0115813_1135_2625 487
800 3300038443 Ga0395901_0120109 Ga0395901_0120109_647_2110 487
801 3300038443 Ga0395901_0156287 Ga0395901_0156287_879_2369 487
802 3300042157 Ga0439458_0000668 Ga0439458_0000668_2454_3932 487
803 3300042157 Ga0439458_0000796 Ga0439458_0000796_527_2005 487
804 3300042439 Ga0439464_0000946 Ga0439464_0000946_2060_3538 487
805 3300044656 Ga0466969_0006087 Ga0466969_0006087_3616_5088 487
806 3300044656 Ga0466969_0027746 Ga0466969_0027746_1106_2581 487
807 3300044658 Ga0466972_0045216 Ga0466972_0045216_310_1785 487
808 3300044684 Ga0466966_0000709 Ga0466966_0000709_16176_17654 487
809 3300044684 Ga0466966_0005040 Ga0466966_0005040_6651_8123 487
810 3300044684 Ga0466966_0009822 Ga0466966_0009822_3918_5393 487
811 3300044684 Ga0466966_0014240 Ga0466966_0014240_1702_3177 487
812 3300044693 Ga0466961_0001728 Ga0466961_0001728_2761_4233 487
813 3300044694 Ga0466963_0029887 Ga0466963_0029887_1818_3296 487
814 3300044694 Ga0466963_0070474 Ga0466963_0070474_678_2150 487
815 3300044719 Ga0466971_0000339 Ga0466971_0000339_2105_3577 487
816 3300044765 Ga0466970_0003618 Ga0466970_0003618_3698_5170 487
817 3300044765 Ga0466970_0020876 Ga0466970_0020876_374_1852 487
818 3300044842 Ga0466957_0008392 Ga0466957_0008392_4223_5695 487
819 3300045049 Ga0466959_0017818 Ga0466959_0017818_3680_5152 487
820 3300045836 Ga0466958_0000054 Ga0466958_0000054_12599_14071 487
821 3300045976 Ga0466967_0010874 Ga0466967_0010874_4057_5535 487
822 3300045976 Ga0466967_0026271 Ga0466967_0026271_442_1920 487
823 3300045976 Ga0466967_0189952 Ga0466967_0189952_353_1831 487
824 3300046537 Ga0495598_0001515 Ga0495598_0001515_2573_4048 487
825 3300046537 Ga0495598_0002001 Ga0495598_0002001_1656_3134 487
826 3300046539 Ga0495621_0003177 Ga0495621_0003177_2142_3620 487
827 3300046539 Ga0495621_0015273 Ga0495621_0015273_127_1602 487
828 3300046558 Ga0495633_0001647 Ga0495633_0001647_8617_10095 487
829 3300046679 Ga0495623_0056334 Ga0495623_0056334_344_1819 487
830 3300046684 Ga0495669_0000293 Ga0495669_0000293_23437_24906 487
831 3300046684 Ga0495669_0002650 Ga0495669_0002650_4025_5503 487
832 3300046684 Ga0495669_0006355 Ga0495669_0006355_562_2040 487
833 3300046684 Ga0495669_0021682 Ga0495669_0021682_918_2396 487
834 3300046691 Ga0495670_0005527 Ga0495670_0005527_4486_5964 487
835 3300046691 Ga0495670_0026043 Ga0495670_0026043_738_2213 487
836 3300048088 Ga0495602_0014578 Ga0495602_0014578_3767_5242 487
837 3300048903 Ga0496100_0005041 Ga0496100_0005041_3772_5247 487
838 3300048904 Ga0496101_0208146 Ga0496101_0208146_29_1504 487
839 3300048905 Ga0496102_0077395 Ga0496102_0077395_1230_2705 487
840 3300048908 Ga0496105_0000481 Ga0496105_0000481_17378_18892 487
841 3300048909 Ga0496106_0014816 Ga0496106_0014816_2474_3949 487
842 3300048909 Ga0496106_0053256 Ga0496106_0053256_88_1566 487
843 3300048910 Ga0496107_0058599 Ga0496107_0058599_822_2303 487
844 3300048910 Ga0496107_0117944 Ga0496107_0117944_32_1507 487
845 3300048911 Ga0496108_0001272 Ga0496108_0001272_1845_3314 487
846 3300048911 Ga0496108_0008736 Ga0496108_0008736_3412_4887 487
847 3300048911 Ga0496108_0031252 Ga0496108_0031252_567_2048 487
848 3300048912 Ga0496109_0003815 Ga0496109_0003815_861_2339 487
849 3300048912 Ga0496109_0037089 Ga0496109_0037089_2507_3982 487
850 3300048912 Ga0496109_0059815 Ga0496109_0059815_1847_3325 487
851 3300048912 Ga0496109_0078167 Ga0496109_0078167_1356_2831 487
852 3300048912 Ga0496109_0109985 Ga0496109_0109985_134_1609 487
853 3300048913 Ga0496110_0001131 Ga0496110_0001131_8511_9989 487
854 3300048913 Ga0496110_0005464 Ga0496110_0005464_7435_8910 487
855 3300048913 Ga0496110_0019874 Ga0496110_0019874_1693_3174 487
856 3300048913 Ga0496110_0061837 Ga0496110_0061837_1783_3258 487
857 3300048914 Ga0496111_0002242 Ga0496111_0002242_1106_2581 487
858 3300048914 Ga0496111_0004595 Ga0496111_0004595_422_1900 487
859 3300048914 Ga0496111_0125961 Ga0496111_0125961_385_1866 487
860 3300048915 Ga0496112_0008275 Ga0496112_0008275_1928_3409 487
861 3300048915 Ga0496112_0091300 Ga0496112_0091300_1118_2593 487
862 3300048915 Ga0496112_0140527 Ga0496112_0140527_855_2330 487
863 3300048916 Ga0496113_0004166 Ga0496113_0004166_6841_8322 487
864 3300048916 Ga0496113_0084883 Ga0496113_0084883_45_1520 487
865 3300048916 Ga0496113_0182741 Ga0496113_0182741_119_1597 487
866 3300048917 Ga0496114_0000019 Ga0496114_0000019_173198_174676 487
867 3300048917 Ga0496114_0015261 Ga0496114_0015261_1273_2754 487
868 3300048917 Ga0496114_0041852 Ga0496114_0041852_2022_3500 487
869 3300048918 Ga0496115_0015645 Ga0496115_0015645_2229_3707 487
870 3300048918 Ga0496115_0026170 Ga0496115_0026170_1894_3375 487
871 3300050489 nmdc:mga03683_130_c1 nmdc:mga03683_130_c1_18325_19824 487
872 3300050489 nmdc:mga03683_8_c1 nmdc:mga03683_8_c1_14570_16063 487
873 3300050490 nmdc:mga03n38_704_c1 nmdc:mga03n38_704_c1_7064_8557 487
874 3300050493 nmdc:mga0k408_101712_c1 nmdc:mga0k408_101712_c1_75_1574 487
875 3300050493 nmdc:mga0k408_212_c1 nmdc:mga0k408_212_c1_15591_17084 487
876 3300050494 nmdc:mga06z11_8620_c1 nmdc:mga06z11_8620_c1_183_1682 487
877 3300050495 nmdc:mga04h51_548_c1 nmdc:mga04h51_548_c1_5190_6689 487
878 3300050496 nmdc:mga07m45_1249_c1 nmdc:mga07m45_1249_c1_6234_7733 487
879 3300050515 nmdc:mga0a205_1890_c1 nmdc:mga0a205_1890_c1_12139_13617 487
880 3300050516 nmdc:mga0sz30_2721_c1 nmdc:mga0sz30_2721_c1_4566_6059 487
881 3300050516 nmdc:mga0sz30_6989_c1 nmdc:mga0sz30_6989_c1_2257_3756 487
882 3300053121 Ga0500607_002050 Ga0500607_002050_4899_6413 487
883 3300053136 Ga0500559_0002752 Ga0500559_0002752_4129_5643 487
884 3300053136 Ga0500559_0004233 Ga0500559_0004233_4284_5783 487
885 3300053730 Ga0500645_004660 Ga0500645_004660_428_1921 487
886 3300061719 Ga0466962_0004642 Ga0466962_0004642_4949_6439 487
887 3300061719 Ga0466962_0008135 Ga0466962_0008135_2338_3810 487

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02637

GatB_Yqey

GatB domain

337

484

0.99

PF02934

GatB_N

GatB/GatE catalytic domain

15

298

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wj3-assembly2.cif.gz_H crystal structure of the asparagine transamidosome from pseudomonas aeruginosa 0.8537 13 413
3al0-assembly1.cif.gz_B crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. 0.8226 13 486
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8165 13 423
3h0l-assembly2.cif.gz_E structure of trna-dependent amidotransferase gatcab from aquifex aeolicus 0.8111 13 423
3al0-assembly1.cif.gz_B crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. 0.8088 13 486
ID Description Score Start End Superfamily
af_Q2R2Z0_480_542_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9992 426 486 1.10.10.410
af_I1K5J4_480_543_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9983 426 486 1.10.10.410
af_I1KQC8_485_546_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9976 426 487 1.10.10.410
af_I1KQC8_485_546_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9818 426 487 1.10.10.410
af_Q2FWZ0_412_475_1.10.10.410 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; 0.9709 426 486 1.10.10.410
ID Description Score Start End GO Terms
AF-A0A847H326-F1-model_v4 Asn/Gln amidotransferase domain-containing protein 0.9766 377 487 GO:0005524
GO:0006412
GO:0016884
AF-A0A7C9CTH7-F1-model_v4 Asn/Gln amidotransferase domain-containing protein 0.9765 335 486 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-A0A1S3XTW9-F1-model_v4 Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like 0.9744 372 486 GO:0005524
GO:0006412
GO:0016884
AF-A0A521WPK4-F1-model_v4 Asn/Gln amidotransferase domain-containing protein 0.9739 361 486 GO:0005524
GO:0006412
GO:0050567
GO:0070681
AF-A0A4Q2YL85-F1-model_v4 Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) 0.9736 375 487 GO:0005524
GO:0006412
GO:0016740
GO:0050567
GO:0070681

Feature Viewer

pLDDT pTM Quality
85.21 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map