F484735
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 887 | 288 | 870 | 491 |
Family's Representative Sequence
| Representative Sequence | 3300044735|Ga0466968_0011086|Ga0466968_0011086_1725_3182 |
| Length | 485 |
| Sequence | MSSYRIQGDTGEWEVVIGLEVHAQVTSQSKLFSGAATAFGAEPNTQVSLVDAAMPGMLPVPNRECIRQAVRTGMALDAQINRWSRFDRKNYFYADLPQGYQISQLYHPLVGEGSILIEPEGAEPKTIGIERIHVEQDAGKLMHDQHPTRSYVDLNRSGVALMEIVSRPDMRSPAEAGAYVKKLRAILRYVGSCDGNMEQGSMRADVNVSVRKPGEPFGTRTETKNVNSIRFVMAAIEYEARRQVELIEDGGTVVQETRLFDPDRGVTRSMRSKEDAHDYRYFPDPDLLPVELDDAFLEEARASLPELPDAKRRRYEEVLGISAYNADVLTADVETARWFEAMLAEGAPAKQASNWVMSELFGALNRLGKDITESPVSPADAAALIGLVADGTLSGSLAKQVFELMLETGDAPAKIVEERGLKQTSDTGAIEAEIAKILEANPDKVADYRGGKDKLFGFFVGQTMRAMGGKANPGVVNELLKKALG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185354 | Sphingomonas sp. NFR15 | Isolate | Rhizoplane |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 5 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 6 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 7 | 2751185897 | Sphingomonas panacis DCY99 | Isolate | Unclassified |
| 8 | 2830075706 | Sphingomonas jinjuensis DSM 21457 | Isolate | Rhizosphere |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 11 | 2885427238 | Sphingomonas mesophila SYSUP0001 | Isolate | Stem Tuber |
| 12 | 2885429604 | Sphingomonas sp. WZY 27 | Isolate | Rhizosphere |
| 13 | 2896429255 | Sphingomonas rhizophila KACC 19189 | Isolate | Rhizosphere |
| 14 | 2946787523 | Sphingomonas faeni W4I17 | Isolate | Rhizosphere |
| 15 | 2990265787 | Sphingomonas sp. SORGH_AS802 | Isolate | Aerial Root |
| 16 | 2993693658 | Sphingomonas sp. SORGH_AS438 | Isolate | Aerial Root |
| 17 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 18 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 19 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 20 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 21 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 22 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 23 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 24 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 25 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 29 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 30 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 114 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 119 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 174 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 179 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 185 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 191 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 192 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 201 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 208 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 209 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 257 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 258 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 259 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 260 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 267 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 275 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 276 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 279 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 282 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 283 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 284 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 285 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 288 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.08 |
| Metatranscriptomes | 0 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 4.96 |
| Nodule | 0.11 |
| Rhizoplane | 4.4 |
| Rhizosphere | 87.94 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 2.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24741J21665_1000431 | 3300001915 | Bacteria | 12681 |
| 2 | JGI24740J21852_10005606 | 3300001979 | Bacteria | 5288 |
| 3 | JGI24740J21852_10006044 | 3300001979 | Bacteria | 5061 |
| 4 | JGI24739J22299_10007482 | 3300001989 | Bacteria | 4095 |
| 5 | JGI24739J22299_10012411 | 3300001989 | Bacteria | 3130 |
| 6 | JGI24737J22298_10002753 | 3300001990 | Bacteria | 6217 |
| 7 | JGI24737J22298_10008497 | 3300001990 | Bacteria | 3433 |
| 8 | JGI24737J22298_10008534 | 3300001990 | Bacteria | 3426 |
| 9 | JGI24737J22298_10008709 | 3300001990 | Bacteria | 3389 |
| 10 | JGI24737J22298_10034006 | 3300001990 | Bacteria | 1581 |
| 11 | JGI24735J21928_10013571 | 3300002067 | Bacteria | 2558 |
| 12 | JGI24738J21930_10001196 | 3300002075 | Bacteria | 7269 |
| 13 | JGI25165J46597_1000012 | 3300003214 | Bacteria | 421074 |
| 14 | Ga0055525_1000104 | 3300003759 | Bacteria | 134560 |
| 15 | Ga0055542_1000025 | 3300003762 | Bacteria | 263538 |
| 16 | Ga0055529_1000014 | 3300003763 | Bacteria | 367283 |
| 17 | Ga0055536_1001462 | 3300003781 | Bacteria | 14195 |
| 18 | Ga0055536_1005390 | 3300003781 | Bacteria | 6268 |
| 19 | Ga0055531_10001396 | 3300003794 | Bacteria | 17890 |
| 20 | Ga0065712_10075956 | 3300005290 | Bacteria | 3748 |
| 21 | Ga0065715_10140700 | 3300005293 | Bacteria | 1858 |
| 22 | Ga0070658_10000001 | 3300005327 | Bacteria | 856789 |
| 23 | Ga0070658_10000453 | 3300005327 | Bacteria | 35538 |
| 24 | Ga0070658_10000608 | 3300005327 | Bacteria | 31026 |
| 25 | Ga0070658_10013798 | 3300005327 | Bacteria | 6483 |
| 26 | Ga0070658_10014330 | 3300005327 | Bacteria | 6360 |
| 27 | Ga0070658_10046392 | 3300005327 | Bacteria | 3516 |
| 28 | Ga0070658_10048136 | 3300005327 | Bacteria | 3451 |
| 29 | Ga0070658_10053350 | 3300005327 | Bacteria | 3281 |
| 30 | Ga0070658_10059310 | 3300005327 | Bacteria | 3116 |
| 31 | Ga0070658_10062122 | 3300005327 | Bacteria | 3044 |
| 32 | Ga0070683_100015274 | 3300005329 | Bacteria | 6742 |
| 33 | Ga0070683_100015500 | 3300005329 | Bacteria | 6697 |
| 34 | Ga0070683_100033164 | 3300005329 | Bacteria | 4707 |
| 35 | Ga0070683_100073969 | 3300005329 | Bacteria | 3182 |
| 36 | Ga0070683_100083739 | 3300005329 | Bacteria | 2988 |
| 37 | Ga0070690_100057999 | 3300005330 | Bacteria | 2485 |
| 38 | Ga0070670_100000926 | 3300005331 | Bacteria | 23049 |
| 39 | Ga0070670_100004560 | 3300005331 | Bacteria | 11619 |
| 40 | Ga0070670_100006393 | 3300005331 | Bacteria | 9974 |
| 41 | Ga0070670_100010746 | 3300005331 | Bacteria | 7820 |
| 42 | Ga0070670_100014788 | 3300005331 | Bacteria | 6697 |
| 43 | Ga0070670_100036425 | 3300005331 | Bacteria | 4234 |
| 44 | Ga0070670_100095328 | 3300005331 | Bacteria | 2560 |
| 45 | Ga0070670_100108435 | 3300005331 | Bacteria | 2392 |
| 46 | Ga0070666_10000215 | 3300005335 | Bacteria | 39675 |
| 47 | Ga0070666_10003971 | 3300005335 | Bacteria | 8972 |
| 48 | Ga0070666_10006651 | 3300005335 | Bacteria | 7108 |
| 49 | Ga0070666_10068267 | 3300005335 | Bacteria | 2415 |
| 50 | Ga0070680_100001375 | 3300005336 | Bacteria | 17594 |
| 51 | Ga0070680_100006192 | 3300005336 | Bacteria | 9075 |
| 52 | Ga0070680_100073235 | 3300005336 | Bacteria | 2816 |
| 53 | Ga0070680_100135257 | 3300005336 | Bacteria | 2064 |
| 54 | Ga0070682_100009672 | 3300005337 | Bacteria | 5458 |
| 55 | Ga0070682_100010477 | 3300005337 | Bacteria | 5263 |
| 56 | Ga0068868_100136713 | 3300005338 | Bacteria | 2009 |
| 57 | Ga0070660_100000196 | 3300005339 | Bacteria | 40291 |
| 58 | Ga0070660_100000488 | 3300005339 | Bacteria | 26536 |
| 59 | Ga0070660_100000678 | 3300005339 | Bacteria | 22503 |
| 60 | Ga0070660_100001380 | 3300005339 | Bacteria | 16499 |
| 61 | Ga0070660_100002721 | 3300005339 | Bacteria | 12144 |
| 62 | Ga0070660_100002844 | 3300005339 | Bacteria | 11917 |
| 63 | Ga0070660_100039724 | 3300005339 | Bacteria | 3577 |
| 64 | Ga0070660_100062123 | 3300005339 | Bacteria | 2901 |
| 65 | Ga0070660_100083550 | 3300005339 | Bacteria | 2508 |
| 66 | Ga0070660_100117032 | 3300005339 | Bacteria | 2125 |
| 67 | Ga0070691_10006411 | 3300005341 | Bacteria | 5379 |
| 68 | Ga0070661_100000010 | 3300005344 | Bacteria | 175777 |
| 69 | Ga0070661_100000311 | 3300005344 | Bacteria | 39261 |
| 70 | Ga0070661_100001265 | 3300005344 | Bacteria | 17761 |
| 71 | Ga0070661_100015558 | 3300005344 | Bacteria | 5369 |
| 72 | Ga0070661_100021108 | 3300005344 | Bacteria | 4650 |
| 73 | Ga0070661_100052614 | 3300005344 | Bacteria | 2980 |
| 74 | Ga0070661_100125974 | 3300005344 | Bacteria | 1921 |
| 75 | Ga0070692_10007634 | 3300005345 | Bacteria | 4776 |
| 76 | Ga0070668_100000417 | 3300005347 | Bacteria | 28255 |
| 77 | Ga0070668_100029835 | 3300005347 | Bacteria | 4143 |
| 78 | Ga0070668_100112446 | 3300005347 | Bacteria | 2169 |
| 79 | Ga0070669_100010847 | 3300005353 | Bacteria | 6467 |
| 80 | Ga0070669_100021625 | 3300005353 | Bacteria | 4598 |
| 81 | Ga0070669_100025889 | 3300005353 | Bacteria | 4217 |
| 82 | Ga0070669_100028833 | 3300005353 | Bacteria | 3998 |
| 83 | Ga0070669_100127546 | 3300005353 | Bacteria | 1948 |
| 84 | Ga0070675_100127201 | 3300005354 | Bacteria | 2169 |
| 85 | Ga0070671_100000229 | 3300005355 | Bacteria | 37462 |
| 86 | Ga0070671_100005401 | 3300005355 | Bacteria | 10190 |
| 87 | Ga0070671_100008028 | 3300005355 | Bacteria | 8448 |
| 88 | Ga0070671_100172787 | 3300005355 | Bacteria | 1828 |
| 89 | Ga0070674_100003585 | 3300005356 | Bacteria | 8728 |
| 90 | Ga0070674_100046815 | 3300005356 | Bacteria | 2961 |
| 91 | Ga0070673_100001123 | 3300005364 | Bacteria | 15365 |
| 92 | Ga0070673_100001517 | 3300005364 | Bacteria | 13659 |
| 93 | Ga0070673_100014284 | 3300005364 | Bacteria | 5523 |
| 94 | Ga0070673_100028934 | 3300005364 | Bacteria | 4127 |
| 95 | Ga0070673_100048393 | 3300005364 | Bacteria | 3314 |
| 96 | Ga0070659_100000594 | 3300005366 | Bacteria | 26514 |
| 97 | Ga0070659_100002859 | 3300005366 | Bacteria | 12291 |
| 98 | Ga0070659_100004759 | 3300005366 | Bacteria | 9700 |
| 99 | Ga0070659_100020708 | 3300005366 | Bacteria | 5000 |
| 100 | Ga0070659_100028630 | 3300005366 | Bacteria | 4304 |
| 101 | Ga0070659_100032584 | 3300005366 | Bacteria | 4043 |
| 102 | Ga0070659_100036427 | 3300005366 | Bacteria | 3837 |
| 103 | Ga0070659_100121668 | 3300005366 | Bacteria | 2115 |
| 104 | Ga0070667_100002846 | 3300005367 | Bacteria | 14931 |
| 105 | Ga0070667_100009607 | 3300005367 | Bacteria | 8021 |
| 106 | Ga0070667_100020527 | 3300005367 | Bacteria | 5485 |
| 107 | Ga0070667_100022365 | 3300005367 | Bacteria | 5244 |
| 108 | Ga0070667_100065626 | 3300005367 | Bacteria | 3082 |
| 109 | Ga0070667_100075673 | 3300005367 | Bacteria | 2874 |
| 110 | Ga0070667_100080108 | 3300005367 | Bacteria | 2793 |
| 111 | Ga0070667_100127294 | 3300005367 | Bacteria | 2220 |
| 112 | Ga0070667_100151447 | 3300005367 | Bacteria | 2038 |
| 113 | Ga0070714_100170522 | 3300005435 | Bacteria | 1975 |
| 114 | Ga0070663_100003678 | 3300005455 | Bacteria | 8890 |
| 115 | Ga0070663_100016977 | 3300005455 | Bacteria | 4739 |
| 116 | Ga0070678_100004545 | 3300005456 | Bacteria | 7878 |
| 117 | Ga0070662_100000198 | 3300005457 | Bacteria | 35360 |
| 118 | Ga0070662_100001444 | 3300005457 | Bacteria | 14651 |
| 119 | Ga0070662_100001885 | 3300005457 | Bacteria | 12853 |
| 120 | Ga0070662_100006163 | 3300005457 | Bacteria | 7711 |
| 121 | Ga0070662_100010186 | 3300005457 | Bacteria | 6163 |
| 122 | Ga0070662_100022776 | 3300005457 | Bacteria | 4293 |
| 123 | Ga0070662_100024316 | 3300005457 | Bacteria | 4172 |
| 124 | Ga0070662_100045053 | 3300005457 | Bacteria | 3163 |
| 125 | Ga0070681_10063695 | 3300005458 | Bacteria | 3659 |
| 126 | Ga0070681_10079160 | 3300005458 | Bacteria | 3243 |
| 127 | Ga0068867_100015941 | 3300005459 | Bacteria | 5334 |
| 128 | Ga0070679_100000005 | 3300005530 | Bacteria | 263201 |
| 129 | Ga0070679_100001379 | 3300005530 | Bacteria | 21458 |
| 130 | Ga0070684_100052323 | 3300005535 | Bacteria | 3551 |
| 131 | Ga0068853_100000630 | 3300005539 | Bacteria | 24214 |
| 132 | Ga0068853_100071507 | 3300005539 | Bacteria | 3021 |
| 133 | Ga0068853_100195898 | 3300005539 | Bacteria | 1838 |
| 134 | Ga0068853_100247135 | 3300005539 | Bacteria | 1636 |
| 135 | Ga0070672_100001700 | 3300005543 | Bacteria | 13736 |
| 136 | Ga0070672_100003232 | 3300005543 | Bacteria | 10550 |
| 137 | Ga0070672_100015400 | 3300005543 | Bacteria | 5442 |
| 138 | Ga0070672_100024535 | 3300005543 | Bacteria | 4459 |
| 139 | Ga0070672_100133624 | 3300005543 | Bacteria | 2041 |
| 140 | Ga0070686_100070721 | 3300005544 | Bacteria | 2282 |
| 141 | Ga0070693_100003956 | 3300005547 | Bacteria | 6952 |
| 142 | Ga0070665_100000186 | 3300005548 | Bacteria | 110750 |
| 143 | Ga0070665_100000820 | 3300005548 | Bacteria | 40672 |
| 144 | Ga0070665_100002788 | 3300005548 | Bacteria | 18950 |
| 145 | Ga0070665_100004669 | 3300005548 | Bacteria | 14305 |
| 146 | Ga0070665_100004787 | 3300005548 | Bacteria | 14086 |
| 147 | Ga0070665_100020745 | 3300005548 | Bacteria | 6603 |
| 148 | Ga0070665_100036998 | 3300005548 | Bacteria | 4909 |
| 149 | Ga0070665_100057110 | 3300005548 | Bacteria | 3913 |
| 150 | Ga0068855_100000408 | 3300005563 | Bacteria | 53275 |
| 151 | Ga0068855_100029819 | 3300005563 | Bacteria | 6523 |
| 152 | Ga0068855_100030382 | 3300005563 | Bacteria | 6463 |
| 153 | Ga0068855_100034006 | 3300005563 | Bacteria | 6080 |
| 154 | Ga0068855_100064376 | 3300005563 | Bacteria | 4276 |
| 155 | Ga0068855_100070013 | 3300005563 | Bacteria | 4082 |
| 156 | Ga0068855_100142452 | 3300005563 | Bacteria | 2731 |
| 157 | Ga0070664_100000259 | 3300005564 | Bacteria | 38210 |
| 158 | Ga0070664_100001404 | 3300005564 | Bacteria | 19225 |
| 159 | Ga0070664_100001633 | 3300005564 | Bacteria | 17950 |
| 160 | Ga0070664_100031112 | 3300005564 | Bacteria | 4456 |
| 161 | Ga0070664_100047266 | 3300005564 | Bacteria | 3635 |
| 162 | Ga0070664_100109851 | 3300005564 | Bacteria | 2405 |
| 163 | Ga0068857_100014903 | 3300005577 | Bacteria | 6780 |
| 164 | Ga0068857_100035949 | 3300005577 | Bacteria | 4388 |
| 165 | Ga0068857_100088738 | 3300005577 | Bacteria | 2766 |
| 166 | Ga0068854_100002023 | 3300005578 | Bacteria | 12419 |
| 167 | Ga0068854_100010331 | 3300005578 | Bacteria | 6049 |
| 168 | Ga0068854_100070394 | 3300005578 | Bacteria | 2557 |
| 169 | Ga0068856_100000315 | 3300005614 | Bacteria | 53098 |
| 170 | Ga0068856_100040015 | 3300005614 | Bacteria | 4603 |
| 171 | Ga0068852_100000548 | 3300005616 | Bacteria | 24613 |
| 172 | Ga0068852_100002347 | 3300005616 | Bacteria | 13030 |
| 173 | Ga0068852_100011651 | 3300005616 | Bacteria | 6631 |
| 174 | Ga0068852_100012894 | 3300005616 | Bacteria | 6372 |
| 175 | Ga0068852_100032154 | 3300005616 | Bacteria | 4341 |
| 176 | Ga0068852_100070909 | 3300005616 | Bacteria | 3058 |
| 177 | Ga0068852_100245050 | 3300005616 | Bacteria | 1715 |
| 178 | Ga0068859_100002810 | 3300005617 | Bacteria | 17638 |
| 179 | Ga0068859_100010651 | 3300005617 | Bacteria | 9255 |
| 180 | Ga0068859_100013157 | 3300005617 | Bacteria | 8312 |
| 181 | Ga0068859_100030985 | 3300005617 | Bacteria | 5367 |
| 182 | Ga0068859_100047383 | 3300005617 | Bacteria | 4318 |
| 183 | Ga0068859_100047416 | 3300005617 | Bacteria | 4317 |
| 184 | Ga0068859_100086348 | 3300005617 | Bacteria | 3184 |
| 185 | Ga0068859_100121610 | 3300005617 | Bacteria | 2677 |
| 186 | Ga0068859_100136416 | 3300005617 | Bacteria | 2527 |
| 187 | Ga0068864_100002676 | 3300005618 | Bacteria | 14708 |
| 188 | Ga0068864_100015545 | 3300005618 | Bacteria | 6329 |
| 189 | Ga0068864_100019523 | 3300005618 | Bacteria | 5668 |
| 190 | Ga0068864_100032751 | 3300005618 | Bacteria | 4417 |
| 191 | Ga0068864_100034668 | 3300005618 | Bacteria | 4294 |
| 192 | Ga0068864_100037717 | 3300005618 | Bacteria | 4126 |
| 193 | Ga0068861_100000342 | 3300005719 | Bacteria | 26513 |
| 194 | Ga0068861_100107843 | 3300005719 | Bacteria | 2227 |
| 195 | Ga0068851_10003735 | 3300005834 | Bacteria | 6802 |
| 196 | Ga0068851_10007915 | 3300005834 | Bacteria | 4898 |
| 197 | Ga0068851_10027670 | 3300005834 | Bacteria | 2795 |
| 198 | Ga0068863_100002668 | 3300005841 | Bacteria | 17638 |
| 199 | Ga0068863_100018056 | 3300005841 | Bacteria | 6755 |
| 200 | Ga0068863_100048238 | 3300005841 | Bacteria | 4038 |
| 201 | Ga0068863_100089450 | 3300005841 | Bacteria | 2919 |
| 202 | Ga0068863_100135628 | 3300005841 | Bacteria | 2351 |
| 203 | Ga0068858_100000292 | 3300005842 | Bacteria | 54217 |
| 204 | Ga0068858_100004640 | 3300005842 | Bacteria | 13458 |
| 205 | Ga0068858_100005553 | 3300005842 | Bacteria | 12339 |
| 206 | Ga0068858_100016460 | 3300005842 | Bacteria | 6943 |
| 207 | Ga0068858_100020597 | 3300005842 | Bacteria | 6161 |
| 208 | Ga0068858_100048106 | 3300005842 | Bacteria | 3952 |
| 209 | Ga0068858_100087420 | 3300005842 | Bacteria | 2899 |
| 210 | Ga0068858_100134254 | 3300005842 | Bacteria | 2321 |
| 211 | Ga0068858_100139963 | 3300005842 | Bacteria | 2271 |
| 212 | Ga0068860_100009099 | 3300005843 | Bacteria | 9883 |
| 213 | Ga0068860_100034282 | 3300005843 | Bacteria | 4868 |
| 214 | Ga0068860_100056677 | 3300005843 | Bacteria | 3724 |
| 215 | Ga0068862_100010452 | 3300005844 | Bacteria | 7664 |
| 216 | Ga0068862_100049681 | 3300005844 | Bacteria | 3583 |
| 217 | Ga0081539_10012045 | 3300005985 | Bacteria | 6725 |
| 218 | Ga0075368_10002482 | 3300006042 | Bacteria | 6035 |
| 219 | Ga0075363_100011628 | 3300006048 | Bacteria | 4220 |
| 220 | Ga0075362_10000018 | 3300006177 | Bacteria | 75123 |
| 221 | Ga0075362_10000985 | 3300006177 | Bacteria | 8708 |
| 222 | Ga0075366_10000303 | 3300006195 | Bacteria | 22259 |
| 223 | Ga0097621_100055225 | 3300006237 | Bacteria | 3243 |
| 224 | Ga0068871_100029468 | 3300006358 | Bacteria | 4311 |
| 225 | Ga0068871_100049418 | 3300006358 | Bacteria | 3399 |
| 226 | Ga0068871_100139332 | 3300006358 | Bacteria | 2062 |
| 227 | Ga0075431_100006263 | 3300006847 | Bacteria | 11821 |
| 228 | Ga0068865_100038232 | 3300006881 | Bacteria | 3247 |
| 229 | Ga0068865_100040472 | 3300006881 | Bacteria | 3167 |
| 230 | Ga0068865_100083442 | 3300006881 | Bacteria | 2300 |
| 231 | Ga0097620_100002811 | 3300006931 | Bacteria | 17638 |
| 232 | Ga0097620_100010651 | 3300006931 | Bacteria | 9255 |
| 233 | Ga0097620_100013157 | 3300006931 | Bacteria | 8312 |
| 234 | Ga0097620_100030985 | 3300006931 | Bacteria | 5367 |
| 235 | Ga0097620_100047384 | 3300006931 | Bacteria | 4318 |
| 236 | Ga0097620_100047417 | 3300006931 | Bacteria | 4317 |
| 237 | Ga0097620_100086352 | 3300006931 | Bacteria | 3184 |
| 238 | Ga0097620_100121611 | 3300006931 | Bacteria | 2677 |
| 239 | Ga0097620_100136420 | 3300006931 | Bacteria | 2527 |
| 240 | Ga0105250_10006682 | 3300009092 | Bacteria | 5018 |
| 241 | Ga0111539_10102475 | 3300009094 | Bacteria | 3360 |
| 242 | Ga0105245_10006292 | 3300009098 | Bacteria | 10451 |
| 243 | Ga0105245_10049672 | 3300009098 | Bacteria | 3757 |
| 244 | Ga0105243_10000917 | 3300009148 | Bacteria | 27647 |
| 245 | Ga0105241_10004599 | 3300009174 | Bacteria | 10207 |
| 246 | Ga0105242_10123637 | 3300009176 | Bacteria | 2224 |
| 247 | Ga0105248_10000362 | 3300009177 | Bacteria | 53018 |
| 248 | Ga0105248_10000395 | 3300009177 | Bacteria | 50389 |
| 249 | Ga0105248_10000774 | 3300009177 | Bacteria | 35872 |
| 250 | Ga0105248_10004323 | 3300009177 | Bacteria | 15711 |
| 251 | Ga0105248_10006715 | 3300009177 | Bacteria | 12620 |
| 252 | Ga0105248_10007122 | 3300009177 | Bacteria | 12257 |
| 253 | Ga0105248_10010911 | 3300009177 | Bacteria | 10025 |
| 254 | Ga0105248_10023147 | 3300009177 | Bacteria | 6900 |
| 255 | Ga0105248_10024612 | 3300009177 | Bacteria | 6694 |
| 256 | Ga0105248_10086313 | 3300009177 | Bacteria | 3531 |
| 257 | Ga0105248_10107601 | 3300009177 | Bacteria | 3144 |
| 258 | Ga0105248_10110921 | 3300009177 | Bacteria | 3093 |
| 259 | Ga0105248_10140777 | 3300009177 | Bacteria | 2721 |
| 260 | Ga0105237_10073188 | 3300009545 | Bacteria | 3419 |
| 261 | Ga0105238_10001671 | 3300009551 | Bacteria | 22298 |
| 262 | Ga0105238_10016618 | 3300009551 | Bacteria | 7452 |
| 263 | Ga0105249_10051014 | 3300009553 | Bacteria | 3773 |
| 264 | Ga0105239_10110493 | 3300010375 | Bacteria | 3047 |
| 265 | Ga0157373_10016724 | 3300013100 | Bacteria | 5346 |
| 266 | Ga0157373_10017322 | 3300013100 | Bacteria | 5246 |
| 267 | Ga0157373_10071828 | 3300013100 | Bacteria | 2443 |
| 268 | Ga0157371_10000183 | 3300013102 | Bacteria | 92426 |
| 269 | Ga0157371_10005239 | 3300013102 | Bacteria | 11011 |
| 270 | Ga0157371_10010681 | 3300013102 | Bacteria | 7131 |
| 271 | Ga0157370_10048117 | 3300013104 | Bacteria | 4086 |
| 272 | Ga0157369_10000635 | 3300013105 | Bacteria | 45411 |
| 273 | Ga0157369_10003132 | 3300013105 | Bacteria | 19773 |
| 274 | Ga0157369_10056072 | 3300013105 | Bacteria | 4252 |
| 275 | Ga0157369_10206667 | 3300013105 | Bacteria | 2059 |
| 276 | Ga0157378_10279066 | 3300013297 | Bacteria | 1610 |
| 277 | Ga0163162_10006899 | 3300013306 | Bacteria | 11017 |
| 278 | Ga0163162_10006918 | 3300013306 | Bacteria | 10996 |
| 279 | Ga0163162_10037036 | 3300013306 | Bacteria | 4865 |
| 280 | Ga0163162_10117940 | 3300013306 | Bacteria | 2756 |
| 281 | Ga0157375_10000296 | 3300013308 | Bacteria | 45207 |
| 282 | Ga0157375_10017638 | 3300013308 | Bacteria | 6448 |
| 283 | Ga0157375_10090319 | 3300013308 | Bacteria | 3121 |
| 284 | Ga0157375_10375573 | 3300013308 | Bacteria | 1588 |
| 285 | Ga0163163_10002099 | 3300014325 | Bacteria | 16824 |
| 286 | Ga0163163_10002393 | 3300014325 | Bacteria | 15879 |
| 287 | Ga0163163_10011403 | 3300014325 | Bacteria | 8060 |
| 288 | Ga0157380_10106562 | 3300014326 | Bacteria | 2346 |
| 289 | Ga0157380_10120042 | 3300014326 | Bacteria | 2225 |
| 290 | Ga0157379_10003233 | 3300014968 | Bacteria | 13810 |
| 291 | Ga0157379_10044281 | 3300014968 | Bacteria | 3972 |
| 292 | Ga0183363_1004 | 3300015690 | Bacteria | 416766 |
| 293 | Ga0163161_10003370 | 3300017792 | Bacteria | 11209 |
| 294 | Ga0213873_10000015 | 3300021358 | Bacteria | 131343 |
| 295 | Ga0213876_10000005 | 3300021384 | Bacteria | 727326 |
| 296 | Ga0213876_10000263 | 3300021384 | Bacteria | 48650 |
| 297 | Ga0213875_10002419 | 3300021388 | Bacteria | 11208 |
| 298 | Ga0209563_100116 | 3300025230 | Bacteria | 134661 |
| 299 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 300 | Ga0209233_1000058 | 3300025261 | Bacteria | 421872 |
| 301 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 302 | Ga0209675_1000126 | 3300025291 | Bacteria | 104792 |
| 303 | Ga0209676_1000060 | 3300025292 | Bacteria | 338238 |
| 304 | Ga0209676_1000148 | 3300025292 | Bacteria | 172161 |
| 305 | Ga0209758_1000001 | 3300025297 | Bacteria | 1981790 |
| 306 | Ga0209050_1000047 | 3300025298 | Bacteria | 380561 |
| 307 | Ga0209050_1003236 | 3300025298 | Bacteria | 12273 |
| 308 | Ga0209257_1000076 | 3300025304 | Bacteria | 324617 |
| 309 | Ga0207697_10007831 | 3300025315 | Bacteria | 4726 |
| 310 | Ga0207697_10040015 | 3300025315 | Bacteria | 1924 |
| 311 | Ga0207656_10001128 | 3300025321 | Bacteria | 8776 |
| 312 | Ga0207656_10011235 | 3300025321 | Bacteria | 3378 |
| 313 | Ga0207656_10012022 | 3300025321 | Bacteria | 3284 |
| 314 | Ga0207682_10003135 | 3300025893 | Bacteria | 7244 |
| 315 | Ga0207682_10005730 | 3300025893 | Bacteria | 5038 |
| 316 | Ga0207642_10013595 | 3300025899 | Bacteria | 2974 |
| 317 | Ga0207680_10001423 | 3300025903 | Bacteria | 11336 |
| 318 | Ga0207680_10003548 | 3300025903 | Bacteria | 7346 |
| 319 | Ga0207680_10008878 | 3300025903 | Bacteria | 4956 |
| 320 | Ga0207647_10000339 | 3300025904 | Bacteria | 38180 |
| 321 | Ga0207647_10001091 | 3300025904 | Bacteria | 20920 |
| 322 | Ga0207647_10017322 | 3300025904 | Bacteria | 4898 |
| 323 | Ga0207647_10017780 | 3300025904 | Bacteria | 4825 |
| 324 | Ga0207647_10025267 | 3300025904 | Bacteria | 3906 |
| 325 | Ga0207647_10041128 | 3300025904 | Bacteria | 2908 |
| 326 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 327 | Ga0207705_10000070 | 3300025909 | Bacteria | 130733 |
| 328 | Ga0207705_10000166 | 3300025909 | Bacteria | 71368 |
| 329 | Ga0207705_10000205 | 3300025909 | Bacteria | 59773 |
| 330 | Ga0207705_10000449 | 3300025909 | Bacteria | 35420 |
| 331 | Ga0207705_10005655 | 3300025909 | Bacteria | 9332 |
| 332 | Ga0207705_10007530 | 3300025909 | Bacteria | 8000 |
| 333 | Ga0207705_10008658 | 3300025909 | Bacteria | 7416 |
| 334 | Ga0207705_10016594 | 3300025909 | Bacteria | 5275 |
| 335 | Ga0207705_10018815 | 3300025909 | Bacteria | 4940 |
| 336 | Ga0207705_10030837 | 3300025909 | Bacteria | 3826 |
| 337 | Ga0207705_10034881 | 3300025909 | Bacteria | 3598 |
| 338 | Ga0207705_10037372 | 3300025909 | Bacteria | 3475 |
| 339 | Ga0207705_10049564 | 3300025909 | Bacteria | 3022 |
| 340 | Ga0207705_10053486 | 3300025909 | Bacteria | 2908 |
| 341 | Ga0207705_10115890 | 3300025909 | Bacteria | 1983 |
| 342 | Ga0207654_10000986 | 3300025911 | Bacteria | 15594 |
| 343 | Ga0207707_10024686 | 3300025912 | Bacteria | 5260 |
| 344 | Ga0207707_10080778 | 3300025912 | Bacteria | 2839 |
| 345 | Ga0207707_10108299 | 3300025912 | Bacteria | 2429 |
| 346 | Ga0207695_10005871 | 3300025913 | Bacteria | 16113 |
| 347 | Ga0207695_10014084 | 3300025913 | Bacteria | 9497 |
| 348 | Ga0207695_10233529 | 3300025913 | Bacteria | 1743 |
| 349 | Ga0207671_10010288 | 3300025914 | Bacteria | 7731 |
| 350 | Ga0207671_10065049 | 3300025914 | Bacteria | 2712 |
| 351 | Ga0207671_10115233 | 3300025914 | Bacteria | 2049 |
| 352 | Ga0207660_10004430 | 3300025917 | Bacteria | 9156 |
| 353 | Ga0207657_10000471 | 3300025919 | Bacteria | 42534 |
| 354 | Ga0207657_10001304 | 3300025919 | Bacteria | 26485 |
| 355 | Ga0207657_10002320 | 3300025919 | Bacteria | 20619 |
| 356 | Ga0207657_10003326 | 3300025919 | Bacteria | 17195 |
| 357 | Ga0207657_10003700 | 3300025919 | Bacteria | 16257 |
| 358 | Ga0207657_10005851 | 3300025919 | Bacteria | 12809 |
| 359 | Ga0207657_10008974 | 3300025919 | Bacteria | 10102 |
| 360 | Ga0207657_10009473 | 3300025919 | Bacteria | 9784 |
| 361 | Ga0207657_10009727 | 3300025919 | Bacteria | 9642 |
| 362 | Ga0207657_10011984 | 3300025919 | Bacteria | 8577 |
| 363 | Ga0207657_10032585 | 3300025919 | Bacteria | 4706 |
| 364 | Ga0207657_10064793 | 3300025919 | Bacteria | 3118 |
| 365 | Ga0207657_10073458 | 3300025919 | Bacteria | 2890 |
| 366 | Ga0207657_10177273 | 3300025919 | Bacteria | 1724 |
| 367 | Ga0207649_10000165 | 3300025920 | Bacteria | 54047 |
| 368 | Ga0207649_10000225 | 3300025920 | Bacteria | 46073 |
| 369 | Ga0207649_10001363 | 3300025920 | Bacteria | 14500 |
| 370 | Ga0207649_10003505 | 3300025920 | Bacteria | 8577 |
| 371 | Ga0207649_10041672 | 3300025920 | Bacteria | 2796 |
| 372 | Ga0207649_10042593 | 3300025920 | Bacteria | 2770 |
| 373 | Ga0207649_10046859 | 3300025920 | Bacteria | 2658 |
| 374 | Ga0207649_10077909 | 3300025920 | Bacteria | 2137 |
| 375 | Ga0207652_10000036 | 3300025921 | Bacteria | 134949 |
| 376 | Ga0207652_10000270 | 3300025921 | Bacteria | 54010 |
| 377 | Ga0207652_10074640 | 3300025921 | Bacteria | 2953 |
| 378 | Ga0207652_10228722 | 3300025921 | Bacteria | 1676 |
| 379 | Ga0207681_10000713 | 3300025923 | Bacteria | 21863 |
| 380 | Ga0207681_10003725 | 3300025923 | Bacteria | 9474 |
| 381 | Ga0207681_10006050 | 3300025923 | Bacteria | 7422 |
| 382 | Ga0207681_10010338 | 3300025923 | Bacteria | 5709 |
| 383 | Ga0207681_10057402 | 3300025923 | Bacteria | 2660 |
| 384 | Ga0207694_10001620 | 3300025924 | Bacteria | 18931 |
| 385 | Ga0207694_10016301 | 3300025924 | Bacteria | 5609 |
| 386 | Ga0207650_10004433 | 3300025925 | Bacteria | 9590 |
| 387 | Ga0207650_10021458 | 3300025925 | Bacteria | 4564 |
| 388 | Ga0207650_10064988 | 3300025925 | Bacteria | 2732 |
| 389 | Ga0207659_10008129 | 3300025926 | Bacteria | 6492 |
| 390 | Ga0207687_10000564 | 3300025927 | Bacteria | 25021 |
| 391 | Ga0207700_10112013 | 3300025928 | Bacteria | 2198 |
| 392 | Ga0207644_10000324 | 3300025931 | Bacteria | 31071 |
| 393 | Ga0207644_10007290 | 3300025931 | Bacteria | 7198 |
| 394 | Ga0207644_10011303 | 3300025931 | Bacteria | 5903 |
| 395 | Ga0207644_10019091 | 3300025931 | Bacteria | 4647 |
| 396 | Ga0207644_10034849 | 3300025931 | Bacteria | 3523 |
| 397 | Ga0207644_10120667 | 3300025931 | Bacteria | 1995 |
| 398 | Ga0207690_10000257 | 3300025932 | Bacteria | 38401 |
| 399 | Ga0207690_10026021 | 3300025932 | Bacteria | 3683 |
| 400 | Ga0207706_10001159 | 3300025933 | Bacteria | 26723 |
| 401 | Ga0207706_10001176 | 3300025933 | Bacteria | 26479 |
| 402 | Ga0207706_10004436 | 3300025933 | Bacteria | 13190 |
| 403 | Ga0207706_10012485 | 3300025933 | Bacteria | 7739 |
| 404 | Ga0207706_10015297 | 3300025933 | Bacteria | 6937 |
| 405 | Ga0207706_10027130 | 3300025933 | Bacteria | 5122 |
| 406 | Ga0207706_10028341 | 3300025933 | Bacteria | 5002 |
| 407 | Ga0207706_10041704 | 3300025933 | Bacteria | 4068 |
| 408 | Ga0207706_10075584 | 3300025933 | Bacteria | 2962 |
| 409 | Ga0207706_10194421 | 3300025933 | Bacteria | 1780 |
| 410 | Ga0207709_10000018 | 3300025935 | Bacteria | 431545 |
| 411 | Ga0207669_10000068 | 3300025937 | Bacteria | 52240 |
| 412 | Ga0207669_10003287 | 3300025937 | Bacteria | 6992 |
| 413 | Ga0207669_10006639 | 3300025937 | Bacteria | 5304 |
| 414 | Ga0207669_10061470 | 3300025937 | Bacteria | 2308 |
| 415 | Ga0207704_10028858 | 3300025938 | Bacteria | 3085 |
| 416 | Ga0207704_10038739 | 3300025938 | Bacteria | 2768 |
| 417 | Ga0207704_10124861 | 3300025938 | Bacteria | 1769 |
| 418 | Ga0207691_10000696 | 3300025940 | Bacteria | 33255 |
| 419 | Ga0207691_10000915 | 3300025940 | Bacteria | 29231 |
| 420 | Ga0207691_10018796 | 3300025940 | Bacteria | 6546 |
| 421 | Ga0207691_10035119 | 3300025940 | Bacteria | 4658 |
| 422 | Ga0207691_10036542 | 3300025940 | Bacteria | 4552 |
| 423 | Ga0207691_10050290 | 3300025940 | Bacteria | 3816 |
| 424 | Ga0207691_10052924 | 3300025940 | Bacteria | 3707 |
| 425 | Ga0207691_10129294 | 3300025940 | Bacteria | 2232 |
| 426 | Ga0207691_10199239 | 3300025940 | Bacteria | 1743 |
| 427 | Ga0207711_10000427 | 3300025941 | Bacteria | 44194 |
| 428 | Ga0207711_10000429 | 3300025941 | Bacteria | 43981 |
| 429 | Ga0207711_10001486 | 3300025941 | Bacteria | 21831 |
| 430 | Ga0207711_10001903 | 3300025941 | Bacteria | 18980 |
| 431 | Ga0207711_10008656 | 3300025941 | Bacteria | 8510 |
| 432 | Ga0207711_10011424 | 3300025941 | Bacteria | 7383 |
| 433 | Ga0207711_10011831 | 3300025941 | Bacteria | 7250 |
| 434 | Ga0207711_10018883 | 3300025941 | Bacteria | 5732 |
| 435 | Ga0207711_10059984 | 3300025941 | Bacteria | 3277 |
| 436 | Ga0207689_10014695 | 3300025942 | Bacteria | 6649 |
| 437 | Ga0207661_10001889 | 3300025944 | Bacteria | 14357 |
| 438 | Ga0207661_10020291 | 3300025944 | Bacteria | 4964 |
| 439 | Ga0207661_10048483 | 3300025944 | Bacteria | 3376 |
| 440 | Ga0207661_10092528 | 3300025944 | Bacteria | 2521 |
| 441 | Ga0207661_10150014 | 3300025944 | Bacteria | 2014 |
| 442 | Ga0207679_10000463 | 3300025945 | Bacteria | 28581 |
| 443 | Ga0207679_10008055 | 3300025945 | Bacteria | 6700 |
| 444 | Ga0207679_10014006 | 3300025945 | Bacteria | 5260 |
| 445 | Ga0207667_10000107 | 3300025949 | Bacteria | 133066 |
| 446 | Ga0207667_10001086 | 3300025949 | Bacteria | 34513 |
| 447 | Ga0207667_10011124 | 3300025949 | Bacteria | 10475 |
| 448 | Ga0207667_10011437 | 3300025949 | Bacteria | 10315 |
| 449 | Ga0207667_10022885 | 3300025949 | Bacteria | 6890 |
| 450 | Ga0207667_10032459 | 3300025949 | Bacteria | 5626 |
| 451 | Ga0207667_10038356 | 3300025949 | Bacteria | 5118 |
| 452 | Ga0207667_10054554 | 3300025949 | Bacteria | 4203 |
| 453 | Ga0207667_10166349 | 3300025949 | Bacteria | 2267 |
| 454 | Ga0207667_10210158 | 3300025949 | Bacteria | 1994 |
| 455 | Ga0207651_10001281 | 3300025960 | Bacteria | 11309 |
| 456 | Ga0207651_10018709 | 3300025960 | Bacteria | 4131 |
| 457 | Ga0207651_10029319 | 3300025960 | Bacteria | 3485 |
| 458 | Ga0207651_10032768 | 3300025960 | Bacteria | 3342 |
| 459 | Ga0207651_10088707 | 3300025960 | Bacteria | 2255 |
| 460 | Ga0207651_10119364 | 3300025960 | Bacteria | 1996 |
| 461 | Ga0207712_10001479 | 3300025961 | Bacteria | 16004 |
| 462 | Ga0207668_10000193 | 3300025972 | Bacteria | 41849 |
| 463 | Ga0207668_10006265 | 3300025972 | Bacteria | 7029 |
| 464 | Ga0207668_10021104 | 3300025972 | Bacteria | 4150 |
| 465 | Ga0207668_10024698 | 3300025972 | Bacteria | 3882 |
| 466 | Ga0207668_10094671 | 3300025972 | Bacteria | 2203 |
| 467 | Ga0207668_10204693 | 3300025972 | Bacteria | 1574 |
| 468 | Ga0207640_10007283 | 3300025981 | Bacteria | 6104 |
| 469 | Ga0207640_10015302 | 3300025981 | Bacteria | 4438 |
| 470 | Ga0207640_10041766 | 3300025981 | Bacteria | 2919 |
| 471 | Ga0207658_10003493 | 3300025986 | Bacteria | 11092 |
| 472 | Ga0207658_10003904 | 3300025986 | Bacteria | 10483 |
| 473 | Ga0207658_10012446 | 3300025986 | Bacteria | 5812 |
| 474 | Ga0207658_10032938 | 3300025986 | Bacteria | 3693 |
| 475 | Ga0207658_10043745 | 3300025986 | Bacteria | 3257 |
| 476 | Ga0207658_10046834 | 3300025986 | Bacteria | 3160 |
| 477 | Ga0207677_10018010 | 3300026023 | Bacteria | 4230 |
| 478 | Ga0207677_10058563 | 3300026023 | Bacteria | 2653 |
| 479 | Ga0207677_10113305 | 3300026023 | Bacteria | 2024 |
| 480 | Ga0207703_10000314 | 3300026035 | Bacteria | 52654 |
| 481 | Ga0207703_10001377 | 3300026035 | Bacteria | 22204 |
| 482 | Ga0207703_10002355 | 3300026035 | Bacteria | 16457 |
| 483 | Ga0207703_10004554 | 3300026035 | Bacteria | 11363 |
| 484 | Ga0207703_10006290 | 3300026035 | Bacteria | 9494 |
| 485 | Ga0207703_10022775 | 3300026035 | Bacteria | 4921 |
| 486 | Ga0207703_10097238 | 3300026035 | Bacteria | 2487 |
| 487 | Ga0207639_10000725 | 3300026041 | Bacteria | 22513 |
| 488 | Ga0207639_10002865 | 3300026041 | Bacteria | 11588 |
| 489 | Ga0207639_10006890 | 3300026041 | Bacteria | 7741 |
| 490 | Ga0207639_10113263 | 3300026041 | Bacteria | 2215 |
| 491 | Ga0207678_10000766 | 3300026067 | Bacteria | 29323 |
| 492 | Ga0207678_10001860 | 3300026067 | Bacteria | 19290 |
| 493 | Ga0207678_10003559 | 3300026067 | Bacteria | 14013 |
| 494 | Ga0207678_10005883 | 3300026067 | Bacteria | 10934 |
| 495 | Ga0207678_10018453 | 3300026067 | Bacteria | 6126 |
| 496 | Ga0207678_10019547 | 3300026067 | Bacteria | 5952 |
| 497 | Ga0207678_10028351 | 3300026067 | Bacteria | 4888 |
| 498 | Ga0207678_10056767 | 3300026067 | Bacteria | 3370 |
| 499 | Ga0207678_10087586 | 3300026067 | Bacteria | 2661 |
| 500 | Ga0207678_10114328 | 3300026067 | Bacteria | 2303 |
| 501 | Ga0207678_10136169 | 3300026067 | Bacteria | 2095 |
| 502 | Ga0207702_10002349 | 3300026078 | Bacteria | 18050 |
| 503 | Ga0207702_10009679 | 3300026078 | Bacteria | 8092 |
| 504 | Ga0207702_10020040 | 3300026078 | Bacteria | 5542 |
| 505 | Ga0207702_10024826 | 3300026078 | Bacteria | 4972 |
| 506 | Ga0207702_10036416 | 3300026078 | Bacteria | 4116 |
| 507 | Ga0207641_10002148 | 3300026088 | Bacteria | 18577 |
| 508 | Ga0207641_10015693 | 3300026088 | Bacteria | 6206 |
| 509 | Ga0207641_10015705 | 3300026088 | Bacteria | 6204 |
| 510 | Ga0207641_10030647 | 3300026088 | Bacteria | 4456 |
| 511 | Ga0207648_10008226 | 3300026089 | Bacteria | 10127 |
| 512 | Ga0207648_10015674 | 3300026089 | Bacteria | 6959 |
| 513 | Ga0207648_10036614 | 3300026089 | Bacteria | 4323 |
| 514 | Ga0207648_10038444 | 3300026089 | Bacteria | 4210 |
| 515 | Ga0207648_10108607 | 3300026089 | Bacteria | 2435 |
| 516 | Ga0207676_10000266 | 3300026095 | Bacteria | 45449 |
| 517 | Ga0207676_10001670 | 3300026095 | Bacteria | 16351 |
| 518 | Ga0207676_10015413 | 3300026095 | Bacteria | 5513 |
| 519 | Ga0207676_10029323 | 3300026095 | Bacteria | 4118 |
| 520 | Ga0207676_10119298 | 3300026095 | Bacteria | 2221 |
| 521 | Ga0207674_10000347 | 3300026116 | Bacteria | 59568 |
| 522 | Ga0207674_10001348 | 3300026116 | Bacteria | 31762 |
| 523 | Ga0207674_10006876 | 3300026116 | Bacteria | 13329 |
| 524 | Ga0207674_10007182 | 3300026116 | Bacteria | 13002 |
| 525 | Ga0207674_10015096 | 3300026116 | Bacteria | 8501 |
| 526 | Ga0207675_100000078 | 3300026118 | Bacteria | 75565 |
| 527 | Ga0207675_100012623 | 3300026118 | Bacteria | 7893 |
| 528 | Ga0207683_10002012 | 3300026121 | Bacteria | 17987 |
| 529 | Ga0207683_10007048 | 3300026121 | Bacteria | 9638 |
| 530 | Ga0207683_10039360 | 3300026121 | Bacteria | 4124 |
| 531 | Ga0207698_10000435 | 3300026142 | Bacteria | 24060 |
| 532 | Ga0207698_10001498 | 3300026142 | Bacteria | 13598 |
| 533 | Ga0207698_10001522 | 3300026142 | Bacteria | 13500 |
| 534 | Ga0207698_10002732 | 3300026142 | Bacteria | 10512 |
| 535 | Ga0207698_10003563 | 3300026142 | Bacteria | 9392 |
| 536 | Ga0207698_10004314 | 3300026142 | Bacteria | 8662 |
| 537 | Ga0207698_10016372 | 3300026142 | Bacteria | 4994 |
| 538 | Ga0207698_10037815 | 3300026142 | Bacteria | 3559 |
| 539 | Ga0207698_10059612 | 3300026142 | Bacteria | 2964 |
| 540 | Ga0207698_10073087 | 3300026142 | Bacteria | 2729 |
| 541 | Ga0207698_10083458 | 3300026142 | Bacteria | 2586 |
| 542 | Ga0207698_10172312 | 3300026142 | Bacteria | 1907 |
| 543 | Ga0209281_1010293 | 3300027111 | Bacteria | 2149 |
| 544 | Ga0209813_10000122 | 3300027866 | Bacteria | 28118 |
| 545 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 546 | Ga0268266_10001757 | 3300028379 | Bacteria | 24717 |
| 547 | Ga0268266_10002440 | 3300028379 | Bacteria | 19956 |
| 548 | Ga0268266_10006728 | 3300028379 | Bacteria | 10483 |
| 549 | Ga0268266_10068949 | 3300028379 | Bacteria | 3063 |
| 550 | Ga0268265_10008726 | 3300028380 | Bacteria | 6854 |
| 551 | Ga0268265_10056551 | 3300028380 | Bacteria | 2985 |
| 552 | Ga0268265_10179982 | 3300028380 | Bacteria | 1815 |
| 553 | Ga0268264_10002233 | 3300028381 | Bacteria | 17176 |
| 554 | Ga0268264_10003251 | 3300028381 | Bacteria | 14056 |
| 555 | Ga0268264_10006977 | 3300028381 | Bacteria | 9481 |
| 556 | Ga0307517_10042939 | 3300028786 | Bacteria | 4831 |
| 557 | Ga0307408_100003140 | 3300031548 | Bacteria | 11380 |
| 558 | Ga0307408_100004067 | 3300031548 | Bacteria | 9974 |
| 559 | Ga0307408_100018685 | 3300031548 | Bacteria | 4658 |
| 560 | Ga0307408_100032161 | 3300031548 | Bacteria | 3657 |
| 561 | Ga0307408_100039634 | 3300031548 | Bacteria | 3332 |
| 562 | Ga0307408_100054972 | 3300031548 | Bacteria | 2880 |
| 563 | Ga0307405_10024034 | 3300031731 | Bacteria | 3475 |
| 564 | Ga0307405_10114775 | 3300031731 | Bacteria | 1831 |
| 565 | Ga0307413_10000139 | 3300031824 | Bacteria | 19243 |
| 566 | Ga0307413_10002683 | 3300031824 | Bacteria | 7294 |
| 567 | Ga0307413_10009251 | 3300031824 | Bacteria | 4706 |
| 568 | Ga0307413_10020505 | 3300031824 | Bacteria | 3517 |
| 569 | Ga0307413_10030085 | 3300031824 | Bacteria | 3046 |
| 570 | Ga0307413_10059049 | 3300031824 | Bacteria | 2355 |
| 571 | Ga0307413_10118389 | 3300031824 | Bacteria | 1788 |
| 572 | Ga0307410_10000619 | 3300031852 | Bacteria | 14637 |
| 573 | Ga0307410_10000651 | 3300031852 | Bacteria | 14307 |
| 574 | Ga0307410_10003266 | 3300031852 | Bacteria | 8093 |
| 575 | Ga0307410_10009790 | 3300031852 | Bacteria | 5395 |
| 576 | Ga0307410_10012640 | 3300031852 | Bacteria | 4891 |
| 577 | Ga0307410_10019193 | 3300031852 | Bacteria | 4153 |
| 578 | Ga0307410_10034526 | 3300031852 | Bacteria | 3276 |
| 579 | Ga0307410_10068799 | 3300031852 | Bacteria | 2446 |
| 580 | Ga0307410_10069875 | 3300031852 | Bacteria | 2430 |
| 581 | Ga0307410_10072899 | 3300031852 | Bacteria | 2386 |
| 582 | Ga0307410_10087122 | 3300031852 | Bacteria | 2208 |
| 583 | Ga0307406_10012877 | 3300031901 | Bacteria | 4777 |
| 584 | Ga0307406_10035147 | 3300031901 | Bacteria | 3079 |
| 585 | Ga0307406_10058971 | 3300031901 | Bacteria | 2468 |
| 586 | Ga0307406_10120451 | 3300031901 | Bacteria | 1823 |
| 587 | Ga0307407_10005544 | 3300031903 | Bacteria | 5490 |
| 588 | Ga0307407_10006410 | 3300031903 | Bacteria | 5225 |
| 589 | Ga0307407_10007250 | 3300031903 | Bacteria | 5010 |
| 590 | Ga0307407_10108338 | 3300031903 | Bacteria | 1739 |
| 591 | Ga0307412_10001209 | 3300031911 | Bacteria | 14667 |
| 592 | Ga0307412_10001748 | 3300031911 | Bacteria | 12005 |
| 593 | Ga0307412_10005139 | 3300031911 | Bacteria | 7328 |
| 594 | Ga0307412_10033365 | 3300031911 | Bacteria | 3271 |
| 595 | Ga0307412_10101613 | 3300031911 | Bacteria | 2035 |
| 596 | Ga0307409_100003140 | 3300031995 | Bacteria | 8876 |
| 597 | Ga0307409_100004723 | 3300031995 | Bacteria | 7713 |
| 598 | Ga0307409_100013078 | 3300031995 | Bacteria | 5322 |
| 599 | Ga0307409_100017882 | 3300031995 | Bacteria | 4742 |
| 600 | Ga0307409_100035225 | 3300031995 | Bacteria | 3665 |
| 601 | Ga0307409_100087147 | 3300031995 | Bacteria | 2543 |
| 602 | Ga0307416_100024325 | 3300032002 | Bacteria | 4418 |
| 603 | Ga0307416_100033774 | 3300032002 | Bacteria | 3883 |
| 604 | Ga0307416_100048350 | 3300032002 | Bacteria | 3374 |
| 605 | Ga0307416_100103978 | 3300032002 | Bacteria | 2481 |
| 606 | Ga0307416_100145905 | 3300032002 | Bacteria | 2160 |
| 607 | Ga0307414_10004677 | 3300032004 | Bacteria | 7462 |
| 608 | Ga0307414_10022460 | 3300032004 | Bacteria | 3979 |
| 609 | Ga0307414_10080880 | 3300032004 | Bacteria | 2377 |
| 610 | Ga0307414_10086395 | 3300032004 | Bacteria | 2314 |
| 611 | Ga0307414_10117535 | 3300032004 | Bacteria | 2037 |
| 612 | Ga0307411_10000463 | 3300032005 | Bacteria | 14041 |
| 613 | Ga0307411_10001218 | 3300032005 | Bacteria | 10212 |
| 614 | Ga0307411_10007038 | 3300032005 | Bacteria | 5688 |
| 615 | Ga0307411_10015109 | 3300032005 | Bacteria | 4323 |
| 616 | Ga0307411_10019087 | 3300032005 | Bacteria | 3950 |
| 617 | Ga0307411_10021157 | 3300032005 | Bacteria | 3800 |
| 618 | Ga0307411_10030333 | 3300032005 | Bacteria | 3313 |
| 619 | Ga0307411_10068395 | 3300032005 | Bacteria | 2393 |
| 620 | Ga0307411_10076033 | 3300032005 | Bacteria | 2294 |
| 621 | Ga0307415_100000243 | 3300032126 | Bacteria | 23624 |
| 622 | Ga0307415_100005402 | 3300032126 | Bacteria | 6781 |
| 623 | Ga0307415_100011470 | 3300032126 | Bacteria | 5074 |
| 624 | Ga0307415_100013777 | 3300032126 | Bacteria | 4730 |
| 625 | Ga0307415_100026221 | 3300032126 | Bacteria | 3672 |
| 626 | Ga0373923_0004243 | 3300035111 | Bacteria | 4734 |
| 627 | Ga0373953_0036630 | 3300035117 | Bacteria | 1933 |
| 628 | Ga0373943_0011615 | 3300035170 | Bacteria | 3963 |
| 629 | Ga0373961_0005268 | 3300035241 | Bacteria | 3111 |
| 630 | Ga0373931_0006860 | 3300035691 | Bacteria | 5353 |
| 631 | Ga0373931_0052663 | 3300035691 | Bacteria | 2170 |
| 632 | Ga0373937_0026424 | 3300036401 | Bacteria | 5246 |
| 633 | Ga0395899_0000387 | 3300037312 | Bacteria | 52472 |
| 634 | Ga0395899_0000419 | 3300037312 | Bacteria | 49177 |
| 635 | Ga0395899_0001750 | 3300037312 | Bacteria | 18054 |
| 636 | Ga0395899_0006476 | 3300037312 | Bacteria | 9073 |
| 637 | Ga0395899_0008340 | 3300037312 | Bacteria | 7978 |
| 638 | Ga0395899_0013085 | 3300037312 | Bacteria | 6345 |
| 639 | Ga0395899_0023263 | 3300037312 | Bacteria | 4696 |
| 640 | Ga0395899_0033818 | 3300037312 | Bacteria | 3839 |
| 641 | Ga0395899_0035634 | 3300037312 | Bacteria | 3735 |
| 642 | Ga0395899_0037193 | 3300037312 | Bacteria | 3649 |
| 643 | Ga0395899_0078520 | 3300037312 | Bacteria | 2406 |
| 644 | Ga0395899_0127337 | 3300037312 | Bacteria | 1820 |
| 645 | Ga0395900_0000130 | 3300037418 | Bacteria | 126231 |
| 646 | Ga0395900_0000572 | 3300037418 | Bacteria | 50991 |
| 647 | Ga0395900_0003659 | 3300037418 | Bacteria | 16533 |
| 648 | Ga0395900_0005352 | 3300037418 | Bacteria | 13449 |
| 649 | Ga0395900_0012536 | 3300037418 | Bacteria | 8672 |
| 650 | Ga0395900_0022296 | 3300037418 | Bacteria | 6478 |
| 651 | Ga0395900_0039940 | 3300037418 | Bacteria | 4836 |
| 652 | Ga0395900_0052994 | 3300037418 | Bacteria | 4176 |
| 653 | Ga0395900_0062610 | 3300037418 | Bacteria | 3824 |
| 654 | Ga0395900_0063941 | 3300037418 | Bacteria | 3782 |
| 655 | Ga0395900_0069065 | 3300037418 | Bacteria | 3631 |
| 656 | Ga0395900_0081908 | 3300037418 | Bacteria | 3315 |
| 657 | Ga0395900_0086409 | 3300037418 | Bacteria | 3223 |
| 658 | Ga0395900_0101234 | 3300037418 | Bacteria | 2959 |
| 659 | Ga0395900_0106565 | 3300037418 | Bacteria | 2879 |
| 660 | Ga0395900_0120555 | 3300037418 | Bacteria | 2691 |
| 661 | Ga0395900_0155414 | 3300037418 | Bacteria | 2336 |
| 662 | Ga0395900_0190501 | 3300037418 | Bacteria | 2080 |
| 663 | Ga0395900_0204971 | 3300037418 | Bacteria | 1993 |
| 664 | Ga0395900_0259911 | 3300037418 | Bacteria | 1734 |
| 665 | Ga0395900_0315448 | 3300037418 | Bacteria | 1545 |
| 666 | Ga0395898_0000274 | 3300037466 | Bacteria | 125922 |
| 667 | Ga0395898_0002801 | 3300037466 | Bacteria | 19982 |
| 668 | Ga0395898_0007664 | 3300037466 | Bacteria | 11462 |
| 669 | Ga0395898_0011442 | 3300037466 | Bacteria | 9216 |
| 670 | Ga0395898_0045955 | 3300037466 | Bacteria | 4290 |
| 671 | Ga0395898_0061837 | 3300037466 | Bacteria | 3637 |
| 672 | Ga0395898_0067016 | 3300037466 | Bacteria | 3477 |
| 673 | Ga0395898_0067930 | 3300037466 | Bacteria | 3450 |
| 674 | Ga0395898_0070029 | 3300037466 | Bacteria | 3392 |
| 675 | Ga0395898_0075486 | 3300037466 | Bacteria | 3256 |
| 676 | Ga0395898_0079117 | 3300037466 | Bacteria | 3171 |
| 677 | Ga0395905_0000165 | 3300037471 | Bacteria | 109385 |
| 678 | Ga0395905_0000287 | 3300037471 | Bacteria | 73803 |
| 679 | Ga0395905_0001408 | 3300037471 | Bacteria | 29105 |
| 680 | Ga0395905_0001429 | 3300037471 | Bacteria | 28769 |
| 681 | Ga0395905_0003581 | 3300037471 | Bacteria | 16529 |
| 682 | Ga0395905_0005698 | 3300037471 | Bacteria | 12656 |
| 683 | Ga0395905_0006659 | 3300037471 | Bacteria | 11584 |
| 684 | Ga0395905_0006715 | 3300037471 | Bacteria | 11520 |
| 685 | Ga0395905_0015997 | 3300037471 | Bacteria | 7130 |
| 686 | Ga0395905_0020773 | 3300037471 | Bacteria | 6217 |
| 687 | Ga0395905_0021508 | 3300037471 | Bacteria | 6099 |
| 688 | Ga0395905_0023872 | 3300037471 | Bacteria | 5773 |
| 689 | Ga0395905_0024929 | 3300037471 | Bacteria | 5643 |
| 690 | Ga0395905_0027305 | 3300037471 | Bacteria | 5383 |
| 691 | Ga0395905_0042894 | 3300037471 | Bacteria | 4244 |
| 692 | Ga0395905_0043776 | 3300037471 | Bacteria | 4199 |
| 693 | Ga0395905_0048914 | 3300037471 | Bacteria | 3961 |
| 694 | Ga0395905_0060357 | 3300037471 | Bacteria | 3546 |
| 695 | Ga0395905_0067605 | 3300037471 | Bacteria | 3347 |
| 696 | Ga0395905_0077351 | 3300037471 | Bacteria | 3117 |
| 697 | Ga0395905_0077877 | 3300037471 | Bacteria | 3106 |
| 698 | Ga0395905_0082270 | 3300037471 | Bacteria | 3017 |
| 699 | Ga0395905_0098434 | 3300037471 | Bacteria | 2747 |
| 700 | Ga0395905_0102064 | 3300037471 | Bacteria | 2693 |
| 701 | Ga0395905_0116785 | 3300037471 | Bacteria | 2508 |
| 702 | Ga0395905_0135281 | 3300037471 | Bacteria | 2318 |
| 703 | Ga0395905_0185166 | 3300037471 | Bacteria | 1954 |
| 704 | Ga0436364_1265496 | 3300037853 | Bacteria | 15678 |
| 705 | Ga0395901_0000030 | 3300038443 | Bacteria | 241916 |
| 706 | Ga0395901_0000243 | 3300038443 | Bacteria | 68039 |
| 707 | Ga0395901_0002288 | 3300038443 | Bacteria | 19530 |
| 708 | Ga0395901_0004432 | 3300038443 | Bacteria | 14163 |
| 709 | Ga0395901_0005970 | 3300038443 | Bacteria | 12329 |
| 710 | Ga0395901_0012772 | 3300038443 | Bacteria | 8518 |
| 711 | Ga0395901_0019952 | 3300038443 | Bacteria | 6858 |
| 712 | Ga0395901_0023876 | 3300038443 | Bacteria | 6271 |
| 713 | Ga0395901_0024647 | 3300038443 | Bacteria | 6177 |
| 714 | Ga0395901_0031909 | 3300038443 | Bacteria | 5432 |
| 715 | Ga0395901_0053302 | 3300038443 | Bacteria | 4202 |
| 716 | Ga0395901_0066737 | 3300038443 | Bacteria | 3747 |
| 717 | Ga0395901_0075085 | 3300038443 | Bacteria | 3526 |
| 718 | Ga0395901_0079078 | 3300038443 | Bacteria | 3434 |
| 719 | Ga0395901_0092319 | 3300038443 | Bacteria | 3169 |
| 720 | Ga0395901_0095193 | 3300038443 | Bacteria | 3120 |
| 721 | Ga0395901_0115813 | 3300038443 | Bacteria | 2815 |
| 722 | Ga0395901_0120109 | 3300038443 | Bacteria | 2762 |
| 723 | Ga0395901_0156287 | 3300038443 | Bacteria | 2395 |
| 724 | Ga0436365_0011005 | 3300039437 | Bacteria | 74317 |
| 725 | Ga0436365_1526301 | 3300039437 | Bacteria | 136420 |
| 726 | Ga0436362_0287059 | 3300039453 | Bacteria | 76995 |
| 727 | Ga0439458_0000668 | 3300042157 | Bacteria | 8838 |
| 728 | Ga0439458_0000796 | 3300042157 | Bacteria | 8089 |
| 729 | Ga0439464_0000946 | 3300042439 | Bacteria | 6549 |
| 730 | Ga0466969_0006087 | 3300044656 | Bacteria | 6420 |
| 731 | Ga0466969_0027746 | 3300044656 | Bacteria | 2898 |
| 732 | Ga0466972_0045216 | 3300044658 | Bacteria | 2135 |
| 733 | Ga0466966_0000709 | 3300044684 | Bacteria | 21117 |
| 734 | Ga0466966_0005040 | 3300044684 | Bacteria | 8684 |
| 735 | Ga0466966_0009822 | 3300044684 | Bacteria | 6342 |
| 736 | Ga0466966_0014240 | 3300044684 | Bacteria | 5266 |
| 737 | Ga0466966_0022956 | 3300044684 | Bacteria | 4087 |
| 738 | Ga0466961_0001728 | 3300044693 | Bacteria | 13588 |
| 739 | Ga0466963_0014177 | 3300044694 | Bacteria | 4911 |
| 740 | Ga0466963_0029887 | 3300044694 | Bacteria | 3511 |
| 741 | Ga0466963_0070474 | 3300044694 | Bacteria | 2351 |
| 742 | Ga0466971_0000339 | 3300044719 | Bacteria | 17936 |
| 743 | Ga0466968_0011086 | 3300044735 | Bacteria | 3507 |
| 744 | Ga0466970_0003618 | 3300044765 | Bacteria | 7535 |
| 745 | Ga0466970_0020876 | 3300044765 | Bacteria | 3408 |
| 746 | Ga0466970_0126176 | 3300044765 | Bacteria | 1404 |
| 747 | Ga0466957_0008392 | 3300044842 | Bacteria | 5875 |
| 748 | Ga0466959_0017818 | 3300045049 | Bacteria | 5209 |
| 749 | Ga0466958_0000054 | 3300045836 | Bacteria | 34351 |
| 750 | Ga0466958_0120131 | 3300045836 | Bacteria | 1645 |
| 751 | Ga0466967_0010874 | 3300045976 | Bacteria | 6856 |
| 752 | Ga0466967_0026271 | 3300045976 | Bacteria | 4820 |
| 753 | Ga0466967_0064773 | 3300045976 | Bacteria | 3251 |
| 754 | Ga0466967_0189952 | 3300045976 | Bacteria | 1941 |
| 755 | Ga0466967_0263509 | 3300045976 | Bacteria | 1649 |
| 756 | Ga0495638_0000336 | 3300046460 | Bacteria | 59114 |
| 757 | Ga0495585_0017532 | 3300046492 | Bacteria | 4137 |
| 758 | Ga0495583_0002396 | 3300046506 | Bacteria | 16129 |
| 759 | Ga0495583_0015943 | 3300046506 | Bacteria | 4062 |
| 760 | Ga0495606_0002746 | 3300046507 | Bacteria | 19754 |
| 761 | Ga0495643_0005356 | 3300046522 | Bacteria | 8689 |
| 762 | Ga0495643_0006655 | 3300046522 | Bacteria | 7576 |
| 763 | Ga0495648_0001627 | 3300046524 | Bacteria | 21807 |
| 764 | Ga0495663_0003377 | 3300046525 | Bacteria | 4614 |
| 765 | Ga0495598_0001515 | 3300046537 | Bacteria | 4635 |
| 766 | Ga0495598_0002001 | 3300046537 | Bacteria | 4143 |
| 767 | Ga0495621_0003177 | 3300046539 | Bacteria | 4502 |
| 768 | Ga0495621_0015273 | 3300046539 | Bacteria | 2446 |
| 769 | Ga0495622_0003984 | 3300046557 | Bacteria | 6897 |
| 770 | Ga0495633_0001647 | 3300046558 | Bacteria | 16862 |
| 771 | Ga0495633_0003068 | 3300046558 | Bacteria | 11362 |
| 772 | Ga0495668_0000024 | 3300046616 | Bacteria | 359469 |
| 773 | Ga0495668_0000325 | 3300046616 | Bacteria | 65404 |
| 774 | Ga0495625_0000112 | 3300046660 | Bacteria | 124365 |
| 775 | Ga0495625_0000727 | 3300046660 | Bacteria | 46264 |
| 776 | Ga0495625_0002224 | 3300046660 | Bacteria | 21448 |
| 777 | Ga0495659_0017344 | 3300046664 | Bacteria | 2385 |
| 778 | Ga0495623_0056334 | 3300046679 | Bacteria | 2475 |
| 779 | Ga0495669_0000221 | 3300046684 | Bacteria | 34153 |
| 780 | Ga0495669_0000293 | 3300046684 | Bacteria | 28317 |
| 781 | Ga0495669_0002650 | 3300046684 | Bacteria | 7328 |
| 782 | Ga0495669_0006355 | 3300046684 | Bacteria | 4936 |
| 783 | Ga0495669_0021682 | 3300046684 | Bacteria | 2790 |
| 784 | Ga0495670_0005527 | 3300046691 | Bacteria | 6201 |
| 785 | Ga0495670_0026043 | 3300046691 | Bacteria | 2895 |
| 786 | Ga0495600_0009475 | 3300046809 | Bacteria | 6018 |
| 787 | Ga0495683_0002822 | 3300047323 | Bacteria | 10294 |
| 788 | Ga0495687_000513 | 3300047443 | Bacteria | 46650 |
| 789 | Ga0495687_005979 | 3300047443 | Bacteria | 7585 |
| 790 | Ga0495681_0002815 | 3300047470 | Bacteria | 12305 |
| 791 | Ga0495686_0000185 | 3300047472 | Bacteria | 116495 |
| 792 | Ga0495686_0100864 | 3300047472 | Bacteria | 1741 |
| 793 | Ga0495602_0014578 | 3300048088 | Bacteria | 7974 |
| 794 | Ga0496100_0005041 | 3300048903 | Bacteria | 7066 |
| 795 | Ga0496101_0208146 | 3300048904 | Bacteria | 1514 |
| 796 | Ga0496102_0003117 | 3300048905 | Bacteria | 14065 |
| 797 | Ga0496102_0077395 | 3300048905 | Bacteria | 3061 |
| 798 | Ga0496105_0000481 | 3300048908 | Bacteria | 26219 |
| 799 | Ga0496106_0014816 | 3300048909 | Bacteria | 5766 |
| 800 | Ga0496106_0053256 | 3300048909 | Bacteria | 3056 |
| 801 | Ga0496107_0058599 | 3300048910 | Bacteria | 2785 |
| 802 | Ga0496107_0117944 | 3300048910 | Bacteria | 1954 |
| 803 | Ga0496108_0001272 | 3300048911 | Bacteria | 19736 |
| 804 | Ga0496108_0008736 | 3300048911 | Bacteria | 8214 |
| 805 | Ga0496108_0031252 | 3300048911 | Bacteria | 4416 |
| 806 | Ga0496109_0003815 | 3300048912 | Bacteria | 12585 |
| 807 | Ga0496109_0037089 | 3300048912 | Bacteria | 4403 |
| 808 | Ga0496109_0059815 | 3300048912 | Bacteria | 3481 |
| 809 | Ga0496109_0078167 | 3300048912 | Bacteria | 3046 |
| 810 | Ga0496109_0109985 | 3300048912 | Bacteria | 2562 |
| 811 | Ga0496110_0001131 | 3300048913 | Bacteria | 18835 |
| 812 | Ga0496110_0005464 | 3300048913 | Bacteria | 9968 |
| 813 | Ga0496110_0019874 | 3300048913 | Bacteria | 5661 |
| 814 | Ga0496110_0061837 | 3300048913 | Bacteria | 3306 |
| 815 | Ga0496111_0002242 | 3300048914 | Bacteria | 11611 |
| 816 | Ga0496111_0004595 | 3300048914 | Bacteria | 8738 |
| 817 | Ga0496111_0125961 | 3300048914 | Bacteria | 1893 |
| 818 | Ga0496112_0008275 | 3300048915 | Bacteria | 9307 |
| 819 | Ga0496112_0091300 | 3300048915 | Bacteria | 3014 |
| 820 | Ga0496112_0140527 | 3300048915 | Bacteria | 2384 |
| 821 | Ga0496113_0004166 | 3300048916 | Bacteria | 8831 |
| 822 | Ga0496113_0009708 | 3300048916 | Bacteria | 6323 |
| 823 | Ga0496113_0084883 | 3300048916 | Bacteria | 2431 |
| 824 | Ga0496113_0182741 | 3300048916 | Bacteria | 1662 |
| 825 | Ga0496114_0000019 | 3300048917 | Bacteria | 244365 |
| 826 | Ga0496114_0015261 | 3300048917 | Bacteria | 6176 |
| 827 | Ga0496114_0026195 | 3300048917 | Bacteria | 4773 |
| 828 | Ga0496114_0041852 | 3300048917 | Bacteria | 3796 |
| 829 | Ga0496115_0002119 | 3300048918 | Bacteria | 14187 |
| 830 | Ga0496115_0015645 | 3300048918 | Bacteria | 5759 |
| 831 | Ga0496115_0026170 | 3300048918 | Bacteria | 4550 |
| 832 | Ga0496117_0004108 | 3300048920 | Bacteria | 16312 |
| 833 | Ga0496118_0000989 | 3300048921 | Bacteria | 44266 |
| 834 | Ga0496121_0000367 | 3300048924 | Bacteria | 92745 |
| 835 | Ga0496121_0006798 | 3300048924 | Bacteria | 14014 |
| 836 | Ga0496124_0000050 | 3300048927 | Bacteria | 258041 |
| 837 | Ga0496125_0002189 | 3300048928 | Bacteria | 26097 |
| 838 | Ga0496126_0005697 | 3300048929 | Bacteria | 14113 |
| 839 | Ga0501031_0077556 | 3300049568 | Bacteria | 2164 |
| 840 | Ga0501033_0013635 | 3300049570 | Bacteria | 6185 |
| 841 | Ga0501034_0007685 | 3300049571 | Bacteria | 11471 |
| 842 | Ga0501036_0047084 | 3300049572 | Bacteria | 3652 |
| 843 | Ga0501043_0023159 | 3300049579 | Bacteria | 4872 |
| 844 | Ga0501074_0039006 | 3300049590 | Bacteria | 3440 |
| 845 | Ga0501080_0012158 | 3300049742 | Bacteria | 7889 |
| 846 | Ga0501035_0021879 | 3300049822 | Bacteria | 5874 |
| 847 | Ga0501044_0023393 | 3300049823 | Bacteria | 6571 |
| 848 | nmdc:mga03683_130_c1 | 3300050489 | Bacteria | 24999 |
| 849 | nmdc:mga03683_8_c1 | 3300050489 | Bacteria | 138266 |
| 850 | nmdc:mga03n38_704_c1 | 3300050490 | Bacteria | 8762 |
| 851 | nmdc:mga0k408_101712_c1 | 3300050493 | Bacteria | 1695 |
| 852 | nmdc:mga0k408_212_c1 | 3300050493 | Bacteria | 31209 |
| 853 | nmdc:mga06z11_8620_c1 | 3300050494 | Bacteria | 4264 |
| 854 | nmdc:mga04h51_548_c1 | 3300050495 | Bacteria | 8962 |
| 855 | nmdc:mga07m45_1249_c1 | 3300050496 | Bacteria | 11550 |
| 856 | nmdc:mga0a205_1890_c1 | 3300050515 | Bacteria | 18175 |
| 857 | nmdc:mga0sz30_2721_c1 | 3300050516 | Bacteria | 6307 |
| 858 | nmdc:mga0sz30_6989_c1 | 3300050516 | Bacteria | 4218 |
| 859 | Ga0500610_0000595 | 3300053079 | Bacteria | 11091 |
| 860 | Ga0500643_000702 | 3300053087 | Bacteria | 22236 |
| 861 | Ga0500595_000166 | 3300053119 | Bacteria | 43537 |
| 862 | Ga0500607_002050 | 3300053121 | Bacteria | 16931 |
| 863 | Ga0500658_0001416 | 3300053134 | Bacteria | 9661 |
| 864 | Ga0500559_0002752 | 3300053136 | Bacteria | 8923 |
| 865 | Ga0500559_0004233 | 3300053136 | Bacteria | 6866 |
| 866 | Ga0500627_0000068 | 3300053158 | Bacteria | 44198 |
| 867 | Ga0500645_000138 | 3300053730 | Bacteria | 57099 |
| 868 | Ga0500645_004660 | 3300053730 | Bacteria | 5219 |
| 869 | Ga0466962_0004642 | 3300061719 | Bacteria | 6599 |
| 870 | Ga0466962_0008135 | 3300061719 | Bacteria | 5028 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037312 | Ga0395899_0127337 | Ga0395899_0127337_457_1782 | 441 |
| 2 | 3300037471 | Ga0395905_0102064 | Ga0395905_0102064_36_1361 | 441 |
| 3 | 3300044765 | Ga0466970_0126176 | Ga0466970_0126176_52_1377 | 441 |
| 4 | 3300009177 | Ga0105248_10004323 | Ga0105248_1000432317 | 448 |
| 5 | 3300035241 | Ga0373961_0005268 | Ga0373961_0005268_557_1975 | 472 |
| 6 | 3300005347 | Ga0070668_100000417 | Ga0070668_1000004174 | 473 |
| 7 | 3300005353 | Ga0070669_100021625 | Ga0070669_1000216252 | 473 |
| 8 | 3300005364 | Ga0070673_100048393 | Ga0070673_1000483932 | 473 |
| 9 | 3300005367 | Ga0070667_100075673 | Ga0070667_1000756732 | 473 |
| 10 | 3300025923 | Ga0207681_10010338 | Ga0207681_100103382 | 473 |
| 11 | 3300025960 | Ga0207651_10032768 | Ga0207651_100327682 | 473 |
| 12 | 3300025972 | Ga0207668_10000193 | Ga0207668_1000019318 | 473 |
| 13 | 3300026089 | Ga0207648_10038444 | Ga0207648_100384443 | 473 |
| 14 | 3300026121 | Ga0207683_10039360 | Ga0207683_100393603 | 473 |
| 15 | 3300031824 | Ga0307413_10002683 | Ga0307413_100026832 | 473 |
| 16 | 3300031824 | Ga0307413_10030085 | Ga0307413_100300852 | 473 |
| 17 | 3300031852 | Ga0307410_10072899 | Ga0307410_100728992 | 473 |
| 18 | 3300032004 | Ga0307414_10086395 | Ga0307414_100863952 | 473 |
| 19 | 3300032005 | Ga0307411_10007038 | Ga0307411_100070384 | 473 |
| 20 | 3300032005 | Ga0307411_10030333 | Ga0307411_100303332 | 473 |
| 21 | 3300003759 | Ga0055525_1000104 | Ga0055525_100010478 | 475 |
| 22 | 3300025230 | Ga0209563_100116 | Ga0209563_10011660 | 475 |
| 23 | 3300025931 | Ga0207644_10019091 | Ga0207644_100190911 | 477 |
| 24 | 3300025941 | Ga0207711_10059984 | Ga0207711_100599842 | 477 |
| 25 | 3300026095 | Ga0207676_10119298 | Ga0207676_101192982 | 477 |
| 26 | 3300048916 | Ga0496113_0009708 | Ga0496113_0009708_2067_3545 | 477 |
| 27 | 3300005347 | Ga0070668_100112446 | Ga0070668_1001124461 | 478 |
| 28 | 3300025937 | Ga0207669_10003287 | Ga0207669_100032873 | 478 |
| 29 | 3300025972 | Ga0207668_10204693 | Ga0207668_102046931 | 478 |
| 30 | 3300046616 | Ga0495668_0000325 | Ga0495668_0000325_15424_16911 | 478 |
| 31 | iso_pu_bacteria | 8057101203 | 8057103107 | 479 |
| 32 | 3300037312 | Ga0395899_0013085 | Ga0395899_0013085_2411_3859 | 481 |
| 33 | 3300037471 | Ga0395905_0077351 | Ga0395905_0077351_1059_2507 | 481 |
| 34 | 3300044735 | Ga0466968_0011086 | Ga0466968_0011086_1725_3182 | 481 |
| 35 | 3300045976 | Ga0466967_0263509 | Ga0466967_0263509_51_1502 | 482 |
| 36 | iso_pu_bacteria | 2643221560 | 2643822464 | 482 |
| 37 | iso_pu_bacteria | 2643221563 | 2643833518 | 482 |
| 38 | iso_pu_bacteria | 2643221608 | 2644054445 | 482 |
| 39 | iso_pu_bacteria | 2852653556 | 2852656775 | 482 |
| 40 | iso_pu_bacteria | 2852680915 | 2852682023 | 482 |
| 41 | 3300005719 | Ga0068861_100107843 | Ga0068861_1001078432 | 483 |
| 42 | 3300006881 | Ga0068865_100083442 | Ga0068865_1000834422 | 483 |
| 43 | 3300013100 | Ga0157373_10017322 | Ga0157373_100173222 | 483 |
| 44 | 3300025938 | Ga0207704_10124861 | Ga0207704_101248611 | 483 |
| 45 | 3300025940 | Ga0207691_10052924 | Ga0207691_100529242 | 483 |
| 46 | 3300026118 | Ga0207675_100012623 | Ga0207675_1000126239 | 483 |
| 47 | iso_pu_bacteria | 2739367664 | 2739648774 | 483 |
| 48 | iso_pu_bacteria | 2739367865 | 2740027247 | 483 |
| 49 | iso_pu_bacteria | 2885427238 | 2885428263 | 483 |
| 50 | iso_pu_bacteria | 2885429604 | 2885429645 | 483 |
| 51 | iso_pu_bacteria | 2896429255 | 2896430168 | 483 |
| 52 | iso_pu_bacteria | 2946787523 | 2946789064 | 483 |
| 53 | iso_pu_bacteria | 2990265787 | 2990266635 | 483 |
| 54 | iso_pu_bacteria | 2993693658 | 2993695566 | 483 |
| 55 | 3300001990 | JGI24737J22298_10008534 | JGI24737J22298_100085342 | 484 |
| 56 | 3300002067 | JGI24735J21928_10013571 | JGI24735J21928_100135712 | 484 |
| 57 | 3300002075 | JGI24738J21930_10001196 | JGI24738J21930_100011965 | 484 |
| 58 | 3300003214 | JGI25165J46597_1000012 | JGI25165J46597_1000012328 | 484 |
| 59 | 3300005327 | Ga0070658_10000001 | Ga0070658_10000001549 | 484 |
| 60 | 3300005327 | Ga0070658_10000453 | Ga0070658_1000045331 | 484 |
| 61 | 3300005327 | Ga0070658_10046392 | Ga0070658_100463923 | 484 |
| 62 | 3300005329 | Ga0070683_100015500 | Ga0070683_1000155008 | 484 |
| 63 | 3300005335 | Ga0070666_10006651 | Ga0070666_100066514 | 484 |
| 64 | 3300005336 | Ga0070680_100006192 | Ga0070680_1000061921 | 484 |
| 65 | 3300005336 | Ga0070680_100135257 | Ga0070680_1001352572 | 484 |
| 66 | 3300005337 | Ga0070682_100009672 | Ga0070682_1000096725 | 484 |
| 67 | 3300005339 | Ga0070660_100000488 | Ga0070660_1000004886 | 484 |
| 68 | 3300005339 | Ga0070660_100002721 | Ga0070660_10000272110 | 484 |
| 69 | 3300005339 | Ga0070660_100002844 | Ga0070660_10000284410 | 484 |
| 70 | 3300005344 | Ga0070661_100000010 | Ga0070661_10000001093 | 484 |
| 71 | 3300005344 | Ga0070661_100000311 | Ga0070661_1000003116 | 484 |
| 72 | 3300005344 | Ga0070661_100125974 | Ga0070661_1001259741 | 484 |
| 73 | 3300005345 | Ga0070692_10007634 | Ga0070692_100076343 | 484 |
| 74 | 3300005366 | Ga0070659_100000594 | Ga0070659_10000059425 | 484 |
| 75 | 3300005367 | Ga0070667_100022365 | Ga0070667_1000223655 | 484 |
| 76 | 3300005435 | Ga0070714_100170522 | Ga0070714_1001705221 | 484 |
| 77 | 3300005457 | Ga0070662_100000198 | Ga0070662_1000001986 | 484 |
| 78 | 3300005458 | Ga0070681_10063695 | Ga0070681_100636953 | 484 |
| 79 | 3300005530 | Ga0070679_100000005 | Ga0070679_10000000545 | 484 |
| 80 | 3300005539 | Ga0068853_100000630 | Ga0068853_1000006304 | 484 |
| 81 | 3300005547 | Ga0070693_100003956 | Ga0070693_1000039563 | 484 |
| 82 | 3300005548 | Ga0070665_100002788 | Ga0070665_10000278811 | 484 |
| 83 | 3300005563 | Ga0068855_100030382 | Ga0068855_1000303827 | 484 |
| 84 | 3300005563 | Ga0068855_100142452 | Ga0068855_1001424522 | 484 |
| 85 | 3300005564 | Ga0070664_100000259 | Ga0070664_1000002597 | 484 |
| 86 | 3300005577 | Ga0068857_100014903 | Ga0068857_1000149033 | 484 |
| 87 | 3300005614 | Ga0068856_100000315 | Ga0068856_10000031532 | 484 |
| 88 | 3300005616 | Ga0068852_100000548 | Ga0068852_10000054823 | 484 |
| 89 | 3300005616 | Ga0068852_100002347 | Ga0068852_10000234715 | 484 |
| 90 | 3300005617 | Ga0068859_100010651 | Ga0068859_1000106513 | 484 |
| 91 | 3300005618 | Ga0068864_100002676 | Ga0068864_1000026769 | 484 |
| 92 | 3300005719 | Ga0068861_100000342 | Ga0068861_10000034212 | 484 |
| 93 | 3300005842 | Ga0068858_100000292 | Ga0068858_10000029213 | 484 |
| 94 | 3300005842 | Ga0068858_100004640 | Ga0068858_1000046406 | 484 |
| 95 | 3300005844 | Ga0068862_100010452 | Ga0068862_1000104525 | 484 |
| 96 | 3300006881 | Ga0068865_100038232 | Ga0068865_1000382322 | 484 |
| 97 | 3300006931 | Ga0097620_100010651 | Ga0097620_1000106513 | 484 |
| 98 | 3300009177 | Ga0105248_10000395 | Ga0105248_1000039531 | 484 |
| 99 | 3300009177 | Ga0105248_10000774 | Ga0105248_1000077420 | 484 |
| 100 | 3300009545 | Ga0105237_10073188 | Ga0105237_100731882 | 484 |
| 101 | 3300009551 | Ga0105238_10001671 | Ga0105238_100016713 | 484 |
| 102 | 3300009551 | Ga0105238_10016618 | Ga0105238_100166183 | 484 |
| 103 | 3300013104 | Ga0157370_10048117 | Ga0157370_100481173 | 484 |
| 104 | 3300013105 | Ga0157369_10003132 | Ga0157369_1000313219 | 484 |
| 105 | 3300013306 | Ga0163162_10037036 | Ga0163162_100370366 | 484 |
| 106 | 3300014325 | Ga0163163_10002393 | Ga0163163_100023939 | 484 |
| 107 | 3300014968 | Ga0157379_10044281 | Ga0157379_100442813 | 484 |
| 108 | 3300015690 | Ga0183363_1004 | Ga0183363_100428 | 484 |
| 109 | 3300017792 | Ga0163161_10003370 | Ga0163161_1000337012 | 484 |
| 110 | 3300021358 | Ga0213873_10000015 | Ga0213873_10000015109 | 484 |
| 111 | 3300021384 | Ga0213876_10000005 | Ga0213876_10000005627 | 484 |
| 112 | 3300021384 | Ga0213876_10000263 | Ga0213876_1000026351 | 484 |
| 113 | 3300025261 | Ga0209233_1000058 | Ga0209233_100005890 | 484 |
| 114 | 3300025321 | Ga0207656_10011235 | Ga0207656_100112353 | 484 |
| 115 | 3300025903 | Ga0207680_10001423 | Ga0207680_100014234 | 484 |
| 116 | 3300025904 | Ga0207647_10017322 | Ga0207647_100173223 | 484 |
| 117 | 3300025909 | Ga0207705_10000002 | Ga0207705_100000021332 | 484 |
| 118 | 3300025909 | Ga0207705_10000449 | Ga0207705_100004497 | 484 |
| 119 | 3300025909 | Ga0207705_10037372 | Ga0207705_100373722 | 484 |
| 120 | 3300025912 | Ga0207707_10080778 | Ga0207707_100807783 | 484 |
| 121 | 3300025913 | Ga0207695_10014084 | Ga0207695_100140842 | 484 |
| 122 | 3300025914 | Ga0207671_10065049 | Ga0207671_100650492 | 484 |
| 123 | 3300025917 | Ga0207660_10004430 | Ga0207660_100044309 | 484 |
| 124 | 3300025919 | Ga0207657_10001304 | Ga0207657_1000130425 | 484 |
| 125 | 3300025919 | Ga0207657_10002320 | Ga0207657_1000232015 | 484 |
| 126 | 3300025919 | Ga0207657_10003700 | Ga0207657_1000370017 | 484 |
| 127 | 3300025920 | Ga0207649_10000165 | Ga0207649_1000016526 | 484 |
| 128 | 3300025920 | Ga0207649_10003505 | Ga0207649_100035056 | 484 |
| 129 | 3300025921 | Ga0207652_10000036 | Ga0207652_1000003644 | 484 |
| 130 | 3300025924 | Ga0207694_10001620 | Ga0207694_100016208 | 484 |
| 131 | 3300025924 | Ga0207694_10016301 | Ga0207694_100163012 | 484 |
| 132 | 3300025927 | Ga0207687_10000564 | Ga0207687_1000056418 | 484 |
| 133 | 3300025931 | Ga0207644_10011303 | Ga0207644_100113034 | 484 |
| 134 | 3300025932 | Ga0207690_10000257 | Ga0207690_1000025716 | 484 |
| 135 | 3300025933 | Ga0207706_10001176 | Ga0207706_100011766 | 484 |
| 136 | 3300025938 | Ga0207704_10028858 | Ga0207704_100288582 | 484 |
| 137 | 3300025941 | Ga0207711_10000427 | Ga0207711_1000042732 | 484 |
| 138 | 3300025941 | Ga0207711_10001486 | Ga0207711_1000148613 | 484 |
| 139 | 3300025944 | Ga0207661_10001889 | Ga0207661_100018898 | 484 |
| 140 | 3300025945 | Ga0207679_10000463 | Ga0207679_1000046319 | 484 |
| 141 | 3300025949 | Ga0207667_10011124 | Ga0207667_100111248 | 484 |
| 142 | 3300025949 | Ga0207667_10011437 | Ga0207667_1001143711 | 484 |
| 143 | 3300025949 | Ga0207667_10032459 | Ga0207667_100324592 | 484 |
| 144 | 3300025986 | Ga0207658_10043745 | Ga0207658_100437452 | 484 |
| 145 | 3300026035 | Ga0207703_10000314 | Ga0207703_1000031432 | 484 |
| 146 | 3300026035 | Ga0207703_10004554 | Ga0207703_1000455410 | 484 |
| 147 | 3300026035 | Ga0207703_10006290 | Ga0207703_100062908 | 484 |
| 148 | 3300026041 | Ga0207639_10000725 | Ga0207639_1000072516 | 484 |
| 149 | 3300026067 | Ga0207678_10028351 | Ga0207678_100283514 | 484 |
| 150 | 3300026078 | Ga0207702_10002349 | Ga0207702_1000234910 | 484 |
| 151 | 3300026078 | Ga0207702_10036416 | Ga0207702_100364163 | 484 |
| 152 | 3300026095 | Ga0207676_10000266 | Ga0207676_1000026612 | 484 |
| 153 | 3300026116 | Ga0207674_10001348 | Ga0207674_1000134812 | 484 |
| 154 | 3300026116 | Ga0207674_10015096 | Ga0207674_100150966 | 484 |
| 155 | 3300026118 | Ga0207675_100000078 | Ga0207675_10000007812 | 484 |
| 156 | 3300026142 | Ga0207698_10000435 | Ga0207698_100004353 | 484 |
| 157 | 3300026142 | Ga0207698_10001522 | Ga0207698_100015224 | 484 |
| 158 | 3300026142 | Ga0207698_10002732 | Ga0207698_100027322 | 484 |
| 159 | 3300026142 | Ga0207698_10003563 | Ga0207698_100035638 | 484 |
| 160 | 3300027111 | Ga0209281_1010293 | Ga0209281_10102932 | 484 |
| 161 | 3300028379 | Ga0268266_10006728 | Ga0268266_100067287 | 484 |
| 162 | 3300028380 | Ga0268265_10008726 | Ga0268265_100087263 | 484 |
| 163 | 3300031911 | Ga0307412_10101613 | Ga0307412_101016132 | 484 |
| 164 | 3300032002 | Ga0307416_100145905 | Ga0307416_1001459052 | 484 |
| 165 | 3300035691 | Ga0373931_0052663 | Ga0373931_0052663_95_1561 | 484 |
| 166 | 3300037312 | Ga0395899_0006476 | Ga0395899_0006476_3342_4811 | 484 |
| 167 | 3300037312 | Ga0395899_0035634 | Ga0395899_0035634_2086_3555 | 484 |
| 168 | 3300037418 | Ga0395900_0005352 | Ga0395900_0005352_7437_8906 | 484 |
| 169 | 3300037418 | Ga0395900_0052994 | Ga0395900_0052994_198_1664 | 484 |
| 170 | 3300037418 | Ga0395900_0081908 | Ga0395900_0081908_1118_2584 | 484 |
| 171 | 3300037418 | Ga0395900_0101234 | Ga0395900_0101234_924_2390 | 484 |
| 172 | 3300037418 | Ga0395900_0155414 | Ga0395900_0155414_370_1836 | 484 |
| 173 | 3300037418 | Ga0395900_0259911 | Ga0395900_0259911_65_1534 | 484 |
| 174 | 3300037466 | Ga0395898_0002801 | Ga0395898_0002801_7802_9271 | 484 |
| 175 | 3300037466 | Ga0395898_0067016 | Ga0395898_0067016_1998_3467 | 484 |
| 176 | 3300037471 | Ga0395905_0027305 | Ga0395905_0027305_2823_4289 | 484 |
| 177 | 3300037471 | Ga0395905_0043776 | Ga0395905_0043776_1163_2632 | 484 |
| 178 | 3300037471 | Ga0395905_0135281 | Ga0395905_0135281_735_2201 | 484 |
| 179 | 3300038443 | Ga0395901_0000243 | Ga0395901_0000243_56698_58167 | 484 |
| 180 | 3300038443 | Ga0395901_0002288 | Ga0395901_0002288_10094_11563 | 484 |
| 181 | 3300038443 | Ga0395901_0031909 | Ga0395901_0031909_3306_4775 | 484 |
| 182 | 3300038443 | Ga0395901_0095193 | Ga0395901_0095193_521_1993 | 484 |
| 183 | 3300039437 | Ga0436365_0011005 | Ga0436365_0011005_48168_49643 | 484 |
| 184 | 3300039437 | Ga0436365_1526301 | Ga0436365_1526301_39788_41266 | 484 |
| 185 | 3300039453 | Ga0436362_0287059 | Ga0436362_0287059_48168_49643 | 484 |
| 186 | 3300044684 | Ga0466966_0022956 | Ga0466966_0022956_441_1910 | 484 |
| 187 | 3300044694 | Ga0466963_0014177 | Ga0466963_0014177_2348_3817 | 484 |
| 188 | 3300045836 | Ga0466958_0120131 | Ga0466958_0120131_49_1521 | 484 |
| 189 | 3300045976 | Ga0466967_0064773 | Ga0466967_0064773_596_2065 | 484 |
| 190 | 3300046660 | Ga0495625_0000112 | Ga0495625_0000112_115735_117216 | 484 |
| 191 | 3300047472 | Ga0495686_0100864 | Ga0495686_0100864_66_1538 | 484 |
| 192 | 3300048924 | Ga0496121_0000367 | Ga0496121_0000367_41239_42711 | 484 |
| 193 | 3300049590 | Ga0501074_0039006 | Ga0501074_0039006_1460_2926 | 484 |
| 194 | 3300049742 | Ga0501080_0012158 | Ga0501080_0012158_2589_4055 | 484 |
| 195 | 3300053087 | Ga0500643_000702 | Ga0500643_000702_12299_13774 | 484 |
| 196 | iso_pu_bacteria | 2599185354 | 2600200579 | 484 |
| 197 | iso_pu_bacteria | 2751185897 | 2753763640 | 484 |
| 198 | iso_pu_bacteria | 2830075706 | 2830076582 | 484 |
| 199 | 3300005366 | Ga0070659_100032584 | Ga0070659_1000325844 | 485 |
| 200 | 3300013308 | Ga0157375_10090319 | Ga0157375_100903192 | 485 |
| 201 | 3300048917 | Ga0496114_0026195 | Ga0496114_0026195_821_2290 | 485 |
| 202 | 3300001989 | JGI24739J22299_10007482 | JGI24739J22299_100074822 | 486 |
| 203 | 3300003762 | Ga0055542_1000025 | Ga0055542_1000025244 | 486 |
| 204 | 3300003763 | Ga0055529_1000014 | Ga0055529_10000149 | 486 |
| 205 | 3300003781 | Ga0055536_1001462 | Ga0055536_10014627 | 486 |
| 206 | 3300003781 | Ga0055536_1005390 | Ga0055536_10053904 | 486 |
| 207 | 3300003794 | Ga0055531_10001396 | Ga0055531_1000139613 | 486 |
| 208 | 3300005293 | Ga0065715_10140700 | Ga0065715_101407001 | 486 |
| 209 | 3300005327 | Ga0070658_10000608 | Ga0070658_1000060819 | 486 |
| 210 | 3300005331 | Ga0070670_100000926 | Ga0070670_1000009264 | 486 |
| 211 | 3300005344 | Ga0070661_100001265 | Ga0070661_1000012656 | 486 |
| 212 | 3300005356 | Ga0070674_100003585 | Ga0070674_1000035854 | 486 |
| 213 | 3300005457 | Ga0070662_100006163 | Ga0070662_1000061638 | 486 |
| 214 | 3300005543 | Ga0070672_100001700 | Ga0070672_10000170012 | 486 |
| 215 | 3300005548 | Ga0070665_100000186 | Ga0070665_10000018699 | 486 |
| 216 | 3300005563 | Ga0068855_100070013 | Ga0068855_1000700132 | 486 |
| 217 | 3300005617 | Ga0068859_100013157 | Ga0068859_1000131575 | 486 |
| 218 | 3300005834 | Ga0068851_10027670 | Ga0068851_100276702 | 486 |
| 219 | 3300006847 | Ga0075431_100006263 | Ga0075431_1000062634 | 486 |
| 220 | 3300006931 | Ga0097620_100013157 | Ga0097620_1000131575 | 486 |
| 221 | 3300009094 | Ga0111539_10102475 | Ga0111539_101024752 | 486 |
| 222 | 3300009148 | Ga0105243_10000917 | Ga0105243_1000091720 | 486 |
| 223 | 3300009174 | Ga0105241_10004599 | Ga0105241_100045996 | 486 |
| 224 | 3300013100 | Ga0157373_10016724 | Ga0157373_100167246 | 486 |
| 225 | 3300013102 | Ga0157371_10000183 | Ga0157371_100001835 | 486 |
| 226 | 3300014326 | Ga0157380_10106562 | Ga0157380_101065622 | 486 |
| 227 | 3300025254 | Ga0209148_1000011 | Ga0209148_100001111 | 486 |
| 228 | 3300025272 | Ga0209455_1000006 | Ga0209455_10000061183 | 486 |
| 229 | 3300025291 | Ga0209675_1000126 | Ga0209675_100012627 | 486 |
| 230 | 3300025292 | Ga0209676_1000060 | Ga0209676_1000060298 | 486 |
| 231 | 3300025292 | Ga0209676_1000148 | Ga0209676_1000148137 | 486 |
| 232 | 3300025297 | Ga0209758_1000001 | Ga0209758_1000001859 | 486 |
| 233 | 3300025298 | Ga0209050_1000047 | Ga0209050_100004750 | 486 |
| 234 | 3300025298 | Ga0209050_1003236 | Ga0209050_10032367 | 486 |
| 235 | 3300025304 | Ga0209257_1000076 | Ga0209257_10000766 | 486 |
| 236 | 3300025315 | Ga0207697_10040015 | Ga0207697_100400152 | 486 |
| 237 | 3300025321 | Ga0207656_10001128 | Ga0207656_100011285 | 486 |
| 238 | 3300025893 | Ga0207682_10005730 | Ga0207682_100057302 | 486 |
| 239 | 3300025904 | Ga0207647_10025267 | Ga0207647_100252674 | 486 |
| 240 | 3300025911 | Ga0207654_10000986 | Ga0207654_100009867 | 486 |
| 241 | 3300025914 | Ga0207671_10010288 | Ga0207671_100102882 | 486 |
| 242 | 3300025919 | Ga0207657_10064793 | Ga0207657_100647933 | 486 |
| 243 | 3300025920 | Ga0207649_10000225 | Ga0207649_1000022515 | 486 |
| 244 | 3300025923 | Ga0207681_10000713 | Ga0207681_100007132 | 486 |
| 245 | 3300025933 | Ga0207706_10004436 | Ga0207706_1000443611 | 486 |
| 246 | 3300025933 | Ga0207706_10041704 | Ga0207706_100417044 | 486 |
| 247 | 3300025935 | Ga0207709_10000018 | Ga0207709_1000001864 | 486 |
| 248 | 3300025937 | Ga0207669_10000068 | Ga0207669_1000006816 | 486 |
| 249 | 3300025940 | Ga0207691_10000696 | Ga0207691_1000069633 | 486 |
| 250 | 3300025949 | Ga0207667_10000107 | Ga0207667_1000010796 | 486 |
| 251 | 3300025972 | Ga0207668_10006265 | Ga0207668_100062655 | 486 |
| 252 | 3300025981 | Ga0207640_10007283 | Ga0207640_100072835 | 486 |
| 253 | 3300026041 | Ga0207639_10006890 | Ga0207639_100068907 | 486 |
| 254 | 3300026067 | Ga0207678_10018453 | Ga0207678_100184533 | 486 |
| 255 | 3300026078 | Ga0207702_10024826 | Ga0207702_100248262 | 486 |
| 256 | 3300026089 | Ga0207648_10008226 | Ga0207648_100082268 | 486 |
| 257 | 3300026121 | Ga0207683_10007048 | Ga0207683_100070487 | 486 |
| 258 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021856 | 486 |
| 259 | 3300028786 | Ga0307517_10042939 | Ga0307517_100429393 | 486 |
| 260 | 3300031824 | Ga0307413_10000139 | Ga0307413_1000013915 | 486 |
| 261 | 3300031824 | Ga0307413_10059049 | Ga0307413_100590492 | 486 |
| 262 | 3300031852 | Ga0307410_10000651 | Ga0307410_100006512 | 486 |
| 263 | 3300031911 | Ga0307412_10001209 | Ga0307412_1000120912 | 486 |
| 264 | 3300031995 | Ga0307409_100017882 | Ga0307409_1000178823 | 486 |
| 265 | 3300032004 | Ga0307414_10004677 | Ga0307414_100046772 | 486 |
| 266 | 3300032005 | Ga0307411_10000463 | Ga0307411_100004637 | 486 |
| 267 | 3300035170 | Ga0373943_0011615 | Ga0373943_0011615_1489_2997 | 486 |
| 268 | 3300037471 | Ga0395905_0116785 | Ga0395905_0116785_860_2335 | 486 |
| 269 | 3300046460 | Ga0495638_0000336 | Ga0495638_0000336_33703_35199 | 486 |
| 270 | 3300046492 | Ga0495585_0017532 | Ga0495585_0017532_1580_3067 | 486 |
| 271 | 3300046506 | Ga0495583_0002396 | Ga0495583_0002396_8031_9518 | 486 |
| 272 | 3300046506 | Ga0495583_0015943 | Ga0495583_0015943_880_2367 | 486 |
| 273 | 3300046507 | Ga0495606_0002746 | Ga0495606_0002746_13349_14836 | 486 |
| 274 | 3300046522 | Ga0495643_0005356 | Ga0495643_0005356_6101_7588 | 486 |
| 275 | 3300046522 | Ga0495643_0006655 | Ga0495643_0006655_2234_3721 | 486 |
| 276 | 3300046524 | Ga0495648_0001627 | Ga0495648_0001627_8957_10444 | 486 |
| 277 | 3300046525 | Ga0495663_0003377 | Ga0495663_0003377_88_1554 | 486 |
| 278 | 3300046557 | Ga0495622_0003984 | Ga0495622_0003984_4310_5797 | 486 |
| 279 | 3300046558 | Ga0495633_0003068 | Ga0495633_0003068_1977_3464 | 486 |
| 280 | 3300046616 | Ga0495668_0000024 | Ga0495668_0000024_99659_101131 | 486 |
| 281 | 3300046660 | Ga0495625_0000727 | Ga0495625_0000727_39592_41058 | 486 |
| 282 | 3300046660 | Ga0495625_0002224 | Ga0495625_0002224_13312_14799 | 486 |
| 283 | 3300046664 | Ga0495659_0017344 | Ga0495659_0017344_398_1873 | 486 |
| 284 | 3300046684 | Ga0495669_0000221 | Ga0495669_0000221_4700_6187 | 486 |
| 285 | 3300046809 | Ga0495600_0009475 | Ga0495600_0009475_89_1576 | 486 |
| 286 | 3300047323 | Ga0495683_0002822 | Ga0495683_0002822_6033_7520 | 486 |
| 287 | 3300047443 | Ga0495687_000513 | Ga0495687_000513_9128_10615 | 486 |
| 288 | 3300047443 | Ga0495687_005979 | Ga0495687_005979_2156_3643 | 486 |
| 289 | 3300047470 | Ga0495681_0002815 | Ga0495681_0002815_6751_8238 | 486 |
| 290 | 3300047472 | Ga0495686_0000185 | Ga0495686_0000185_97318_98805 | 486 |
| 291 | 3300048905 | Ga0496102_0003117 | Ga0496102_0003117_4824_6311 | 486 |
| 292 | 3300048918 | Ga0496115_0002119 | Ga0496115_0002119_7790_9277 | 486 |
| 293 | 3300048920 | Ga0496117_0004108 | Ga0496117_0004108_4940_6427 | 486 |
| 294 | 3300048921 | Ga0496118_0000989 | Ga0496118_0000989_38528_40015 | 486 |
| 295 | 3300048924 | Ga0496121_0006798 | Ga0496121_0006798_4781_6268 | 486 |
| 296 | 3300048927 | Ga0496124_0000050 | Ga0496124_0000050_8974_10461 | 486 |
| 297 | 3300048928 | Ga0496125_0002189 | Ga0496125_0002189_11246_12733 | 486 |
| 298 | 3300048929 | Ga0496126_0005697 | Ga0496126_0005697_4945_6432 | 486 |
| 299 | 3300049568 | Ga0501031_0077556 | Ga0501031_0077556_609_2081 | 486 |
| 300 | 3300049570 | Ga0501033_0013635 | Ga0501033_0013635_2242_3708 | 486 |
| 301 | 3300049571 | Ga0501034_0007685 | Ga0501034_0007685_6495_7961 | 486 |
| 302 | 3300049572 | Ga0501036_0047084 | Ga0501036_0047084_1000_2466 | 486 |
| 303 | 3300049579 | Ga0501043_0023159 | Ga0501043_0023159_191_1657 | 486 |
| 304 | 3300049822 | Ga0501035_0021879 | Ga0501035_0021879_2376_3842 | 486 |
| 305 | 3300049823 | Ga0501044_0023393 | Ga0501044_0023393_4374_5840 | 486 |
| 306 | 3300053079 | Ga0500610_0000595 | Ga0500610_0000595_3696_5183 | 486 |
| 307 | 3300053119 | Ga0500595_000166 | Ga0500595_000166_4925_6412 | 486 |
| 308 | 3300053134 | Ga0500658_0001416 | Ga0500658_0001416_4727_6190 | 486 |
| 309 | 3300053158 | Ga0500627_0000068 | Ga0500627_0000068_28678_30144 | 486 |
| 310 | 3300053730 | Ga0500645_000138 | Ga0500645_000138_15447_16934 | 486 |
| 311 | 3300001915 | JGI24741J21665_1000431 | JGI24741J21665_100043110 | 487 |
| 312 | 3300001979 | JGI24740J21852_10005606 | JGI24740J21852_100056063 | 487 |
| 313 | 3300001979 | JGI24740J21852_10006044 | JGI24740J21852_100060442 | 487 |
| 314 | 3300001989 | JGI24739J22299_10012411 | JGI24739J22299_100124113 | 487 |
| 315 | 3300001990 | JGI24737J22298_10002753 | JGI24737J22298_100027534 | 487 |
| 316 | 3300001990 | JGI24737J22298_10008497 | JGI24737J22298_100084973 | 487 |
| 317 | 3300001990 | JGI24737J22298_10008709 | JGI24737J22298_100087092 | 487 |
| 318 | 3300001990 | JGI24737J22298_10034006 | JGI24737J22298_100340061 | 487 |
| 319 | 3300005290 | Ga0065712_10075956 | Ga0065712_100759564 | 487 |
| 320 | 3300005327 | Ga0070658_10013798 | Ga0070658_100137982 | 487 |
| 321 | 3300005327 | Ga0070658_10014330 | Ga0070658_100143303 | 487 |
| 322 | 3300005327 | Ga0070658_10048136 | Ga0070658_100481363 | 487 |
| 323 | 3300005327 | Ga0070658_10053350 | Ga0070658_100533502 | 487 |
| 324 | 3300005327 | Ga0070658_10059310 | Ga0070658_100593102 | 487 |
| 325 | 3300005327 | Ga0070658_10062122 | Ga0070658_100621222 | 487 |
| 326 | 3300005329 | Ga0070683_100015274 | Ga0070683_1000152745 | 487 |
| 327 | 3300005329 | Ga0070683_100033164 | Ga0070683_1000331644 | 487 |
| 328 | 3300005329 | Ga0070683_100073969 | Ga0070683_1000739692 | 487 |
| 329 | 3300005329 | Ga0070683_100083739 | Ga0070683_1000837392 | 487 |
| 330 | 3300005330 | Ga0070690_100057999 | Ga0070690_1000579992 | 487 |
| 331 | 3300005331 | Ga0070670_100004560 | Ga0070670_1000045606 | 487 |
| 332 | 3300005331 | Ga0070670_100006393 | Ga0070670_1000063935 | 487 |
| 333 | 3300005331 | Ga0070670_100010746 | Ga0070670_1000107466 | 487 |
| 334 | 3300005331 | Ga0070670_100014788 | Ga0070670_1000147882 | 487 |
| 335 | 3300005331 | Ga0070670_100036425 | Ga0070670_1000364253 | 487 |
| 336 | 3300005331 | Ga0070670_100095328 | Ga0070670_1000953281 | 487 |
| 337 | 3300005331 | Ga0070670_100108435 | Ga0070670_1001084353 | 487 |
| 338 | 3300005335 | Ga0070666_10000215 | Ga0070666_100002158 | 487 |
| 339 | 3300005335 | Ga0070666_10003971 | Ga0070666_100039719 | 487 |
| 340 | 3300005335 | Ga0070666_10068267 | Ga0070666_100682672 | 487 |
| 341 | 3300005336 | Ga0070680_100001375 | Ga0070680_10000137515 | 487 |
| 342 | 3300005336 | Ga0070680_100073235 | Ga0070680_1000732352 | 487 |
| 343 | 3300005337 | Ga0070682_100010477 | Ga0070682_1000104773 | 487 |
| 344 | 3300005338 | Ga0068868_100136713 | Ga0068868_1001367132 | 487 |
| 345 | 3300005339 | Ga0070660_100000196 | Ga0070660_1000001966 | 487 |
| 346 | 3300005339 | Ga0070660_100000678 | Ga0070660_10000067821 | 487 |
| 347 | 3300005339 | Ga0070660_100001380 | Ga0070660_1000013801 | 487 |
| 348 | 3300005339 | Ga0070660_100039724 | Ga0070660_1000397242 | 487 |
| 349 | 3300005339 | Ga0070660_100062123 | Ga0070660_1000621233 | 487 |
| 350 | 3300005339 | Ga0070660_100083550 | Ga0070660_1000835502 | 487 |
| 351 | 3300005339 | Ga0070660_100117032 | Ga0070660_1001170322 | 487 |
| 352 | 3300005341 | Ga0070691_10006411 | Ga0070691_100064114 | 487 |
| 353 | 3300005344 | Ga0070661_100015558 | Ga0070661_1000155582 | 487 |
| 354 | 3300005344 | Ga0070661_100021108 | Ga0070661_1000211082 | 487 |
| 355 | 3300005344 | Ga0070661_100052614 | Ga0070661_1000526142 | 487 |
| 356 | 3300005347 | Ga0070668_100029835 | Ga0070668_1000298354 | 487 |
| 357 | 3300005353 | Ga0070669_100010847 | Ga0070669_1000108475 | 487 |
| 358 | 3300005353 | Ga0070669_100025889 | Ga0070669_1000258894 | 487 |
| 359 | 3300005353 | Ga0070669_100028833 | Ga0070669_1000288334 | 487 |
| 360 | 3300005353 | Ga0070669_100127546 | Ga0070669_1001275462 | 487 |
| 361 | 3300005354 | Ga0070675_100127201 | Ga0070675_1001272012 | 487 |
| 362 | 3300005355 | Ga0070671_100000229 | Ga0070671_10000022910 | 487 |
| 363 | 3300005355 | Ga0070671_100005401 | Ga0070671_1000054018 | 487 |
| 364 | 3300005355 | Ga0070671_100008028 | Ga0070671_1000080282 | 487 |
| 365 | 3300005355 | Ga0070671_100172787 | Ga0070671_1001727871 | 487 |
| 366 | 3300005356 | Ga0070674_100046815 | Ga0070674_1000468152 | 487 |
| 367 | 3300005364 | Ga0070673_100001123 | Ga0070673_1000011233 | 487 |
| 368 | 3300005364 | Ga0070673_100001517 | Ga0070673_10000151712 | 487 |
| 369 | 3300005364 | Ga0070673_100014284 | Ga0070673_1000142842 | 487 |
| 370 | 3300005364 | Ga0070673_100028934 | Ga0070673_1000289342 | 487 |
| 371 | 3300005366 | Ga0070659_100002859 | Ga0070659_1000028593 | 487 |
| 372 | 3300005366 | Ga0070659_100004759 | Ga0070659_1000047594 | 487 |
| 373 | 3300005366 | Ga0070659_100020708 | Ga0070659_1000207085 | 487 |
| 374 | 3300005366 | Ga0070659_100028630 | Ga0070659_1000286304 | 487 |
| 375 | 3300005366 | Ga0070659_100036427 | Ga0070659_1000364272 | 487 |
| 376 | 3300005366 | Ga0070659_100121668 | Ga0070659_1001216682 | 487 |
| 377 | 3300005367 | Ga0070667_100002846 | Ga0070667_1000028463 | 487 |
| 378 | 3300005367 | Ga0070667_100009607 | Ga0070667_1000096076 | 487 |
| 379 | 3300005367 | Ga0070667_100020527 | Ga0070667_1000205274 | 487 |
| 380 | 3300005367 | Ga0070667_100065626 | Ga0070667_1000656263 | 487 |
| 381 | 3300005367 | Ga0070667_100080108 | Ga0070667_1000801082 | 487 |
| 382 | 3300005367 | Ga0070667_100127294 | Ga0070667_1001272941 | 487 |
| 383 | 3300005367 | Ga0070667_100151447 | Ga0070667_1001514473 | 487 |
| 384 | 3300005455 | Ga0070663_100003678 | Ga0070663_1000036788 | 487 |
| 385 | 3300005455 | Ga0070663_100016977 | Ga0070663_1000169772 | 487 |
| 386 | 3300005456 | Ga0070678_100004545 | Ga0070678_1000045457 | 487 |
| 387 | 3300005457 | Ga0070662_100001444 | Ga0070662_1000014449 | 487 |
| 388 | 3300005457 | Ga0070662_100001885 | Ga0070662_1000018857 | 487 |
| 389 | 3300005457 | Ga0070662_100010186 | Ga0070662_1000101866 | 487 |
| 390 | 3300005457 | Ga0070662_100022776 | Ga0070662_1000227762 | 487 |
| 391 | 3300005457 | Ga0070662_100024316 | Ga0070662_1000243164 | 487 |
| 392 | 3300005457 | Ga0070662_100045053 | Ga0070662_1000450532 | 487 |
| 393 | 3300005458 | Ga0070681_10079160 | Ga0070681_100791602 | 487 |
| 394 | 3300005459 | Ga0068867_100015941 | Ga0068867_1000159414 | 487 |
| 395 | 3300005530 | Ga0070679_100001379 | Ga0070679_1000013793 | 487 |
| 396 | 3300005535 | Ga0070684_100052323 | Ga0070684_1000523232 | 487 |
| 397 | 3300005539 | Ga0068853_100071507 | Ga0068853_1000715073 | 487 |
| 398 | 3300005539 | Ga0068853_100195898 | Ga0068853_1001958981 | 487 |
| 399 | 3300005539 | Ga0068853_100247135 | Ga0068853_1002471351 | 487 |
| 400 | 3300005543 | Ga0070672_100003232 | Ga0070672_1000032322 | 487 |
| 401 | 3300005543 | Ga0070672_100015400 | Ga0070672_1000154003 | 487 |
| 402 | 3300005543 | Ga0070672_100024535 | Ga0070672_1000245351 | 487 |
| 403 | 3300005543 | Ga0070672_100133624 | Ga0070672_1001336242 | 487 |
| 404 | 3300005544 | Ga0070686_100070721 | Ga0070686_1000707212 | 487 |
| 405 | 3300005548 | Ga0070665_100000820 | Ga0070665_10000082030 | 487 |
| 406 | 3300005548 | Ga0070665_100004669 | Ga0070665_10000466910 | 487 |
| 407 | 3300005548 | Ga0070665_100004787 | Ga0070665_10000478710 | 487 |
| 408 | 3300005548 | Ga0070665_100020745 | Ga0070665_1000207455 | 487 |
| 409 | 3300005548 | Ga0070665_100036998 | Ga0070665_1000369984 | 487 |
| 410 | 3300005548 | Ga0070665_100057110 | Ga0070665_1000571102 | 487 |
| 411 | 3300005563 | Ga0068855_100000408 | Ga0068855_1000004086 | 487 |
| 412 | 3300005563 | Ga0068855_100029819 | Ga0068855_1000298193 | 487 |
| 413 | 3300005563 | Ga0068855_100034006 | Ga0068855_1000340064 | 487 |
| 414 | 3300005563 | Ga0068855_100064376 | Ga0068855_1000643762 | 487 |
| 415 | 3300005564 | Ga0070664_100001404 | Ga0070664_1000014043 | 487 |
| 416 | 3300005564 | Ga0070664_100001633 | Ga0070664_10000163312 | 487 |
| 417 | 3300005564 | Ga0070664_100031112 | Ga0070664_1000311123 | 487 |
| 418 | 3300005564 | Ga0070664_100047266 | Ga0070664_1000472662 | 487 |
| 419 | 3300005564 | Ga0070664_100109851 | Ga0070664_1001098512 | 487 |
| 420 | 3300005577 | Ga0068857_100035949 | Ga0068857_1000359492 | 487 |
| 421 | 3300005577 | Ga0068857_100088738 | Ga0068857_1000887381 | 487 |
| 422 | 3300005578 | Ga0068854_100002023 | Ga0068854_1000020239 | 487 |
| 423 | 3300005578 | Ga0068854_100010331 | Ga0068854_1000103315 | 487 |
| 424 | 3300005578 | Ga0068854_100070394 | Ga0068854_1000703942 | 487 |
| 425 | 3300005614 | Ga0068856_100040015 | Ga0068856_1000400152 | 487 |
| 426 | 3300005616 | Ga0068852_100011651 | Ga0068852_1000116513 | 487 |
| 427 | 3300005616 | Ga0068852_100012894 | Ga0068852_1000128943 | 487 |
| 428 | 3300005616 | Ga0068852_100032154 | Ga0068852_1000321543 | 487 |
| 429 | 3300005616 | Ga0068852_100070909 | Ga0068852_1000709092 | 487 |
| 430 | 3300005616 | Ga0068852_100245050 | Ga0068852_1002450501 | 487 |
| 431 | 3300005617 | Ga0068859_100002810 | Ga0068859_1000028104 | 487 |
| 432 | 3300005617 | Ga0068859_100030985 | Ga0068859_1000309853 | 487 |
| 433 | 3300005617 | Ga0068859_100047383 | Ga0068859_1000473832 | 487 |
| 434 | 3300005617 | Ga0068859_100047416 | Ga0068859_1000474162 | 487 |
| 435 | 3300005617 | Ga0068859_100086348 | Ga0068859_1000863483 | 487 |
| 436 | 3300005617 | Ga0068859_100121610 | Ga0068859_1001216102 | 487 |
| 437 | 3300005617 | Ga0068859_100136416 | Ga0068859_1001364162 | 487 |
| 438 | 3300005618 | Ga0068864_100015545 | Ga0068864_1000155454 | 487 |
| 439 | 3300005618 | Ga0068864_100019523 | Ga0068864_1000195234 | 487 |
| 440 | 3300005618 | Ga0068864_100032751 | Ga0068864_1000327513 | 487 |
| 441 | 3300005618 | Ga0068864_100034668 | Ga0068864_1000346682 | 487 |
| 442 | 3300005618 | Ga0068864_100037717 | Ga0068864_1000377172 | 487 |
| 443 | 3300005834 | Ga0068851_10003735 | Ga0068851_100037352 | 487 |
| 444 | 3300005834 | Ga0068851_10007915 | Ga0068851_100079152 | 487 |
| 445 | 3300005841 | Ga0068863_100002668 | Ga0068863_10000266812 | 487 |
| 446 | 3300005841 | Ga0068863_100018056 | Ga0068863_1000180568 | 487 |
| 447 | 3300005841 | Ga0068863_100048238 | Ga0068863_1000482382 | 487 |
| 448 | 3300005841 | Ga0068863_100089450 | Ga0068863_1000894502 | 487 |
| 449 | 3300005841 | Ga0068863_100135628 | Ga0068863_1001356282 | 487 |
| 450 | 3300005842 | Ga0068858_100005553 | Ga0068858_1000055532 | 487 |
| 451 | 3300005842 | Ga0068858_100016460 | Ga0068858_1000164604 | 487 |
| 452 | 3300005842 | Ga0068858_100020597 | Ga0068858_1000205975 | 487 |
| 453 | 3300005842 | Ga0068858_100048106 | Ga0068858_1000481063 | 487 |
| 454 | 3300005842 | Ga0068858_100087420 | Ga0068858_1000874202 | 487 |
| 455 | 3300005842 | Ga0068858_100134254 | Ga0068858_1001342542 | 487 |
| 456 | 3300005842 | Ga0068858_100139963 | Ga0068858_1001399632 | 487 |
| 457 | 3300005843 | Ga0068860_100009099 | Ga0068860_1000090996 | 487 |
| 458 | 3300005843 | Ga0068860_100034282 | Ga0068860_1000342822 | 487 |
| 459 | 3300005843 | Ga0068860_100056677 | Ga0068860_1000566772 | 487 |
| 460 | 3300005844 | Ga0068862_100049681 | Ga0068862_1000496812 | 487 |
| 461 | 3300005985 | Ga0081539_10012045 | Ga0081539_100120452 | 487 |
| 462 | 3300006042 | Ga0075368_10002482 | Ga0075368_100024826 | 487 |
| 463 | 3300006048 | Ga0075363_100011628 | Ga0075363_1000116285 | 487 |
| 464 | 3300006177 | Ga0075362_10000018 | Ga0075362_1000001857 | 487 |
| 465 | 3300006177 | Ga0075362_10000985 | Ga0075362_100009859 | 487 |
| 466 | 3300006195 | Ga0075366_10000303 | Ga0075366_1000030311 | 487 |
| 467 | 3300006237 | Ga0097621_100055225 | Ga0097621_1000552252 | 487 |
| 468 | 3300006358 | Ga0068871_100029468 | Ga0068871_1000294684 | 487 |
| 469 | 3300006358 | Ga0068871_100049418 | Ga0068871_1000494184 | 487 |
| 470 | 3300006358 | Ga0068871_100139332 | Ga0068871_1001393321 | 487 |
| 471 | 3300006881 | Ga0068865_100040472 | Ga0068865_1000404722 | 487 |
| 472 | 3300006931 | Ga0097620_100002811 | Ga0097620_1000028114 | 487 |
| 473 | 3300006931 | Ga0097620_100030985 | Ga0097620_1000309853 | 487 |
| 474 | 3300006931 | Ga0097620_100047384 | Ga0097620_1000473842 | 487 |
| 475 | 3300006931 | Ga0097620_100047417 | Ga0097620_1000474172 | 487 |
| 476 | 3300006931 | Ga0097620_100086352 | Ga0097620_1000863523 | 487 |
| 477 | 3300006931 | Ga0097620_100121611 | Ga0097620_1001216113 | 487 |
| 478 | 3300006931 | Ga0097620_100136420 | Ga0097620_1001364202 | 487 |
| 479 | 3300009092 | Ga0105250_10006682 | Ga0105250_100066823 | 487 |
| 480 | 3300009098 | Ga0105245_10006292 | Ga0105245_1000629210 | 487 |
| 481 | 3300009098 | Ga0105245_10049672 | Ga0105245_100496722 | 487 |
| 482 | 3300009176 | Ga0105242_10123637 | Ga0105242_101236372 | 487 |
| 483 | 3300009177 | Ga0105248_10000362 | Ga0105248_1000036247 | 487 |
| 484 | 3300009177 | Ga0105248_10006715 | Ga0105248_100067155 | 487 |
| 485 | 3300009177 | Ga0105248_10007122 | Ga0105248_100071224 | 487 |
| 486 | 3300009177 | Ga0105248_10010911 | Ga0105248_100109113 | 487 |
| 487 | 3300009177 | Ga0105248_10023147 | Ga0105248_100231476 | 487 |
| 488 | 3300009177 | Ga0105248_10024612 | Ga0105248_100246126 | 487 |
| 489 | 3300009177 | Ga0105248_10086313 | Ga0105248_100863132 | 487 |
| 490 | 3300009177 | Ga0105248_10107601 | Ga0105248_101076012 | 487 |
| 491 | 3300009177 | Ga0105248_10110921 | Ga0105248_101109213 | 487 |
| 492 | 3300009177 | Ga0105248_10140777 | Ga0105248_101407772 | 487 |
| 493 | 3300009553 | Ga0105249_10051014 | Ga0105249_100510142 | 487 |
| 494 | 3300010375 | Ga0105239_10110493 | Ga0105239_101104932 | 487 |
| 495 | 3300013100 | Ga0157373_10071828 | Ga0157373_100718282 | 487 |
| 496 | 3300013102 | Ga0157371_10005239 | Ga0157371_100052397 | 487 |
| 497 | 3300013102 | Ga0157371_10010681 | Ga0157371_100106814 | 487 |
| 498 | 3300013105 | Ga0157369_10000635 | Ga0157369_1000063541 | 487 |
| 499 | 3300013105 | Ga0157369_10056072 | Ga0157369_100560724 | 487 |
| 500 | 3300013105 | Ga0157369_10206667 | Ga0157369_102066671 | 487 |
| 501 | 3300013297 | Ga0157378_10279066 | Ga0157378_102790661 | 487 |
| 502 | 3300013306 | Ga0163162_10006899 | Ga0163162_100068992 | 487 |
| 503 | 3300013306 | Ga0163162_10006918 | Ga0163162_100069185 | 487 |
| 504 | 3300013306 | Ga0163162_10117940 | Ga0163162_101179403 | 487 |
| 505 | 3300013308 | Ga0157375_10000296 | Ga0157375_100002966 | 487 |
| 506 | 3300013308 | Ga0157375_10017638 | Ga0157375_100176383 | 487 |
| 507 | 3300013308 | Ga0157375_10375573 | Ga0157375_103755731 | 487 |
| 508 | 3300014325 | Ga0163163_10002099 | Ga0163163_1000209911 | 487 |
| 509 | 3300014325 | Ga0163163_10011403 | Ga0163163_100114033 | 487 |
| 510 | 3300014326 | Ga0157380_10120042 | Ga0157380_101200423 | 487 |
| 511 | 3300014968 | Ga0157379_10003233 | Ga0157379_1000323310 | 487 |
| 512 | 3300021388 | Ga0213875_10002419 | Ga0213875_100024191 | 487 |
| 513 | 3300025315 | Ga0207697_10007831 | Ga0207697_100078314 | 487 |
| 514 | 3300025321 | Ga0207656_10012022 | Ga0207656_100120222 | 487 |
| 515 | 3300025893 | Ga0207682_10003135 | Ga0207682_100031357 | 487 |
| 516 | 3300025899 | Ga0207642_10013595 | Ga0207642_100135952 | 487 |
| 517 | 3300025903 | Ga0207680_10003548 | Ga0207680_100035482 | 487 |
| 518 | 3300025903 | Ga0207680_10008878 | Ga0207680_100088783 | 487 |
| 519 | 3300025904 | Ga0207647_10000339 | Ga0207647_1000033923 | 487 |
| 520 | 3300025904 | Ga0207647_10001091 | Ga0207647_1000109112 | 487 |
| 521 | 3300025904 | Ga0207647_10017780 | Ga0207647_100177802 | 487 |
| 522 | 3300025904 | Ga0207647_10041128 | Ga0207647_100411282 | 487 |
| 523 | 3300025909 | Ga0207705_10000070 | Ga0207705_10000070108 | 487 |
| 524 | 3300025909 | Ga0207705_10000166 | Ga0207705_100001666 | 487 |
| 525 | 3300025909 | Ga0207705_10000205 | Ga0207705_1000020528 | 487 |
| 526 | 3300025909 | Ga0207705_10005655 | Ga0207705_100056552 | 487 |
| 527 | 3300025909 | Ga0207705_10007530 | Ga0207705_100075302 | 487 |
| 528 | 3300025909 | Ga0207705_10008658 | Ga0207705_100086586 | 487 |
| 529 | 3300025909 | Ga0207705_10016594 | Ga0207705_100165944 | 487 |
| 530 | 3300025909 | Ga0207705_10018815 | Ga0207705_100188152 | 487 |
| 531 | 3300025909 | Ga0207705_10030837 | Ga0207705_100308373 | 487 |
| 532 | 3300025909 | Ga0207705_10034881 | Ga0207705_100348812 | 487 |
| 533 | 3300025909 | Ga0207705_10049564 | Ga0207705_100495643 | 487 |
| 534 | 3300025909 | Ga0207705_10053486 | Ga0207705_100534861 | 487 |
| 535 | 3300025909 | Ga0207705_10115890 | Ga0207705_101158901 | 487 |
| 536 | 3300025912 | Ga0207707_10024686 | Ga0207707_100246862 | 487 |
| 537 | 3300025912 | Ga0207707_10108299 | Ga0207707_101082992 | 487 |
| 538 | 3300025913 | Ga0207695_10005871 | Ga0207695_1000587111 | 487 |
| 539 | 3300025913 | Ga0207695_10233529 | Ga0207695_102335292 | 487 |
| 540 | 3300025914 | Ga0207671_10115233 | Ga0207671_101152332 | 487 |
| 541 | 3300025919 | Ga0207657_10000471 | Ga0207657_100004712 | 487 |
| 542 | 3300025919 | Ga0207657_10003326 | Ga0207657_100033262 | 487 |
| 543 | 3300025919 | Ga0207657_10005851 | Ga0207657_100058516 | 487 |
| 544 | 3300025919 | Ga0207657_10008974 | Ga0207657_100089748 | 487 |
| 545 | 3300025919 | Ga0207657_10009473 | Ga0207657_100094733 | 487 |
| 546 | 3300025919 | Ga0207657_10009727 | Ga0207657_100097273 | 487 |
| 547 | 3300025919 | Ga0207657_10011984 | Ga0207657_100119846 | 487 |
| 548 | 3300025919 | Ga0207657_10032585 | Ga0207657_100325853 | 487 |
| 549 | 3300025919 | Ga0207657_10073458 | Ga0207657_100734582 | 487 |
| 550 | 3300025919 | Ga0207657_10177273 | Ga0207657_101772731 | 487 |
| 551 | 3300025920 | Ga0207649_10001363 | Ga0207649_1000136314 | 487 |
| 552 | 3300025920 | Ga0207649_10041672 | Ga0207649_100416722 | 487 |
| 553 | 3300025920 | Ga0207649_10042593 | Ga0207649_100425932 | 487 |
| 554 | 3300025920 | Ga0207649_10046859 | Ga0207649_100468592 | 487 |
| 555 | 3300025920 | Ga0207649_10077909 | Ga0207649_100779091 | 487 |
| 556 | 3300025921 | Ga0207652_10000270 | Ga0207652_1000027027 | 487 |
| 557 | 3300025921 | Ga0207652_10074640 | Ga0207652_100746402 | 487 |
| 558 | 3300025921 | Ga0207652_10228722 | Ga0207652_102287222 | 487 |
| 559 | 3300025923 | Ga0207681_10003725 | Ga0207681_100037257 | 487 |
| 560 | 3300025923 | Ga0207681_10006050 | Ga0207681_100060507 | 487 |
| 561 | 3300025923 | Ga0207681_10057402 | Ga0207681_100574022 | 487 |
| 562 | 3300025925 | Ga0207650_10004433 | Ga0207650_100044336 | 487 |
| 563 | 3300025925 | Ga0207650_10021458 | Ga0207650_100214582 | 487 |
| 564 | 3300025925 | Ga0207650_10064988 | Ga0207650_100649882 | 487 |
| 565 | 3300025926 | Ga0207659_10008129 | Ga0207659_100081294 | 487 |
| 566 | 3300025928 | Ga0207700_10112013 | Ga0207700_101120132 | 487 |
| 567 | 3300025931 | Ga0207644_10000324 | Ga0207644_100003241 | 487 |
| 568 | 3300025931 | Ga0207644_10007290 | Ga0207644_100072904 | 487 |
| 569 | 3300025931 | Ga0207644_10034849 | Ga0207644_100348494 | 487 |
| 570 | 3300025931 | Ga0207644_10120667 | Ga0207644_101206672 | 487 |
| 571 | 3300025932 | Ga0207690_10026021 | Ga0207690_100260213 | 487 |
| 572 | 3300025933 | Ga0207706_10001159 | Ga0207706_1000115913 | 487 |
| 573 | 3300025933 | Ga0207706_10012485 | Ga0207706_100124857 | 487 |
| 574 | 3300025933 | Ga0207706_10015297 | Ga0207706_100152975 | 487 |
| 575 | 3300025933 | Ga0207706_10027130 | Ga0207706_100271305 | 487 |
| 576 | 3300025933 | Ga0207706_10028341 | Ga0207706_100283412 | 487 |
| 577 | 3300025933 | Ga0207706_10075584 | Ga0207706_100755842 | 487 |
| 578 | 3300025933 | Ga0207706_10194421 | Ga0207706_101944212 | 487 |
| 579 | 3300025937 | Ga0207669_10006639 | Ga0207669_100066394 | 487 |
| 580 | 3300025937 | Ga0207669_10061470 | Ga0207669_100614702 | 487 |
| 581 | 3300025938 | Ga0207704_10038739 | Ga0207704_100387393 | 487 |
| 582 | 3300025940 | Ga0207691_10000915 | Ga0207691_1000091511 | 487 |
| 583 | 3300025940 | Ga0207691_10018796 | Ga0207691_100187963 | 487 |
| 584 | 3300025940 | Ga0207691_10035119 | Ga0207691_100351194 | 487 |
| 585 | 3300025940 | Ga0207691_10036542 | Ga0207691_100365421 | 487 |
| 586 | 3300025940 | Ga0207691_10050290 | Ga0207691_100502902 | 487 |
| 587 | 3300025940 | Ga0207691_10129294 | Ga0207691_101292942 | 487 |
| 588 | 3300025940 | Ga0207691_10199239 | Ga0207691_101992392 | 487 |
| 589 | 3300025941 | Ga0207711_10000429 | Ga0207711_1000042915 | 487 |
| 590 | 3300025941 | Ga0207711_10001903 | Ga0207711_1000190316 | 487 |
| 591 | 3300025941 | Ga0207711_10008656 | Ga0207711_100086567 | 487 |
| 592 | 3300025941 | Ga0207711_10011424 | Ga0207711_100114242 | 487 |
| 593 | 3300025941 | Ga0207711_10011831 | Ga0207711_100118316 | 487 |
| 594 | 3300025941 | Ga0207711_10018883 | Ga0207711_100188835 | 487 |
| 595 | 3300025942 | Ga0207689_10014695 | Ga0207689_100146952 | 487 |
| 596 | 3300025944 | Ga0207661_10020291 | Ga0207661_100202912 | 487 |
| 597 | 3300025944 | Ga0207661_10048483 | Ga0207661_100484832 | 487 |
| 598 | 3300025944 | Ga0207661_10092528 | Ga0207661_100925282 | 487 |
| 599 | 3300025944 | Ga0207661_10150014 | Ga0207661_101500142 | 487 |
| 600 | 3300025945 | Ga0207679_10008055 | Ga0207679_100080554 | 487 |
| 601 | 3300025945 | Ga0207679_10014006 | Ga0207679_100140064 | 487 |
| 602 | 3300025949 | Ga0207667_10001086 | Ga0207667_1000108630 | 487 |
| 603 | 3300025949 | Ga0207667_10022885 | Ga0207667_100228854 | 487 |
| 604 | 3300025949 | Ga0207667_10038356 | Ga0207667_100383564 | 487 |
| 605 | 3300025949 | Ga0207667_10054554 | Ga0207667_100545542 | 487 |
| 606 | 3300025949 | Ga0207667_10166349 | Ga0207667_101663491 | 487 |
| 607 | 3300025949 | Ga0207667_10210158 | Ga0207667_102101582 | 487 |
| 608 | 3300025960 | Ga0207651_10001281 | Ga0207651_100012816 | 487 |
| 609 | 3300025960 | Ga0207651_10018709 | Ga0207651_100187093 | 487 |
| 610 | 3300025960 | Ga0207651_10029319 | Ga0207651_100293194 | 487 |
| 611 | 3300025960 | Ga0207651_10088707 | Ga0207651_100887072 | 487 |
| 612 | 3300025960 | Ga0207651_10119364 | Ga0207651_101193641 | 487 |
| 613 | 3300025961 | Ga0207712_10001479 | Ga0207712_1000147917 | 487 |
| 614 | 3300025972 | Ga0207668_10021104 | Ga0207668_100211042 | 487 |
| 615 | 3300025972 | Ga0207668_10024698 | Ga0207668_100246984 | 487 |
| 616 | 3300025972 | Ga0207668_10094671 | Ga0207668_100946712 | 487 |
| 617 | 3300025981 | Ga0207640_10015302 | Ga0207640_100153023 | 487 |
| 618 | 3300025981 | Ga0207640_10041766 | Ga0207640_100417662 | 487 |
| 619 | 3300025986 | Ga0207658_10003493 | Ga0207658_100034937 | 487 |
| 620 | 3300025986 | Ga0207658_10003904 | Ga0207658_100039044 | 487 |
| 621 | 3300025986 | Ga0207658_10012446 | Ga0207658_100124464 | 487 |
| 622 | 3300025986 | Ga0207658_10032938 | Ga0207658_100329382 | 487 |
| 623 | 3300025986 | Ga0207658_10046834 | Ga0207658_100468342 | 487 |
| 624 | 3300026023 | Ga0207677_10018010 | Ga0207677_100180104 | 487 |
| 625 | 3300026023 | Ga0207677_10058563 | Ga0207677_100585632 | 487 |
| 626 | 3300026023 | Ga0207677_10113305 | Ga0207677_101133052 | 487 |
| 627 | 3300026035 | Ga0207703_10001377 | Ga0207703_100013778 | 487 |
| 628 | 3300026035 | Ga0207703_10002355 | Ga0207703_100023557 | 487 |
| 629 | 3300026035 | Ga0207703_10022775 | Ga0207703_100227751 | 487 |
| 630 | 3300026035 | Ga0207703_10097238 | Ga0207703_100972382 | 487 |
| 631 | 3300026041 | Ga0207639_10002865 | Ga0207639_100028658 | 487 |
| 632 | 3300026041 | Ga0207639_10113263 | Ga0207639_101132632 | 487 |
| 633 | 3300026067 | Ga0207678_10000766 | Ga0207678_1000076627 | 487 |
| 634 | 3300026067 | Ga0207678_10001860 | Ga0207678_1000186013 | 487 |
| 635 | 3300026067 | Ga0207678_10003559 | Ga0207678_1000355912 | 487 |
| 636 | 3300026067 | Ga0207678_10005883 | Ga0207678_100058835 | 487 |
| 637 | 3300026067 | Ga0207678_10019547 | Ga0207678_100195477 | 487 |
| 638 | 3300026067 | Ga0207678_10056767 | Ga0207678_100567672 | 487 |
| 639 | 3300026067 | Ga0207678_10087586 | Ga0207678_100875862 | 487 |
| 640 | 3300026067 | Ga0207678_10114328 | Ga0207678_101143282 | 487 |
| 641 | 3300026067 | Ga0207678_10136169 | Ga0207678_101361692 | 487 |
| 642 | 3300026078 | Ga0207702_10009679 | Ga0207702_100096795 | 487 |
| 643 | 3300026078 | Ga0207702_10020040 | Ga0207702_100200401 | 487 |
| 644 | 3300026088 | Ga0207641_10002148 | Ga0207641_100021482 | 487 |
| 645 | 3300026088 | Ga0207641_10015693 | Ga0207641_100156935 | 487 |
| 646 | 3300026088 | Ga0207641_10015705 | Ga0207641_100157058 | 487 |
| 647 | 3300026088 | Ga0207641_10030647 | Ga0207641_100306472 | 487 |
| 648 | 3300026089 | Ga0207648_10015674 | Ga0207648_100156746 | 487 |
| 649 | 3300026089 | Ga0207648_10036614 | Ga0207648_100366144 | 487 |
| 650 | 3300026089 | Ga0207648_10108607 | Ga0207648_101086071 | 487 |
| 651 | 3300026095 | Ga0207676_10001670 | Ga0207676_100016704 | 487 |
| 652 | 3300026095 | Ga0207676_10015413 | Ga0207676_100154132 | 487 |
| 653 | 3300026095 | Ga0207676_10029323 | Ga0207676_100293231 | 487 |
| 654 | 3300026116 | Ga0207674_10000347 | Ga0207674_1000034732 | 487 |
| 655 | 3300026116 | Ga0207674_10006876 | Ga0207674_100068765 | 487 |
| 656 | 3300026116 | Ga0207674_10007182 | Ga0207674_1000718210 | 487 |
| 657 | 3300026121 | Ga0207683_10002012 | Ga0207683_1000201211 | 487 |
| 658 | 3300026142 | Ga0207698_10001498 | Ga0207698_100014988 | 487 |
| 659 | 3300026142 | Ga0207698_10004314 | Ga0207698_100043149 | 487 |
| 660 | 3300026142 | Ga0207698_10016372 | Ga0207698_100163722 | 487 |
| 661 | 3300026142 | Ga0207698_10037815 | Ga0207698_100378153 | 487 |
| 662 | 3300026142 | Ga0207698_10059612 | Ga0207698_100596122 | 487 |
| 663 | 3300026142 | Ga0207698_10073087 | Ga0207698_100730872 | 487 |
| 664 | 3300026142 | Ga0207698_10083458 | Ga0207698_100834582 | 487 |
| 665 | 3300026142 | Ga0207698_10172312 | Ga0207698_101723122 | 487 |
| 666 | 3300027866 | Ga0209813_10000122 | Ga0209813_100001227 | 487 |
| 667 | 3300028379 | Ga0268266_10001757 | Ga0268266_1000175715 | 487 |
| 668 | 3300028379 | Ga0268266_10002440 | Ga0268266_100024407 | 487 |
| 669 | 3300028379 | Ga0268266_10068949 | Ga0268266_100689492 | 487 |
| 670 | 3300028380 | Ga0268265_10056551 | Ga0268265_100565513 | 487 |
| 671 | 3300028380 | Ga0268265_10179982 | Ga0268265_101799821 | 487 |
| 672 | 3300028381 | Ga0268264_10002233 | Ga0268264_1000223310 | 487 |
| 673 | 3300028381 | Ga0268264_10003251 | Ga0268264_100032514 | 487 |
| 674 | 3300028381 | Ga0268264_10006977 | Ga0268264_100069779 | 487 |
| 675 | 3300031548 | Ga0307408_100003140 | Ga0307408_10000314013 | 487 |
| 676 | 3300031548 | Ga0307408_100004067 | Ga0307408_1000040676 | 487 |
| 677 | 3300031548 | Ga0307408_100018685 | Ga0307408_1000186854 | 487 |
| 678 | 3300031548 | Ga0307408_100032161 | Ga0307408_1000321612 | 487 |
| 679 | 3300031548 | Ga0307408_100039634 | Ga0307408_1000396343 | 487 |
| 680 | 3300031548 | Ga0307408_100054972 | Ga0307408_1000549722 | 487 |
| 681 | 3300031731 | Ga0307405_10024034 | Ga0307405_100240343 | 487 |
| 682 | 3300031731 | Ga0307405_10114775 | Ga0307405_101147752 | 487 |
| 683 | 3300031824 | Ga0307413_10009251 | Ga0307413_100092512 | 487 |
| 684 | 3300031824 | Ga0307413_10020505 | Ga0307413_100205051 | 487 |
| 685 | 3300031824 | Ga0307413_10118389 | Ga0307413_101183892 | 487 |
| 686 | 3300031852 | Ga0307410_10000619 | Ga0307410_100006197 | 487 |
| 687 | 3300031852 | Ga0307410_10003266 | Ga0307410_100032668 | 487 |
| 688 | 3300031852 | Ga0307410_10009790 | Ga0307410_100097904 | 487 |
| 689 | 3300031852 | Ga0307410_10012640 | Ga0307410_100126402 | 487 |
| 690 | 3300031852 | Ga0307410_10019193 | Ga0307410_100191932 | 487 |
| 691 | 3300031852 | Ga0307410_10034526 | Ga0307410_100345262 | 487 |
| 692 | 3300031852 | Ga0307410_10068799 | Ga0307410_100687992 | 487 |
| 693 | 3300031852 | Ga0307410_10069875 | Ga0307410_100698752 | 487 |
| 694 | 3300031852 | Ga0307410_10087122 | Ga0307410_100871222 | 487 |
| 695 | 3300031901 | Ga0307406_10012877 | Ga0307406_100128772 | 487 |
| 696 | 3300031901 | Ga0307406_10035147 | Ga0307406_100351472 | 487 |
| 697 | 3300031901 | Ga0307406_10058971 | Ga0307406_100589712 | 487 |
| 698 | 3300031901 | Ga0307406_10120451 | Ga0307406_101204511 | 487 |
| 699 | 3300031903 | Ga0307407_10005544 | Ga0307407_100055442 | 487 |
| 700 | 3300031903 | Ga0307407_10006410 | Ga0307407_100064103 | 487 |
| 701 | 3300031903 | Ga0307407_10007250 | Ga0307407_100072505 | 487 |
| 702 | 3300031903 | Ga0307407_10108338 | Ga0307407_101083382 | 487 |
| 703 | 3300031911 | Ga0307412_10001748 | Ga0307412_1000174812 | 487 |
| 704 | 3300031911 | Ga0307412_10005139 | Ga0307412_100051392 | 487 |
| 705 | 3300031911 | Ga0307412_10033365 | Ga0307412_100333652 | 487 |
| 706 | 3300031995 | Ga0307409_100003140 | Ga0307409_1000031404 | 487 |
| 707 | 3300031995 | Ga0307409_100004723 | Ga0307409_1000047232 | 487 |
| 708 | 3300031995 | Ga0307409_100013078 | Ga0307409_1000130782 | 487 |
| 709 | 3300031995 | Ga0307409_100035225 | Ga0307409_1000352252 | 487 |
| 710 | 3300031995 | Ga0307409_100087147 | Ga0307409_1000871472 | 487 |
| 711 | 3300032002 | Ga0307416_100024325 | Ga0307416_1000243252 | 487 |
| 712 | 3300032002 | Ga0307416_100033774 | Ga0307416_1000337742 | 487 |
| 713 | 3300032002 | Ga0307416_100048350 | Ga0307416_1000483502 | 487 |
| 714 | 3300032002 | Ga0307416_100103978 | Ga0307416_1001039783 | 487 |
| 715 | 3300032004 | Ga0307414_10022460 | Ga0307414_100224602 | 487 |
| 716 | 3300032004 | Ga0307414_10080880 | Ga0307414_100808802 | 487 |
| 717 | 3300032004 | Ga0307414_10117535 | Ga0307414_101175352 | 487 |
| 718 | 3300032005 | Ga0307411_10001218 | Ga0307411_100012188 | 487 |
| 719 | 3300032005 | Ga0307411_10015109 | Ga0307411_100151092 | 487 |
| 720 | 3300032005 | Ga0307411_10019087 | Ga0307411_100190872 | 487 |
| 721 | 3300032005 | Ga0307411_10021157 | Ga0307411_100211573 | 487 |
| 722 | 3300032005 | Ga0307411_10068395 | Ga0307411_100683952 | 487 |
| 723 | 3300032005 | Ga0307411_10076033 | Ga0307411_100760332 | 487 |
| 724 | 3300032126 | Ga0307415_100000243 | Ga0307415_1000002433 | 487 |
| 725 | 3300032126 | Ga0307415_100005402 | Ga0307415_1000054022 | 487 |
| 726 | 3300032126 | Ga0307415_100011470 | Ga0307415_1000114702 | 487 |
| 727 | 3300032126 | Ga0307415_100013777 | Ga0307415_1000137772 | 487 |
| 728 | 3300032126 | Ga0307415_100026221 | Ga0307415_1000262212 | 487 |
| 729 | 3300035111 | Ga0373923_0004243 | Ga0373923_0004243_1184_2659 | 487 |
| 730 | 3300035117 | Ga0373953_0036630 | Ga0373953_0036630_362_1837 | 487 |
| 731 | 3300035691 | Ga0373931_0006860 | Ga0373931_0006860_1493_2986 | 487 |
| 732 | 3300036401 | Ga0373937_0026424 | Ga0373937_0026424_2094_3569 | 487 |
| 733 | 3300037312 | Ga0395899_0000387 | Ga0395899_0000387_48809_50302 | 487 |
| 734 | 3300037312 | Ga0395899_0000419 | Ga0395899_0000419_1514_2989 | 487 |
| 735 | 3300037312 | Ga0395899_0001750 | Ga0395899_0001750_14453_15946 | 487 |
| 736 | 3300037312 | Ga0395899_0008340 | Ga0395899_0008340_1333_2811 | 487 |
| 737 | 3300037312 | Ga0395899_0023263 | Ga0395899_0023263_1784_3274 | 487 |
| 738 | 3300037312 | Ga0395899_0033818 | Ga0395899_0033818_1596_3071 | 487 |
| 739 | 3300037312 | Ga0395899_0037193 | Ga0395899_0037193_1276_2754 | 487 |
| 740 | 3300037312 | Ga0395899_0078520 | Ga0395899_0078520_19_1497 | 487 |
| 741 | 3300037418 | Ga0395900_0000130 | Ga0395900_0000130_102281_103774 | 487 |
| 742 | 3300037418 | Ga0395900_0000572 | Ga0395900_0000572_22776_24245 | 487 |
| 743 | 3300037418 | Ga0395900_0003659 | Ga0395900_0003659_9960_11435 | 487 |
| 744 | 3300037418 | Ga0395900_0012536 | Ga0395900_0012536_4927_6405 | 487 |
| 745 | 3300037418 | Ga0395900_0022296 | Ga0395900_0022296_4451_5929 | 487 |
| 746 | 3300037418 | Ga0395900_0039940 | Ga0395900_0039940_1071_2549 | 487 |
| 747 | 3300037418 | Ga0395900_0062610 | Ga0395900_0062610_1406_2884 | 487 |
| 748 | 3300037418 | Ga0395900_0063941 | Ga0395900_0063941_1457_2935 | 487 |
| 749 | 3300037418 | Ga0395900_0069065 | Ga0395900_0069065_1074_2552 | 487 |
| 750 | 3300037418 | Ga0395900_0086409 | Ga0395900_0086409_59_1534 | 487 |
| 751 | 3300037418 | Ga0395900_0106565 | Ga0395900_0106565_1201_2679 | 487 |
| 752 | 3300037418 | Ga0395900_0120555 | Ga0395900_0120555_702_2168 | 487 |
| 753 | 3300037418 | Ga0395900_0190501 | Ga0395900_0190501_273_1751 | 487 |
| 754 | 3300037418 | Ga0395900_0204971 | Ga0395900_0204971_427_1905 | 487 |
| 755 | 3300037418 | Ga0395900_0315448 | Ga0395900_0315448_38_1510 | 487 |
| 756 | 3300037466 | Ga0395898_0000274 | Ga0395898_0000274_55285_56778 | 487 |
| 757 | 3300037466 | Ga0395898_0007664 | Ga0395898_0007664_5108_6586 | 487 |
| 758 | 3300037466 | Ga0395898_0011442 | Ga0395898_0011442_4040_5515 | 487 |
| 759 | 3300037466 | Ga0395898_0045955 | Ga0395898_0045955_2076_3551 | 487 |
| 760 | 3300037466 | Ga0395898_0061837 | Ga0395898_0061837_1854_3332 | 487 |
| 761 | 3300037466 | Ga0395898_0067930 | Ga0395898_0067930_414_1895 | 487 |
| 762 | 3300037466 | Ga0395898_0070029 | Ga0395898_0070029_1265_2743 | 487 |
| 763 | 3300037466 | Ga0395898_0075486 | Ga0395898_0075486_670_2142 | 487 |
| 764 | 3300037466 | Ga0395898_0079117 | Ga0395898_0079117_1257_2735 | 487 |
| 765 | 3300037471 | Ga0395905_0000165 | Ga0395905_0000165_62774_64243 | 487 |
| 766 | 3300037471 | Ga0395905_0000287 | Ga0395905_0000287_70140_71633 | 487 |
| 767 | 3300037471 | Ga0395905_0001408 | Ga0395905_0001408_15896_17374 | 487 |
| 768 | 3300037471 | Ga0395905_0001429 | Ga0395905_0001429_12260_13738 | 487 |
| 769 | 3300037471 | Ga0395905_0003581 | Ga0395905_0003581_1313_2800 | 487 |
| 770 | 3300037471 | Ga0395905_0005698 | Ga0395905_0005698_6524_8002 | 487 |
| 771 | 3300037471 | Ga0395905_0006659 | Ga0395905_0006659_127_1605 | 487 |
| 772 | 3300037471 | Ga0395905_0006715 | Ga0395905_0006715_1198_2676 | 487 |
| 773 | 3300037471 | Ga0395905_0015997 | Ga0395905_0015997_2830_4308 | 487 |
| 774 | 3300037471 | Ga0395905_0020773 | Ga0395905_0020773_1837_3315 | 487 |
| 775 | 3300037471 | Ga0395905_0021508 | Ga0395905_0021508_4461_5927 | 487 |
| 776 | 3300037471 | Ga0395905_0023872 | Ga0395905_0023872_2186_3679 | 487 |
| 777 | 3300037471 | Ga0395905_0024929 | Ga0395905_0024929_4065_5543 | 487 |
| 778 | 3300037471 | Ga0395905_0042894 | Ga0395905_0042894_819_2297 | 487 |
| 779 | 3300037471 | Ga0395905_0048914 | Ga0395905_0048914_2426_3904 | 487 |
| 780 | 3300037471 | Ga0395905_0060357 | Ga0395905_0060357_1041_2522 | 487 |
| 781 | 3300037471 | Ga0395905_0067605 | Ga0395905_0067605_298_1776 | 487 |
| 782 | 3300037471 | Ga0395905_0077877 | Ga0395905_0077877_1159_2634 | 487 |
| 783 | 3300037471 | Ga0395905_0082270 | Ga0395905_0082270_950_2413 | 487 |
| 784 | 3300037471 | Ga0395905_0098434 | Ga0395905_0098434_836_2314 | 487 |
| 785 | 3300037471 | Ga0395905_0185166 | Ga0395905_0185166_163_1641 | 487 |
| 786 | 3300037853 | Ga0436364_1265496 | Ga0436364_1265496_61_1563 | 487 |
| 787 | 3300038443 | Ga0395901_0000030 | Ga0395901_0000030_129377_130852 | 487 |
| 788 | 3300038443 | Ga0395901_0004432 | Ga0395901_0004432_83_1561 | 487 |
| 789 | 3300038443 | Ga0395901_0005970 | Ga0395901_0005970_2849_4342 | 487 |
| 790 | 3300038443 | Ga0395901_0012772 | Ga0395901_0012772_6154_7632 | 487 |
| 791 | 3300038443 | Ga0395901_0019952 | Ga0395901_0019952_442_1929 | 487 |
| 792 | 3300038443 | Ga0395901_0023876 | Ga0395901_0023876_3010_4479 | 487 |
| 793 | 3300038443 | Ga0395901_0024647 | Ga0395901_0024647_2715_4208 | 487 |
| 794 | 3300038443 | Ga0395901_0053302 | Ga0395901_0053302_387_1865 | 487 |
| 795 | 3300038443 | Ga0395901_0066737 | Ga0395901_0066737_2082_3560 | 487 |
| 796 | 3300038443 | Ga0395901_0075085 | Ga0395901_0075085_491_1969 | 487 |
| 797 | 3300038443 | Ga0395901_0079078 | Ga0395901_0079078_290_1768 | 487 |
| 798 | 3300038443 | Ga0395901_0092319 | Ga0395901_0092319_1269_2747 | 487 |
| 799 | 3300038443 | Ga0395901_0115813 | Ga0395901_0115813_1135_2625 | 487 |
| 800 | 3300038443 | Ga0395901_0120109 | Ga0395901_0120109_647_2110 | 487 |
| 801 | 3300038443 | Ga0395901_0156287 | Ga0395901_0156287_879_2369 | 487 |
| 802 | 3300042157 | Ga0439458_0000668 | Ga0439458_0000668_2454_3932 | 487 |
| 803 | 3300042157 | Ga0439458_0000796 | Ga0439458_0000796_527_2005 | 487 |
| 804 | 3300042439 | Ga0439464_0000946 | Ga0439464_0000946_2060_3538 | 487 |
| 805 | 3300044656 | Ga0466969_0006087 | Ga0466969_0006087_3616_5088 | 487 |
| 806 | 3300044656 | Ga0466969_0027746 | Ga0466969_0027746_1106_2581 | 487 |
| 807 | 3300044658 | Ga0466972_0045216 | Ga0466972_0045216_310_1785 | 487 |
| 808 | 3300044684 | Ga0466966_0000709 | Ga0466966_0000709_16176_17654 | 487 |
| 809 | 3300044684 | Ga0466966_0005040 | Ga0466966_0005040_6651_8123 | 487 |
| 810 | 3300044684 | Ga0466966_0009822 | Ga0466966_0009822_3918_5393 | 487 |
| 811 | 3300044684 | Ga0466966_0014240 | Ga0466966_0014240_1702_3177 | 487 |
| 812 | 3300044693 | Ga0466961_0001728 | Ga0466961_0001728_2761_4233 | 487 |
| 813 | 3300044694 | Ga0466963_0029887 | Ga0466963_0029887_1818_3296 | 487 |
| 814 | 3300044694 | Ga0466963_0070474 | Ga0466963_0070474_678_2150 | 487 |
| 815 | 3300044719 | Ga0466971_0000339 | Ga0466971_0000339_2105_3577 | 487 |
| 816 | 3300044765 | Ga0466970_0003618 | Ga0466970_0003618_3698_5170 | 487 |
| 817 | 3300044765 | Ga0466970_0020876 | Ga0466970_0020876_374_1852 | 487 |
| 818 | 3300044842 | Ga0466957_0008392 | Ga0466957_0008392_4223_5695 | 487 |
| 819 | 3300045049 | Ga0466959_0017818 | Ga0466959_0017818_3680_5152 | 487 |
| 820 | 3300045836 | Ga0466958_0000054 | Ga0466958_0000054_12599_14071 | 487 |
| 821 | 3300045976 | Ga0466967_0010874 | Ga0466967_0010874_4057_5535 | 487 |
| 822 | 3300045976 | Ga0466967_0026271 | Ga0466967_0026271_442_1920 | 487 |
| 823 | 3300045976 | Ga0466967_0189952 | Ga0466967_0189952_353_1831 | 487 |
| 824 | 3300046537 | Ga0495598_0001515 | Ga0495598_0001515_2573_4048 | 487 |
| 825 | 3300046537 | Ga0495598_0002001 | Ga0495598_0002001_1656_3134 | 487 |
| 826 | 3300046539 | Ga0495621_0003177 | Ga0495621_0003177_2142_3620 | 487 |
| 827 | 3300046539 | Ga0495621_0015273 | Ga0495621_0015273_127_1602 | 487 |
| 828 | 3300046558 | Ga0495633_0001647 | Ga0495633_0001647_8617_10095 | 487 |
| 829 | 3300046679 | Ga0495623_0056334 | Ga0495623_0056334_344_1819 | 487 |
| 830 | 3300046684 | Ga0495669_0000293 | Ga0495669_0000293_23437_24906 | 487 |
| 831 | 3300046684 | Ga0495669_0002650 | Ga0495669_0002650_4025_5503 | 487 |
| 832 | 3300046684 | Ga0495669_0006355 | Ga0495669_0006355_562_2040 | 487 |
| 833 | 3300046684 | Ga0495669_0021682 | Ga0495669_0021682_918_2396 | 487 |
| 834 | 3300046691 | Ga0495670_0005527 | Ga0495670_0005527_4486_5964 | 487 |
| 835 | 3300046691 | Ga0495670_0026043 | Ga0495670_0026043_738_2213 | 487 |
| 836 | 3300048088 | Ga0495602_0014578 | Ga0495602_0014578_3767_5242 | 487 |
| 837 | 3300048903 | Ga0496100_0005041 | Ga0496100_0005041_3772_5247 | 487 |
| 838 | 3300048904 | Ga0496101_0208146 | Ga0496101_0208146_29_1504 | 487 |
| 839 | 3300048905 | Ga0496102_0077395 | Ga0496102_0077395_1230_2705 | 487 |
| 840 | 3300048908 | Ga0496105_0000481 | Ga0496105_0000481_17378_18892 | 487 |
| 841 | 3300048909 | Ga0496106_0014816 | Ga0496106_0014816_2474_3949 | 487 |
| 842 | 3300048909 | Ga0496106_0053256 | Ga0496106_0053256_88_1566 | 487 |
| 843 | 3300048910 | Ga0496107_0058599 | Ga0496107_0058599_822_2303 | 487 |
| 844 | 3300048910 | Ga0496107_0117944 | Ga0496107_0117944_32_1507 | 487 |
| 845 | 3300048911 | Ga0496108_0001272 | Ga0496108_0001272_1845_3314 | 487 |
| 846 | 3300048911 | Ga0496108_0008736 | Ga0496108_0008736_3412_4887 | 487 |
| 847 | 3300048911 | Ga0496108_0031252 | Ga0496108_0031252_567_2048 | 487 |
| 848 | 3300048912 | Ga0496109_0003815 | Ga0496109_0003815_861_2339 | 487 |
| 849 | 3300048912 | Ga0496109_0037089 | Ga0496109_0037089_2507_3982 | 487 |
| 850 | 3300048912 | Ga0496109_0059815 | Ga0496109_0059815_1847_3325 | 487 |
| 851 | 3300048912 | Ga0496109_0078167 | Ga0496109_0078167_1356_2831 | 487 |
| 852 | 3300048912 | Ga0496109_0109985 | Ga0496109_0109985_134_1609 | 487 |
| 853 | 3300048913 | Ga0496110_0001131 | Ga0496110_0001131_8511_9989 | 487 |
| 854 | 3300048913 | Ga0496110_0005464 | Ga0496110_0005464_7435_8910 | 487 |
| 855 | 3300048913 | Ga0496110_0019874 | Ga0496110_0019874_1693_3174 | 487 |
| 856 | 3300048913 | Ga0496110_0061837 | Ga0496110_0061837_1783_3258 | 487 |
| 857 | 3300048914 | Ga0496111_0002242 | Ga0496111_0002242_1106_2581 | 487 |
| 858 | 3300048914 | Ga0496111_0004595 | Ga0496111_0004595_422_1900 | 487 |
| 859 | 3300048914 | Ga0496111_0125961 | Ga0496111_0125961_385_1866 | 487 |
| 860 | 3300048915 | Ga0496112_0008275 | Ga0496112_0008275_1928_3409 | 487 |
| 861 | 3300048915 | Ga0496112_0091300 | Ga0496112_0091300_1118_2593 | 487 |
| 862 | 3300048915 | Ga0496112_0140527 | Ga0496112_0140527_855_2330 | 487 |
| 863 | 3300048916 | Ga0496113_0004166 | Ga0496113_0004166_6841_8322 | 487 |
| 864 | 3300048916 | Ga0496113_0084883 | Ga0496113_0084883_45_1520 | 487 |
| 865 | 3300048916 | Ga0496113_0182741 | Ga0496113_0182741_119_1597 | 487 |
| 866 | 3300048917 | Ga0496114_0000019 | Ga0496114_0000019_173198_174676 | 487 |
| 867 | 3300048917 | Ga0496114_0015261 | Ga0496114_0015261_1273_2754 | 487 |
| 868 | 3300048917 | Ga0496114_0041852 | Ga0496114_0041852_2022_3500 | 487 |
| 869 | 3300048918 | Ga0496115_0015645 | Ga0496115_0015645_2229_3707 | 487 |
| 870 | 3300048918 | Ga0496115_0026170 | Ga0496115_0026170_1894_3375 | 487 |
| 871 | 3300050489 | nmdc:mga03683_130_c1 | nmdc:mga03683_130_c1_18325_19824 | 487 |
| 872 | 3300050489 | nmdc:mga03683_8_c1 | nmdc:mga03683_8_c1_14570_16063 | 487 |
| 873 | 3300050490 | nmdc:mga03n38_704_c1 | nmdc:mga03n38_704_c1_7064_8557 | 487 |
| 874 | 3300050493 | nmdc:mga0k408_101712_c1 | nmdc:mga0k408_101712_c1_75_1574 | 487 |
| 875 | 3300050493 | nmdc:mga0k408_212_c1 | nmdc:mga0k408_212_c1_15591_17084 | 487 |
| 876 | 3300050494 | nmdc:mga06z11_8620_c1 | nmdc:mga06z11_8620_c1_183_1682 | 487 |
| 877 | 3300050495 | nmdc:mga04h51_548_c1 | nmdc:mga04h51_548_c1_5190_6689 | 487 |
| 878 | 3300050496 | nmdc:mga07m45_1249_c1 | nmdc:mga07m45_1249_c1_6234_7733 | 487 |
| 879 | 3300050515 | nmdc:mga0a205_1890_c1 | nmdc:mga0a205_1890_c1_12139_13617 | 487 |
| 880 | 3300050516 | nmdc:mga0sz30_2721_c1 | nmdc:mga0sz30_2721_c1_4566_6059 | 487 |
| 881 | 3300050516 | nmdc:mga0sz30_6989_c1 | nmdc:mga0sz30_6989_c1_2257_3756 | 487 |
| 882 | 3300053121 | Ga0500607_002050 | Ga0500607_002050_4899_6413 | 487 |
| 883 | 3300053136 | Ga0500559_0002752 | Ga0500559_0002752_4129_5643 | 487 |
| 884 | 3300053136 | Ga0500559_0004233 | Ga0500559_0004233_4284_5783 | 487 |
| 885 | 3300053730 | Ga0500645_004660 | Ga0500645_004660_428_1921 | 487 |
| 886 | 3300061719 | Ga0466962_0004642 | Ga0466962_0004642_4949_6439 | 487 |
| 887 | 3300061719 | Ga0466962_0008135 | Ga0466962_0008135_2338_3810 | 487 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4wj3-assembly2.cif.gz_H | crystal structure of the asparagine transamidosome from pseudomonas aeruginosa | 0.8537 | 13 | 413 |
| 3al0-assembly1.cif.gz_B | crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. | 0.8226 | 13 | 486 |
| 3h0l-assembly2.cif.gz_E | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.8165 | 13 | 423 |
| 3h0l-assembly2.cif.gz_E | structure of trna-dependent amidotransferase gatcab from aquifex aeolicus | 0.8111 | 13 | 423 |
| 3al0-assembly1.cif.gz_B | crystal structure of the glutamine transamidosome from thermotoga maritima in the glutamylation state. | 0.8088 | 13 | 486 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2R2Z0_480_542_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9992 | 426 | 486 | 1.10.10.410 |
| af_I1K5J4_480_543_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9983 | 426 | 486 | 1.10.10.410 |
| af_I1KQC8_485_546_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9976 | 426 | 487 | 1.10.10.410 |
| af_I1KQC8_485_546_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9818 | 426 | 487 | 1.10.10.410 |
| af_Q2FWZ0_412_475_1.10.10.410 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A; | 0.9709 | 426 | 486 | 1.10.10.410 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847H326-F1-model_v4 | Asn/Gln amidotransferase domain-containing protein | 0.9766 | 377 | 487 |
GO:0005524
GO:0006412 GO:0016884 |
| AF-A0A7C9CTH7-F1-model_v4 | Asn/Gln amidotransferase domain-containing protein | 0.9765 | 335 | 486 |
GO:0005524
GO:0006412 GO:0050567 GO:0070681 |
| AF-A0A1S3XTW9-F1-model_v4 | Glutamyl-tRNA(Gln) amidotransferase subunit B, chloroplastic/mitochondrial-like | 0.9744 | 372 | 486 |
GO:0005524
GO:0006412 GO:0016884 |
| AF-A0A521WPK4-F1-model_v4 | Asn/Gln amidotransferase domain-containing protein | 0.9739 | 361 | 486 |
GO:0005524
GO:0006412 GO:0050567 GO:0070681 |
| AF-A0A4Q2YL85-F1-model_v4 | Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase GatCAB subunit B (EC 6.3.5.-) | 0.9736 | 375 | 487 |
GO:0005524
GO:0006412 GO:0016740 GO:0050567 GO:0070681 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar