F484723

General Info

Members Datasets Scaffolds Average Seq Length
887 335 1774 308

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10116815|Ga0081455_101168152
Length 331
Sequence VRTSVAFPGESYGTLQAPDQGDPTIMGSLPIGYGVNATAAQTLGVYMTIANGGVTRPLRLVDGTLGSTHMALMLVSLVDGHIDEHLHSFETSFYVLDGEPVLYFEGRGVRLKPGACGAIPVGSPHAFRSEGAARWIEMMSPRPRVDRSDTFFLGPTPDSDPAQLDARDPRNHNLFLLTDGEMDLERLKQGQAMGAPTVSGSMATAVLAYSGIAVKMLVDQRLDAQLHTMFMVDYQPGACANPHDHPFEESYYMLEGEVDVVANGDRHTLRPGDAFWTATGCVHAFYETRGGTVRWLETSAPGPPPRHSYRHQRDWEYMAEHIASDAGVSAA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
171 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
175 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
176 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
177 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
180 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
186 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
205 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
228 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
229 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
230 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
234 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
235 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
236 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
242 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
243 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
244 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
245 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
246 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
247 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
252 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
253 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
254 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
255 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
256 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
259 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
260 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
261 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
262 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
263 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
264 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
265 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
266 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
267 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
299 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
301 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
302 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
303 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
304 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
305 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
306 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
307 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
308 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
309 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
310 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
311 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
312 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
313 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
314 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
315 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
334 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
335 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.56
Isolates 0.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 10.6
Rhizosphere 88.95
Stem 0
Stem Tuber 0
Unclassified 7.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10116815 3300005937 Bacteria 2109
2 Ga0070658_10076233 3300005327 Bacteria 2750
3 Ga0070658_10181174 3300005327 Bacteria 1773
4 Ga0070683_100001511 3300005329 Bacteria 17965
5 Ga0070683_100092440 3300005329 Bacteria 2842
6 Ga0070683_100093542 3300005329 Bacteria 2824
7 Ga0070683_100107201 3300005329 Bacteria 2634
8 Ga0070683_100176414 3300005329 Bacteria 2028
9 Ga0070670_100025282 3300005331 Bacteria 5109
10 Ga0068869_100013310 3300005334 Bacteria 5468
11 Ga0070680_100013567 3300005336 Bacteria 6352
12 Ga0070680_100018340 3300005336 Bacteria 5528
13 Ga0070680_100058287 3300005336 Bacteria 3158
14 Ga0070680_100171258 3300005336 Bacteria 1827
15 Ga0070680_100296921 3300005336 Bacteria 1370
16 Ga0070682_100013359 3300005337 Bacteria 4722
17 Ga0070682_100033577 3300005337 Bacteria 3119
18 Ga0070682_100162612 3300005337 Unclassified 1543
19 Ga0070682_100267374 3300005337 Unclassified 1240
20 Ga0068868_100012148 3300005338 Bacteria 6288
21 Ga0068868_100057126 3300005338 Bacteria 3083
22 Ga0070660_100006183 3300005339 Bacteria 8284
23 Ga0070660_100109775 3300005339 Bacteria 2193
24 Ga0070660_100196481 3300005339 Bacteria 1635
25 Ga0070660_100305946 3300005339 Bacteria 1304
26 Ga0070689_100026358 3300005340 Bacteria 4376
27 Ga0070691_10005579 3300005341 Bacteria 5728
28 Ga0070687_100101658 3300005343 Bacteria 1610
29 Ga0070661_100014164 3300005344 Bacteria 5616
30 Ga0070661_100076047 3300005344 Bacteria 2475
31 Ga0070692_10019780 3300005345 Bacteria 3255
32 Ga0070668_100184108 3300005347 Bacteria 1708
33 Ga0070675_100074143 3300005354 Bacteria 2826
34 Ga0070675_100237441 3300005354 Bacteria 1592
35 Ga0070675_100356117 3300005354 Bacteria 1299
36 Ga0070675_100372033 3300005354 Bacteria 1270
37 Ga0070674_100011737 3300005356 Bacteria 5345
38 Ga0070674_100038298 3300005356 Bacteria 3230
39 Ga0070674_100079232 3300005356 Bacteria 2343
40 Ga0070673_100012976 3300005364 Bacteria 5744
41 Ga0070673_100236738 3300005364 Bacteria 1586
42 Ga0070673_100387681 3300005364 Bacteria 1247
43 Ga0070688_100005327 3300005365 Bacteria 6760
44 Ga0070688_100060649 3300005365 Bacteria 2389
45 Ga0070688_100215763 3300005365 Bacteria 1350
46 Ga0070659_100072561 3300005366 Bacteria 2739
47 Ga0070659_100087129 3300005366 Bacteria 2499
48 Ga0070659_100103273 3300005366 Bacteria 2296
49 Ga0070659_100180007 3300005366 Bacteria 1735
50 Ga0070659_100417348 3300005366 Unclassified 1134
51 Ga0070667_100007322 3300005367 Bacteria 9171
52 Ga0070667_100433297 3300005367 Bacteria 1200
53 Ga0070709_10155006 3300005434 Bacteria 1587
54 Ga0070714_100063737 3300005435 Bacteria 3170
55 Ga0070714_100374176 3300005435 Bacteria 1342
56 Ga0070710_10066403 3300005437 Bacteria 2068
57 Ga0070701_10020847 3300005438 Bacteria 3118
58 Ga0070701_10264977 3300005438 Bacteria 1043
59 Ga0070711_100129269 3300005439 Bacteria 1879
60 Ga0070705_100003518 3300005440 Bacteria 7666
61 Ga0070700_100086887 3300005441 Bacteria 2031
62 Ga0070700_100272505 3300005441 Bacteria 1223
63 Ga0070694_100145112 3300005444 Bacteria 1728
64 Ga0070694_100200330 3300005444 Bacteria 1488
65 Ga0070663_100011213 3300005455 Bacteria 5615
66 Ga0070663_100270500 3300005455 Bacteria 1351
67 Ga0070678_100000994 3300005456 Bacteria 14674
68 Ga0070678_100015365 3300005456 Bacteria 4864
69 Ga0070678_100049869 3300005456 Bacteria 3024
70 Ga0070678_100053407 3300005456 Unclassified 2938
71 Ga0070678_100448376 3300005456 Bacteria 1130
72 Ga0070681_10025719 3300005458 Bacteria 5919
73 Ga0070681_10075782 3300005458 Unclassified 3324
74 Ga0070681_10078133 3300005458 Bacteria 3266
75 Ga0070681_10096947 3300005458 Bacteria 2896
76 Ga0068867_100210615 3300005459 Bacteria 1561
77 Ga0070685_10022590 3300005466 Bacteria 3431
78 Ga0070706_100057572 3300005467 Bacteria 3587
79 Ga0070698_100044298 3300005471 Bacteria 4558
80 Ga0070698_100291796 3300005471 Bacteria 1562
81 Ga0070679_100029799 3300005530 Bacteria 5384
82 Ga0070679_100066431 3300005530 Bacteria 3595
83 Ga0070679_100089042 3300005530 Unclassified 3073
84 Ga0070679_100102811 3300005530 Bacteria 2843
85 Ga0070679_100508984 3300005530 Bacteria 1148
86 Ga0070684_100008159 3300005535 Bacteria 8176
87 Ga0070684_100010835 3300005535 Bacteria 7241
88 Ga0070684_100032010 3300005535 Bacteria 4480
89 Ga0070684_100032864 3300005535 Bacteria 4427
90 Ga0070684_100035945 3300005535 Bacteria 4243
91 Ga0070684_100057553 3300005535 Bacteria 3394
92 Ga0070684_100262651 3300005535 Bacteria 1579
93 Ga0068853_100061002 3300005539 Bacteria 3261
94 Ga0070672_100025047 3300005543 Bacteria 4420
95 Ga0070672_100026949 3300005543 Bacteria 4284
96 Ga0070672_100039502 3300005543 Bacteria 3615
97 Ga0070672_100059327 3300005543 Bacteria 3010
98 Ga0070686_100026834 3300005544 Bacteria 3480
99 Ga0070686_100029109 3300005544 Bacteria 3356
100 Ga0070696_100021618 3300005546 Bacteria 4363
101 Ga0070696_100044154 3300005546 Bacteria 3086
102 Ga0070693_100037363 3300005547 Bacteria 2707
103 Ga0070693_100170913 3300005547 Bacteria 1392
104 Ga0070665_100004920 3300005548 Bacteria 13860
105 Ga0070704_100023436 3300005549 Bacteria 4032
106 Ga0070704_100071693 3300005549 Unclassified 2518
107 Ga0070704_100245639 3300005549 Bacteria 1467
108 Ga0068855_100029046 3300005563 Bacteria 6613
109 Ga0068855_100110665 3300005563 Bacteria 3153
110 Ga0068855_100343079 3300005563 Bacteria 1646
111 Ga0068855_100456949 3300005563 Bacteria 1393
112 Ga0070664_100154101 3300005564 Bacteria 2029
113 Ga0068857_100019377 3300005577 Bacteria 5973
114 Ga0068857_100151545 3300005577 Bacteria 2101
115 Ga0068854_100083829 3300005578 Bacteria 2357
116 Ga0068856_100006059 3300005614 Bacteria 11883
117 Ga0068856_100078434 3300005614 Bacteria 3274
118 Ga0068856_100084892 3300005614 Bacteria 3146
119 Ga0068856_100114058 3300005614 Bacteria 2701
120 Ga0068856_100380344 3300005614 Unclassified 1431
121 Ga0070702_100001248 3300005615 Bacteria 10318
122 Ga0068852_100262228 3300005616 Bacteria 1659
123 Ga0068852_100272389 3300005616 Bacteria 1629
124 Ga0068852_100408045 3300005616 Bacteria 1338
125 Ga0068859_100187523 3300005617 Bacteria 2152
126 Ga0068859_100240480 3300005617 Bacteria 1899
127 Ga0068864_100310433 3300005618 Unclassified 1478
128 Ga0068866_10080690 3300005718 Unclassified 1746
129 Ga0068866_10100199 3300005718 Bacteria 1597
130 Ga0068861_100031844 3300005719 Bacteria 3878
131 Ga0068861_100186435 3300005719 Bacteria 1731
132 Ga0068861_100202348 3300005719 Unclassified 1668
133 Ga0068851_10017806 3300005834 Bacteria 3418
134 Ga0068870_10022120 3300005840 Bacteria 3121
135 Ga0068870_10028295 3300005840 Bacteria 2813
136 Ga0068870_10156408 3300005840 Bacteria 1348
137 Ga0068860_100009233 3300005843 Bacteria 9802
138 Ga0068860_100073582 3300005843 Bacteria 3248
139 Ga0068860_100600383 3300005843 Bacteria 1106
140 Ga0068862_100181001 3300005844 Bacteria 1892
141 Ga0081455_10008878 3300005937 Bacteria 10394
142 Ga0081455_10011995 3300005937 Bacteria 8672
143 Ga0081455_10020170 3300005937 Bacteria 6288
144 Ga0081540_1004204 3300005983 Bacteria 11064
145 Ga0081540_1019924 3300005983 Bacteria 4054
146 Ga0070717_10002940 3300006028 Bacteria 12103
147 Ga0070717_10016455 3300006028 Bacteria 5734
148 Ga0075432_10001987 3300006058 Bacteria 6795
149 Ga0070715_10011274 3300006163 Bacteria 3215
150 Ga0070716_100272845 3300006173 Bacteria 1163
151 Ga0070712_100027127 3300006175 Bacteria 3822
152 Ga0070712_100043402 3300006175 Bacteria 3095
153 Ga0097621_100028225 3300006237 Bacteria 4422
154 Ga0097621_100258788 3300006237 Bacteria 1526
155 Ga0075370_10032801 3300006353 Bacteria 2905
156 Ga0068871_100006072 3300006358 Bacteria 8500
157 Ga0075428_100000211 3300006844 Bacteria 56062
158 Ga0075428_100001472 3300006844 Bacteria 25194
159 Ga0075428_100297963 3300006844 Unclassified 1734
160 Ga0075428_100540641 3300006844 Bacteria 1246
161 Ga0075433_10012759 3300006852 Bacteria 6803
162 Ga0075433_10305536 3300006852 Bacteria 1408
163 Ga0075434_100237257 3300006871 Bacteria 1843
164 Ga0075429_100005341 3300006880 Bacteria 11052
165 Ga0075429_100183184 3300006880 Bacteria 1835
166 Ga0068865_100013452 3300006881 Bacteria 5171
167 Ga0068865_100015100 3300006881 Bacteria 4920
168 Ga0068865_100181824 3300006881 Bacteria 1620
169 Ga0097620_100187522 3300006931 Bacteria 2152
170 Ga0097620_100240495 3300006931 Bacteria 1899
171 Ga0075435_100007124 3300007076 Bacteria 7943
172 Ga0105240_10154991 3300009093 Bacteria 2725
173 Ga0105240_10160060 3300009093 Bacteria 2675
174 Ga0105240_10291224 3300009093 Bacteria 1871
175 Ga0105240_10377992 3300009093 Unclassified 1600
176 Ga0111539_10003281 3300009094 Bacteria 21391
177 Ga0111539_10072396 3300009094 Bacteria 4064
178 Ga0111539_10103504 3300009094 Bacteria 3341
179 Ga0111539_10195746 3300009094 Bacteria 2358
180 Ga0111539_10241429 3300009094 Bacteria 2103
181 Ga0111539_10302662 3300009094 Bacteria 1861
182 Ga0105245_10001672 3300009098 Bacteria 20188
183 Ga0105245_10006039 3300009098 Bacteria 10648
184 Ga0105245_10029684 3300009098 Bacteria 4834
185 Ga0105245_10082162 3300009098 Bacteria 2947
186 Ga0105245_10110460 3300009098 Bacteria 2556
187 Ga0105245_10164739 3300009098 Bacteria 2106
188 Ga0105245_10170744 3300009098 Bacteria 2071
189 Ga0105245_10241557 3300009098 Bacteria 1751
190 Ga0105245_10292019 3300009098 Bacteria 1597
191 Ga0105245_10397160 3300009098 Bacteria 1377
192 Ga0105245_10675696 3300009098 Bacteria 1064
193 Ga0105247_10006987 3300009101 Bacteria 6947
194 Ga0105247_10031086 3300009101 Bacteria 3239
195 Ga0114129_10002058 3300009147 Bacteria 27627
196 Ga0114129_10014359 3300009147 Bacteria 11289
197 Ga0114129_10062127 3300009147 Bacteria 5219
198 Ga0105243_10004171 3300009148 Bacteria 11463
199 Ga0105243_10013258 3300009148 Bacteria 6233
200 Ga0105243_10020248 3300009148 Bacteria 5045
201 Ga0105243_10022730 3300009148 Bacteria 4768
202 Ga0105243_10244705 3300009148 Bacteria 1598
203 Ga0105243_10597865 3300009148 Bacteria 1062
204 Ga0105241_10017128 3300009174 Bacteria 5321
205 Ga0105241_10110414 3300009174 Bacteria 2200
206 Ga0105241_10114021 3300009174 Bacteria 2167
207 Ga0105242_10008815 3300009176 Bacteria 7739
208 Ga0105242_10186334 3300009176 Bacteria 1834
209 Ga0105242_10507503 3300009176 Unclassified 1148
210 Ga0105248_10017461 3300009177 Bacteria 7912
211 Ga0105248_10170081 3300009177 Bacteria 2456
212 Ga0105248_10492822 3300009177 Bacteria 1381
213 Ga0105237_10101507 3300009545 Bacteria 2869
214 Ga0105238_10010169 3300009551 Bacteria 9437
215 Ga0105238_10046758 3300009551 Bacteria 4365
216 Ga0105238_10125091 3300009551 Bacteria 2551
217 Ga0105249_10010169 3300009553 Bacteria 8262
218 Ga0105249_10102276 3300009553 Bacteria 2696
219 Ga0105239_10031419 3300010375 Bacteria 5840
220 Ga0105239_10054676 3300010375 Bacteria 4379
221 Ga0105239_10319808 3300010375 Bacteria 1750
222 Ga0105246_10042671 3300011119 Bacteria 3072
223 Ga0105246_10073261 3300011119 Bacteria 2417
224 Ga0105246_10163486 3300011119 Bacteria 1698
225 Ga0105246_10180281 3300011119 Bacteria 1626
226 Ga0157373_10104342 3300013100 Bacteria 1994
227 Ga0157371_10090213 3300013102 Bacteria 2171
228 Ga0157370_10022377 3300013104 Bacteria 6289
229 Ga0157370_10026174 3300013104 Bacteria 5762
230 Ga0157370_10033161 3300013104 Bacteria 5035
231 Ga0157370_10054870 3300013104 Bacteria 3798
232 Ga0157369_10017118 3300013105 Bacteria 8145
233 Ga0157369_10022942 3300013105 Bacteria 6960
234 Ga0157369_10220950 3300013105 Bacteria 1983
235 Ga0157369_10225011 3300013105 Bacteria 1963
236 Ga0157369_10372889 3300013105 Bacteria 1481
237 Ga0157374_10026077 3300013296 Bacteria 5255
238 Ga0157374_10076623 3300013296 Bacteria 3162
239 Ga0157374_10275298 3300013296 Bacteria 1660
240 Ga0157374_10341577 3300013296 Bacteria 1486
241 Ga0157374_10660026 3300013296 Bacteria 1058
242 Ga0157378_10017333 3300013297 Bacteria 6319
243 Ga0163162_10008756 3300013306 Bacteria 9844
244 Ga0163162_10188599 3300013306 Bacteria 2189
245 Ga0157372_10011088 3300013307 Bacteria 9588
246 Ga0157372_10043786 3300013307 Bacteria 4958
247 Ga0157372_10240480 3300013307 Bacteria 2101
248 Ga0157372_10342294 3300013307 Bacteria 1742
249 Ga0157372_10536835 3300013307 Unclassified 1363
250 Ga0157372_10782626 3300013307 Bacteria 1109
251 Ga0157375_10023433 3300013308 Bacteria 5696
252 Ga0157375_10059076 3300013308 Bacteria 3797
253 Ga0157375_10062507 3300013308 Bacteria 3700
254 Ga0157375_10442499 3300013308 Bacteria 1465
255 Ga0163163_10039202 3300014325 Bacteria 4622
256 Ga0163163_10090670 3300014325 Bacteria 3070
257 Ga0157380_10240770 3300014326 Bacteria 1631
258 Ga0157380_10502705 3300014326 Bacteria 1178
259 Ga0182008_10003683 3300014497 Bacteria 9148
260 Ga0182008_10153664 3300014497 Bacteria 1155
261 Ga0157377_10006166 3300014745 Bacteria 5697
262 Ga0157377_10035532 3300014745 Bacteria 2734
263 Ga0157377_10123251 3300014745 Bacteria 1573
264 Ga0157379_10005788 3300014968 Bacteria 10641
265 Ga0157376_10006519 3300014969 Bacteria 8252
266 Ga0157376_10115771 3300014969 Bacteria 2367
267 Ga0157376_10135635 3300014969 Bacteria 2202
268 Ga0157376_10368150 3300014969 Bacteria 1380
269 Ga0182006_1028239 3300015261 Bacteria 2283
270 Ga0163161_10185366 3300017792 Bacteria 1597
271 Ga0206354_10152404 3300020081 Bacteria 1245
272 Ga0206354_11376887 3300020081 Bacteria 1861
273 Ga0206353_10290895 3300020082 Bacteria 2239
274 Ga0206353_10835708 3300020082 Bacteria 3039
275 Ga0224712_10077945 3300022467 Unclassified 1361
276 Ga0207692_10009347 3300025898 Bacteria 4090
277 Ga0207692_10091408 3300025898 Bacteria 1651
278 Ga0207688_10009635 3300025901 Bacteria 5260
279 Ga0207688_10114845 3300025901 Bacteria 1566
280 Ga0207685_10006858 3300025905 Bacteria 3134
281 Ga0207699_10254154 3300025906 Bacteria 1212
282 Ga0207645_10054967 3300025907 Bacteria 2542
283 Ga0207643_10003002 3300025908 Bacteria 9098
284 Ga0207643_10029234 3300025908 Bacteria 3065
285 Ga0207643_10034512 3300025908 Bacteria 2834
286 Ga0207705_10016247 3300025909 Bacteria 5337
287 Ga0207705_10130907 3300025909 Bacteria 1867
288 Ga0207684_10071765 3300025910 Bacteria 2941
289 Ga0207654_10017694 3300025911 Bacteria 3731
290 Ga0207695_10321502 3300025913 Bacteria 1437
291 Ga0207671_10136865 3300025914 Bacteria 1884
292 Ga0207693_10000919 3300025915 Bacteria 26430
293 Ga0207693_10037360 3300025915 Bacteria 3828
294 Ga0207693_10056444 3300025915 Bacteria 3079
295 Ga0207693_10057330 3300025915 Bacteria 3053
296 Ga0207693_10092213 3300025915 Bacteria 2374
297 Ga0207663_10023698 3300025916 Bacteria 3526
298 Ga0207663_10283008 3300025916 Unclassified 1232
299 Ga0207660_10022675 3300025917 Bacteria 4232
300 Ga0207660_10032251 3300025917 Bacteria 3615
301 Ga0207662_10017719 3300025918 Bacteria 4032
302 Ga0207657_10005718 3300025919 Bacteria 12973
303 Ga0207657_10008090 3300025919 Bacteria 10721
304 Ga0207657_10020451 3300025919 Bacteria 6254
305 Ga0207657_10074418 3300025919 Bacteria 2868
306 Ga0207657_10221440 3300025919 Unclassified 1516
307 Ga0207649_10077221 3300025920 Unclassified 2145
308 Ga0207649_10165416 3300025920 Bacteria 1536
309 Ga0207652_10008696 3300025921 Bacteria 8175
310 Ga0207652_10047664 3300025921 Bacteria 3661
311 Ga0207652_10191680 3300025921 Bacteria 1839
312 Ga0207652_10414841 3300025921 Bacteria 1214
313 Ga0207646_10167050 3300025922 Bacteria 1987
314 Ga0207681_10156803 3300025923 Bacteria 1712
315 Ga0207650_10016445 3300025925 Bacteria 5171
316 Ga0207650_10088839 3300025925 Bacteria 2357
317 Ga0207659_10052897 3300025926 Bacteria 2895
318 Ga0207659_10206227 3300025926 Bacteria 1573
319 Ga0207659_10325964 3300025926 Bacteria 1268
320 Ga0207687_10002244 3300025927 Bacteria 13162
321 Ga0207687_10021313 3300025927 Bacteria 4305
322 Ga0207687_10426966 3300025927 Bacteria 1095
323 Ga0207700_10092550 3300025928 Bacteria 2390
324 Ga0207664_10014782 3300025929 Bacteria 5650
325 Ga0207664_10042768 3300025929 Bacteria 3539
326 Ga0207664_10094015 3300025929 Bacteria 2463
327 Ga0207664_10304207 3300025929 Bacteria 1403
328 Ga0207664_10341110 3300025929 Unclassified 1325
329 Ga0207690_10021370 3300025932 Bacteria 4013
330 Ga0207690_10138948 3300025932 Bacteria 1788
331 Ga0207706_10012502 3300025933 Bacteria 7732
332 Ga0207686_10004653 3300025934 Bacteria 7352
333 Ga0207686_10048505 3300025934 Bacteria 2631
334 Ga0207709_10018813 3300025935 Bacteria 3874
335 Ga0207709_10025212 3300025935 Bacteria 3403
336 Ga0207709_10149945 3300025935 Bacteria 1614
337 Ga0207709_10203327 3300025935 Bacteria 1416
338 Ga0207670_10258609 3300025936 Unclassified 1348
339 Ga0207669_10103895 3300025937 Unclassified 1886
340 Ga0207669_10173171 3300025937 Bacteria 1539
341 Ga0207704_10060366 3300025938 Bacteria 2346
342 Ga0207704_10202757 3300025938 Bacteria 1453
343 Ga0207665_10000603 3300025939 Bacteria 24124
344 Ga0207665_10345045 3300025939 Unclassified 1123
345 Ga0207691_10009210 3300025940 Bacteria 9476
346 Ga0207691_10039180 3300025940 Bacteria 4384
347 Ga0207691_10059619 3300025940 Bacteria 3470
348 Ga0207711_10110490 3300025941 Bacteria 2444
349 Ga0207689_10026647 3300025942 Bacteria 4842
350 Ga0207661_10000463 3300025944 Bacteria 26200
351 Ga0207661_10124436 3300025944 Unclassified 2200
352 Ga0207661_10152477 3300025944 Bacteria 1998
353 Ga0207661_10203623 3300025944 Bacteria 1741
354 Ga0207661_10221511 3300025944 Bacteria 1672
355 Ga0207661_10248871 3300025944 Bacteria 1579
356 Ga0207661_10266690 3300025944 Bacteria 1527
357 Ga0207661_10495324 3300025944 Bacteria 1116
358 Ga0207679_10116931 3300025945 Bacteria 2115
359 Ga0207679_10148461 3300025945 Bacteria 1905
360 Ga0207679_10280734 3300025945 Bacteria 1428
361 Ga0207667_10305153 3300025949 Bacteria 1626
362 Ga0207667_10394436 3300025949 Bacteria 1409
363 Ga0207651_10109468 3300025960 Bacteria 2070
364 Ga0207651_10327181 3300025960 Bacteria 1283
365 Ga0207640_10043944 3300025981 Bacteria 2859
366 Ga0207658_10010769 3300025986 Bacteria 6221
367 Ga0207658_10350864 3300025986 Unclassified 1285
368 Ga0207639_10364946 3300026041 Bacteria 1293
369 Ga0207678_10008989 3300026067 Bacteria 8792
370 Ga0207678_10021648 3300026067 Bacteria 5638
371 Ga0207678_10031027 3300026067 Bacteria 4664
372 Ga0207678_10163303 3300026067 Bacteria 1902
373 Ga0207678_10270707 3300026067 Bacteria 1456
374 Ga0207708_10021885 3300026075 Bacteria 4824
375 Ga0207708_10052203 3300026075 Bacteria 3114
376 Ga0207708_10178681 3300026075 Unclassified 1684
377 Ga0207702_10015391 3300026078 Bacteria 6339
378 Ga0207702_10028487 3300026078 Bacteria 4643
379 Ga0207702_10058258 3300026078 Bacteria 3287
380 Ga0207702_10137960 3300026078 Bacteria 2203
381 Ga0207641_10352200 3300026088 Bacteria 1404
382 Ga0207648_10043497 3300026089 Bacteria 3942
383 Ga0207648_10118497 3300026089 Bacteria 2327
384 Ga0207676_10572720 3300026095 Unclassified 1081
385 Ga0207674_10028849 3300026116 Bacteria 5850
386 Ga0207674_10117157 3300026116 Bacteria 2634
387 Ga0207674_10173072 3300026116 Bacteria 2112
388 Ga0207674_10190368 3300026116 Bacteria 2001
389 Ga0207674_10214023 3300026116 Bacteria 1876
390 Ga0207675_100001496 3300026118 Bacteria 23416
391 Ga0207675_100083606 3300026118 Bacteria 2994
392 Ga0207675_100309253 3300026118 Bacteria 1541
393 Ga0207683_10002515 3300026121 Bacteria 16003
394 Ga0207683_10004769 3300026121 Bacteria 11676
395 Ga0207683_10028730 3300026121 Bacteria 4810
396 Ga0207683_10060153 3300026121 Bacteria 3339
397 Ga0207683_10106557 3300026121 Bacteria 2507
398 Ga0207683_10198294 3300026121 Bacteria 1824
399 Ga0207683_10264401 3300026121 Bacteria 1571
400 Ga0207698_10385298 3300026142 Bacteria 1335
401 Ga0207698_10419970 3300026142 Bacteria 1283
402 Ga0207428_10000315 3300027907 Bacteria 63531
403 Ga0207428_10070484 3300027907 Bacteria 2747
404 Ga0207428_10125946 3300027907 Bacteria 1962
405 Ga0207428_10219666 3300027907 Bacteria 1425
406 Ga0268266_10047771 3300028379 Bacteria 3668
407 Ga0268266_10073210 3300028379 Bacteria 2973
408 Ga0265319_1004366 3300028563 Bacteria 7009
409 Ga0265318_10019213 3300028577 Bacteria 2773
410 Ga0265322_10013754 3300028654 Bacteria 2343
411 Ga0265338_10015737 3300028800 Bacteria 8285
412 Ga0265338_10065827 3300028800 Bacteria 3140
413 Ga0265338_10098097 3300028800 Bacteria 2398
414 Ga0265338_10117088 3300028800 Unclassified 2133
415 Ga0265338_10137691 3300028800 Bacteria 1916
416 Ga0265330_10063643 3300031235 Bacteria 1603
417 Ga0265332_10023968 3300031238 Bacteria 2689
418 Ga0265320_10050370 3300031240 Bacteria 2024
419 Ga0265325_10044993 3300031241 Bacteria 2295
420 Ga0265340_10042406 3300031247 Bacteria 2234
421 Ga0265339_10007410 3300031249 Bacteria 7094
422 Ga0265331_10059062 3300031250 Bacteria 1814
423 Ga0265331_10113581 3300031250 Bacteria 1241
424 Ga0265316_10020436 3300031344 Bacteria 5634
425 Ga0265313_10026781 3300031595 Bacteria 3030
426 Ga0265314_10006777 3300031711 Bacteria 10049
427 Ga0265314_10050555 3300031711 Bacteria 2902
428 Ga0265342_10031976 3300031712 Bacteria 3248
429 Ga0307410_10408239 3300031852 Unclassified 1099
430 Ga0307406_10161587 3300031901 Bacteria 1611
431 Ga0307409_100134476 3300031995 Bacteria 2119
432 Ga0307415_100046294 3300032126 Bacteria 2921
433 Ga0316583_10018819 3300032133 Bacteria 2481
434 Ga0373930_0014340 3300034816 Bacteria 1475
435 Ga0373929_0018991 3300035085 Bacteria 1372
436 Ga0373939_0025347 3300035114 Bacteria 1662
437 Ga0373946_0051029 3300035171 Bacteria 1730
438 Ga0373955_0102617 3300035172 Bacteria 1644
439 Ga0373942_0007075 3300035207 Bacteria 2595
440 Ga0373962_0021804 3300035242 Bacteria 1693
441 Ga0373962_0081365 3300035242 Unclassified 984
442 Ga0373931_0027133 3300035691 Bacteria 2920
443 Ga0373935_0035974 3300035692 Bacteria 3093
444 Ga0373935_0100154 3300035692 Bacteria 1909
445 Ga0373935_0182079 3300035692 Bacteria 1443
446 Ga0373927_0006434 3300035695 Bacteria 8004
447 Ga0373947_0049242 3300035725 Bacteria 2529
448 Ga0373937_0001462 3300036401 Bacteria 19776
449 Ga0373937_0013260 3300036401 Bacteria 7259
450 Ga0373937_0073725 3300036401 Bacteria 3149
451 Ga0373937_0715789 3300036401 Bacteria 948
452 Ga0373925_0016109 3300037068 Bacteria 5413
453 Ga0373925_0050590 3300037068 Unclassified 3099
454 Ga0373925_0188903 3300037068 Bacteria 1634
455 Ga0395900_0088362 3300037418 Bacteria 3186
456 Ga0395900_0151455 3300037418 Unclassified 2369
457 Ga0395898_0027962 3300037466 Bacteria 5655
458 Ga0395898_0056257 3300037466 Bacteria 3835
459 Ga0395898_0087418 3300037466 Bacteria 3002
460 Ga0395898_0230316 3300037466 Bacteria 1767
461 Ga0395898_0289599 3300037466 Bacteria 1562
462 Ga0395905_0048403 3300037471 Bacteria 3984
463 Ga0395901_0009918 3300038443 Bacteria 9655
464 Ga0395901_0047081 3300038443 Bacteria 4478
465 Ga0395901_0127304 3300038443 Bacteria 2676
466 Ga0395901_0180943 3300038443 Bacteria 2211
467 Ga0395901_0484025 3300038443 Unclassified 1262
468 Ga0395901_0580517 3300038443 Bacteria 1132
469 Ga0439448_0069147 3300042005 Unclassified 1175
470 Ga0450920_001235 3300042122 Bacteria 4198
471 Ga0450923_042774 3300042125 Unclassified 956
472 Ga0450906_006760 3300042145 Bacteria 2296
473 Ga0439458_0005864 3300042157 Bacteria 2752
474 Ga0439459_0021336 3300042438 Bacteria 1243
475 Ga0466969_0075969 3300044656 Bacteria 1609
476 Ga0466965_0048264 3300044683 Bacteria 2109
477 Ga0466966_0093580 3300044684 Bacteria 1863
478 Ga0466961_0009894 3300044693 Bacteria 6077
479 Ga0466961_0017102 3300044693 Bacteria 4657
480 Ga0466961_0046450 3300044693 Bacteria 2777
481 Ga0466963_0000205 3300044694 Bacteria 25099
482 Ga0466963_0001336 3300044694 Bacteria 13143
483 Ga0466963_0003667 3300044694 Bacteria 8837
484 Ga0466963_0004431 3300044694 Bacteria 8159
485 Ga0466963_0023517 3300044694 Bacteria 3914
486 Ga0466963_0047499 3300044694 Bacteria 2833
487 Ga0466963_0073009 3300044694 Bacteria 2312
488 Ga0466963_0086263 3300044694 Bacteria 2133
489 Ga0466964_0002840 3300044706 Bacteria 6244
490 Ga0466964_0012332 3300044706 Bacteria 3234
491 Ga0466964_0021517 3300044706 Bacteria 2495
492 Ga0466964_0030843 3300044706 Bacteria 2124
493 Ga0466964_0053489 3300044706 Bacteria 1662
494 Ga0466971_0002531 3300044719 Bacteria 7726
495 Ga0466971_0010508 3300044719 Bacteria 4047
496 Ga0466957_0000280 3300044842 Bacteria 24823
497 Ga0466957_0030847 3300044842 Bacteria 3201
498 Ga0466957_0120445 3300044842 Bacteria 1672
499 Ga0466959_0014713 3300045049 Bacteria 5695
500 Ga0466959_0079467 3300045049 Bacteria 2364
501 Ga0451576_0039636 3300045051 Bacteria 4986
502 Ga0451576_0135991 3300045051 Bacteria 2563
503 Ga0451576_0430452 3300045051 Bacteria 1385
504 Ga0466958_0012132 3300045836 Bacteria 4871
505 Ga0466958_0034792 3300045836 Bacteria 3007
506 Ga0466958_0083071 3300045836 Bacteria 1974
507 Ga0466958_0125774 3300045836 Bacteria 1607
508 Ga0466967_0004529 3300045976 Bacteria 9400
509 Ga0466967_0005434 3300045976 Bacteria 8833
510 Ga0466967_0013824 3300045976 Bacteria 6258
511 Ga0466967_0016123 3300045976 Bacteria 5881
512 Ga0466967_0026731 3300045976 Bacteria 4787
513 Ga0466967_0051112 3300045976 Bacteria 3621
514 Ga0466967_0073437 3300045976 Bacteria 3069
515 Ga0466967_0093798 3300045976 Bacteria 2732
516 Ga0466967_0121901 3300045976 Bacteria 2410
517 Ga0466967_0184283 3300045976 Bacteria 1970
518 Ga0466967_0221367 3300045976 Bacteria 1798
519 Ga0466967_0344136 3300045976 Bacteria 1442
520 Ga0495592_0000207 3300046454 Bacteria 50220
521 Ga0495592_0141323 3300046454 Unclassified 1674
522 Ga0495603_0000445 3300046455 Bacteria 22677
523 Ga0495603_0051865 3300046455 Bacteria 2436
524 Ga0495603_0059720 3300046455 Bacteria 2254
525 Ga0495603_0098158 3300046455 Bacteria 1711
526 Ga0495629_0003295 3300046459 Bacteria 12198
527 Ga0495629_0050293 3300046459 Bacteria 2919
528 Ga0495629_0333112 3300046459 Bacteria 1037
529 Ga0495641_0004373 3300046461 Bacteria 10014
530 Ga0495641_0082627 3300046461 Bacteria 1438
531 Ga0495651_0000106 3300046462 Bacteria 61363
532 Ga0495651_0065641 3300046462 Bacteria 2771
533 Ga0495653_0000290 3300046463 Bacteria 40612
534 Ga0495653_0008918 3300046463 Bacteria 8201
535 Ga0495653_0068050 3300046463 Bacteria 2672
536 Ga0495653_0092294 3300046463 Bacteria 2211
537 Ga0495582_0000516 3300046473 Bacteria 21253
538 Ga0495582_0007912 3300046473 Bacteria 5875
539 Ga0495582_0040172 3300046473 Bacteria 2576
540 Ga0495582_0059933 3300046473 Bacteria 2100
541 Ga0495639_0001552 3300046475 Bacteria 10257
542 Ga0495639_0105458 3300046475 Unclassified 1334
543 Ga0495662_0013779 3300046476 Bacteria 3936
544 Ga0495664_0111167 3300046477 Bacteria 1654
545 Ga0495584_0048069 3300046491 Bacteria 2152
546 Ga0495584_0066228 3300046491 Bacteria 1817
547 Ga0495594_0061877 3300046499 Bacteria 2072
548 Ga0495596_0025578 3300046500 Bacteria 2386
549 Ga0495607_0153390 3300046501 Bacteria 1177
550 Ga0495608_0001216 3300046511 Bacteria 18231
551 Ga0495608_0048246 3300046511 Bacteria 2830
552 Ga0495618_0000561 3300046514 Bacteria 26461
553 Ga0495618_0014856 3300046514 Bacteria 4750
554 Ga0495618_0017961 3300046514 Bacteria 4340
555 Ga0495618_0207856 3300046514 Bacteria 1238
556 Ga0495628_0000185 3300046516 Bacteria 54717
557 Ga0495628_0035539 3300046516 Bacteria 4003
558 Ga0495630_0005490 3300046517 Bacteria 8949
559 Ga0495630_0076664 3300046517 Bacteria 2520
560 Ga0495630_0203184 3300046517 Bacteria 1512
561 Ga0495666_0055679 3300046526 Unclassified 1895
562 Ga0495652_0000466 3300046529 Bacteria 47387
563 Ga0495652_0050989 3300046529 Bacteria 3536
564 Ga0495652_0281834 3300046529 Bacteria 1216
565 Ga0495652_0415027 3300046529 Bacteria 950
566 Ga0495665_0000240 3300046531 Bacteria 27586
567 Ga0495640_0028208 3300046533 Bacteria 4043
568 Ga0495640_0086439 3300046533 Bacteria 2076
569 Ga0495586_0079761 3300046535 Bacteria 1797
570 Ga0495587_0000537 3300046536 Bacteria 26275
571 Ga0495587_0048521 3300046536 Unclassified 2514
572 Ga0495587_0171103 3300046536 Bacteria 1234
573 Ga0495645_0000115 3300046543 Bacteria 54956
574 Ga0495667_0011033 3300046559 Bacteria 6109
575 Ga0495667_0011347 3300046559 Bacteria 6033
576 Ga0495667_0041925 3300046559 Unclassified 3034
577 Ga0495667_0145431 3300046559 Bacteria 1527
578 Ga0495668_0051358 3300046616 Bacteria 2283
579 Ga0495634_0012164 3300046642 Bacteria 6238
580 Ga0495634_0028372 3300046642 Bacteria 3885
581 Ga0495634_0169221 3300046642 Bacteria 1374
582 Ga0495635_0016636 3300046663 Bacteria 5138
583 Ga0495635_0048774 3300046663 Bacteria 2919
584 Ga0495635_0090558 3300046663 Bacteria 2092
585 Ga0495635_0266292 3300046663 Unclassified 1153
586 Ga0495588_0004083 3300046674 Bacteria 6425
587 Ga0495657_0029004 3300046675 Bacteria 3884
588 Ga0495657_0047150 3300046675 Bacteria 2915
589 Ga0495657_0050638 3300046675 Bacteria 2792
590 Ga0495599_0000135 3300046678 Bacteria 47515
591 Ga0495599_0086704 3300046678 Bacteria 1955
592 Ga0495623_0000350 3300046679 Bacteria 30436
593 Ga0495646_0000351 3300046680 Bacteria 23709
594 Ga0495647_0028505 3300046681 Bacteria 2059
595 Ga0495658_0000691 3300046683 Bacteria 18249
596 Ga0495658_0093703 3300046683 Bacteria 1782
597 Ga0495613_0011438 3300046689 Bacteria 6597
598 Ga0495613_0072645 3300046689 Bacteria 2508
599 Ga0495613_0104755 3300046689 Bacteria 2042
600 Ga0495600_0006098 3300046809 Bacteria 7302
601 Ga0495600_0006211 3300046809 Bacteria 7247
602 Ga0495581_0000481 3300047315 Bacteria 20285
603 Ga0495581_0035485 3300047315 Bacteria 2886
604 Ga0495581_0061459 3300047315 Bacteria 2171
605 Ga0495604_0000060 3300047317 Bacteria 95444
606 Ga0495604_0031932 3300047317 Bacteria 4175
607 Ga0495604_0045259 3300047317 Bacteria 3435
608 Ga0495604_0147924 3300047317 Bacteria 1672
609 Ga0495674_0011434 3300047319 Bacteria 8375
610 Ga0495674_0022505 3300047319 Bacteria 5814
611 Ga0495674_0399587 3300047319 Bacteria 1109
612 Ga0495676_0000654 3300047321 Bacteria 28845
613 Ga0495676_0010451 3300047321 Bacteria 8416
614 Ga0495680_0002258 3300047322 Bacteria 19853
615 Ga0495680_0002435 3300047322 Bacteria 19040
616 Ga0495680_0003818 3300047322 Bacteria 14626
617 Ga0495680_0014000 3300047322 Bacteria 6973
618 Ga0495680_0024176 3300047322 Bacteria 5042
619 Ga0495680_0035391 3300047322 Bacteria 4022
620 Ga0495680_0326125 3300047322 Bacteria 1074
621 Ga0495675_0000223 3300047444 Bacteria 41211
622 Ga0495675_0245997 3300047444 Bacteria 1075
623 Ga0495684_0014714 3300047471 Bacteria 6023
624 Ga0495684_0051296 3300047471 Bacteria 3149
625 Ga0495684_0130327 3300047471 Bacteria 1889
626 Ga0495684_0191592 3300047471 Bacteria 1511
627 Ga0495593_0011508 3300047673 Bacteria 5079
628 Ga0495602_0000197 3300048088 Bacteria 56557
629 Ga0495602_0338282 3300048088 Unclassified 1089
630 Ga0495614_0035273 3300048089 Unclassified 2149
631 Ga0496100_0062511 3300048903 Bacteria 2457
632 Ga0496100_0110649 3300048903 Bacteria 1907
633 Ga0496100_0158934 3300048903 Bacteria 1619
634 Ga0496101_0003915 3300048904 Bacteria 9306
635 Ga0496101_0006852 3300048904 Bacteria 7353
636 Ga0496101_0010618 3300048904 Bacteria 6084
637 Ga0496101_0016672 3300048904 Bacteria 4970
638 Ga0496101_0069443 3300048904 Bacteria 2578
639 Ga0496101_0263273 3300048904 Unclassified 1345
640 Ga0496102_0004341 3300048905 Bacteria 11987
641 Ga0496102_0006327 3300048905 Bacteria 10097
642 Ga0496102_0007328 3300048905 Bacteria 9419
643 Ga0496102_0010973 3300048905 Bacteria 7807
644 Ga0496102_0017197 3300048905 Bacteria 6331
645 Ga0496102_0017858 3300048905 Bacteria 6221
646 Ga0496102_0069875 3300048905 Bacteria 3224
647 Ga0496102_0160808 3300048905 Bacteria 2113
648 Ga0496102_0544014 3300048905 Bacteria 1084
649 Ga0496103_0028980 3300048906 Bacteria 3362
650 Ga0496103_0064673 3300048906 Bacteria 2280
651 Ga0496103_0132925 3300048906 Bacteria 1590
652 Ga0496104_0000254 3300048907 Bacteria 47479
653 Ga0496104_0001809 3300048907 Bacteria 18537
654 Ga0496104_0003247 3300048907 Bacteria 14012
655 Ga0496104_0040739 3300048907 Bacteria 4354
656 Ga0496104_0055821 3300048907 Bacteria 3734
657 Ga0496104_0110054 3300048907 Bacteria 2640
658 Ga0496104_0167778 3300048907 Bacteria 2105
659 Ga0496104_0168149 3300048907 Bacteria 2103
660 Ga0496105_0000055 3300048908 Bacteria 88389
661 Ga0496105_0001748 3300048908 Bacteria 15536
662 Ga0496105_0010299 3300048908 Bacteria 7349
663 Ga0496105_0015684 3300048908 Bacteria 6045
664 Ga0496105_0016988 3300048908 Bacteria 5822
665 Ga0496105_0076842 3300048908 Bacteria 2757
666 Ga0496105_0109580 3300048908 Bacteria 2279
667 Ga0496106_0004134 3300048909 Bacteria 10816
668 Ga0496106_0019107 3300048909 Bacteria 5079
669 Ga0496106_0104903 3300048909 Bacteria 2195
670 Ga0496106_0177148 3300048909 Bacteria 1692
671 Ga0496106_0430358 3300048909 Bacteria 1060
672 Ga0496107_0028465 3300048910 Bacteria 3971
673 Ga0496107_0051018 3300048910 Bacteria 2983
674 Ga0496107_0116299 3300048910 Bacteria 1968
675 Ga0496107_0173568 3300048910 Bacteria 1600
676 Ga0496108_0025258 3300048911 Bacteria 4895
677 Ga0496108_0034899 3300048911 Bacteria 4179
678 Ga0496108_0065698 3300048911 Bacteria 3058
679 Ga0496108_0374932 3300048911 Bacteria 1242
680 Ga0496109_0001140 3300048912 Bacteria 22090
681 Ga0496109_0013078 3300048912 Bacteria 7179
682 Ga0496109_0019918 3300048912 Bacteria 5922
683 Ga0496109_0056112 3300048912 Bacteria 3594
684 Ga0496109_0078028 3300048912 Bacteria 3049
685 Ga0496109_0084123 3300048912 Bacteria 2934
686 Ga0496109_0119989 3300048912 Bacteria 2449
687 Ga0496109_0187046 3300048912 Bacteria 1946
688 Ga0496109_0221378 3300048912 Bacteria 1780
689 Ga0496110_0001472 3300048913 Bacteria 17050
690 Ga0496110_0010434 3300048913 Bacteria 7554
691 Ga0496110_0031403 3300048913 Bacteria 4583
692 Ga0496110_0041456 3300048913 Bacteria 4017
693 Ga0496110_0162808 3300048913 Bacteria 2022
694 Ga0496110_0210433 3300048913 Bacteria 1768
695 Ga0496110_0334525 3300048913 Bacteria 1379
696 Ga0496111_0000582 3300048914 Bacteria 19124
697 Ga0496111_0001388 3300048914 Bacteria 13743
698 Ga0496111_0019990 3300048914 Bacteria 4658
699 Ga0496111_0027506 3300048914 Bacteria 4023
700 Ga0496111_0134013 3300048914 Bacteria 1834
701 Ga0496112_0033359 3300048915 Bacteria 5004
702 Ga0496112_0200423 3300048915 Bacteria 1955
703 Ga0496112_0635899 3300048915 Unclassified 997
704 Ga0496113_0015361 3300048916 Bacteria 5260
705 Ga0496113_0233939 3300048916 Bacteria 1465
706 Ga0496114_0000256 3300048917 Bacteria 38442
707 Ga0496114_0002392 3300048917 Bacteria 14278
708 Ga0496114_0003388 3300048917 Bacteria 12237
709 Ga0496114_0004328 3300048917 Bacteria 10992
710 Ga0496114_0015571 3300048917 Bacteria 6114
711 Ga0496114_0024176 3300048917 Bacteria 4958
712 Ga0496114_0040438 3300048917 Bacteria 3861
713 Ga0496114_0177383 3300048917 Unclassified 1859
714 Ga0496114_0185944 3300048917 Bacteria 1816
715 Ga0496114_0186170 3300048917 Bacteria 1815
716 Ga0496114_0201726 3300048917 Bacteria 1742
717 Ga0496115_0010994 3300048918 Bacteria 6777
718 Ga0496115_0014093 3300048918 Bacteria 6053
719 Ga0496115_0019911 3300048918 Bacteria 5170
720 Ga0496115_0059349 3300048918 Bacteria 3080
721 Ga0496115_0124405 3300048918 Bacteria 2124
722 Ga0496115_0125968 3300048918 Bacteria 2110
723 Ga0496115_0307010 3300048918 Unclassified 1299
724 Ga0496115_0642998 3300048918 Unclassified 839
725 Ga0501031_0005364 3300049568 Bacteria 8347
726 Ga0501031_0057948 3300049568 Bacteria 2524
727 Ga0501032_0050504 3300049569 Bacteria 2805
728 Ga0501033_0029934 3300049570 Bacteria 4092
729 Ga0501034_0053587 3300049571 Bacteria 4061
730 Ga0501034_0173568 3300049571 Bacteria 2122
731 Ga0501034_0186800 3300049571 Bacteria 2036
732 Ga0501034_0326640 3300049571 Bacteria 1466
733 Ga0501036_0008841 3300049572 Bacteria 8269
734 Ga0501036_0012587 3300049572 Bacteria 7016
735 Ga0501036_0055128 3300049572 Bacteria 3367
736 Ga0501037_0007155 3300049573 Bacteria 8156
737 Ga0501037_0063001 3300049573 Bacteria 2703
738 Ga0501038_0004352 3300049574 Bacteria 13177
739 Ga0501038_0010405 3300049574 Bacteria 8504
740 Ga0501039_0007649 3300049575 Bacteria 8249
741 Ga0501039_0019157 3300049575 Bacteria 5251
742 Ga0501039_0034101 3300049575 Bacteria 3928
743 Ga0501040_0009636 3300049576 Bacteria 6304
744 Ga0501040_0030782 3300049576 Bacteria 3626
745 Ga0501040_0086996 3300049576 Bacteria 2170
746 Ga0501040_0094042 3300049576 Unclassified 2085
747 Ga0501041_0005357 3300049577 Bacteria 7512
748 Ga0501041_0015393 3300049577 Bacteria 4541
749 Ga0501041_0054237 3300049577 Unclassified 2446
750 Ga0501041_0138615 3300049577 Bacteria 1516
751 Ga0501041_0161737 3300049577 Bacteria 1400
752 Ga0501042_0007391 3300049578 Bacteria 7195
753 Ga0501042_0323404 3300049578 Unclassified 1114
754 Ga0501043_0114181 3300049579 Bacteria 2120
755 Ga0501043_0136899 3300049579 Bacteria 1918
756 Ga0501046_0008189 3300049580 Bacteria 9132
757 Ga0501046_0137527 3300049580 Unclassified 1850
758 Ga0501046_0190519 3300049580 Bacteria 1530
759 Ga0501047_0028024 3300049581 Bacteria 5428
760 Ga0501048_0015969 3300049582 Bacteria 5539
761 Ga0501048_0078888 3300049582 Unclassified 2324
762 Ga0501048_0128678 3300049582 Bacteria 1790
763 Ga0501067_0004482 3300049583 Bacteria 7703
764 Ga0501067_0025963 3300049583 Bacteria 3246
765 Ga0501067_0026142 3300049583 Bacteria 3234
766 Ga0501067_0031868 3300049583 Unclassified 2925
767 Ga0501067_0081089 3300049583 Bacteria 1799
768 Ga0501067_0136085 3300049583 Bacteria 1368
769 Ga0501068_0001354 3300049584 Bacteria 12993
770 Ga0501068_0005957 3300049584 Bacteria 6689
771 Ga0501068_0018073 3300049584 Bacteria 4083
772 Ga0501068_0051552 3300049584 Bacteria 2489
773 Ga0501068_0073970 3300049584 Bacteria 2082
774 Ga0501069_0016121 3300049585 Bacteria 4009
775 Ga0501069_0019982 3300049585 Bacteria 3625
776 Ga0501069_0105072 3300049585 Bacteria 1605
777 Ga0501069_0127079 3300049585 Bacteria 1458
778 Ga0501070_0015415 3300049586 Bacteria 6430
779 Ga0501070_0020855 3300049586 Bacteria 5497
780 Ga0501070_0214752 3300049586 Bacteria 1578
781 Ga0501071_0009471 3300049587 Bacteria 6489
782 Ga0501071_0015098 3300049587 Bacteria 5296
783 Ga0501071_0046781 3300049587 Bacteria 3107
784 Ga0501072_0007825 3300049588 Bacteria 8116
785 Ga0501072_0015793 3300049588 Bacteria 5788
786 Ga0501072_0017765 3300049588 Bacteria 5469
787 Ga0501072_0026018 3300049588 Bacteria 4560
788 Ga0501072_0073576 3300049588 Bacteria 2701
789 Ga0501073_0000628 3300049589 Bacteria 24828
790 Ga0501073_0026251 3300049589 Bacteria 4173
791 Ga0501073_0087624 3300049589 Bacteria 2165
792 Ga0501074_0016439 3300049590 Bacteria 5372
793 Ga0501074_0024114 3300049590 Bacteria 4421
794 Ga0501074_0026160 3300049590 Bacteria 4231
795 Ga0501074_0103669 3300049590 Bacteria 2036
796 Ga0501075_0004487 3300049591 Bacteria 9454
797 Ga0501075_0005137 3300049591 Bacteria 8950
798 Ga0501075_0033610 3300049591 Bacteria 3815
799 Ga0501075_0148855 3300049591 Bacteria 1784
800 Ga0501076_0018581 3300049592 Bacteria 5302
801 Ga0501076_0065302 3300049592 Bacteria 2901
802 Ga0501077_0005536 3300049593 Bacteria 7687
803 Ga0501077_0009048 3300049593 Bacteria 6181
804 Ga0501077_0011415 3300049593 Bacteria 5547
805 Ga0501079_0007265 3300049741 Bacteria 8365
806 Ga0501079_0043082 3300049741 Bacteria 3483
807 Ga0501079_0077107 3300049741 Bacteria 2578
808 Ga0501079_0174503 3300049741 Unclassified 1676
809 Ga0501080_0021157 3300049742 Bacteria 6020
810 Ga0501080_0057448 3300049742 Bacteria 3623
811 Ga0501080_0067361 3300049742 Bacteria 3330
812 Ga0501081_0008239 3300049743 Bacteria 6766
813 Ga0501081_0011177 3300049743 Bacteria 5871
814 Ga0501081_0023921 3300049743 Unclassified 4098
815 Ga0501083_0000739 3300049744 Bacteria 21326
816 Ga0501083_0005244 3300049744 Bacteria 9166
817 Ga0501035_0069067 3300049822 Bacteria 3132
818 Ga0501035_0074745 3300049822 Bacteria 2997
819 Ga0501044_0095658 3300049823 Bacteria 2993
820 Ga0501045_0001564 3300049824 Bacteria 15240
821 Ga0501045_0002762 3300049824 Bacteria 11982
822 Ga0501045_0222089 3300049824 Bacteria 1407
823 nmdc:mga03n38_177166_c1 3300050490 Bacteria 1090
824 nmdc:mga07m45_93842_c1 3300050496 Bacteria 1720
825 nmdc:mga05p37_17104_c1 3300050507 Bacteria 8748
826 nmdc:mga05p37_39397_c1 3300050507 Bacteria 5802
827 nmdc:mga05p37_4337_c1 3300050507 Bacteria 16558
828 nmdc:mga05p37_64172_c1 3300050507 Bacteria 4519
829 nmdc:mga05p37_885_c1 3300050507 Bacteria 33780
830 nmdc:mga09592_197115_c1 3300050508 Bacteria 1743
831 nmdc:mga09592_303537_c1 3300050508 Bacteria 1384
832 nmdc:mga09592_6255_c1 3300050508 Bacteria 9696
833 nmdc:mga06r32_307375_c1 3300050510 Bacteria 1571
834 nmdc:mga06r32_661127_c1 3300050510 Bacteria 1012
835 nmdc:mga08y16_1003_c1 3300050511 Bacteria 27574
836 nmdc:mga08y16_145036_c1 3300050511 Unclassified 2468
837 nmdc:mga08y16_178663_c1 3300050511 Bacteria 2204
838 nmdc:mga08y16_27785_c1 3300050511 Bacteria 5962
839 nmdc:mga08y16_279118_c1 3300050511 Bacteria 1723
840 nmdc:mga08y16_469887_c1 3300050511 Bacteria 1281
841 nmdc:mga08y16_60710_c1 3300050511 Bacteria 3948
842 nmdc:mga0n895_14233_c1 3300050512 Bacteria 7216
843 nmdc:mga0n895_455325_c1 3300050512 Bacteria 1292
844 nmdc:mga0n895_97399_c1 3300050512 Bacteria 2947
845 nmdc:mga0rr50_121001_c1 3300050513 Bacteria 2084
846 nmdc:mga0rr50_20546_c1 3300050513 Bacteria 4489
847 nmdc:mga0rr50_66409_c1 3300050513 Bacteria 2737
848 nmdc:mga0a205_107563_c1 3300050515 Bacteria 2687
849 nmdc:mga0a205_110063_c1 3300050515 Bacteria 2653
850 nmdc:mga0a205_231295_c1 3300050515 Unclassified 1732
851 nmdc:mga0a205_9352_c1 3300050515 Bacteria 8955
852 Ga0495601_0000238 3300053077 Bacteria 29363
853 Ga0495601_0008450 3300053077 Bacteria 6081
854 Ga0495601_0011451 3300053077 Bacteria 5305
855 Ga0495601_0023900 3300053077 Bacteria 3759
856 Ga0495601_0071041 3300053077 Bacteria 2223
857 Ga0495601_0081458 3300053077 Bacteria 2077
858 Ga0495601_0230248 3300053077 Unclassified 1210
859 Ga0495612_0054128 3300053078 Bacteria 1653
860 Ga0495595_0028779 3300053084 Bacteria 2483
861 Ga0495595_0043033 3300053084 Bacteria 2070
862 Ga0495595_0053527 3300053084 Bacteria 1875
863 Ga0495619_0000200 3300053085 Bacteria 43823
864 Ga0495619_0033926 3300053085 Bacteria 3316
865 Ga0495619_0041021 3300053085 Bacteria 3026
866 Ga0495619_0056785 3300053085 Bacteria 2596
867 Ga0495619_0121542 3300053085 Bacteria 1791
868 Ga0501084_0004886 3300054114 Bacteria 10950
869 Ga0501084_0037442 3300054114 Bacteria 4052
870 Ga0501084_0040580 3300054114 Bacteria 3894
871 Ga0501084_0089049 3300054114 Bacteria 2591
872 Ga0501084_0282052 3300054114 Unclassified 1403
873 Ga0501084_0398125 3300054114 Bacteria 1164
874 Ga0501082_0019554 3300060353 Bacteria 5840
875 Ga0501082_0045737 3300060353 Bacteria 3774
876 Ga0501082_0046905 3300060353 Unclassified 3724
877 Ga0501082_0143066 3300060353 Bacteria 2075
878 Ga0501082_0163468 3300060353 Bacteria 1934
879 Ga0466962_0001269 3300061719 Bacteria 11653
880 Ga0466962_0076178 3300061719 Unclassified 1603
881 Ga0466962_0117162 3300061719 Bacteria 1284
882 Ga0530510_0002748 3300061734 Bacteria 12090
883 Ga0530510_0009540 3300061734 Bacteria 6806
884 Ga0530510_0065593 3300061734 Bacteria 2631
885 Ga0530510_0126812 3300061734 Bacteria 1876
886 Ga0530510_0127397 3300061734 Unclassified 1872
887 2867511325 2867507094 Bacteria 6506033
888 Ga0081455_10116815
889 Ga0070658_10076233
890 Ga0070658_10181174
891 Ga0070683_100001511
892 Ga0070683_100092440
893 Ga0070683_100093542
894 Ga0070683_100107201
895 Ga0070683_100176414
896 Ga0070670_100025282
897 Ga0068869_100013310
898 Ga0070680_100013567
899 Ga0070680_100018340
900 Ga0070680_100058287
901 Ga0070680_100171258
902 Ga0070680_100296921
903 Ga0070682_100013359
904 Ga0070682_100033577
905 Ga0070682_100162612
906 Ga0070682_100267374
907 Ga0068868_100012148
908 Ga0068868_100057126
909 Ga0070660_100006183
910 Ga0070660_100109775
911 Ga0070660_100196481
912 Ga0070660_100305946
913 Ga0070689_100026358
914 Ga0070691_10005579
915 Ga0070687_100101658
916 Ga0070661_100014164
917 Ga0070661_100076047
918 Ga0070692_10019780
919 Ga0070668_100184108
920 Ga0070675_100074143
921 Ga0070675_100237441
922 Ga0070675_100356117
923 Ga0070675_100372033
924 Ga0070674_100011737
925 Ga0070674_100038298
926 Ga0070674_100079232
927 Ga0070673_100012976
928 Ga0070673_100236738
929 Ga0070673_100387681
930 Ga0070688_100005327
931 Ga0070688_100060649
932 Ga0070688_100215763
933 Ga0070659_100072561
934 Ga0070659_100087129
935 Ga0070659_100103273
936 Ga0070659_100180007
937 Ga0070659_100417348
938 Ga0070667_100007322
939 Ga0070667_100433297
940 Ga0070709_10155006
941 Ga0070714_100063737
942 Ga0070714_100374176
943 Ga0070710_10066403
944 Ga0070701_10020847
945 Ga0070701_10264977
946 Ga0070711_100129269
947 Ga0070705_100003518
948 Ga0070700_100086887
949 Ga0070700_100272505
950 Ga0070694_100145112
951 Ga0070694_100200330
952 Ga0070663_100011213
953 Ga0070663_100270500
954 Ga0070678_100000994
955 Ga0070678_100015365
956 Ga0070678_100049869
957 Ga0070678_100053407
958 Ga0070678_100448376
959 Ga0070681_10025719
960 Ga0070681_10075782
961 Ga0070681_10078133
962 Ga0070681_10096947
963 Ga0068867_100210615
964 Ga0070685_10022590
965 Ga0070706_100057572
966 Ga0070698_100044298
967 Ga0070698_100291796
968 Ga0070679_100029799
969 Ga0070679_100066431
970 Ga0070679_100089042
971 Ga0070679_100102811
972 Ga0070679_100508984
973 Ga0070684_100008159
974 Ga0070684_100010835
975 Ga0070684_100032010
976 Ga0070684_100032864
977 Ga0070684_100035945
978 Ga0070684_100057553
979 Ga0070684_100262651
980 Ga0068853_100061002
981 Ga0070672_100025047
982 Ga0070672_100026949
983 Ga0070672_100039502
984 Ga0070672_100059327
985 Ga0070686_100026834
986 Ga0070686_100029109
987 Ga0070696_100021618
988 Ga0070696_100044154
989 Ga0070693_100037363
990 Ga0070693_100170913
991 Ga0070665_100004920
992 Ga0070704_100023436
993 Ga0070704_100071693
994 Ga0070704_100245639
995 Ga0068855_100029046
996 Ga0068855_100110665
997 Ga0068855_100343079
998 Ga0068855_100456949
999 Ga0070664_100154101
1000 Ga0068857_100019377
1001 Ga0068857_100151545
1002 Ga0068854_100083829
1003 Ga0068856_100006059
1004 Ga0068856_100078434
1005 Ga0068856_100084892
1006 Ga0068856_100114058
1007 Ga0068856_100380344
1008 Ga0070702_100001248
1009 Ga0068852_100262228
1010 Ga0068852_100272389
1011 Ga0068852_100408045
1012 Ga0068859_100187523
1013 Ga0068859_100240480
1014 Ga0068864_100310433
1015 Ga0068866_10080690
1016 Ga0068866_10100199
1017 Ga0068861_100031844
1018 Ga0068861_100186435
1019 Ga0068861_100202348
1020 Ga0068851_10017806
1021 Ga0068870_10022120
1022 Ga0068870_10028295
1023 Ga0068870_10156408
1024 Ga0068860_100009233
1025 Ga0068860_100073582
1026 Ga0068860_100600383
1027 Ga0068862_100181001
1028 Ga0081455_10008878
1029 Ga0081455_10011995
1030 Ga0081455_10020170
1031 Ga0081540_1004204
1032 Ga0081540_1019924
1033 Ga0070717_10002940
1034 Ga0070717_10016455
1035 Ga0075432_10001987
1036 Ga0070715_10011274
1037 Ga0070716_100272845
1038 Ga0070712_100027127
1039 Ga0070712_100043402
1040 Ga0097621_100028225
1041 Ga0097621_100258788
1042 Ga0075370_10032801
1043 Ga0068871_100006072
1044 Ga0075428_100000211
1045 Ga0075428_100001472
1046 Ga0075428_100297963
1047 Ga0075428_100540641
1048 Ga0075433_10012759
1049 Ga0075433_10305536
1050 Ga0075434_100237257
1051 Ga0075429_100005341
1052 Ga0075429_100183184
1053 Ga0068865_100013452
1054 Ga0068865_100015100
1055 Ga0068865_100181824
1056 Ga0097620_100187522
1057 Ga0097620_100240495
1058 Ga0075435_100007124
1059 Ga0105240_10154991
1060 Ga0105240_10160060
1061 Ga0105240_10291224
1062 Ga0105240_10377992
1063 Ga0111539_10003281
1064 Ga0111539_10072396
1065 Ga0111539_10103504
1066 Ga0111539_10195746
1067 Ga0111539_10241429
1068 Ga0111539_10302662
1069 Ga0105245_10001672
1070 Ga0105245_10006039
1071 Ga0105245_10029684
1072 Ga0105245_10082162
1073 Ga0105245_10110460
1074 Ga0105245_10164739
1075 Ga0105245_10170744
1076 Ga0105245_10241557
1077 Ga0105245_10292019
1078 Ga0105245_10397160
1079 Ga0105245_10675696
1080 Ga0105247_10006987
1081 Ga0105247_10031086
1082 Ga0114129_10002058
1083 Ga0114129_10014359
1084 Ga0114129_10062127
1085 Ga0105243_10004171
1086 Ga0105243_10013258
1087 Ga0105243_10020248
1088 Ga0105243_10022730
1089 Ga0105243_10244705
1090 Ga0105243_10597865
1091 Ga0105241_10017128
1092 Ga0105241_10110414
1093 Ga0105241_10114021
1094 Ga0105242_10008815
1095 Ga0105242_10186334
1096 Ga0105242_10507503
1097 Ga0105248_10017461
1098 Ga0105248_10170081
1099 Ga0105248_10492822
1100 Ga0105237_10101507
1101 Ga0105238_10010169
1102 Ga0105238_10046758
1103 Ga0105238_10125091
1104 Ga0105249_10010169
1105 Ga0105249_10102276
1106 Ga0105239_10031419
1107 Ga0105239_10054676
1108 Ga0105239_10319808
1109 Ga0105246_10042671
1110 Ga0105246_10073261
1111 Ga0105246_10163486
1112 Ga0105246_10180281
1113 Ga0157373_10104342
1114 Ga0157371_10090213
1115 Ga0157370_10022377
1116 Ga0157370_10026174
1117 Ga0157370_10033161
1118 Ga0157370_10054870
1119 Ga0157369_10017118
1120 Ga0157369_10022942
1121 Ga0157369_10220950
1122 Ga0157369_10225011
1123 Ga0157369_10372889
1124 Ga0157374_10026077
1125 Ga0157374_10076623
1126 Ga0157374_10275298
1127 Ga0157374_10341577
1128 Ga0157374_10660026
1129 Ga0157378_10017333
1130 Ga0163162_10008756
1131 Ga0163162_10188599
1132 Ga0157372_10011088
1133 Ga0157372_10043786
1134 Ga0157372_10240480
1135 Ga0157372_10342294
1136 Ga0157372_10536835
1137 Ga0157372_10782626
1138 Ga0157375_10023433
1139 Ga0157375_10059076
1140 Ga0157375_10062507
1141 Ga0157375_10442499
1142 Ga0163163_10039202
1143 Ga0163163_10090670
1144 Ga0157380_10240770
1145 Ga0157380_10502705
1146 Ga0182008_10003683
1147 Ga0182008_10153664
1148 Ga0157377_10006166
1149 Ga0157377_10035532
1150 Ga0157377_10123251
1151 Ga0157379_10005788
1152 Ga0157376_10006519
1153 Ga0157376_10115771
1154 Ga0157376_10135635
1155 Ga0157376_10368150
1156 Ga0182006_1028239
1157 Ga0163161_10185366
1158 Ga0206354_10152404
1159 Ga0206354_11376887
1160 Ga0206353_10290895
1161 Ga0206353_10835708
1162 Ga0224712_10077945
1163 Ga0207692_10009347
1164 Ga0207692_10091408
1165 Ga0207688_10009635
1166 Ga0207688_10114845
1167 Ga0207685_10006858
1168 Ga0207699_10254154
1169 Ga0207645_10054967
1170 Ga0207643_10003002
1171 Ga0207643_10029234
1172 Ga0207643_10034512
1173 Ga0207705_10016247
1174 Ga0207705_10130907
1175 Ga0207684_10071765
1176 Ga0207654_10017694
1177 Ga0207695_10321502
1178 Ga0207671_10136865
1179 Ga0207693_10000919
1180 Ga0207693_10037360
1181 Ga0207693_10056444
1182 Ga0207693_10057330
1183 Ga0207693_10092213
1184 Ga0207663_10023698
1185 Ga0207663_10283008
1186 Ga0207660_10022675
1187 Ga0207660_10032251
1188 Ga0207662_10017719
1189 Ga0207657_10005718
1190 Ga0207657_10008090
1191 Ga0207657_10020451
1192 Ga0207657_10074418
1193 Ga0207657_10221440
1194 Ga0207649_10077221
1195 Ga0207649_10165416
1196 Ga0207652_10008696
1197 Ga0207652_10047664
1198 Ga0207652_10191680
1199 Ga0207652_10414841
1200 Ga0207646_10167050
1201 Ga0207681_10156803
1202 Ga0207650_10016445
1203 Ga0207650_10088839
1204 Ga0207659_10052897
1205 Ga0207659_10206227
1206 Ga0207659_10325964
1207 Ga0207687_10002244
1208 Ga0207687_10021313
1209 Ga0207687_10426966
1210 Ga0207700_10092550
1211 Ga0207664_10014782
1212 Ga0207664_10042768
1213 Ga0207664_10094015
1214 Ga0207664_10304207
1215 Ga0207664_10341110
1216 Ga0207690_10021370
1217 Ga0207690_10138948
1218 Ga0207706_10012502
1219 Ga0207686_10004653
1220 Ga0207686_10048505
1221 Ga0207709_10018813
1222 Ga0207709_10025212
1223 Ga0207709_10149945
1224 Ga0207709_10203327
1225 Ga0207670_10258609
1226 Ga0207669_10103895
1227 Ga0207669_10173171
1228 Ga0207704_10060366
1229 Ga0207704_10202757
1230 Ga0207665_10000603
1231 Ga0207665_10345045
1232 Ga0207691_10009210
1233 Ga0207691_10039180
1234 Ga0207691_10059619
1235 Ga0207711_10110490
1236 Ga0207689_10026647
1237 Ga0207661_10000463
1238 Ga0207661_10124436
1239 Ga0207661_10152477
1240 Ga0207661_10203623
1241 Ga0207661_10221511
1242 Ga0207661_10248871
1243 Ga0207661_10266690
1244 Ga0207661_10495324
1245 Ga0207679_10116931
1246 Ga0207679_10148461
1247 Ga0207679_10280734
1248 Ga0207667_10305153
1249 Ga0207667_10394436
1250 Ga0207651_10109468
1251 Ga0207651_10327181
1252 Ga0207640_10043944
1253 Ga0207658_10010769
1254 Ga0207658_10350864
1255 Ga0207639_10364946
1256 Ga0207678_10008989
1257 Ga0207678_10021648
1258 Ga0207678_10031027
1259 Ga0207678_10163303
1260 Ga0207678_10270707
1261 Ga0207708_10021885
1262 Ga0207708_10052203
1263 Ga0207708_10178681
1264 Ga0207702_10015391
1265 Ga0207702_10028487
1266 Ga0207702_10058258
1267 Ga0207702_10137960
1268 Ga0207641_10352200
1269 Ga0207648_10043497
1270 Ga0207648_10118497
1271 Ga0207676_10572720
1272 Ga0207674_10028849
1273 Ga0207674_10117157
1274 Ga0207674_10173072
1275 Ga0207674_10190368
1276 Ga0207674_10214023
1277 Ga0207675_100001496
1278 Ga0207675_100083606
1279 Ga0207675_100309253
1280 Ga0207683_10002515
1281 Ga0207683_10004769
1282 Ga0207683_10028730
1283 Ga0207683_10060153
1284 Ga0207683_10106557
1285 Ga0207683_10198294
1286 Ga0207683_10264401
1287 Ga0207698_10385298
1288 Ga0207698_10419970
1289 Ga0207428_10000315
1290 Ga0207428_10070484
1291 Ga0207428_10125946
1292 Ga0207428_10219666
1293 Ga0268266_10047771
1294 Ga0268266_10073210
1295 Ga0265319_1004366
1296 Ga0265318_10019213
1297 Ga0265322_10013754
1298 Ga0265338_10015737
1299 Ga0265338_10065827
1300 Ga0265338_10098097
1301 Ga0265338_10117088
1302 Ga0265338_10137691
1303 Ga0265330_10063643
1304 Ga0265332_10023968
1305 Ga0265320_10050370
1306 Ga0265325_10044993
1307 Ga0265340_10042406
1308 Ga0265339_10007410
1309 Ga0265331_10059062
1310 Ga0265331_10113581
1311 Ga0265316_10020436
1312 Ga0265313_10026781
1313 Ga0265314_10006777
1314 Ga0265314_10050555
1315 Ga0265342_10031976
1316 Ga0307410_10408239
1317 Ga0307406_10161587
1318 Ga0307409_100134476
1319 Ga0307415_100046294
1320 Ga0316583_10018819
1321 Ga0373930_0014340
1322 Ga0373929_0018991
1323 Ga0373939_0025347
1324 Ga0373946_0051029
1325 Ga0373955_0102617
1326 Ga0373942_0007075
1327 Ga0373962_0021804
1328 Ga0373962_0081365
1329 Ga0373931_0027133
1330 Ga0373935_0035974
1331 Ga0373935_0100154
1332 Ga0373935_0182079
1333 Ga0373927_0006434
1334 Ga0373947_0049242
1335 Ga0373937_0001462
1336 Ga0373937_0013260
1337 Ga0373937_0073725
1338 Ga0373937_0715789
1339 Ga0373925_0016109
1340 Ga0373925_0050590
1341 Ga0373925_0188903
1342 Ga0395900_0088362
1343 Ga0395900_0151455
1344 Ga0395898_0027962
1345 Ga0395898_0056257
1346 Ga0395898_0087418
1347 Ga0395898_0230316
1348 Ga0395898_0289599
1349 Ga0395905_0048403
1350 Ga0395901_0009918
1351 Ga0395901_0047081
1352 Ga0395901_0127304
1353 Ga0395901_0180943
1354 Ga0395901_0484025
1355 Ga0395901_0580517
1356 Ga0439448_0069147
1357 Ga0450920_001235
1358 Ga0450923_042774
1359 Ga0450906_006760
1360 Ga0439458_0005864
1361 Ga0439459_0021336
1362 Ga0466969_0075969
1363 Ga0466965_0048264
1364 Ga0466966_0093580
1365 Ga0466961_0009894
1366 Ga0466961_0017102
1367 Ga0466961_0046450
1368 Ga0466963_0000205
1369 Ga0466963_0001336
1370 Ga0466963_0003667
1371 Ga0466963_0004431
1372 Ga0466963_0023517
1373 Ga0466963_0047499
1374 Ga0466963_0073009
1375 Ga0466963_0086263
1376 Ga0466964_0002840
1377 Ga0466964_0012332
1378 Ga0466964_0021517
1379 Ga0466964_0030843
1380 Ga0466964_0053489
1381 Ga0466971_0002531
1382 Ga0466971_0010508
1383 Ga0466957_0000280
1384 Ga0466957_0030847
1385 Ga0466957_0120445
1386 Ga0466959_0014713
1387 Ga0466959_0079467
1388 Ga0451576_0039636
1389 Ga0451576_0135991
1390 Ga0451576_0430452
1391 Ga0466958_0012132
1392 Ga0466958_0034792
1393 Ga0466958_0083071
1394 Ga0466958_0125774
1395 Ga0466967_0004529
1396 Ga0466967_0005434
1397 Ga0466967_0013824
1398 Ga0466967_0016123
1399 Ga0466967_0026731
1400 Ga0466967_0051112
1401 Ga0466967_0073437
1402 Ga0466967_0093798
1403 Ga0466967_0121901
1404 Ga0466967_0184283
1405 Ga0466967_0221367
1406 Ga0466967_0344136
1407 Ga0495592_0000207
1408 Ga0495592_0141323
1409 Ga0495603_0000445
1410 Ga0495603_0051865
1411 Ga0495603_0059720
1412 Ga0495603_0098158
1413 Ga0495629_0003295
1414 Ga0495629_0050293
1415 Ga0495629_0333112
1416 Ga0495641_0004373
1417 Ga0495641_0082627
1418 Ga0495651_0000106
1419 Ga0495651_0065641
1420 Ga0495653_0000290
1421 Ga0495653_0008918
1422 Ga0495653_0068050
1423 Ga0495653_0092294
1424 Ga0495582_0000516
1425 Ga0495582_0007912
1426 Ga0495582_0040172
1427 Ga0495582_0059933
1428 Ga0495639_0001552
1429 Ga0495639_0105458
1430 Ga0495662_0013779
1431 Ga0495664_0111167
1432 Ga0495584_0048069
1433 Ga0495584_0066228
1434 Ga0495594_0061877
1435 Ga0495596_0025578
1436 Ga0495607_0153390
1437 Ga0495608_0001216
1438 Ga0495608_0048246
1439 Ga0495618_0000561
1440 Ga0495618_0014856
1441 Ga0495618_0017961
1442 Ga0495618_0207856
1443 Ga0495628_0000185
1444 Ga0495628_0035539
1445 Ga0495630_0005490
1446 Ga0495630_0076664
1447 Ga0495630_0203184
1448 Ga0495666_0055679
1449 Ga0495652_0000466
1450 Ga0495652_0050989
1451 Ga0495652_0281834
1452 Ga0495652_0415027
1453 Ga0495665_0000240
1454 Ga0495640_0028208
1455 Ga0495640_0086439
1456 Ga0495586_0079761
1457 Ga0495587_0000537
1458 Ga0495587_0048521
1459 Ga0495587_0171103
1460 Ga0495645_0000115
1461 Ga0495667_0011033
1462 Ga0495667_0011347
1463 Ga0495667_0041925
1464 Ga0495667_0145431
1465 Ga0495668_0051358
1466 Ga0495634_0012164
1467 Ga0495634_0028372
1468 Ga0495634_0169221
1469 Ga0495635_0016636
1470 Ga0495635_0048774
1471 Ga0495635_0090558
1472 Ga0495635_0266292
1473 Ga0495588_0004083
1474 Ga0495657_0029004
1475 Ga0495657_0047150
1476 Ga0495657_0050638
1477 Ga0495599_0000135
1478 Ga0495599_0086704
1479 Ga0495623_0000350
1480 Ga0495646_0000351
1481 Ga0495647_0028505
1482 Ga0495658_0000691
1483 Ga0495658_0093703
1484 Ga0495613_0011438
1485 Ga0495613_0072645
1486 Ga0495613_0104755
1487 Ga0495600_0006098
1488 Ga0495600_0006211
1489 Ga0495581_0000481
1490 Ga0495581_0035485
1491 Ga0495581_0061459
1492 Ga0495604_0000060
1493 Ga0495604_0031932
1494 Ga0495604_0045259
1495 Ga0495604_0147924
1496 Ga0495674_0011434
1497 Ga0495674_0022505
1498 Ga0495674_0399587
1499 Ga0495676_0000654
1500 Ga0495676_0010451
1501 Ga0495680_0002258
1502 Ga0495680_0002435
1503 Ga0495680_0003818
1504 Ga0495680_0014000
1505 Ga0495680_0024176
1506 Ga0495680_0035391
1507 Ga0495680_0326125
1508 Ga0495675_0000223
1509 Ga0495675_0245997
1510 Ga0495684_0014714
1511 Ga0495684_0051296
1512 Ga0495684_0130327
1513 Ga0495684_0191592
1514 Ga0495593_0011508
1515 Ga0495602_0000197
1516 Ga0495602_0338282
1517 Ga0495614_0035273
1518 Ga0496100_0062511
1519 Ga0496100_0110649
1520 Ga0496100_0158934
1521 Ga0496101_0003915
1522 Ga0496101_0006852
1523 Ga0496101_0010618
1524 Ga0496101_0016672
1525 Ga0496101_0069443
1526 Ga0496101_0263273
1527 Ga0496102_0004341
1528 Ga0496102_0006327
1529 Ga0496102_0007328
1530 Ga0496102_0010973
1531 Ga0496102_0017197
1532 Ga0496102_0017858
1533 Ga0496102_0069875
1534 Ga0496102_0160808
1535 Ga0496102_0544014
1536 Ga0496103_0028980
1537 Ga0496103_0064673
1538 Ga0496103_0132925
1539 Ga0496104_0000254
1540 Ga0496104_0001809
1541 Ga0496104_0003247
1542 Ga0496104_0040739
1543 Ga0496104_0055821
1544 Ga0496104_0110054
1545 Ga0496104_0167778
1546 Ga0496104_0168149
1547 Ga0496105_0000055
1548 Ga0496105_0001748
1549 Ga0496105_0010299
1550 Ga0496105_0015684
1551 Ga0496105_0016988
1552 Ga0496105_0076842
1553 Ga0496105_0109580
1554 Ga0496106_0004134
1555 Ga0496106_0019107
1556 Ga0496106_0104903
1557 Ga0496106_0177148
1558 Ga0496106_0430358
1559 Ga0496107_0028465
1560 Ga0496107_0051018
1561 Ga0496107_0116299
1562 Ga0496107_0173568
1563 Ga0496108_0025258
1564 Ga0496108_0034899
1565 Ga0496108_0065698
1566 Ga0496108_0374932
1567 Ga0496109_0001140
1568 Ga0496109_0013078
1569 Ga0496109_0019918
1570 Ga0496109_0056112
1571 Ga0496109_0078028
1572 Ga0496109_0084123
1573 Ga0496109_0119989
1574 Ga0496109_0187046
1575 Ga0496109_0221378
1576 Ga0496110_0001472
1577 Ga0496110_0010434
1578 Ga0496110_0031403
1579 Ga0496110_0041456
1580 Ga0496110_0162808
1581 Ga0496110_0210433
1582 Ga0496110_0334525
1583 Ga0496111_0000582
1584 Ga0496111_0001388
1585 Ga0496111_0019990
1586 Ga0496111_0027506
1587 Ga0496111_0134013
1588 Ga0496112_0033359
1589 Ga0496112_0200423
1590 Ga0496112_0635899
1591 Ga0496113_0015361
1592 Ga0496113_0233939
1593 Ga0496114_0000256
1594 Ga0496114_0002392
1595 Ga0496114_0003388
1596 Ga0496114_0004328
1597 Ga0496114_0015571
1598 Ga0496114_0024176
1599 Ga0496114_0040438
1600 Ga0496114_0177383
1601 Ga0496114_0185944
1602 Ga0496114_0186170
1603 Ga0496114_0201726
1604 Ga0496115_0010994
1605 Ga0496115_0014093
1606 Ga0496115_0019911
1607 Ga0496115_0059349
1608 Ga0496115_0124405
1609 Ga0496115_0125968
1610 Ga0496115_0307010
1611 Ga0496115_0642998
1612 Ga0501031_0005364
1613 Ga0501031_0057948
1614 Ga0501032_0050504
1615 Ga0501033_0029934
1616 Ga0501034_0053587
1617 Ga0501034_0173568
1618 Ga0501034_0186800
1619 Ga0501034_0326640
1620 Ga0501036_0008841
1621 Ga0501036_0012587
1622 Ga0501036_0055128
1623 Ga0501037_0007155
1624 Ga0501037_0063001
1625 Ga0501038_0004352
1626 Ga0501038_0010405
1627 Ga0501039_0007649
1628 Ga0501039_0019157
1629 Ga0501039_0034101
1630 Ga0501040_0009636
1631 Ga0501040_0030782
1632 Ga0501040_0086996
1633 Ga0501040_0094042
1634 Ga0501041_0005357
1635 Ga0501041_0015393
1636 Ga0501041_0054237
1637 Ga0501041_0138615
1638 Ga0501041_0161737
1639 Ga0501042_0007391
1640 Ga0501042_0323404
1641 Ga0501043_0114181
1642 Ga0501043_0136899
1643 Ga0501046_0008189
1644 Ga0501046_0137527
1645 Ga0501046_0190519
1646 Ga0501047_0028024
1647 Ga0501048_0015969
1648 Ga0501048_0078888
1649 Ga0501048_0128678
1650 Ga0501067_0004482
1651 Ga0501067_0025963
1652 Ga0501067_0026142
1653 Ga0501067_0031868
1654 Ga0501067_0081089
1655 Ga0501067_0136085
1656 Ga0501068_0001354
1657 Ga0501068_0005957
1658 Ga0501068_0018073
1659 Ga0501068_0051552
1660 Ga0501068_0073970
1661 Ga0501069_0016121
1662 Ga0501069_0019982
1663 Ga0501069_0105072
1664 Ga0501069_0127079
1665 Ga0501070_0015415
1666 Ga0501070_0020855
1667 Ga0501070_0214752
1668 Ga0501071_0009471
1669 Ga0501071_0015098
1670 Ga0501071_0046781
1671 Ga0501072_0007825
1672 Ga0501072_0015793
1673 Ga0501072_0017765
1674 Ga0501072_0026018
1675 Ga0501072_0073576
1676 Ga0501073_0000628
1677 Ga0501073_0026251
1678 Ga0501073_0087624
1679 Ga0501074_0016439
1680 Ga0501074_0024114
1681 Ga0501074_0026160
1682 Ga0501074_0103669
1683 Ga0501075_0004487
1684 Ga0501075_0005137
1685 Ga0501075_0033610
1686 Ga0501075_0148855
1687 Ga0501076_0018581
1688 Ga0501076_0065302
1689 Ga0501077_0005536
1690 Ga0501077_0009048
1691 Ga0501077_0011415
1692 Ga0501079_0007265
1693 Ga0501079_0043082
1694 Ga0501079_0077107
1695 Ga0501079_0174503
1696 Ga0501080_0021157
1697 Ga0501080_0057448
1698 Ga0501080_0067361
1699 Ga0501081_0008239
1700 Ga0501081_0011177
1701 Ga0501081_0023921
1702 Ga0501083_0000739
1703 Ga0501083_0005244
1704 Ga0501035_0069067
1705 Ga0501035_0074745
1706 Ga0501044_0095658
1707 Ga0501045_0001564
1708 Ga0501045_0002762
1709 Ga0501045_0222089
1710 nmdc:mga03n38_177166_c1
1711 nmdc:mga07m45_93842_c1
1712 nmdc:mga05p37_17104_c1
1713 nmdc:mga05p37_39397_c1
1714 nmdc:mga05p37_4337_c1
1715 nmdc:mga05p37_64172_c1
1716 nmdc:mga05p37_885_c1
1717 nmdc:mga09592_197115_c1
1718 nmdc:mga09592_303537_c1
1719 nmdc:mga09592_6255_c1
1720 nmdc:mga06r32_307375_c1
1721 nmdc:mga06r32_661127_c1
1722 nmdc:mga08y16_1003_c1
1723 nmdc:mga08y16_145036_c1
1724 nmdc:mga08y16_178663_c1
1725 nmdc:mga08y16_27785_c1
1726 nmdc:mga08y16_279118_c1
1727 nmdc:mga08y16_469887_c1
1728 nmdc:mga08y16_60710_c1
1729 nmdc:mga0n895_14233_c1
1730 nmdc:mga0n895_455325_c1
1731 nmdc:mga0n895_97399_c1
1732 nmdc:mga0rr50_121001_c1
1733 nmdc:mga0rr50_20546_c1
1734 nmdc:mga0rr50_66409_c1
1735 nmdc:mga0a205_107563_c1
1736 nmdc:mga0a205_110063_c1
1737 nmdc:mga0a205_231295_c1
1738 nmdc:mga0a205_9352_c1
1739 Ga0495601_0000238
1740 Ga0495601_0008450
1741 Ga0495601_0011451
1742 Ga0495601_0023900
1743 Ga0495601_0071041
1744 Ga0495601_0081458
1745 Ga0495601_0230248
1746 Ga0495612_0054128
1747 Ga0495595_0028779
1748 Ga0495595_0043033
1749 Ga0495595_0053527
1750 Ga0495619_0000200
1751 Ga0495619_0033926
1752 Ga0495619_0041021
1753 Ga0495619_0056785
1754 Ga0495619_0121542
1755 Ga0501084_0004886
1756 Ga0501084_0037442
1757 Ga0501084_0040580
1758 Ga0501084_0089049
1759 Ga0501084_0282052
1760 Ga0501084_0398125
1761 Ga0501082_0019554
1762 Ga0501082_0045737
1763 Ga0501082_0046905
1764 Ga0501082_0143066
1765 Ga0501082_0163468
1766 Ga0466962_0001269
1767 Ga0466962_0076178
1768 Ga0466962_0117162
1769 Ga0530510_0002748
1770 Ga0530510_0009540
1771 Ga0530510_0065593
1772 Ga0530510_0126812
1773 Ga0530510_0127397
1774 2867511325

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

230

299

0.94

PF07883

Cupin_2

Cupin domain

73

139

0.92

PF02311

AraC_binding

AraC-like ligand binding domain

233

301

0.88

PF00190

Cupin_1

Cupin

220

302

0.87

PF00905

Transpeptidase

Penicillin binding protein transpeptidase domain

1

85

0.87

PF05899

Cupin_3

EutQ-like cupin domain

225

295

0.83

PF12973

Cupin_7

ChrR Cupin-like domain

201

295

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wsf-assembly1.cif.gz_D crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii 0.9585 194 283
6l2e-assembly1.cif.gz_B crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form 0.9501 194 283
3fjs-assembly2.cif.gz_D crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution 0.9414 197 283
8ch4-assembly1.cif.gz_C crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. 0.9373 210 283
2ozj-assembly2.cif.gz_B-3 crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution 0.9309 195 283
ID Description Score Start End Superfamily
5wsdA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9408 194 282 2.60.120.10
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9348 210 282 2.60.120.10
3fjsA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9318 206 283 2.60.120.10
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9254 194 283 2.60.120.10
af_Q03188_852_942_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9216 194 284 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A524A6Q0-F1-model_v4 Cupin domain-containing protein 0.9735 194 284
AF-A0A117SU88-F1-model_v4 Cupin 0.9729 197 286
AF-L8P7J5-F1-model_v4 Cupin type-2 domain-containing protein 0.9724 186 283
AF-B5I9V5-F1-model_v4 deleted 0.9704 193 284
AF-A0A432HEA0-F1-model_v4 Cupin type-2 domain-containing protein 0.9671 193 284

Map