F484723
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 887 | 335 | 1774 | 308 |
Family's Representative Sequence
| Representative Sequence | 3300005937|Ga0081455_10116815|Ga0081455_101168152 |
| Length | 331 |
| Sequence | VRTSVAFPGESYGTLQAPDQGDPTIMGSLPIGYGVNATAAQTLGVYMTIANGGVTRPLRLVDGTLGSTHMALMLVSLVDGHIDEHLHSFETSFYVLDGEPVLYFEGRGVRLKPGACGAIPVGSPHAFRSEGAARWIEMMSPRPRVDRSDTFFLGPTPDSDPAQLDARDPRNHNLFLLTDGEMDLERLKQGQAMGAPTVSGSMATAVLAYSGIAVKMLVDQRLDAQLHTMFMVDYQPGACANPHDHPFEESYYMLEGEVDVVANGDRHTLRPGDAFWTATGCVHAFYETRGGTVRWLETSAPGPPPRHSYRHQRDWEYMAEHIASDAGVSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 64 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 167 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 168 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 169 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 170 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 178 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 179 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 180 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 184 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 185 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 186 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 188 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 189 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 205 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 206 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 217 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 218 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 273 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 274 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 275 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 276 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 277 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 280 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 281 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 282 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 283 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 284 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 285 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 314 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 315 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 319 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 320 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 334 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 335 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.32 |
| Metatranscriptomes | 0.56 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 10.6 |
| Rhizosphere | 88.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0081455_10116815 | 3300005937 | Bacteria | 2109 |
| 2 | Ga0070658_10076233 | 3300005327 | Bacteria | 2750 |
| 3 | Ga0070658_10181174 | 3300005327 | Bacteria | 1773 |
| 4 | Ga0070683_100001511 | 3300005329 | Bacteria | 17965 |
| 5 | Ga0070683_100092440 | 3300005329 | Bacteria | 2842 |
| 6 | Ga0070683_100093542 | 3300005329 | Bacteria | 2824 |
| 7 | Ga0070683_100107201 | 3300005329 | Bacteria | 2634 |
| 8 | Ga0070683_100176414 | 3300005329 | Bacteria | 2028 |
| 9 | Ga0070670_100025282 | 3300005331 | Bacteria | 5109 |
| 10 | Ga0068869_100013310 | 3300005334 | Bacteria | 5468 |
| 11 | Ga0070680_100013567 | 3300005336 | Bacteria | 6352 |
| 12 | Ga0070680_100018340 | 3300005336 | Bacteria | 5528 |
| 13 | Ga0070680_100058287 | 3300005336 | Bacteria | 3158 |
| 14 | Ga0070680_100171258 | 3300005336 | Bacteria | 1827 |
| 15 | Ga0070680_100296921 | 3300005336 | Bacteria | 1370 |
| 16 | Ga0070682_100013359 | 3300005337 | Bacteria | 4722 |
| 17 | Ga0070682_100033577 | 3300005337 | Bacteria | 3119 |
| 18 | Ga0070682_100162612 | 3300005337 | Unclassified | 1543 |
| 19 | Ga0070682_100267374 | 3300005337 | Unclassified | 1240 |
| 20 | Ga0068868_100012148 | 3300005338 | Bacteria | 6288 |
| 21 | Ga0068868_100057126 | 3300005338 | Bacteria | 3083 |
| 22 | Ga0070660_100006183 | 3300005339 | Bacteria | 8284 |
| 23 | Ga0070660_100109775 | 3300005339 | Bacteria | 2193 |
| 24 | Ga0070660_100196481 | 3300005339 | Bacteria | 1635 |
| 25 | Ga0070660_100305946 | 3300005339 | Bacteria | 1304 |
| 26 | Ga0070689_100026358 | 3300005340 | Bacteria | 4376 |
| 27 | Ga0070691_10005579 | 3300005341 | Bacteria | 5728 |
| 28 | Ga0070687_100101658 | 3300005343 | Bacteria | 1610 |
| 29 | Ga0070661_100014164 | 3300005344 | Bacteria | 5616 |
| 30 | Ga0070661_100076047 | 3300005344 | Bacteria | 2475 |
| 31 | Ga0070692_10019780 | 3300005345 | Bacteria | 3255 |
| 32 | Ga0070668_100184108 | 3300005347 | Bacteria | 1708 |
| 33 | Ga0070675_100074143 | 3300005354 | Bacteria | 2826 |
| 34 | Ga0070675_100237441 | 3300005354 | Bacteria | 1592 |
| 35 | Ga0070675_100356117 | 3300005354 | Bacteria | 1299 |
| 36 | Ga0070675_100372033 | 3300005354 | Bacteria | 1270 |
| 37 | Ga0070674_100011737 | 3300005356 | Bacteria | 5345 |
| 38 | Ga0070674_100038298 | 3300005356 | Bacteria | 3230 |
| 39 | Ga0070674_100079232 | 3300005356 | Bacteria | 2343 |
| 40 | Ga0070673_100012976 | 3300005364 | Bacteria | 5744 |
| 41 | Ga0070673_100236738 | 3300005364 | Bacteria | 1586 |
| 42 | Ga0070673_100387681 | 3300005364 | Bacteria | 1247 |
| 43 | Ga0070688_100005327 | 3300005365 | Bacteria | 6760 |
| 44 | Ga0070688_100060649 | 3300005365 | Bacteria | 2389 |
| 45 | Ga0070688_100215763 | 3300005365 | Bacteria | 1350 |
| 46 | Ga0070659_100072561 | 3300005366 | Bacteria | 2739 |
| 47 | Ga0070659_100087129 | 3300005366 | Bacteria | 2499 |
| 48 | Ga0070659_100103273 | 3300005366 | Bacteria | 2296 |
| 49 | Ga0070659_100180007 | 3300005366 | Bacteria | 1735 |
| 50 | Ga0070659_100417348 | 3300005366 | Unclassified | 1134 |
| 51 | Ga0070667_100007322 | 3300005367 | Bacteria | 9171 |
| 52 | Ga0070667_100433297 | 3300005367 | Bacteria | 1200 |
| 53 | Ga0070709_10155006 | 3300005434 | Bacteria | 1587 |
| 54 | Ga0070714_100063737 | 3300005435 | Bacteria | 3170 |
| 55 | Ga0070714_100374176 | 3300005435 | Bacteria | 1342 |
| 56 | Ga0070710_10066403 | 3300005437 | Bacteria | 2068 |
| 57 | Ga0070701_10020847 | 3300005438 | Bacteria | 3118 |
| 58 | Ga0070701_10264977 | 3300005438 | Bacteria | 1043 |
| 59 | Ga0070711_100129269 | 3300005439 | Bacteria | 1879 |
| 60 | Ga0070705_100003518 | 3300005440 | Bacteria | 7666 |
| 61 | Ga0070700_100086887 | 3300005441 | Bacteria | 2031 |
| 62 | Ga0070700_100272505 | 3300005441 | Bacteria | 1223 |
| 63 | Ga0070694_100145112 | 3300005444 | Bacteria | 1728 |
| 64 | Ga0070694_100200330 | 3300005444 | Bacteria | 1488 |
| 65 | Ga0070663_100011213 | 3300005455 | Bacteria | 5615 |
| 66 | Ga0070663_100270500 | 3300005455 | Bacteria | 1351 |
| 67 | Ga0070678_100000994 | 3300005456 | Bacteria | 14674 |
| 68 | Ga0070678_100015365 | 3300005456 | Bacteria | 4864 |
| 69 | Ga0070678_100049869 | 3300005456 | Bacteria | 3024 |
| 70 | Ga0070678_100053407 | 3300005456 | Unclassified | 2938 |
| 71 | Ga0070678_100448376 | 3300005456 | Bacteria | 1130 |
| 72 | Ga0070681_10025719 | 3300005458 | Bacteria | 5919 |
| 73 | Ga0070681_10075782 | 3300005458 | Unclassified | 3324 |
| 74 | Ga0070681_10078133 | 3300005458 | Bacteria | 3266 |
| 75 | Ga0070681_10096947 | 3300005458 | Bacteria | 2896 |
| 76 | Ga0068867_100210615 | 3300005459 | Bacteria | 1561 |
| 77 | Ga0070685_10022590 | 3300005466 | Bacteria | 3431 |
| 78 | Ga0070706_100057572 | 3300005467 | Bacteria | 3587 |
| 79 | Ga0070698_100044298 | 3300005471 | Bacteria | 4558 |
| 80 | Ga0070698_100291796 | 3300005471 | Bacteria | 1562 |
| 81 | Ga0070679_100029799 | 3300005530 | Bacteria | 5384 |
| 82 | Ga0070679_100066431 | 3300005530 | Bacteria | 3595 |
| 83 | Ga0070679_100089042 | 3300005530 | Unclassified | 3073 |
| 84 | Ga0070679_100102811 | 3300005530 | Bacteria | 2843 |
| 85 | Ga0070679_100508984 | 3300005530 | Bacteria | 1148 |
| 86 | Ga0070684_100008159 | 3300005535 | Bacteria | 8176 |
| 87 | Ga0070684_100010835 | 3300005535 | Bacteria | 7241 |
| 88 | Ga0070684_100032010 | 3300005535 | Bacteria | 4480 |
| 89 | Ga0070684_100032864 | 3300005535 | Bacteria | 4427 |
| 90 | Ga0070684_100035945 | 3300005535 | Bacteria | 4243 |
| 91 | Ga0070684_100057553 | 3300005535 | Bacteria | 3394 |
| 92 | Ga0070684_100262651 | 3300005535 | Bacteria | 1579 |
| 93 | Ga0068853_100061002 | 3300005539 | Bacteria | 3261 |
| 94 | Ga0070672_100025047 | 3300005543 | Bacteria | 4420 |
| 95 | Ga0070672_100026949 | 3300005543 | Bacteria | 4284 |
| 96 | Ga0070672_100039502 | 3300005543 | Bacteria | 3615 |
| 97 | Ga0070672_100059327 | 3300005543 | Bacteria | 3010 |
| 98 | Ga0070686_100026834 | 3300005544 | Bacteria | 3480 |
| 99 | Ga0070686_100029109 | 3300005544 | Bacteria | 3356 |
| 100 | Ga0070696_100021618 | 3300005546 | Bacteria | 4363 |
| 101 | Ga0070696_100044154 | 3300005546 | Bacteria | 3086 |
| 102 | Ga0070693_100037363 | 3300005547 | Bacteria | 2707 |
| 103 | Ga0070693_100170913 | 3300005547 | Bacteria | 1392 |
| 104 | Ga0070665_100004920 | 3300005548 | Bacteria | 13860 |
| 105 | Ga0070704_100023436 | 3300005549 | Bacteria | 4032 |
| 106 | Ga0070704_100071693 | 3300005549 | Unclassified | 2518 |
| 107 | Ga0070704_100245639 | 3300005549 | Bacteria | 1467 |
| 108 | Ga0068855_100029046 | 3300005563 | Bacteria | 6613 |
| 109 | Ga0068855_100110665 | 3300005563 | Bacteria | 3153 |
| 110 | Ga0068855_100343079 | 3300005563 | Bacteria | 1646 |
| 111 | Ga0068855_100456949 | 3300005563 | Bacteria | 1393 |
| 112 | Ga0070664_100154101 | 3300005564 | Bacteria | 2029 |
| 113 | Ga0068857_100019377 | 3300005577 | Bacteria | 5973 |
| 114 | Ga0068857_100151545 | 3300005577 | Bacteria | 2101 |
| 115 | Ga0068854_100083829 | 3300005578 | Bacteria | 2357 |
| 116 | Ga0068856_100006059 | 3300005614 | Bacteria | 11883 |
| 117 | Ga0068856_100078434 | 3300005614 | Bacteria | 3274 |
| 118 | Ga0068856_100084892 | 3300005614 | Bacteria | 3146 |
| 119 | Ga0068856_100114058 | 3300005614 | Bacteria | 2701 |
| 120 | Ga0068856_100380344 | 3300005614 | Unclassified | 1431 |
| 121 | Ga0070702_100001248 | 3300005615 | Bacteria | 10318 |
| 122 | Ga0068852_100262228 | 3300005616 | Bacteria | 1659 |
| 123 | Ga0068852_100272389 | 3300005616 | Bacteria | 1629 |
| 124 | Ga0068852_100408045 | 3300005616 | Bacteria | 1338 |
| 125 | Ga0068859_100187523 | 3300005617 | Bacteria | 2152 |
| 126 | Ga0068859_100240480 | 3300005617 | Bacteria | 1899 |
| 127 | Ga0068864_100310433 | 3300005618 | Unclassified | 1478 |
| 128 | Ga0068866_10080690 | 3300005718 | Unclassified | 1746 |
| 129 | Ga0068866_10100199 | 3300005718 | Bacteria | 1597 |
| 130 | Ga0068861_100031844 | 3300005719 | Bacteria | 3878 |
| 131 | Ga0068861_100186435 | 3300005719 | Bacteria | 1731 |
| 132 | Ga0068861_100202348 | 3300005719 | Unclassified | 1668 |
| 133 | Ga0068851_10017806 | 3300005834 | Bacteria | 3418 |
| 134 | Ga0068870_10022120 | 3300005840 | Bacteria | 3121 |
| 135 | Ga0068870_10028295 | 3300005840 | Bacteria | 2813 |
| 136 | Ga0068870_10156408 | 3300005840 | Bacteria | 1348 |
| 137 | Ga0068860_100009233 | 3300005843 | Bacteria | 9802 |
| 138 | Ga0068860_100073582 | 3300005843 | Bacteria | 3248 |
| 139 | Ga0068860_100600383 | 3300005843 | Bacteria | 1106 |
| 140 | Ga0068862_100181001 | 3300005844 | Bacteria | 1892 |
| 141 | Ga0081455_10008878 | 3300005937 | Bacteria | 10394 |
| 142 | Ga0081455_10011995 | 3300005937 | Bacteria | 8672 |
| 143 | Ga0081455_10020170 | 3300005937 | Bacteria | 6288 |
| 144 | Ga0081540_1004204 | 3300005983 | Bacteria | 11064 |
| 145 | Ga0081540_1019924 | 3300005983 | Bacteria | 4054 |
| 146 | Ga0070717_10002940 | 3300006028 | Bacteria | 12103 |
| 147 | Ga0070717_10016455 | 3300006028 | Bacteria | 5734 |
| 148 | Ga0075432_10001987 | 3300006058 | Bacteria | 6795 |
| 149 | Ga0070715_10011274 | 3300006163 | Bacteria | 3215 |
| 150 | Ga0070716_100272845 | 3300006173 | Bacteria | 1163 |
| 151 | Ga0070712_100027127 | 3300006175 | Bacteria | 3822 |
| 152 | Ga0070712_100043402 | 3300006175 | Bacteria | 3095 |
| 153 | Ga0097621_100028225 | 3300006237 | Bacteria | 4422 |
| 154 | Ga0097621_100258788 | 3300006237 | Bacteria | 1526 |
| 155 | Ga0075370_10032801 | 3300006353 | Bacteria | 2905 |
| 156 | Ga0068871_100006072 | 3300006358 | Bacteria | 8500 |
| 157 | Ga0075428_100000211 | 3300006844 | Bacteria | 56062 |
| 158 | Ga0075428_100001472 | 3300006844 | Bacteria | 25194 |
| 159 | Ga0075428_100297963 | 3300006844 | Unclassified | 1734 |
| 160 | Ga0075428_100540641 | 3300006844 | Bacteria | 1246 |
| 161 | Ga0075433_10012759 | 3300006852 | Bacteria | 6803 |
| 162 | Ga0075433_10305536 | 3300006852 | Bacteria | 1408 |
| 163 | Ga0075434_100237257 | 3300006871 | Bacteria | 1843 |
| 164 | Ga0075429_100005341 | 3300006880 | Bacteria | 11052 |
| 165 | Ga0075429_100183184 | 3300006880 | Bacteria | 1835 |
| 166 | Ga0068865_100013452 | 3300006881 | Bacteria | 5171 |
| 167 | Ga0068865_100015100 | 3300006881 | Bacteria | 4920 |
| 168 | Ga0068865_100181824 | 3300006881 | Bacteria | 1620 |
| 169 | Ga0097620_100187522 | 3300006931 | Bacteria | 2152 |
| 170 | Ga0097620_100240495 | 3300006931 | Bacteria | 1899 |
| 171 | Ga0075435_100007124 | 3300007076 | Bacteria | 7943 |
| 172 | Ga0105240_10154991 | 3300009093 | Bacteria | 2725 |
| 173 | Ga0105240_10160060 | 3300009093 | Bacteria | 2675 |
| 174 | Ga0105240_10291224 | 3300009093 | Bacteria | 1871 |
| 175 | Ga0105240_10377992 | 3300009093 | Unclassified | 1600 |
| 176 | Ga0111539_10003281 | 3300009094 | Bacteria | 21391 |
| 177 | Ga0111539_10072396 | 3300009094 | Bacteria | 4064 |
| 178 | Ga0111539_10103504 | 3300009094 | Bacteria | 3341 |
| 179 | Ga0111539_10195746 | 3300009094 | Bacteria | 2358 |
| 180 | Ga0111539_10241429 | 3300009094 | Bacteria | 2103 |
| 181 | Ga0111539_10302662 | 3300009094 | Bacteria | 1861 |
| 182 | Ga0105245_10001672 | 3300009098 | Bacteria | 20188 |
| 183 | Ga0105245_10006039 | 3300009098 | Bacteria | 10648 |
| 184 | Ga0105245_10029684 | 3300009098 | Bacteria | 4834 |
| 185 | Ga0105245_10082162 | 3300009098 | Bacteria | 2947 |
| 186 | Ga0105245_10110460 | 3300009098 | Bacteria | 2556 |
| 187 | Ga0105245_10164739 | 3300009098 | Bacteria | 2106 |
| 188 | Ga0105245_10170744 | 3300009098 | Bacteria | 2071 |
| 189 | Ga0105245_10241557 | 3300009098 | Bacteria | 1751 |
| 190 | Ga0105245_10292019 | 3300009098 | Bacteria | 1597 |
| 191 | Ga0105245_10397160 | 3300009098 | Bacteria | 1377 |
| 192 | Ga0105245_10675696 | 3300009098 | Bacteria | 1064 |
| 193 | Ga0105247_10006987 | 3300009101 | Bacteria | 6947 |
| 194 | Ga0105247_10031086 | 3300009101 | Bacteria | 3239 |
| 195 | Ga0114129_10002058 | 3300009147 | Bacteria | 27627 |
| 196 | Ga0114129_10014359 | 3300009147 | Bacteria | 11289 |
| 197 | Ga0114129_10062127 | 3300009147 | Bacteria | 5219 |
| 198 | Ga0105243_10004171 | 3300009148 | Bacteria | 11463 |
| 199 | Ga0105243_10013258 | 3300009148 | Bacteria | 6233 |
| 200 | Ga0105243_10020248 | 3300009148 | Bacteria | 5045 |
| 201 | Ga0105243_10022730 | 3300009148 | Bacteria | 4768 |
| 202 | Ga0105243_10244705 | 3300009148 | Bacteria | 1598 |
| 203 | Ga0105243_10597865 | 3300009148 | Bacteria | 1062 |
| 204 | Ga0105241_10017128 | 3300009174 | Bacteria | 5321 |
| 205 | Ga0105241_10110414 | 3300009174 | Bacteria | 2200 |
| 206 | Ga0105241_10114021 | 3300009174 | Bacteria | 2167 |
| 207 | Ga0105242_10008815 | 3300009176 | Bacteria | 7739 |
| 208 | Ga0105242_10186334 | 3300009176 | Bacteria | 1834 |
| 209 | Ga0105242_10507503 | 3300009176 | Unclassified | 1148 |
| 210 | Ga0105248_10017461 | 3300009177 | Bacteria | 7912 |
| 211 | Ga0105248_10170081 | 3300009177 | Bacteria | 2456 |
| 212 | Ga0105248_10492822 | 3300009177 | Bacteria | 1381 |
| 213 | Ga0105237_10101507 | 3300009545 | Bacteria | 2869 |
| 214 | Ga0105238_10010169 | 3300009551 | Bacteria | 9437 |
| 215 | Ga0105238_10046758 | 3300009551 | Bacteria | 4365 |
| 216 | Ga0105238_10125091 | 3300009551 | Bacteria | 2551 |
| 217 | Ga0105249_10010169 | 3300009553 | Bacteria | 8262 |
| 218 | Ga0105249_10102276 | 3300009553 | Bacteria | 2696 |
| 219 | Ga0105239_10031419 | 3300010375 | Bacteria | 5840 |
| 220 | Ga0105239_10054676 | 3300010375 | Bacteria | 4379 |
| 221 | Ga0105239_10319808 | 3300010375 | Bacteria | 1750 |
| 222 | Ga0105246_10042671 | 3300011119 | Bacteria | 3072 |
| 223 | Ga0105246_10073261 | 3300011119 | Bacteria | 2417 |
| 224 | Ga0105246_10163486 | 3300011119 | Bacteria | 1698 |
| 225 | Ga0105246_10180281 | 3300011119 | Bacteria | 1626 |
| 226 | Ga0157373_10104342 | 3300013100 | Bacteria | 1994 |
| 227 | Ga0157371_10090213 | 3300013102 | Bacteria | 2171 |
| 228 | Ga0157370_10022377 | 3300013104 | Bacteria | 6289 |
| 229 | Ga0157370_10026174 | 3300013104 | Bacteria | 5762 |
| 230 | Ga0157370_10033161 | 3300013104 | Bacteria | 5035 |
| 231 | Ga0157370_10054870 | 3300013104 | Bacteria | 3798 |
| 232 | Ga0157369_10017118 | 3300013105 | Bacteria | 8145 |
| 233 | Ga0157369_10022942 | 3300013105 | Bacteria | 6960 |
| 234 | Ga0157369_10220950 | 3300013105 | Bacteria | 1983 |
| 235 | Ga0157369_10225011 | 3300013105 | Bacteria | 1963 |
| 236 | Ga0157369_10372889 | 3300013105 | Bacteria | 1481 |
| 237 | Ga0157374_10026077 | 3300013296 | Bacteria | 5255 |
| 238 | Ga0157374_10076623 | 3300013296 | Bacteria | 3162 |
| 239 | Ga0157374_10275298 | 3300013296 | Bacteria | 1660 |
| 240 | Ga0157374_10341577 | 3300013296 | Bacteria | 1486 |
| 241 | Ga0157374_10660026 | 3300013296 | Bacteria | 1058 |
| 242 | Ga0157378_10017333 | 3300013297 | Bacteria | 6319 |
| 243 | Ga0163162_10008756 | 3300013306 | Bacteria | 9844 |
| 244 | Ga0163162_10188599 | 3300013306 | Bacteria | 2189 |
| 245 | Ga0157372_10011088 | 3300013307 | Bacteria | 9588 |
| 246 | Ga0157372_10043786 | 3300013307 | Bacteria | 4958 |
| 247 | Ga0157372_10240480 | 3300013307 | Bacteria | 2101 |
| 248 | Ga0157372_10342294 | 3300013307 | Bacteria | 1742 |
| 249 | Ga0157372_10536835 | 3300013307 | Unclassified | 1363 |
| 250 | Ga0157372_10782626 | 3300013307 | Bacteria | 1109 |
| 251 | Ga0157375_10023433 | 3300013308 | Bacteria | 5696 |
| 252 | Ga0157375_10059076 | 3300013308 | Bacteria | 3797 |
| 253 | Ga0157375_10062507 | 3300013308 | Bacteria | 3700 |
| 254 | Ga0157375_10442499 | 3300013308 | Bacteria | 1465 |
| 255 | Ga0163163_10039202 | 3300014325 | Bacteria | 4622 |
| 256 | Ga0163163_10090670 | 3300014325 | Bacteria | 3070 |
| 257 | Ga0157380_10240770 | 3300014326 | Bacteria | 1631 |
| 258 | Ga0157380_10502705 | 3300014326 | Bacteria | 1178 |
| 259 | Ga0182008_10003683 | 3300014497 | Bacteria | 9148 |
| 260 | Ga0182008_10153664 | 3300014497 | Bacteria | 1155 |
| 261 | Ga0157377_10006166 | 3300014745 | Bacteria | 5697 |
| 262 | Ga0157377_10035532 | 3300014745 | Bacteria | 2734 |
| 263 | Ga0157377_10123251 | 3300014745 | Bacteria | 1573 |
| 264 | Ga0157379_10005788 | 3300014968 | Bacteria | 10641 |
| 265 | Ga0157376_10006519 | 3300014969 | Bacteria | 8252 |
| 266 | Ga0157376_10115771 | 3300014969 | Bacteria | 2367 |
| 267 | Ga0157376_10135635 | 3300014969 | Bacteria | 2202 |
| 268 | Ga0157376_10368150 | 3300014969 | Bacteria | 1380 |
| 269 | Ga0182006_1028239 | 3300015261 | Bacteria | 2283 |
| 270 | Ga0163161_10185366 | 3300017792 | Bacteria | 1597 |
| 271 | Ga0206354_10152404 | 3300020081 | Bacteria | 1245 |
| 272 | Ga0206354_11376887 | 3300020081 | Bacteria | 1861 |
| 273 | Ga0206353_10290895 | 3300020082 | Bacteria | 2239 |
| 274 | Ga0206353_10835708 | 3300020082 | Bacteria | 3039 |
| 275 | Ga0224712_10077945 | 3300022467 | Unclassified | 1361 |
| 276 | Ga0207692_10009347 | 3300025898 | Bacteria | 4090 |
| 277 | Ga0207692_10091408 | 3300025898 | Bacteria | 1651 |
| 278 | Ga0207688_10009635 | 3300025901 | Bacteria | 5260 |
| 279 | Ga0207688_10114845 | 3300025901 | Bacteria | 1566 |
| 280 | Ga0207685_10006858 | 3300025905 | Bacteria | 3134 |
| 281 | Ga0207699_10254154 | 3300025906 | Bacteria | 1212 |
| 282 | Ga0207645_10054967 | 3300025907 | Bacteria | 2542 |
| 283 | Ga0207643_10003002 | 3300025908 | Bacteria | 9098 |
| 284 | Ga0207643_10029234 | 3300025908 | Bacteria | 3065 |
| 285 | Ga0207643_10034512 | 3300025908 | Bacteria | 2834 |
| 286 | Ga0207705_10016247 | 3300025909 | Bacteria | 5337 |
| 287 | Ga0207705_10130907 | 3300025909 | Bacteria | 1867 |
| 288 | Ga0207684_10071765 | 3300025910 | Bacteria | 2941 |
| 289 | Ga0207654_10017694 | 3300025911 | Bacteria | 3731 |
| 290 | Ga0207695_10321502 | 3300025913 | Bacteria | 1437 |
| 291 | Ga0207671_10136865 | 3300025914 | Bacteria | 1884 |
| 292 | Ga0207693_10000919 | 3300025915 | Bacteria | 26430 |
| 293 | Ga0207693_10037360 | 3300025915 | Bacteria | 3828 |
| 294 | Ga0207693_10056444 | 3300025915 | Bacteria | 3079 |
| 295 | Ga0207693_10057330 | 3300025915 | Bacteria | 3053 |
| 296 | Ga0207693_10092213 | 3300025915 | Bacteria | 2374 |
| 297 | Ga0207663_10023698 | 3300025916 | Bacteria | 3526 |
| 298 | Ga0207663_10283008 | 3300025916 | Unclassified | 1232 |
| 299 | Ga0207660_10022675 | 3300025917 | Bacteria | 4232 |
| 300 | Ga0207660_10032251 | 3300025917 | Bacteria | 3615 |
| 301 | Ga0207662_10017719 | 3300025918 | Bacteria | 4032 |
| 302 | Ga0207657_10005718 | 3300025919 | Bacteria | 12973 |
| 303 | Ga0207657_10008090 | 3300025919 | Bacteria | 10721 |
| 304 | Ga0207657_10020451 | 3300025919 | Bacteria | 6254 |
| 305 | Ga0207657_10074418 | 3300025919 | Bacteria | 2868 |
| 306 | Ga0207657_10221440 | 3300025919 | Unclassified | 1516 |
| 307 | Ga0207649_10077221 | 3300025920 | Unclassified | 2145 |
| 308 | Ga0207649_10165416 | 3300025920 | Bacteria | 1536 |
| 309 | Ga0207652_10008696 | 3300025921 | Bacteria | 8175 |
| 310 | Ga0207652_10047664 | 3300025921 | Bacteria | 3661 |
| 311 | Ga0207652_10191680 | 3300025921 | Bacteria | 1839 |
| 312 | Ga0207652_10414841 | 3300025921 | Bacteria | 1214 |
| 313 | Ga0207646_10167050 | 3300025922 | Bacteria | 1987 |
| 314 | Ga0207681_10156803 | 3300025923 | Bacteria | 1712 |
| 315 | Ga0207650_10016445 | 3300025925 | Bacteria | 5171 |
| 316 | Ga0207650_10088839 | 3300025925 | Bacteria | 2357 |
| 317 | Ga0207659_10052897 | 3300025926 | Bacteria | 2895 |
| 318 | Ga0207659_10206227 | 3300025926 | Bacteria | 1573 |
| 319 | Ga0207659_10325964 | 3300025926 | Bacteria | 1268 |
| 320 | Ga0207687_10002244 | 3300025927 | Bacteria | 13162 |
| 321 | Ga0207687_10021313 | 3300025927 | Bacteria | 4305 |
| 322 | Ga0207687_10426966 | 3300025927 | Bacteria | 1095 |
| 323 | Ga0207700_10092550 | 3300025928 | Bacteria | 2390 |
| 324 | Ga0207664_10014782 | 3300025929 | Bacteria | 5650 |
| 325 | Ga0207664_10042768 | 3300025929 | Bacteria | 3539 |
| 326 | Ga0207664_10094015 | 3300025929 | Bacteria | 2463 |
| 327 | Ga0207664_10304207 | 3300025929 | Bacteria | 1403 |
| 328 | Ga0207664_10341110 | 3300025929 | Unclassified | 1325 |
| 329 | Ga0207690_10021370 | 3300025932 | Bacteria | 4013 |
| 330 | Ga0207690_10138948 | 3300025932 | Bacteria | 1788 |
| 331 | Ga0207706_10012502 | 3300025933 | Bacteria | 7732 |
| 332 | Ga0207686_10004653 | 3300025934 | Bacteria | 7352 |
| 333 | Ga0207686_10048505 | 3300025934 | Bacteria | 2631 |
| 334 | Ga0207709_10018813 | 3300025935 | Bacteria | 3874 |
| 335 | Ga0207709_10025212 | 3300025935 | Bacteria | 3403 |
| 336 | Ga0207709_10149945 | 3300025935 | Bacteria | 1614 |
| 337 | Ga0207709_10203327 | 3300025935 | Bacteria | 1416 |
| 338 | Ga0207670_10258609 | 3300025936 | Unclassified | 1348 |
| 339 | Ga0207669_10103895 | 3300025937 | Unclassified | 1886 |
| 340 | Ga0207669_10173171 | 3300025937 | Bacteria | 1539 |
| 341 | Ga0207704_10060366 | 3300025938 | Bacteria | 2346 |
| 342 | Ga0207704_10202757 | 3300025938 | Bacteria | 1453 |
| 343 | Ga0207665_10000603 | 3300025939 | Bacteria | 24124 |
| 344 | Ga0207665_10345045 | 3300025939 | Unclassified | 1123 |
| 345 | Ga0207691_10009210 | 3300025940 | Bacteria | 9476 |
| 346 | Ga0207691_10039180 | 3300025940 | Bacteria | 4384 |
| 347 | Ga0207691_10059619 | 3300025940 | Bacteria | 3470 |
| 348 | Ga0207711_10110490 | 3300025941 | Bacteria | 2444 |
| 349 | Ga0207689_10026647 | 3300025942 | Bacteria | 4842 |
| 350 | Ga0207661_10000463 | 3300025944 | Bacteria | 26200 |
| 351 | Ga0207661_10124436 | 3300025944 | Unclassified | 2200 |
| 352 | Ga0207661_10152477 | 3300025944 | Bacteria | 1998 |
| 353 | Ga0207661_10203623 | 3300025944 | Bacteria | 1741 |
| 354 | Ga0207661_10221511 | 3300025944 | Bacteria | 1672 |
| 355 | Ga0207661_10248871 | 3300025944 | Bacteria | 1579 |
| 356 | Ga0207661_10266690 | 3300025944 | Bacteria | 1527 |
| 357 | Ga0207661_10495324 | 3300025944 | Bacteria | 1116 |
| 358 | Ga0207679_10116931 | 3300025945 | Bacteria | 2115 |
| 359 | Ga0207679_10148461 | 3300025945 | Bacteria | 1905 |
| 360 | Ga0207679_10280734 | 3300025945 | Bacteria | 1428 |
| 361 | Ga0207667_10305153 | 3300025949 | Bacteria | 1626 |
| 362 | Ga0207667_10394436 | 3300025949 | Bacteria | 1409 |
| 363 | Ga0207651_10109468 | 3300025960 | Bacteria | 2070 |
| 364 | Ga0207651_10327181 | 3300025960 | Bacteria | 1283 |
| 365 | Ga0207640_10043944 | 3300025981 | Bacteria | 2859 |
| 366 | Ga0207658_10010769 | 3300025986 | Bacteria | 6221 |
| 367 | Ga0207658_10350864 | 3300025986 | Unclassified | 1285 |
| 368 | Ga0207639_10364946 | 3300026041 | Bacteria | 1293 |
| 369 | Ga0207678_10008989 | 3300026067 | Bacteria | 8792 |
| 370 | Ga0207678_10021648 | 3300026067 | Bacteria | 5638 |
| 371 | Ga0207678_10031027 | 3300026067 | Bacteria | 4664 |
| 372 | Ga0207678_10163303 | 3300026067 | Bacteria | 1902 |
| 373 | Ga0207678_10270707 | 3300026067 | Bacteria | 1456 |
| 374 | Ga0207708_10021885 | 3300026075 | Bacteria | 4824 |
| 375 | Ga0207708_10052203 | 3300026075 | Bacteria | 3114 |
| 376 | Ga0207708_10178681 | 3300026075 | Unclassified | 1684 |
| 377 | Ga0207702_10015391 | 3300026078 | Bacteria | 6339 |
| 378 | Ga0207702_10028487 | 3300026078 | Bacteria | 4643 |
| 379 | Ga0207702_10058258 | 3300026078 | Bacteria | 3287 |
| 380 | Ga0207702_10137960 | 3300026078 | Bacteria | 2203 |
| 381 | Ga0207641_10352200 | 3300026088 | Bacteria | 1404 |
| 382 | Ga0207648_10043497 | 3300026089 | Bacteria | 3942 |
| 383 | Ga0207648_10118497 | 3300026089 | Bacteria | 2327 |
| 384 | Ga0207676_10572720 | 3300026095 | Unclassified | 1081 |
| 385 | Ga0207674_10028849 | 3300026116 | Bacteria | 5850 |
| 386 | Ga0207674_10117157 | 3300026116 | Bacteria | 2634 |
| 387 | Ga0207674_10173072 | 3300026116 | Bacteria | 2112 |
| 388 | Ga0207674_10190368 | 3300026116 | Bacteria | 2001 |
| 389 | Ga0207674_10214023 | 3300026116 | Bacteria | 1876 |
| 390 | Ga0207675_100001496 | 3300026118 | Bacteria | 23416 |
| 391 | Ga0207675_100083606 | 3300026118 | Bacteria | 2994 |
| 392 | Ga0207675_100309253 | 3300026118 | Bacteria | 1541 |
| 393 | Ga0207683_10002515 | 3300026121 | Bacteria | 16003 |
| 394 | Ga0207683_10004769 | 3300026121 | Bacteria | 11676 |
| 395 | Ga0207683_10028730 | 3300026121 | Bacteria | 4810 |
| 396 | Ga0207683_10060153 | 3300026121 | Bacteria | 3339 |
| 397 | Ga0207683_10106557 | 3300026121 | Bacteria | 2507 |
| 398 | Ga0207683_10198294 | 3300026121 | Bacteria | 1824 |
| 399 | Ga0207683_10264401 | 3300026121 | Bacteria | 1571 |
| 400 | Ga0207698_10385298 | 3300026142 | Bacteria | 1335 |
| 401 | Ga0207698_10419970 | 3300026142 | Bacteria | 1283 |
| 402 | Ga0207428_10000315 | 3300027907 | Bacteria | 63531 |
| 403 | Ga0207428_10070484 | 3300027907 | Bacteria | 2747 |
| 404 | Ga0207428_10125946 | 3300027907 | Bacteria | 1962 |
| 405 | Ga0207428_10219666 | 3300027907 | Bacteria | 1425 |
| 406 | Ga0268266_10047771 | 3300028379 | Bacteria | 3668 |
| 407 | Ga0268266_10073210 | 3300028379 | Bacteria | 2973 |
| 408 | Ga0265319_1004366 | 3300028563 | Bacteria | 7009 |
| 409 | Ga0265318_10019213 | 3300028577 | Bacteria | 2773 |
| 410 | Ga0265322_10013754 | 3300028654 | Bacteria | 2343 |
| 411 | Ga0265338_10015737 | 3300028800 | Bacteria | 8285 |
| 412 | Ga0265338_10065827 | 3300028800 | Bacteria | 3140 |
| 413 | Ga0265338_10098097 | 3300028800 | Bacteria | 2398 |
| 414 | Ga0265338_10117088 | 3300028800 | Unclassified | 2133 |
| 415 | Ga0265338_10137691 | 3300028800 | Bacteria | 1916 |
| 416 | Ga0265330_10063643 | 3300031235 | Bacteria | 1603 |
| 417 | Ga0265332_10023968 | 3300031238 | Bacteria | 2689 |
| 418 | Ga0265320_10050370 | 3300031240 | Bacteria | 2024 |
| 419 | Ga0265325_10044993 | 3300031241 | Bacteria | 2295 |
| 420 | Ga0265340_10042406 | 3300031247 | Bacteria | 2234 |
| 421 | Ga0265339_10007410 | 3300031249 | Bacteria | 7094 |
| 422 | Ga0265331_10059062 | 3300031250 | Bacteria | 1814 |
| 423 | Ga0265331_10113581 | 3300031250 | Bacteria | 1241 |
| 424 | Ga0265316_10020436 | 3300031344 | Bacteria | 5634 |
| 425 | Ga0265313_10026781 | 3300031595 | Bacteria | 3030 |
| 426 | Ga0265314_10006777 | 3300031711 | Bacteria | 10049 |
| 427 | Ga0265314_10050555 | 3300031711 | Bacteria | 2902 |
| 428 | Ga0265342_10031976 | 3300031712 | Bacteria | 3248 |
| 429 | Ga0307410_10408239 | 3300031852 | Unclassified | 1099 |
| 430 | Ga0307406_10161587 | 3300031901 | Bacteria | 1611 |
| 431 | Ga0307409_100134476 | 3300031995 | Bacteria | 2119 |
| 432 | Ga0307415_100046294 | 3300032126 | Bacteria | 2921 |
| 433 | Ga0316583_10018819 | 3300032133 | Bacteria | 2481 |
| 434 | Ga0373930_0014340 | 3300034816 | Bacteria | 1475 |
| 435 | Ga0373929_0018991 | 3300035085 | Bacteria | 1372 |
| 436 | Ga0373939_0025347 | 3300035114 | Bacteria | 1662 |
| 437 | Ga0373946_0051029 | 3300035171 | Bacteria | 1730 |
| 438 | Ga0373955_0102617 | 3300035172 | Bacteria | 1644 |
| 439 | Ga0373942_0007075 | 3300035207 | Bacteria | 2595 |
| 440 | Ga0373962_0021804 | 3300035242 | Bacteria | 1693 |
| 441 | Ga0373962_0081365 | 3300035242 | Unclassified | 984 |
| 442 | Ga0373931_0027133 | 3300035691 | Bacteria | 2920 |
| 443 | Ga0373935_0035974 | 3300035692 | Bacteria | 3093 |
| 444 | Ga0373935_0100154 | 3300035692 | Bacteria | 1909 |
| 445 | Ga0373935_0182079 | 3300035692 | Bacteria | 1443 |
| 446 | Ga0373927_0006434 | 3300035695 | Bacteria | 8004 |
| 447 | Ga0373947_0049242 | 3300035725 | Bacteria | 2529 |
| 448 | Ga0373937_0001462 | 3300036401 | Bacteria | 19776 |
| 449 | Ga0373937_0013260 | 3300036401 | Bacteria | 7259 |
| 450 | Ga0373937_0073725 | 3300036401 | Bacteria | 3149 |
| 451 | Ga0373937_0715789 | 3300036401 | Bacteria | 948 |
| 452 | Ga0373925_0016109 | 3300037068 | Bacteria | 5413 |
| 453 | Ga0373925_0050590 | 3300037068 | Unclassified | 3099 |
| 454 | Ga0373925_0188903 | 3300037068 | Bacteria | 1634 |
| 455 | Ga0395900_0088362 | 3300037418 | Bacteria | 3186 |
| 456 | Ga0395900_0151455 | 3300037418 | Unclassified | 2369 |
| 457 | Ga0395898_0027962 | 3300037466 | Bacteria | 5655 |
| 458 | Ga0395898_0056257 | 3300037466 | Bacteria | 3835 |
| 459 | Ga0395898_0087418 | 3300037466 | Bacteria | 3002 |
| 460 | Ga0395898_0230316 | 3300037466 | Bacteria | 1767 |
| 461 | Ga0395898_0289599 | 3300037466 | Bacteria | 1562 |
| 462 | Ga0395905_0048403 | 3300037471 | Bacteria | 3984 |
| 463 | Ga0395901_0009918 | 3300038443 | Bacteria | 9655 |
| 464 | Ga0395901_0047081 | 3300038443 | Bacteria | 4478 |
| 465 | Ga0395901_0127304 | 3300038443 | Bacteria | 2676 |
| 466 | Ga0395901_0180943 | 3300038443 | Bacteria | 2211 |
| 467 | Ga0395901_0484025 | 3300038443 | Unclassified | 1262 |
| 468 | Ga0395901_0580517 | 3300038443 | Bacteria | 1132 |
| 469 | Ga0439448_0069147 | 3300042005 | Unclassified | 1175 |
| 470 | Ga0450920_001235 | 3300042122 | Bacteria | 4198 |
| 471 | Ga0450923_042774 | 3300042125 | Unclassified | 956 |
| 472 | Ga0450906_006760 | 3300042145 | Bacteria | 2296 |
| 473 | Ga0439458_0005864 | 3300042157 | Bacteria | 2752 |
| 474 | Ga0439459_0021336 | 3300042438 | Bacteria | 1243 |
| 475 | Ga0466969_0075969 | 3300044656 | Bacteria | 1609 |
| 476 | Ga0466965_0048264 | 3300044683 | Bacteria | 2109 |
| 477 | Ga0466966_0093580 | 3300044684 | Bacteria | 1863 |
| 478 | Ga0466961_0009894 | 3300044693 | Bacteria | 6077 |
| 479 | Ga0466961_0017102 | 3300044693 | Bacteria | 4657 |
| 480 | Ga0466961_0046450 | 3300044693 | Bacteria | 2777 |
| 481 | Ga0466963_0000205 | 3300044694 | Bacteria | 25099 |
| 482 | Ga0466963_0001336 | 3300044694 | Bacteria | 13143 |
| 483 | Ga0466963_0003667 | 3300044694 | Bacteria | 8837 |
| 484 | Ga0466963_0004431 | 3300044694 | Bacteria | 8159 |
| 485 | Ga0466963_0023517 | 3300044694 | Bacteria | 3914 |
| 486 | Ga0466963_0047499 | 3300044694 | Bacteria | 2833 |
| 487 | Ga0466963_0073009 | 3300044694 | Bacteria | 2312 |
| 488 | Ga0466963_0086263 | 3300044694 | Bacteria | 2133 |
| 489 | Ga0466964_0002840 | 3300044706 | Bacteria | 6244 |
| 490 | Ga0466964_0012332 | 3300044706 | Bacteria | 3234 |
| 491 | Ga0466964_0021517 | 3300044706 | Bacteria | 2495 |
| 492 | Ga0466964_0030843 | 3300044706 | Bacteria | 2124 |
| 493 | Ga0466964_0053489 | 3300044706 | Bacteria | 1662 |
| 494 | Ga0466971_0002531 | 3300044719 | Bacteria | 7726 |
| 495 | Ga0466971_0010508 | 3300044719 | Bacteria | 4047 |
| 496 | Ga0466957_0000280 | 3300044842 | Bacteria | 24823 |
| 497 | Ga0466957_0030847 | 3300044842 | Bacteria | 3201 |
| 498 | Ga0466957_0120445 | 3300044842 | Bacteria | 1672 |
| 499 | Ga0466959_0014713 | 3300045049 | Bacteria | 5695 |
| 500 | Ga0466959_0079467 | 3300045049 | Bacteria | 2364 |
| 501 | Ga0451576_0039636 | 3300045051 | Bacteria | 4986 |
| 502 | Ga0451576_0135991 | 3300045051 | Bacteria | 2563 |
| 503 | Ga0451576_0430452 | 3300045051 | Bacteria | 1385 |
| 504 | Ga0466958_0012132 | 3300045836 | Bacteria | 4871 |
| 505 | Ga0466958_0034792 | 3300045836 | Bacteria | 3007 |
| 506 | Ga0466958_0083071 | 3300045836 | Bacteria | 1974 |
| 507 | Ga0466958_0125774 | 3300045836 | Bacteria | 1607 |
| 508 | Ga0466967_0004529 | 3300045976 | Bacteria | 9400 |
| 509 | Ga0466967_0005434 | 3300045976 | Bacteria | 8833 |
| 510 | Ga0466967_0013824 | 3300045976 | Bacteria | 6258 |
| 511 | Ga0466967_0016123 | 3300045976 | Bacteria | 5881 |
| 512 | Ga0466967_0026731 | 3300045976 | Bacteria | 4787 |
| 513 | Ga0466967_0051112 | 3300045976 | Bacteria | 3621 |
| 514 | Ga0466967_0073437 | 3300045976 | Bacteria | 3069 |
| 515 | Ga0466967_0093798 | 3300045976 | Bacteria | 2732 |
| 516 | Ga0466967_0121901 | 3300045976 | Bacteria | 2410 |
| 517 | Ga0466967_0184283 | 3300045976 | Bacteria | 1970 |
| 518 | Ga0466967_0221367 | 3300045976 | Bacteria | 1798 |
| 519 | Ga0466967_0344136 | 3300045976 | Bacteria | 1442 |
| 520 | Ga0495592_0000207 | 3300046454 | Bacteria | 50220 |
| 521 | Ga0495592_0141323 | 3300046454 | Unclassified | 1674 |
| 522 | Ga0495603_0000445 | 3300046455 | Bacteria | 22677 |
| 523 | Ga0495603_0051865 | 3300046455 | Bacteria | 2436 |
| 524 | Ga0495603_0059720 | 3300046455 | Bacteria | 2254 |
| 525 | Ga0495603_0098158 | 3300046455 | Bacteria | 1711 |
| 526 | Ga0495629_0003295 | 3300046459 | Bacteria | 12198 |
| 527 | Ga0495629_0050293 | 3300046459 | Bacteria | 2919 |
| 528 | Ga0495629_0333112 | 3300046459 | Bacteria | 1037 |
| 529 | Ga0495641_0004373 | 3300046461 | Bacteria | 10014 |
| 530 | Ga0495641_0082627 | 3300046461 | Bacteria | 1438 |
| 531 | Ga0495651_0000106 | 3300046462 | Bacteria | 61363 |
| 532 | Ga0495651_0065641 | 3300046462 | Bacteria | 2771 |
| 533 | Ga0495653_0000290 | 3300046463 | Bacteria | 40612 |
| 534 | Ga0495653_0008918 | 3300046463 | Bacteria | 8201 |
| 535 | Ga0495653_0068050 | 3300046463 | Bacteria | 2672 |
| 536 | Ga0495653_0092294 | 3300046463 | Bacteria | 2211 |
| 537 | Ga0495582_0000516 | 3300046473 | Bacteria | 21253 |
| 538 | Ga0495582_0007912 | 3300046473 | Bacteria | 5875 |
| 539 | Ga0495582_0040172 | 3300046473 | Bacteria | 2576 |
| 540 | Ga0495582_0059933 | 3300046473 | Bacteria | 2100 |
| 541 | Ga0495639_0001552 | 3300046475 | Bacteria | 10257 |
| 542 | Ga0495639_0105458 | 3300046475 | Unclassified | 1334 |
| 543 | Ga0495662_0013779 | 3300046476 | Bacteria | 3936 |
| 544 | Ga0495664_0111167 | 3300046477 | Bacteria | 1654 |
| 545 | Ga0495584_0048069 | 3300046491 | Bacteria | 2152 |
| 546 | Ga0495584_0066228 | 3300046491 | Bacteria | 1817 |
| 547 | Ga0495594_0061877 | 3300046499 | Bacteria | 2072 |
| 548 | Ga0495596_0025578 | 3300046500 | Bacteria | 2386 |
| 549 | Ga0495607_0153390 | 3300046501 | Bacteria | 1177 |
| 550 | Ga0495608_0001216 | 3300046511 | Bacteria | 18231 |
| 551 | Ga0495608_0048246 | 3300046511 | Bacteria | 2830 |
| 552 | Ga0495618_0000561 | 3300046514 | Bacteria | 26461 |
| 553 | Ga0495618_0014856 | 3300046514 | Bacteria | 4750 |
| 554 | Ga0495618_0017961 | 3300046514 | Bacteria | 4340 |
| 555 | Ga0495618_0207856 | 3300046514 | Bacteria | 1238 |
| 556 | Ga0495628_0000185 | 3300046516 | Bacteria | 54717 |
| 557 | Ga0495628_0035539 | 3300046516 | Bacteria | 4003 |
| 558 | Ga0495630_0005490 | 3300046517 | Bacteria | 8949 |
| 559 | Ga0495630_0076664 | 3300046517 | Bacteria | 2520 |
| 560 | Ga0495630_0203184 | 3300046517 | Bacteria | 1512 |
| 561 | Ga0495666_0055679 | 3300046526 | Unclassified | 1895 |
| 562 | Ga0495652_0000466 | 3300046529 | Bacteria | 47387 |
| 563 | Ga0495652_0050989 | 3300046529 | Bacteria | 3536 |
| 564 | Ga0495652_0281834 | 3300046529 | Bacteria | 1216 |
| 565 | Ga0495652_0415027 | 3300046529 | Bacteria | 950 |
| 566 | Ga0495665_0000240 | 3300046531 | Bacteria | 27586 |
| 567 | Ga0495640_0028208 | 3300046533 | Bacteria | 4043 |
| 568 | Ga0495640_0086439 | 3300046533 | Bacteria | 2076 |
| 569 | Ga0495586_0079761 | 3300046535 | Bacteria | 1797 |
| 570 | Ga0495587_0000537 | 3300046536 | Bacteria | 26275 |
| 571 | Ga0495587_0048521 | 3300046536 | Unclassified | 2514 |
| 572 | Ga0495587_0171103 | 3300046536 | Bacteria | 1234 |
| 573 | Ga0495645_0000115 | 3300046543 | Bacteria | 54956 |
| 574 | Ga0495667_0011033 | 3300046559 | Bacteria | 6109 |
| 575 | Ga0495667_0011347 | 3300046559 | Bacteria | 6033 |
| 576 | Ga0495667_0041925 | 3300046559 | Unclassified | 3034 |
| 577 | Ga0495667_0145431 | 3300046559 | Bacteria | 1527 |
| 578 | Ga0495668_0051358 | 3300046616 | Bacteria | 2283 |
| 579 | Ga0495634_0012164 | 3300046642 | Bacteria | 6238 |
| 580 | Ga0495634_0028372 | 3300046642 | Bacteria | 3885 |
| 581 | Ga0495634_0169221 | 3300046642 | Bacteria | 1374 |
| 582 | Ga0495635_0016636 | 3300046663 | Bacteria | 5138 |
| 583 | Ga0495635_0048774 | 3300046663 | Bacteria | 2919 |
| 584 | Ga0495635_0090558 | 3300046663 | Bacteria | 2092 |
| 585 | Ga0495635_0266292 | 3300046663 | Unclassified | 1153 |
| 586 | Ga0495588_0004083 | 3300046674 | Bacteria | 6425 |
| 587 | Ga0495657_0029004 | 3300046675 | Bacteria | 3884 |
| 588 | Ga0495657_0047150 | 3300046675 | Bacteria | 2915 |
| 589 | Ga0495657_0050638 | 3300046675 | Bacteria | 2792 |
| 590 | Ga0495599_0000135 | 3300046678 | Bacteria | 47515 |
| 591 | Ga0495599_0086704 | 3300046678 | Bacteria | 1955 |
| 592 | Ga0495623_0000350 | 3300046679 | Bacteria | 30436 |
| 593 | Ga0495646_0000351 | 3300046680 | Bacteria | 23709 |
| 594 | Ga0495647_0028505 | 3300046681 | Bacteria | 2059 |
| 595 | Ga0495658_0000691 | 3300046683 | Bacteria | 18249 |
| 596 | Ga0495658_0093703 | 3300046683 | Bacteria | 1782 |
| 597 | Ga0495613_0011438 | 3300046689 | Bacteria | 6597 |
| 598 | Ga0495613_0072645 | 3300046689 | Bacteria | 2508 |
| 599 | Ga0495613_0104755 | 3300046689 | Bacteria | 2042 |
| 600 | Ga0495600_0006098 | 3300046809 | Bacteria | 7302 |
| 601 | Ga0495600_0006211 | 3300046809 | Bacteria | 7247 |
| 602 | Ga0495581_0000481 | 3300047315 | Bacteria | 20285 |
| 603 | Ga0495581_0035485 | 3300047315 | Bacteria | 2886 |
| 604 | Ga0495581_0061459 | 3300047315 | Bacteria | 2171 |
| 605 | Ga0495604_0000060 | 3300047317 | Bacteria | 95444 |
| 606 | Ga0495604_0031932 | 3300047317 | Bacteria | 4175 |
| 607 | Ga0495604_0045259 | 3300047317 | Bacteria | 3435 |
| 608 | Ga0495604_0147924 | 3300047317 | Bacteria | 1672 |
| 609 | Ga0495674_0011434 | 3300047319 | Bacteria | 8375 |
| 610 | Ga0495674_0022505 | 3300047319 | Bacteria | 5814 |
| 611 | Ga0495674_0399587 | 3300047319 | Bacteria | 1109 |
| 612 | Ga0495676_0000654 | 3300047321 | Bacteria | 28845 |
| 613 | Ga0495676_0010451 | 3300047321 | Bacteria | 8416 |
| 614 | Ga0495680_0002258 | 3300047322 | Bacteria | 19853 |
| 615 | Ga0495680_0002435 | 3300047322 | Bacteria | 19040 |
| 616 | Ga0495680_0003818 | 3300047322 | Bacteria | 14626 |
| 617 | Ga0495680_0014000 | 3300047322 | Bacteria | 6973 |
| 618 | Ga0495680_0024176 | 3300047322 | Bacteria | 5042 |
| 619 | Ga0495680_0035391 | 3300047322 | Bacteria | 4022 |
| 620 | Ga0495680_0326125 | 3300047322 | Bacteria | 1074 |
| 621 | Ga0495675_0000223 | 3300047444 | Bacteria | 41211 |
| 622 | Ga0495675_0245997 | 3300047444 | Bacteria | 1075 |
| 623 | Ga0495684_0014714 | 3300047471 | Bacteria | 6023 |
| 624 | Ga0495684_0051296 | 3300047471 | Bacteria | 3149 |
| 625 | Ga0495684_0130327 | 3300047471 | Bacteria | 1889 |
| 626 | Ga0495684_0191592 | 3300047471 | Bacteria | 1511 |
| 627 | Ga0495593_0011508 | 3300047673 | Bacteria | 5079 |
| 628 | Ga0495602_0000197 | 3300048088 | Bacteria | 56557 |
| 629 | Ga0495602_0338282 | 3300048088 | Unclassified | 1089 |
| 630 | Ga0495614_0035273 | 3300048089 | Unclassified | 2149 |
| 631 | Ga0496100_0062511 | 3300048903 | Bacteria | 2457 |
| 632 | Ga0496100_0110649 | 3300048903 | Bacteria | 1907 |
| 633 | Ga0496100_0158934 | 3300048903 | Bacteria | 1619 |
| 634 | Ga0496101_0003915 | 3300048904 | Bacteria | 9306 |
| 635 | Ga0496101_0006852 | 3300048904 | Bacteria | 7353 |
| 636 | Ga0496101_0010618 | 3300048904 | Bacteria | 6084 |
| 637 | Ga0496101_0016672 | 3300048904 | Bacteria | 4970 |
| 638 | Ga0496101_0069443 | 3300048904 | Bacteria | 2578 |
| 639 | Ga0496101_0263273 | 3300048904 | Unclassified | 1345 |
| 640 | Ga0496102_0004341 | 3300048905 | Bacteria | 11987 |
| 641 | Ga0496102_0006327 | 3300048905 | Bacteria | 10097 |
| 642 | Ga0496102_0007328 | 3300048905 | Bacteria | 9419 |
| 643 | Ga0496102_0010973 | 3300048905 | Bacteria | 7807 |
| 644 | Ga0496102_0017197 | 3300048905 | Bacteria | 6331 |
| 645 | Ga0496102_0017858 | 3300048905 | Bacteria | 6221 |
| 646 | Ga0496102_0069875 | 3300048905 | Bacteria | 3224 |
| 647 | Ga0496102_0160808 | 3300048905 | Bacteria | 2113 |
| 648 | Ga0496102_0544014 | 3300048905 | Bacteria | 1084 |
| 649 | Ga0496103_0028980 | 3300048906 | Bacteria | 3362 |
| 650 | Ga0496103_0064673 | 3300048906 | Bacteria | 2280 |
| 651 | Ga0496103_0132925 | 3300048906 | Bacteria | 1590 |
| 652 | Ga0496104_0000254 | 3300048907 | Bacteria | 47479 |
| 653 | Ga0496104_0001809 | 3300048907 | Bacteria | 18537 |
| 654 | Ga0496104_0003247 | 3300048907 | Bacteria | 14012 |
| 655 | Ga0496104_0040739 | 3300048907 | Bacteria | 4354 |
| 656 | Ga0496104_0055821 | 3300048907 | Bacteria | 3734 |
| 657 | Ga0496104_0110054 | 3300048907 | Bacteria | 2640 |
| 658 | Ga0496104_0167778 | 3300048907 | Bacteria | 2105 |
| 659 | Ga0496104_0168149 | 3300048907 | Bacteria | 2103 |
| 660 | Ga0496105_0000055 | 3300048908 | Bacteria | 88389 |
| 661 | Ga0496105_0001748 | 3300048908 | Bacteria | 15536 |
| 662 | Ga0496105_0010299 | 3300048908 | Bacteria | 7349 |
| 663 | Ga0496105_0015684 | 3300048908 | Bacteria | 6045 |
| 664 | Ga0496105_0016988 | 3300048908 | Bacteria | 5822 |
| 665 | Ga0496105_0076842 | 3300048908 | Bacteria | 2757 |
| 666 | Ga0496105_0109580 | 3300048908 | Bacteria | 2279 |
| 667 | Ga0496106_0004134 | 3300048909 | Bacteria | 10816 |
| 668 | Ga0496106_0019107 | 3300048909 | Bacteria | 5079 |
| 669 | Ga0496106_0104903 | 3300048909 | Bacteria | 2195 |
| 670 | Ga0496106_0177148 | 3300048909 | Bacteria | 1692 |
| 671 | Ga0496106_0430358 | 3300048909 | Bacteria | 1060 |
| 672 | Ga0496107_0028465 | 3300048910 | Bacteria | 3971 |
| 673 | Ga0496107_0051018 | 3300048910 | Bacteria | 2983 |
| 674 | Ga0496107_0116299 | 3300048910 | Bacteria | 1968 |
| 675 | Ga0496107_0173568 | 3300048910 | Bacteria | 1600 |
| 676 | Ga0496108_0025258 | 3300048911 | Bacteria | 4895 |
| 677 | Ga0496108_0034899 | 3300048911 | Bacteria | 4179 |
| 678 | Ga0496108_0065698 | 3300048911 | Bacteria | 3058 |
| 679 | Ga0496108_0374932 | 3300048911 | Bacteria | 1242 |
| 680 | Ga0496109_0001140 | 3300048912 | Bacteria | 22090 |
| 681 | Ga0496109_0013078 | 3300048912 | Bacteria | 7179 |
| 682 | Ga0496109_0019918 | 3300048912 | Bacteria | 5922 |
| 683 | Ga0496109_0056112 | 3300048912 | Bacteria | 3594 |
| 684 | Ga0496109_0078028 | 3300048912 | Bacteria | 3049 |
| 685 | Ga0496109_0084123 | 3300048912 | Bacteria | 2934 |
| 686 | Ga0496109_0119989 | 3300048912 | Bacteria | 2449 |
| 687 | Ga0496109_0187046 | 3300048912 | Bacteria | 1946 |
| 688 | Ga0496109_0221378 | 3300048912 | Bacteria | 1780 |
| 689 | Ga0496110_0001472 | 3300048913 | Bacteria | 17050 |
| 690 | Ga0496110_0010434 | 3300048913 | Bacteria | 7554 |
| 691 | Ga0496110_0031403 | 3300048913 | Bacteria | 4583 |
| 692 | Ga0496110_0041456 | 3300048913 | Bacteria | 4017 |
| 693 | Ga0496110_0162808 | 3300048913 | Bacteria | 2022 |
| 694 | Ga0496110_0210433 | 3300048913 | Bacteria | 1768 |
| 695 | Ga0496110_0334525 | 3300048913 | Bacteria | 1379 |
| 696 | Ga0496111_0000582 | 3300048914 | Bacteria | 19124 |
| 697 | Ga0496111_0001388 | 3300048914 | Bacteria | 13743 |
| 698 | Ga0496111_0019990 | 3300048914 | Bacteria | 4658 |
| 699 | Ga0496111_0027506 | 3300048914 | Bacteria | 4023 |
| 700 | Ga0496111_0134013 | 3300048914 | Bacteria | 1834 |
| 701 | Ga0496112_0033359 | 3300048915 | Bacteria | 5004 |
| 702 | Ga0496112_0200423 | 3300048915 | Bacteria | 1955 |
| 703 | Ga0496112_0635899 | 3300048915 | Unclassified | 997 |
| 704 | Ga0496113_0015361 | 3300048916 | Bacteria | 5260 |
| 705 | Ga0496113_0233939 | 3300048916 | Bacteria | 1465 |
| 706 | Ga0496114_0000256 | 3300048917 | Bacteria | 38442 |
| 707 | Ga0496114_0002392 | 3300048917 | Bacteria | 14278 |
| 708 | Ga0496114_0003388 | 3300048917 | Bacteria | 12237 |
| 709 | Ga0496114_0004328 | 3300048917 | Bacteria | 10992 |
| 710 | Ga0496114_0015571 | 3300048917 | Bacteria | 6114 |
| 711 | Ga0496114_0024176 | 3300048917 | Bacteria | 4958 |
| 712 | Ga0496114_0040438 | 3300048917 | Bacteria | 3861 |
| 713 | Ga0496114_0177383 | 3300048917 | Unclassified | 1859 |
| 714 | Ga0496114_0185944 | 3300048917 | Bacteria | 1816 |
| 715 | Ga0496114_0186170 | 3300048917 | Bacteria | 1815 |
| 716 | Ga0496114_0201726 | 3300048917 | Bacteria | 1742 |
| 717 | Ga0496115_0010994 | 3300048918 | Bacteria | 6777 |
| 718 | Ga0496115_0014093 | 3300048918 | Bacteria | 6053 |
| 719 | Ga0496115_0019911 | 3300048918 | Bacteria | 5170 |
| 720 | Ga0496115_0059349 | 3300048918 | Bacteria | 3080 |
| 721 | Ga0496115_0124405 | 3300048918 | Bacteria | 2124 |
| 722 | Ga0496115_0125968 | 3300048918 | Bacteria | 2110 |
| 723 | Ga0496115_0307010 | 3300048918 | Unclassified | 1299 |
| 724 | Ga0496115_0642998 | 3300048918 | Unclassified | 839 |
| 725 | Ga0501031_0005364 | 3300049568 | Bacteria | 8347 |
| 726 | Ga0501031_0057948 | 3300049568 | Bacteria | 2524 |
| 727 | Ga0501032_0050504 | 3300049569 | Bacteria | 2805 |
| 728 | Ga0501033_0029934 | 3300049570 | Bacteria | 4092 |
| 729 | Ga0501034_0053587 | 3300049571 | Bacteria | 4061 |
| 730 | Ga0501034_0173568 | 3300049571 | Bacteria | 2122 |
| 731 | Ga0501034_0186800 | 3300049571 | Bacteria | 2036 |
| 732 | Ga0501034_0326640 | 3300049571 | Bacteria | 1466 |
| 733 | Ga0501036_0008841 | 3300049572 | Bacteria | 8269 |
| 734 | Ga0501036_0012587 | 3300049572 | Bacteria | 7016 |
| 735 | Ga0501036_0055128 | 3300049572 | Bacteria | 3367 |
| 736 | Ga0501037_0007155 | 3300049573 | Bacteria | 8156 |
| 737 | Ga0501037_0063001 | 3300049573 | Bacteria | 2703 |
| 738 | Ga0501038_0004352 | 3300049574 | Bacteria | 13177 |
| 739 | Ga0501038_0010405 | 3300049574 | Bacteria | 8504 |
| 740 | Ga0501039_0007649 | 3300049575 | Bacteria | 8249 |
| 741 | Ga0501039_0019157 | 3300049575 | Bacteria | 5251 |
| 742 | Ga0501039_0034101 | 3300049575 | Bacteria | 3928 |
| 743 | Ga0501040_0009636 | 3300049576 | Bacteria | 6304 |
| 744 | Ga0501040_0030782 | 3300049576 | Bacteria | 3626 |
| 745 | Ga0501040_0086996 | 3300049576 | Bacteria | 2170 |
| 746 | Ga0501040_0094042 | 3300049576 | Unclassified | 2085 |
| 747 | Ga0501041_0005357 | 3300049577 | Bacteria | 7512 |
| 748 | Ga0501041_0015393 | 3300049577 | Bacteria | 4541 |
| 749 | Ga0501041_0054237 | 3300049577 | Unclassified | 2446 |
| 750 | Ga0501041_0138615 | 3300049577 | Bacteria | 1516 |
| 751 | Ga0501041_0161737 | 3300049577 | Bacteria | 1400 |
| 752 | Ga0501042_0007391 | 3300049578 | Bacteria | 7195 |
| 753 | Ga0501042_0323404 | 3300049578 | Unclassified | 1114 |
| 754 | Ga0501043_0114181 | 3300049579 | Bacteria | 2120 |
| 755 | Ga0501043_0136899 | 3300049579 | Bacteria | 1918 |
| 756 | Ga0501046_0008189 | 3300049580 | Bacteria | 9132 |
| 757 | Ga0501046_0137527 | 3300049580 | Unclassified | 1850 |
| 758 | Ga0501046_0190519 | 3300049580 | Bacteria | 1530 |
| 759 | Ga0501047_0028024 | 3300049581 | Bacteria | 5428 |
| 760 | Ga0501048_0015969 | 3300049582 | Bacteria | 5539 |
| 761 | Ga0501048_0078888 | 3300049582 | Unclassified | 2324 |
| 762 | Ga0501048_0128678 | 3300049582 | Bacteria | 1790 |
| 763 | Ga0501067_0004482 | 3300049583 | Bacteria | 7703 |
| 764 | Ga0501067_0025963 | 3300049583 | Bacteria | 3246 |
| 765 | Ga0501067_0026142 | 3300049583 | Bacteria | 3234 |
| 766 | Ga0501067_0031868 | 3300049583 | Unclassified | 2925 |
| 767 | Ga0501067_0081089 | 3300049583 | Bacteria | 1799 |
| 768 | Ga0501067_0136085 | 3300049583 | Bacteria | 1368 |
| 769 | Ga0501068_0001354 | 3300049584 | Bacteria | 12993 |
| 770 | Ga0501068_0005957 | 3300049584 | Bacteria | 6689 |
| 771 | Ga0501068_0018073 | 3300049584 | Bacteria | 4083 |
| 772 | Ga0501068_0051552 | 3300049584 | Bacteria | 2489 |
| 773 | Ga0501068_0073970 | 3300049584 | Bacteria | 2082 |
| 774 | Ga0501069_0016121 | 3300049585 | Bacteria | 4009 |
| 775 | Ga0501069_0019982 | 3300049585 | Bacteria | 3625 |
| 776 | Ga0501069_0105072 | 3300049585 | Bacteria | 1605 |
| 777 | Ga0501069_0127079 | 3300049585 | Bacteria | 1458 |
| 778 | Ga0501070_0015415 | 3300049586 | Bacteria | 6430 |
| 779 | Ga0501070_0020855 | 3300049586 | Bacteria | 5497 |
| 780 | Ga0501070_0214752 | 3300049586 | Bacteria | 1578 |
| 781 | Ga0501071_0009471 | 3300049587 | Bacteria | 6489 |
| 782 | Ga0501071_0015098 | 3300049587 | Bacteria | 5296 |
| 783 | Ga0501071_0046781 | 3300049587 | Bacteria | 3107 |
| 784 | Ga0501072_0007825 | 3300049588 | Bacteria | 8116 |
| 785 | Ga0501072_0015793 | 3300049588 | Bacteria | 5788 |
| 786 | Ga0501072_0017765 | 3300049588 | Bacteria | 5469 |
| 787 | Ga0501072_0026018 | 3300049588 | Bacteria | 4560 |
| 788 | Ga0501072_0073576 | 3300049588 | Bacteria | 2701 |
| 789 | Ga0501073_0000628 | 3300049589 | Bacteria | 24828 |
| 790 | Ga0501073_0026251 | 3300049589 | Bacteria | 4173 |
| 791 | Ga0501073_0087624 | 3300049589 | Bacteria | 2165 |
| 792 | Ga0501074_0016439 | 3300049590 | Bacteria | 5372 |
| 793 | Ga0501074_0024114 | 3300049590 | Bacteria | 4421 |
| 794 | Ga0501074_0026160 | 3300049590 | Bacteria | 4231 |
| 795 | Ga0501074_0103669 | 3300049590 | Bacteria | 2036 |
| 796 | Ga0501075_0004487 | 3300049591 | Bacteria | 9454 |
| 797 | Ga0501075_0005137 | 3300049591 | Bacteria | 8950 |
| 798 | Ga0501075_0033610 | 3300049591 | Bacteria | 3815 |
| 799 | Ga0501075_0148855 | 3300049591 | Bacteria | 1784 |
| 800 | Ga0501076_0018581 | 3300049592 | Bacteria | 5302 |
| 801 | Ga0501076_0065302 | 3300049592 | Bacteria | 2901 |
| 802 | Ga0501077_0005536 | 3300049593 | Bacteria | 7687 |
| 803 | Ga0501077_0009048 | 3300049593 | Bacteria | 6181 |
| 804 | Ga0501077_0011415 | 3300049593 | Bacteria | 5547 |
| 805 | Ga0501079_0007265 | 3300049741 | Bacteria | 8365 |
| 806 | Ga0501079_0043082 | 3300049741 | Bacteria | 3483 |
| 807 | Ga0501079_0077107 | 3300049741 | Bacteria | 2578 |
| 808 | Ga0501079_0174503 | 3300049741 | Unclassified | 1676 |
| 809 | Ga0501080_0021157 | 3300049742 | Bacteria | 6020 |
| 810 | Ga0501080_0057448 | 3300049742 | Bacteria | 3623 |
| 811 | Ga0501080_0067361 | 3300049742 | Bacteria | 3330 |
| 812 | Ga0501081_0008239 | 3300049743 | Bacteria | 6766 |
| 813 | Ga0501081_0011177 | 3300049743 | Bacteria | 5871 |
| 814 | Ga0501081_0023921 | 3300049743 | Unclassified | 4098 |
| 815 | Ga0501083_0000739 | 3300049744 | Bacteria | 21326 |
| 816 | Ga0501083_0005244 | 3300049744 | Bacteria | 9166 |
| 817 | Ga0501035_0069067 | 3300049822 | Bacteria | 3132 |
| 818 | Ga0501035_0074745 | 3300049822 | Bacteria | 2997 |
| 819 | Ga0501044_0095658 | 3300049823 | Bacteria | 2993 |
| 820 | Ga0501045_0001564 | 3300049824 | Bacteria | 15240 |
| 821 | Ga0501045_0002762 | 3300049824 | Bacteria | 11982 |
| 822 | Ga0501045_0222089 | 3300049824 | Bacteria | 1407 |
| 823 | nmdc:mga03n38_177166_c1 | 3300050490 | Bacteria | 1090 |
| 824 | nmdc:mga07m45_93842_c1 | 3300050496 | Bacteria | 1720 |
| 825 | nmdc:mga05p37_17104_c1 | 3300050507 | Bacteria | 8748 |
| 826 | nmdc:mga05p37_39397_c1 | 3300050507 | Bacteria | 5802 |
| 827 | nmdc:mga05p37_4337_c1 | 3300050507 | Bacteria | 16558 |
| 828 | nmdc:mga05p37_64172_c1 | 3300050507 | Bacteria | 4519 |
| 829 | nmdc:mga05p37_885_c1 | 3300050507 | Bacteria | 33780 |
| 830 | nmdc:mga09592_197115_c1 | 3300050508 | Bacteria | 1743 |
| 831 | nmdc:mga09592_303537_c1 | 3300050508 | Bacteria | 1384 |
| 832 | nmdc:mga09592_6255_c1 | 3300050508 | Bacteria | 9696 |
| 833 | nmdc:mga06r32_307375_c1 | 3300050510 | Bacteria | 1571 |
| 834 | nmdc:mga06r32_661127_c1 | 3300050510 | Bacteria | 1012 |
| 835 | nmdc:mga08y16_1003_c1 | 3300050511 | Bacteria | 27574 |
| 836 | nmdc:mga08y16_145036_c1 | 3300050511 | Unclassified | 2468 |
| 837 | nmdc:mga08y16_178663_c1 | 3300050511 | Bacteria | 2204 |
| 838 | nmdc:mga08y16_27785_c1 | 3300050511 | Bacteria | 5962 |
| 839 | nmdc:mga08y16_279118_c1 | 3300050511 | Bacteria | 1723 |
| 840 | nmdc:mga08y16_469887_c1 | 3300050511 | Bacteria | 1281 |
| 841 | nmdc:mga08y16_60710_c1 | 3300050511 | Bacteria | 3948 |
| 842 | nmdc:mga0n895_14233_c1 | 3300050512 | Bacteria | 7216 |
| 843 | nmdc:mga0n895_455325_c1 | 3300050512 | Bacteria | 1292 |
| 844 | nmdc:mga0n895_97399_c1 | 3300050512 | Bacteria | 2947 |
| 845 | nmdc:mga0rr50_121001_c1 | 3300050513 | Bacteria | 2084 |
| 846 | nmdc:mga0rr50_20546_c1 | 3300050513 | Bacteria | 4489 |
| 847 | nmdc:mga0rr50_66409_c1 | 3300050513 | Bacteria | 2737 |
| 848 | nmdc:mga0a205_107563_c1 | 3300050515 | Bacteria | 2687 |
| 849 | nmdc:mga0a205_110063_c1 | 3300050515 | Bacteria | 2653 |
| 850 | nmdc:mga0a205_231295_c1 | 3300050515 | Unclassified | 1732 |
| 851 | nmdc:mga0a205_9352_c1 | 3300050515 | Bacteria | 8955 |
| 852 | Ga0495601_0000238 | 3300053077 | Bacteria | 29363 |
| 853 | Ga0495601_0008450 | 3300053077 | Bacteria | 6081 |
| 854 | Ga0495601_0011451 | 3300053077 | Bacteria | 5305 |
| 855 | Ga0495601_0023900 | 3300053077 | Bacteria | 3759 |
| 856 | Ga0495601_0071041 | 3300053077 | Bacteria | 2223 |
| 857 | Ga0495601_0081458 | 3300053077 | Bacteria | 2077 |
| 858 | Ga0495601_0230248 | 3300053077 | Unclassified | 1210 |
| 859 | Ga0495612_0054128 | 3300053078 | Bacteria | 1653 |
| 860 | Ga0495595_0028779 | 3300053084 | Bacteria | 2483 |
| 861 | Ga0495595_0043033 | 3300053084 | Bacteria | 2070 |
| 862 | Ga0495595_0053527 | 3300053084 | Bacteria | 1875 |
| 863 | Ga0495619_0000200 | 3300053085 | Bacteria | 43823 |
| 864 | Ga0495619_0033926 | 3300053085 | Bacteria | 3316 |
| 865 | Ga0495619_0041021 | 3300053085 | Bacteria | 3026 |
| 866 | Ga0495619_0056785 | 3300053085 | Bacteria | 2596 |
| 867 | Ga0495619_0121542 | 3300053085 | Bacteria | 1791 |
| 868 | Ga0501084_0004886 | 3300054114 | Bacteria | 10950 |
| 869 | Ga0501084_0037442 | 3300054114 | Bacteria | 4052 |
| 870 | Ga0501084_0040580 | 3300054114 | Bacteria | 3894 |
| 871 | Ga0501084_0089049 | 3300054114 | Bacteria | 2591 |
| 872 | Ga0501084_0282052 | 3300054114 | Unclassified | 1403 |
| 873 | Ga0501084_0398125 | 3300054114 | Bacteria | 1164 |
| 874 | Ga0501082_0019554 | 3300060353 | Bacteria | 5840 |
| 875 | Ga0501082_0045737 | 3300060353 | Bacteria | 3774 |
| 876 | Ga0501082_0046905 | 3300060353 | Unclassified | 3724 |
| 877 | Ga0501082_0143066 | 3300060353 | Bacteria | 2075 |
| 878 | Ga0501082_0163468 | 3300060353 | Bacteria | 1934 |
| 879 | Ga0466962_0001269 | 3300061719 | Bacteria | 11653 |
| 880 | Ga0466962_0076178 | 3300061719 | Unclassified | 1603 |
| 881 | Ga0466962_0117162 | 3300061719 | Bacteria | 1284 |
| 882 | Ga0530510_0002748 | 3300061734 | Bacteria | 12090 |
| 883 | Ga0530510_0009540 | 3300061734 | Bacteria | 6806 |
| 884 | Ga0530510_0065593 | 3300061734 | Bacteria | 2631 |
| 885 | Ga0530510_0126812 | 3300061734 | Bacteria | 1876 |
| 886 | Ga0530510_0127397 | 3300061734 | Unclassified | 1872 |
| 887 | 2867511325 | 2867507094 | Bacteria | 6506033 |
| 888 | Ga0081455_10116815 | |||
| 889 | Ga0070658_10076233 | |||
| 890 | Ga0070658_10181174 | |||
| 891 | Ga0070683_100001511 | |||
| 892 | Ga0070683_100092440 | |||
| 893 | Ga0070683_100093542 | |||
| 894 | Ga0070683_100107201 | |||
| 895 | Ga0070683_100176414 | |||
| 896 | Ga0070670_100025282 | |||
| 897 | Ga0068869_100013310 | |||
| 898 | Ga0070680_100013567 | |||
| 899 | Ga0070680_100018340 | |||
| 900 | Ga0070680_100058287 | |||
| 901 | Ga0070680_100171258 | |||
| 902 | Ga0070680_100296921 | |||
| 903 | Ga0070682_100013359 | |||
| 904 | Ga0070682_100033577 | |||
| 905 | Ga0070682_100162612 | |||
| 906 | Ga0070682_100267374 | |||
| 907 | Ga0068868_100012148 | |||
| 908 | Ga0068868_100057126 | |||
| 909 | Ga0070660_100006183 | |||
| 910 | Ga0070660_100109775 | |||
| 911 | Ga0070660_100196481 | |||
| 912 | Ga0070660_100305946 | |||
| 913 | Ga0070689_100026358 | |||
| 914 | Ga0070691_10005579 | |||
| 915 | Ga0070687_100101658 | |||
| 916 | Ga0070661_100014164 | |||
| 917 | Ga0070661_100076047 | |||
| 918 | Ga0070692_10019780 | |||
| 919 | Ga0070668_100184108 | |||
| 920 | Ga0070675_100074143 | |||
| 921 | Ga0070675_100237441 | |||
| 922 | Ga0070675_100356117 | |||
| 923 | Ga0070675_100372033 | |||
| 924 | Ga0070674_100011737 | |||
| 925 | Ga0070674_100038298 | |||
| 926 | Ga0070674_100079232 | |||
| 927 | Ga0070673_100012976 | |||
| 928 | Ga0070673_100236738 | |||
| 929 | Ga0070673_100387681 | |||
| 930 | Ga0070688_100005327 | |||
| 931 | Ga0070688_100060649 | |||
| 932 | Ga0070688_100215763 | |||
| 933 | Ga0070659_100072561 | |||
| 934 | Ga0070659_100087129 | |||
| 935 | Ga0070659_100103273 | |||
| 936 | Ga0070659_100180007 | |||
| 937 | Ga0070659_100417348 | |||
| 938 | Ga0070667_100007322 | |||
| 939 | Ga0070667_100433297 | |||
| 940 | Ga0070709_10155006 | |||
| 941 | Ga0070714_100063737 | |||
| 942 | Ga0070714_100374176 | |||
| 943 | Ga0070710_10066403 | |||
| 944 | Ga0070701_10020847 | |||
| 945 | Ga0070701_10264977 | |||
| 946 | Ga0070711_100129269 | |||
| 947 | Ga0070705_100003518 | |||
| 948 | Ga0070700_100086887 | |||
| 949 | Ga0070700_100272505 | |||
| 950 | Ga0070694_100145112 | |||
| 951 | Ga0070694_100200330 | |||
| 952 | Ga0070663_100011213 | |||
| 953 | Ga0070663_100270500 | |||
| 954 | Ga0070678_100000994 | |||
| 955 | Ga0070678_100015365 | |||
| 956 | Ga0070678_100049869 | |||
| 957 | Ga0070678_100053407 | |||
| 958 | Ga0070678_100448376 | |||
| 959 | Ga0070681_10025719 | |||
| 960 | Ga0070681_10075782 | |||
| 961 | Ga0070681_10078133 | |||
| 962 | Ga0070681_10096947 | |||
| 963 | Ga0068867_100210615 | |||
| 964 | Ga0070685_10022590 | |||
| 965 | Ga0070706_100057572 | |||
| 966 | Ga0070698_100044298 | |||
| 967 | Ga0070698_100291796 | |||
| 968 | Ga0070679_100029799 | |||
| 969 | Ga0070679_100066431 | |||
| 970 | Ga0070679_100089042 | |||
| 971 | Ga0070679_100102811 | |||
| 972 | Ga0070679_100508984 | |||
| 973 | Ga0070684_100008159 | |||
| 974 | Ga0070684_100010835 | |||
| 975 | Ga0070684_100032010 | |||
| 976 | Ga0070684_100032864 | |||
| 977 | Ga0070684_100035945 | |||
| 978 | Ga0070684_100057553 | |||
| 979 | Ga0070684_100262651 | |||
| 980 | Ga0068853_100061002 | |||
| 981 | Ga0070672_100025047 | |||
| 982 | Ga0070672_100026949 | |||
| 983 | Ga0070672_100039502 | |||
| 984 | Ga0070672_100059327 | |||
| 985 | Ga0070686_100026834 | |||
| 986 | Ga0070686_100029109 | |||
| 987 | Ga0070696_100021618 | |||
| 988 | Ga0070696_100044154 | |||
| 989 | Ga0070693_100037363 | |||
| 990 | Ga0070693_100170913 | |||
| 991 | Ga0070665_100004920 | |||
| 992 | Ga0070704_100023436 | |||
| 993 | Ga0070704_100071693 | |||
| 994 | Ga0070704_100245639 | |||
| 995 | Ga0068855_100029046 | |||
| 996 | Ga0068855_100110665 | |||
| 997 | Ga0068855_100343079 | |||
| 998 | Ga0068855_100456949 | |||
| 999 | Ga0070664_100154101 | |||
| 1000 | Ga0068857_100019377 | |||
| 1001 | Ga0068857_100151545 | |||
| 1002 | Ga0068854_100083829 | |||
| 1003 | Ga0068856_100006059 | |||
| 1004 | Ga0068856_100078434 | |||
| 1005 | Ga0068856_100084892 | |||
| 1006 | Ga0068856_100114058 | |||
| 1007 | Ga0068856_100380344 | |||
| 1008 | Ga0070702_100001248 | |||
| 1009 | Ga0068852_100262228 | |||
| 1010 | Ga0068852_100272389 | |||
| 1011 | Ga0068852_100408045 | |||
| 1012 | Ga0068859_100187523 | |||
| 1013 | Ga0068859_100240480 | |||
| 1014 | Ga0068864_100310433 | |||
| 1015 | Ga0068866_10080690 | |||
| 1016 | Ga0068866_10100199 | |||
| 1017 | Ga0068861_100031844 | |||
| 1018 | Ga0068861_100186435 | |||
| 1019 | Ga0068861_100202348 | |||
| 1020 | Ga0068851_10017806 | |||
| 1021 | Ga0068870_10022120 | |||
| 1022 | Ga0068870_10028295 | |||
| 1023 | Ga0068870_10156408 | |||
| 1024 | Ga0068860_100009233 | |||
| 1025 | Ga0068860_100073582 | |||
| 1026 | Ga0068860_100600383 | |||
| 1027 | Ga0068862_100181001 | |||
| 1028 | Ga0081455_10008878 | |||
| 1029 | Ga0081455_10011995 | |||
| 1030 | Ga0081455_10020170 | |||
| 1031 | Ga0081540_1004204 | |||
| 1032 | Ga0081540_1019924 | |||
| 1033 | Ga0070717_10002940 | |||
| 1034 | Ga0070717_10016455 | |||
| 1035 | Ga0075432_10001987 | |||
| 1036 | Ga0070715_10011274 | |||
| 1037 | Ga0070716_100272845 | |||
| 1038 | Ga0070712_100027127 | |||
| 1039 | Ga0070712_100043402 | |||
| 1040 | Ga0097621_100028225 | |||
| 1041 | Ga0097621_100258788 | |||
| 1042 | Ga0075370_10032801 | |||
| 1043 | Ga0068871_100006072 | |||
| 1044 | Ga0075428_100000211 | |||
| 1045 | Ga0075428_100001472 | |||
| 1046 | Ga0075428_100297963 | |||
| 1047 | Ga0075428_100540641 | |||
| 1048 | Ga0075433_10012759 | |||
| 1049 | Ga0075433_10305536 | |||
| 1050 | Ga0075434_100237257 | |||
| 1051 | Ga0075429_100005341 | |||
| 1052 | Ga0075429_100183184 | |||
| 1053 | Ga0068865_100013452 | |||
| 1054 | Ga0068865_100015100 | |||
| 1055 | Ga0068865_100181824 | |||
| 1056 | Ga0097620_100187522 | |||
| 1057 | Ga0097620_100240495 | |||
| 1058 | Ga0075435_100007124 | |||
| 1059 | Ga0105240_10154991 | |||
| 1060 | Ga0105240_10160060 | |||
| 1061 | Ga0105240_10291224 | |||
| 1062 | Ga0105240_10377992 | |||
| 1063 | Ga0111539_10003281 | |||
| 1064 | Ga0111539_10072396 | |||
| 1065 | Ga0111539_10103504 | |||
| 1066 | Ga0111539_10195746 | |||
| 1067 | Ga0111539_10241429 | |||
| 1068 | Ga0111539_10302662 | |||
| 1069 | Ga0105245_10001672 | |||
| 1070 | Ga0105245_10006039 | |||
| 1071 | Ga0105245_10029684 | |||
| 1072 | Ga0105245_10082162 | |||
| 1073 | Ga0105245_10110460 | |||
| 1074 | Ga0105245_10164739 | |||
| 1075 | Ga0105245_10170744 | |||
| 1076 | Ga0105245_10241557 | |||
| 1077 | Ga0105245_10292019 | |||
| 1078 | Ga0105245_10397160 | |||
| 1079 | Ga0105245_10675696 | |||
| 1080 | Ga0105247_10006987 | |||
| 1081 | Ga0105247_10031086 | |||
| 1082 | Ga0114129_10002058 | |||
| 1083 | Ga0114129_10014359 | |||
| 1084 | Ga0114129_10062127 | |||
| 1085 | Ga0105243_10004171 | |||
| 1086 | Ga0105243_10013258 | |||
| 1087 | Ga0105243_10020248 | |||
| 1088 | Ga0105243_10022730 | |||
| 1089 | Ga0105243_10244705 | |||
| 1090 | Ga0105243_10597865 | |||
| 1091 | Ga0105241_10017128 | |||
| 1092 | Ga0105241_10110414 | |||
| 1093 | Ga0105241_10114021 | |||
| 1094 | Ga0105242_10008815 | |||
| 1095 | Ga0105242_10186334 | |||
| 1096 | Ga0105242_10507503 | |||
| 1097 | Ga0105248_10017461 | |||
| 1098 | Ga0105248_10170081 | |||
| 1099 | Ga0105248_10492822 | |||
| 1100 | Ga0105237_10101507 | |||
| 1101 | Ga0105238_10010169 | |||
| 1102 | Ga0105238_10046758 | |||
| 1103 | Ga0105238_10125091 | |||
| 1104 | Ga0105249_10010169 | |||
| 1105 | Ga0105249_10102276 | |||
| 1106 | Ga0105239_10031419 | |||
| 1107 | Ga0105239_10054676 | |||
| 1108 | Ga0105239_10319808 | |||
| 1109 | Ga0105246_10042671 | |||
| 1110 | Ga0105246_10073261 | |||
| 1111 | Ga0105246_10163486 | |||
| 1112 | Ga0105246_10180281 | |||
| 1113 | Ga0157373_10104342 | |||
| 1114 | Ga0157371_10090213 | |||
| 1115 | Ga0157370_10022377 | |||
| 1116 | Ga0157370_10026174 | |||
| 1117 | Ga0157370_10033161 | |||
| 1118 | Ga0157370_10054870 | |||
| 1119 | Ga0157369_10017118 | |||
| 1120 | Ga0157369_10022942 | |||
| 1121 | Ga0157369_10220950 | |||
| 1122 | Ga0157369_10225011 | |||
| 1123 | Ga0157369_10372889 | |||
| 1124 | Ga0157374_10026077 | |||
| 1125 | Ga0157374_10076623 | |||
| 1126 | Ga0157374_10275298 | |||
| 1127 | Ga0157374_10341577 | |||
| 1128 | Ga0157374_10660026 | |||
| 1129 | Ga0157378_10017333 | |||
| 1130 | Ga0163162_10008756 | |||
| 1131 | Ga0163162_10188599 | |||
| 1132 | Ga0157372_10011088 | |||
| 1133 | Ga0157372_10043786 | |||
| 1134 | Ga0157372_10240480 | |||
| 1135 | Ga0157372_10342294 | |||
| 1136 | Ga0157372_10536835 | |||
| 1137 | Ga0157372_10782626 | |||
| 1138 | Ga0157375_10023433 | |||
| 1139 | Ga0157375_10059076 | |||
| 1140 | Ga0157375_10062507 | |||
| 1141 | Ga0157375_10442499 | |||
| 1142 | Ga0163163_10039202 | |||
| 1143 | Ga0163163_10090670 | |||
| 1144 | Ga0157380_10240770 | |||
| 1145 | Ga0157380_10502705 | |||
| 1146 | Ga0182008_10003683 | |||
| 1147 | Ga0182008_10153664 | |||
| 1148 | Ga0157377_10006166 | |||
| 1149 | Ga0157377_10035532 | |||
| 1150 | Ga0157377_10123251 | |||
| 1151 | Ga0157379_10005788 | |||
| 1152 | Ga0157376_10006519 | |||
| 1153 | Ga0157376_10115771 | |||
| 1154 | Ga0157376_10135635 | |||
| 1155 | Ga0157376_10368150 | |||
| 1156 | Ga0182006_1028239 | |||
| 1157 | Ga0163161_10185366 | |||
| 1158 | Ga0206354_10152404 | |||
| 1159 | Ga0206354_11376887 | |||
| 1160 | Ga0206353_10290895 | |||
| 1161 | Ga0206353_10835708 | |||
| 1162 | Ga0224712_10077945 | |||
| 1163 | Ga0207692_10009347 | |||
| 1164 | Ga0207692_10091408 | |||
| 1165 | Ga0207688_10009635 | |||
| 1166 | Ga0207688_10114845 | |||
| 1167 | Ga0207685_10006858 | |||
| 1168 | Ga0207699_10254154 | |||
| 1169 | Ga0207645_10054967 | |||
| 1170 | Ga0207643_10003002 | |||
| 1171 | Ga0207643_10029234 | |||
| 1172 | Ga0207643_10034512 | |||
| 1173 | Ga0207705_10016247 | |||
| 1174 | Ga0207705_10130907 | |||
| 1175 | Ga0207684_10071765 | |||
| 1176 | Ga0207654_10017694 | |||
| 1177 | Ga0207695_10321502 | |||
| 1178 | Ga0207671_10136865 | |||
| 1179 | Ga0207693_10000919 | |||
| 1180 | Ga0207693_10037360 | |||
| 1181 | Ga0207693_10056444 | |||
| 1182 | Ga0207693_10057330 | |||
| 1183 | Ga0207693_10092213 | |||
| 1184 | Ga0207663_10023698 | |||
| 1185 | Ga0207663_10283008 | |||
| 1186 | Ga0207660_10022675 | |||
| 1187 | Ga0207660_10032251 | |||
| 1188 | Ga0207662_10017719 | |||
| 1189 | Ga0207657_10005718 | |||
| 1190 | Ga0207657_10008090 | |||
| 1191 | Ga0207657_10020451 | |||
| 1192 | Ga0207657_10074418 | |||
| 1193 | Ga0207657_10221440 | |||
| 1194 | Ga0207649_10077221 | |||
| 1195 | Ga0207649_10165416 | |||
| 1196 | Ga0207652_10008696 | |||
| 1197 | Ga0207652_10047664 | |||
| 1198 | Ga0207652_10191680 | |||
| 1199 | Ga0207652_10414841 | |||
| 1200 | Ga0207646_10167050 | |||
| 1201 | Ga0207681_10156803 | |||
| 1202 | Ga0207650_10016445 | |||
| 1203 | Ga0207650_10088839 | |||
| 1204 | Ga0207659_10052897 | |||
| 1205 | Ga0207659_10206227 | |||
| 1206 | Ga0207659_10325964 | |||
| 1207 | Ga0207687_10002244 | |||
| 1208 | Ga0207687_10021313 | |||
| 1209 | Ga0207687_10426966 | |||
| 1210 | Ga0207700_10092550 | |||
| 1211 | Ga0207664_10014782 | |||
| 1212 | Ga0207664_10042768 | |||
| 1213 | Ga0207664_10094015 | |||
| 1214 | Ga0207664_10304207 | |||
| 1215 | Ga0207664_10341110 | |||
| 1216 | Ga0207690_10021370 | |||
| 1217 | Ga0207690_10138948 | |||
| 1218 | Ga0207706_10012502 | |||
| 1219 | Ga0207686_10004653 | |||
| 1220 | Ga0207686_10048505 | |||
| 1221 | Ga0207709_10018813 | |||
| 1222 | Ga0207709_10025212 | |||
| 1223 | Ga0207709_10149945 | |||
| 1224 | Ga0207709_10203327 | |||
| 1225 | Ga0207670_10258609 | |||
| 1226 | Ga0207669_10103895 | |||
| 1227 | Ga0207669_10173171 | |||
| 1228 | Ga0207704_10060366 | |||
| 1229 | Ga0207704_10202757 | |||
| 1230 | Ga0207665_10000603 | |||
| 1231 | Ga0207665_10345045 | |||
| 1232 | Ga0207691_10009210 | |||
| 1233 | Ga0207691_10039180 | |||
| 1234 | Ga0207691_10059619 | |||
| 1235 | Ga0207711_10110490 | |||
| 1236 | Ga0207689_10026647 | |||
| 1237 | Ga0207661_10000463 | |||
| 1238 | Ga0207661_10124436 | |||
| 1239 | Ga0207661_10152477 | |||
| 1240 | Ga0207661_10203623 | |||
| 1241 | Ga0207661_10221511 | |||
| 1242 | Ga0207661_10248871 | |||
| 1243 | Ga0207661_10266690 | |||
| 1244 | Ga0207661_10495324 | |||
| 1245 | Ga0207679_10116931 | |||
| 1246 | Ga0207679_10148461 | |||
| 1247 | Ga0207679_10280734 | |||
| 1248 | Ga0207667_10305153 | |||
| 1249 | Ga0207667_10394436 | |||
| 1250 | Ga0207651_10109468 | |||
| 1251 | Ga0207651_10327181 | |||
| 1252 | Ga0207640_10043944 | |||
| 1253 | Ga0207658_10010769 | |||
| 1254 | Ga0207658_10350864 | |||
| 1255 | Ga0207639_10364946 | |||
| 1256 | Ga0207678_10008989 | |||
| 1257 | Ga0207678_10021648 | |||
| 1258 | Ga0207678_10031027 | |||
| 1259 | Ga0207678_10163303 | |||
| 1260 | Ga0207678_10270707 | |||
| 1261 | Ga0207708_10021885 | |||
| 1262 | Ga0207708_10052203 | |||
| 1263 | Ga0207708_10178681 | |||
| 1264 | Ga0207702_10015391 | |||
| 1265 | Ga0207702_10028487 | |||
| 1266 | Ga0207702_10058258 | |||
| 1267 | Ga0207702_10137960 | |||
| 1268 | Ga0207641_10352200 | |||
| 1269 | Ga0207648_10043497 | |||
| 1270 | Ga0207648_10118497 | |||
| 1271 | Ga0207676_10572720 | |||
| 1272 | Ga0207674_10028849 | |||
| 1273 | Ga0207674_10117157 | |||
| 1274 | Ga0207674_10173072 | |||
| 1275 | Ga0207674_10190368 | |||
| 1276 | Ga0207674_10214023 | |||
| 1277 | Ga0207675_100001496 | |||
| 1278 | Ga0207675_100083606 | |||
| 1279 | Ga0207675_100309253 | |||
| 1280 | Ga0207683_10002515 | |||
| 1281 | Ga0207683_10004769 | |||
| 1282 | Ga0207683_10028730 | |||
| 1283 | Ga0207683_10060153 | |||
| 1284 | Ga0207683_10106557 | |||
| 1285 | Ga0207683_10198294 | |||
| 1286 | Ga0207683_10264401 | |||
| 1287 | Ga0207698_10385298 | |||
| 1288 | Ga0207698_10419970 | |||
| 1289 | Ga0207428_10000315 | |||
| 1290 | Ga0207428_10070484 | |||
| 1291 | Ga0207428_10125946 | |||
| 1292 | Ga0207428_10219666 | |||
| 1293 | Ga0268266_10047771 | |||
| 1294 | Ga0268266_10073210 | |||
| 1295 | Ga0265319_1004366 | |||
| 1296 | Ga0265318_10019213 | |||
| 1297 | Ga0265322_10013754 | |||
| 1298 | Ga0265338_10015737 | |||
| 1299 | Ga0265338_10065827 | |||
| 1300 | Ga0265338_10098097 | |||
| 1301 | Ga0265338_10117088 | |||
| 1302 | Ga0265338_10137691 | |||
| 1303 | Ga0265330_10063643 | |||
| 1304 | Ga0265332_10023968 | |||
| 1305 | Ga0265320_10050370 | |||
| 1306 | Ga0265325_10044993 | |||
| 1307 | Ga0265340_10042406 | |||
| 1308 | Ga0265339_10007410 | |||
| 1309 | Ga0265331_10059062 | |||
| 1310 | Ga0265331_10113581 | |||
| 1311 | Ga0265316_10020436 | |||
| 1312 | Ga0265313_10026781 | |||
| 1313 | Ga0265314_10006777 | |||
| 1314 | Ga0265314_10050555 | |||
| 1315 | Ga0265342_10031976 | |||
| 1316 | Ga0307410_10408239 | |||
| 1317 | Ga0307406_10161587 | |||
| 1318 | Ga0307409_100134476 | |||
| 1319 | Ga0307415_100046294 | |||
| 1320 | Ga0316583_10018819 | |||
| 1321 | Ga0373930_0014340 | |||
| 1322 | Ga0373929_0018991 | |||
| 1323 | Ga0373939_0025347 | |||
| 1324 | Ga0373946_0051029 | |||
| 1325 | Ga0373955_0102617 | |||
| 1326 | Ga0373942_0007075 | |||
| 1327 | Ga0373962_0021804 | |||
| 1328 | Ga0373962_0081365 | |||
| 1329 | Ga0373931_0027133 | |||
| 1330 | Ga0373935_0035974 | |||
| 1331 | Ga0373935_0100154 | |||
| 1332 | Ga0373935_0182079 | |||
| 1333 | Ga0373927_0006434 | |||
| 1334 | Ga0373947_0049242 | |||
| 1335 | Ga0373937_0001462 | |||
| 1336 | Ga0373937_0013260 | |||
| 1337 | Ga0373937_0073725 | |||
| 1338 | Ga0373937_0715789 | |||
| 1339 | Ga0373925_0016109 | |||
| 1340 | Ga0373925_0050590 | |||
| 1341 | Ga0373925_0188903 | |||
| 1342 | Ga0395900_0088362 | |||
| 1343 | Ga0395900_0151455 | |||
| 1344 | Ga0395898_0027962 | |||
| 1345 | Ga0395898_0056257 | |||
| 1346 | Ga0395898_0087418 | |||
| 1347 | Ga0395898_0230316 | |||
| 1348 | Ga0395898_0289599 | |||
| 1349 | Ga0395905_0048403 | |||
| 1350 | Ga0395901_0009918 | |||
| 1351 | Ga0395901_0047081 | |||
| 1352 | Ga0395901_0127304 | |||
| 1353 | Ga0395901_0180943 | |||
| 1354 | Ga0395901_0484025 | |||
| 1355 | Ga0395901_0580517 | |||
| 1356 | Ga0439448_0069147 | |||
| 1357 | Ga0450920_001235 | |||
| 1358 | Ga0450923_042774 | |||
| 1359 | Ga0450906_006760 | |||
| 1360 | Ga0439458_0005864 | |||
| 1361 | Ga0439459_0021336 | |||
| 1362 | Ga0466969_0075969 | |||
| 1363 | Ga0466965_0048264 | |||
| 1364 | Ga0466966_0093580 | |||
| 1365 | Ga0466961_0009894 | |||
| 1366 | Ga0466961_0017102 | |||
| 1367 | Ga0466961_0046450 | |||
| 1368 | Ga0466963_0000205 | |||
| 1369 | Ga0466963_0001336 | |||
| 1370 | Ga0466963_0003667 | |||
| 1371 | Ga0466963_0004431 | |||
| 1372 | Ga0466963_0023517 | |||
| 1373 | Ga0466963_0047499 | |||
| 1374 | Ga0466963_0073009 | |||
| 1375 | Ga0466963_0086263 | |||
| 1376 | Ga0466964_0002840 | |||
| 1377 | Ga0466964_0012332 | |||
| 1378 | Ga0466964_0021517 | |||
| 1379 | Ga0466964_0030843 | |||
| 1380 | Ga0466964_0053489 | |||
| 1381 | Ga0466971_0002531 | |||
| 1382 | Ga0466971_0010508 | |||
| 1383 | Ga0466957_0000280 | |||
| 1384 | Ga0466957_0030847 | |||
| 1385 | Ga0466957_0120445 | |||
| 1386 | Ga0466959_0014713 | |||
| 1387 | Ga0466959_0079467 | |||
| 1388 | Ga0451576_0039636 | |||
| 1389 | Ga0451576_0135991 | |||
| 1390 | Ga0451576_0430452 | |||
| 1391 | Ga0466958_0012132 | |||
| 1392 | Ga0466958_0034792 | |||
| 1393 | Ga0466958_0083071 | |||
| 1394 | Ga0466958_0125774 | |||
| 1395 | Ga0466967_0004529 | |||
| 1396 | Ga0466967_0005434 | |||
| 1397 | Ga0466967_0013824 | |||
| 1398 | Ga0466967_0016123 | |||
| 1399 | Ga0466967_0026731 | |||
| 1400 | Ga0466967_0051112 | |||
| 1401 | Ga0466967_0073437 | |||
| 1402 | Ga0466967_0093798 | |||
| 1403 | Ga0466967_0121901 | |||
| 1404 | Ga0466967_0184283 | |||
| 1405 | Ga0466967_0221367 | |||
| 1406 | Ga0466967_0344136 | |||
| 1407 | Ga0495592_0000207 | |||
| 1408 | Ga0495592_0141323 | |||
| 1409 | Ga0495603_0000445 | |||
| 1410 | Ga0495603_0051865 | |||
| 1411 | Ga0495603_0059720 | |||
| 1412 | Ga0495603_0098158 | |||
| 1413 | Ga0495629_0003295 | |||
| 1414 | Ga0495629_0050293 | |||
| 1415 | Ga0495629_0333112 | |||
| 1416 | Ga0495641_0004373 | |||
| 1417 | Ga0495641_0082627 | |||
| 1418 | Ga0495651_0000106 | |||
| 1419 | Ga0495651_0065641 | |||
| 1420 | Ga0495653_0000290 | |||
| 1421 | Ga0495653_0008918 | |||
| 1422 | Ga0495653_0068050 | |||
| 1423 | Ga0495653_0092294 | |||
| 1424 | Ga0495582_0000516 | |||
| 1425 | Ga0495582_0007912 | |||
| 1426 | Ga0495582_0040172 | |||
| 1427 | Ga0495582_0059933 | |||
| 1428 | Ga0495639_0001552 | |||
| 1429 | Ga0495639_0105458 | |||
| 1430 | Ga0495662_0013779 | |||
| 1431 | Ga0495664_0111167 | |||
| 1432 | Ga0495584_0048069 | |||
| 1433 | Ga0495584_0066228 | |||
| 1434 | Ga0495594_0061877 | |||
| 1435 | Ga0495596_0025578 | |||
| 1436 | Ga0495607_0153390 | |||
| 1437 | Ga0495608_0001216 | |||
| 1438 | Ga0495608_0048246 | |||
| 1439 | Ga0495618_0000561 | |||
| 1440 | Ga0495618_0014856 | |||
| 1441 | Ga0495618_0017961 | |||
| 1442 | Ga0495618_0207856 | |||
| 1443 | Ga0495628_0000185 | |||
| 1444 | Ga0495628_0035539 | |||
| 1445 | Ga0495630_0005490 | |||
| 1446 | Ga0495630_0076664 | |||
| 1447 | Ga0495630_0203184 | |||
| 1448 | Ga0495666_0055679 | |||
| 1449 | Ga0495652_0000466 | |||
| 1450 | Ga0495652_0050989 | |||
| 1451 | Ga0495652_0281834 | |||
| 1452 | Ga0495652_0415027 | |||
| 1453 | Ga0495665_0000240 | |||
| 1454 | Ga0495640_0028208 | |||
| 1455 | Ga0495640_0086439 | |||
| 1456 | Ga0495586_0079761 | |||
| 1457 | Ga0495587_0000537 | |||
| 1458 | Ga0495587_0048521 | |||
| 1459 | Ga0495587_0171103 | |||
| 1460 | Ga0495645_0000115 | |||
| 1461 | Ga0495667_0011033 | |||
| 1462 | Ga0495667_0011347 | |||
| 1463 | Ga0495667_0041925 | |||
| 1464 | Ga0495667_0145431 | |||
| 1465 | Ga0495668_0051358 | |||
| 1466 | Ga0495634_0012164 | |||
| 1467 | Ga0495634_0028372 | |||
| 1468 | Ga0495634_0169221 | |||
| 1469 | Ga0495635_0016636 | |||
| 1470 | Ga0495635_0048774 | |||
| 1471 | Ga0495635_0090558 | |||
| 1472 | Ga0495635_0266292 | |||
| 1473 | Ga0495588_0004083 | |||
| 1474 | Ga0495657_0029004 | |||
| 1475 | Ga0495657_0047150 | |||
| 1476 | Ga0495657_0050638 | |||
| 1477 | Ga0495599_0000135 | |||
| 1478 | Ga0495599_0086704 | |||
| 1479 | Ga0495623_0000350 | |||
| 1480 | Ga0495646_0000351 | |||
| 1481 | Ga0495647_0028505 | |||
| 1482 | Ga0495658_0000691 | |||
| 1483 | Ga0495658_0093703 | |||
| 1484 | Ga0495613_0011438 | |||
| 1485 | Ga0495613_0072645 | |||
| 1486 | Ga0495613_0104755 | |||
| 1487 | Ga0495600_0006098 | |||
| 1488 | Ga0495600_0006211 | |||
| 1489 | Ga0495581_0000481 | |||
| 1490 | Ga0495581_0035485 | |||
| 1491 | Ga0495581_0061459 | |||
| 1492 | Ga0495604_0000060 | |||
| 1493 | Ga0495604_0031932 | |||
| 1494 | Ga0495604_0045259 | |||
| 1495 | Ga0495604_0147924 | |||
| 1496 | Ga0495674_0011434 | |||
| 1497 | Ga0495674_0022505 | |||
| 1498 | Ga0495674_0399587 | |||
| 1499 | Ga0495676_0000654 | |||
| 1500 | Ga0495676_0010451 | |||
| 1501 | Ga0495680_0002258 | |||
| 1502 | Ga0495680_0002435 | |||
| 1503 | Ga0495680_0003818 | |||
| 1504 | Ga0495680_0014000 | |||
| 1505 | Ga0495680_0024176 | |||
| 1506 | Ga0495680_0035391 | |||
| 1507 | Ga0495680_0326125 | |||
| 1508 | Ga0495675_0000223 | |||
| 1509 | Ga0495675_0245997 | |||
| 1510 | Ga0495684_0014714 | |||
| 1511 | Ga0495684_0051296 | |||
| 1512 | Ga0495684_0130327 | |||
| 1513 | Ga0495684_0191592 | |||
| 1514 | Ga0495593_0011508 | |||
| 1515 | Ga0495602_0000197 | |||
| 1516 | Ga0495602_0338282 | |||
| 1517 | Ga0495614_0035273 | |||
| 1518 | Ga0496100_0062511 | |||
| 1519 | Ga0496100_0110649 | |||
| 1520 | Ga0496100_0158934 | |||
| 1521 | Ga0496101_0003915 | |||
| 1522 | Ga0496101_0006852 | |||
| 1523 | Ga0496101_0010618 | |||
| 1524 | Ga0496101_0016672 | |||
| 1525 | Ga0496101_0069443 | |||
| 1526 | Ga0496101_0263273 | |||
| 1527 | Ga0496102_0004341 | |||
| 1528 | Ga0496102_0006327 | |||
| 1529 | Ga0496102_0007328 | |||
| 1530 | Ga0496102_0010973 | |||
| 1531 | Ga0496102_0017197 | |||
| 1532 | Ga0496102_0017858 | |||
| 1533 | Ga0496102_0069875 | |||
| 1534 | Ga0496102_0160808 | |||
| 1535 | Ga0496102_0544014 | |||
| 1536 | Ga0496103_0028980 | |||
| 1537 | Ga0496103_0064673 | |||
| 1538 | Ga0496103_0132925 | |||
| 1539 | Ga0496104_0000254 | |||
| 1540 | Ga0496104_0001809 | |||
| 1541 | Ga0496104_0003247 | |||
| 1542 | Ga0496104_0040739 | |||
| 1543 | Ga0496104_0055821 | |||
| 1544 | Ga0496104_0110054 | |||
| 1545 | Ga0496104_0167778 | |||
| 1546 | Ga0496104_0168149 | |||
| 1547 | Ga0496105_0000055 | |||
| 1548 | Ga0496105_0001748 | |||
| 1549 | Ga0496105_0010299 | |||
| 1550 | Ga0496105_0015684 | |||
| 1551 | Ga0496105_0016988 | |||
| 1552 | Ga0496105_0076842 | |||
| 1553 | Ga0496105_0109580 | |||
| 1554 | Ga0496106_0004134 | |||
| 1555 | Ga0496106_0019107 | |||
| 1556 | Ga0496106_0104903 | |||
| 1557 | Ga0496106_0177148 | |||
| 1558 | Ga0496106_0430358 | |||
| 1559 | Ga0496107_0028465 | |||
| 1560 | Ga0496107_0051018 | |||
| 1561 | Ga0496107_0116299 | |||
| 1562 | Ga0496107_0173568 | |||
| 1563 | Ga0496108_0025258 | |||
| 1564 | Ga0496108_0034899 | |||
| 1565 | Ga0496108_0065698 | |||
| 1566 | Ga0496108_0374932 | |||
| 1567 | Ga0496109_0001140 | |||
| 1568 | Ga0496109_0013078 | |||
| 1569 | Ga0496109_0019918 | |||
| 1570 | Ga0496109_0056112 | |||
| 1571 | Ga0496109_0078028 | |||
| 1572 | Ga0496109_0084123 | |||
| 1573 | Ga0496109_0119989 | |||
| 1574 | Ga0496109_0187046 | |||
| 1575 | Ga0496109_0221378 | |||
| 1576 | Ga0496110_0001472 | |||
| 1577 | Ga0496110_0010434 | |||
| 1578 | Ga0496110_0031403 | |||
| 1579 | Ga0496110_0041456 | |||
| 1580 | Ga0496110_0162808 | |||
| 1581 | Ga0496110_0210433 | |||
| 1582 | Ga0496110_0334525 | |||
| 1583 | Ga0496111_0000582 | |||
| 1584 | Ga0496111_0001388 | |||
| 1585 | Ga0496111_0019990 | |||
| 1586 | Ga0496111_0027506 | |||
| 1587 | Ga0496111_0134013 | |||
| 1588 | Ga0496112_0033359 | |||
| 1589 | Ga0496112_0200423 | |||
| 1590 | Ga0496112_0635899 | |||
| 1591 | Ga0496113_0015361 | |||
| 1592 | Ga0496113_0233939 | |||
| 1593 | Ga0496114_0000256 | |||
| 1594 | Ga0496114_0002392 | |||
| 1595 | Ga0496114_0003388 | |||
| 1596 | Ga0496114_0004328 | |||
| 1597 | Ga0496114_0015571 | |||
| 1598 | Ga0496114_0024176 | |||
| 1599 | Ga0496114_0040438 | |||
| 1600 | Ga0496114_0177383 | |||
| 1601 | Ga0496114_0185944 | |||
| 1602 | Ga0496114_0186170 | |||
| 1603 | Ga0496114_0201726 | |||
| 1604 | Ga0496115_0010994 | |||
| 1605 | Ga0496115_0014093 | |||
| 1606 | Ga0496115_0019911 | |||
| 1607 | Ga0496115_0059349 | |||
| 1608 | Ga0496115_0124405 | |||
| 1609 | Ga0496115_0125968 | |||
| 1610 | Ga0496115_0307010 | |||
| 1611 | Ga0496115_0642998 | |||
| 1612 | Ga0501031_0005364 | |||
| 1613 | Ga0501031_0057948 | |||
| 1614 | Ga0501032_0050504 | |||
| 1615 | Ga0501033_0029934 | |||
| 1616 | Ga0501034_0053587 | |||
| 1617 | Ga0501034_0173568 | |||
| 1618 | Ga0501034_0186800 | |||
| 1619 | Ga0501034_0326640 | |||
| 1620 | Ga0501036_0008841 | |||
| 1621 | Ga0501036_0012587 | |||
| 1622 | Ga0501036_0055128 | |||
| 1623 | Ga0501037_0007155 | |||
| 1624 | Ga0501037_0063001 | |||
| 1625 | Ga0501038_0004352 | |||
| 1626 | Ga0501038_0010405 | |||
| 1627 | Ga0501039_0007649 | |||
| 1628 | Ga0501039_0019157 | |||
| 1629 | Ga0501039_0034101 | |||
| 1630 | Ga0501040_0009636 | |||
| 1631 | Ga0501040_0030782 | |||
| 1632 | Ga0501040_0086996 | |||
| 1633 | Ga0501040_0094042 | |||
| 1634 | Ga0501041_0005357 | |||
| 1635 | Ga0501041_0015393 | |||
| 1636 | Ga0501041_0054237 | |||
| 1637 | Ga0501041_0138615 | |||
| 1638 | Ga0501041_0161737 | |||
| 1639 | Ga0501042_0007391 | |||
| 1640 | Ga0501042_0323404 | |||
| 1641 | Ga0501043_0114181 | |||
| 1642 | Ga0501043_0136899 | |||
| 1643 | Ga0501046_0008189 | |||
| 1644 | Ga0501046_0137527 | |||
| 1645 | Ga0501046_0190519 | |||
| 1646 | Ga0501047_0028024 | |||
| 1647 | Ga0501048_0015969 | |||
| 1648 | Ga0501048_0078888 | |||
| 1649 | Ga0501048_0128678 | |||
| 1650 | Ga0501067_0004482 | |||
| 1651 | Ga0501067_0025963 | |||
| 1652 | Ga0501067_0026142 | |||
| 1653 | Ga0501067_0031868 | |||
| 1654 | Ga0501067_0081089 | |||
| 1655 | Ga0501067_0136085 | |||
| 1656 | Ga0501068_0001354 | |||
| 1657 | Ga0501068_0005957 | |||
| 1658 | Ga0501068_0018073 | |||
| 1659 | Ga0501068_0051552 | |||
| 1660 | Ga0501068_0073970 | |||
| 1661 | Ga0501069_0016121 | |||
| 1662 | Ga0501069_0019982 | |||
| 1663 | Ga0501069_0105072 | |||
| 1664 | Ga0501069_0127079 | |||
| 1665 | Ga0501070_0015415 | |||
| 1666 | Ga0501070_0020855 | |||
| 1667 | Ga0501070_0214752 | |||
| 1668 | Ga0501071_0009471 | |||
| 1669 | Ga0501071_0015098 | |||
| 1670 | Ga0501071_0046781 | |||
| 1671 | Ga0501072_0007825 | |||
| 1672 | Ga0501072_0015793 | |||
| 1673 | Ga0501072_0017765 | |||
| 1674 | Ga0501072_0026018 | |||
| 1675 | Ga0501072_0073576 | |||
| 1676 | Ga0501073_0000628 | |||
| 1677 | Ga0501073_0026251 | |||
| 1678 | Ga0501073_0087624 | |||
| 1679 | Ga0501074_0016439 | |||
| 1680 | Ga0501074_0024114 | |||
| 1681 | Ga0501074_0026160 | |||
| 1682 | Ga0501074_0103669 | |||
| 1683 | Ga0501075_0004487 | |||
| 1684 | Ga0501075_0005137 | |||
| 1685 | Ga0501075_0033610 | |||
| 1686 | Ga0501075_0148855 | |||
| 1687 | Ga0501076_0018581 | |||
| 1688 | Ga0501076_0065302 | |||
| 1689 | Ga0501077_0005536 | |||
| 1690 | Ga0501077_0009048 | |||
| 1691 | Ga0501077_0011415 | |||
| 1692 | Ga0501079_0007265 | |||
| 1693 | Ga0501079_0043082 | |||
| 1694 | Ga0501079_0077107 | |||
| 1695 | Ga0501079_0174503 | |||
| 1696 | Ga0501080_0021157 | |||
| 1697 | Ga0501080_0057448 | |||
| 1698 | Ga0501080_0067361 | |||
| 1699 | Ga0501081_0008239 | |||
| 1700 | Ga0501081_0011177 | |||
| 1701 | Ga0501081_0023921 | |||
| 1702 | Ga0501083_0000739 | |||
| 1703 | Ga0501083_0005244 | |||
| 1704 | Ga0501035_0069067 | |||
| 1705 | Ga0501035_0074745 | |||
| 1706 | Ga0501044_0095658 | |||
| 1707 | Ga0501045_0001564 | |||
| 1708 | Ga0501045_0002762 | |||
| 1709 | Ga0501045_0222089 | |||
| 1710 | nmdc:mga03n38_177166_c1 | |||
| 1711 | nmdc:mga07m45_93842_c1 | |||
| 1712 | nmdc:mga05p37_17104_c1 | |||
| 1713 | nmdc:mga05p37_39397_c1 | |||
| 1714 | nmdc:mga05p37_4337_c1 | |||
| 1715 | nmdc:mga05p37_64172_c1 | |||
| 1716 | nmdc:mga05p37_885_c1 | |||
| 1717 | nmdc:mga09592_197115_c1 | |||
| 1718 | nmdc:mga09592_303537_c1 | |||
| 1719 | nmdc:mga09592_6255_c1 | |||
| 1720 | nmdc:mga06r32_307375_c1 | |||
| 1721 | nmdc:mga06r32_661127_c1 | |||
| 1722 | nmdc:mga08y16_1003_c1 | |||
| 1723 | nmdc:mga08y16_145036_c1 | |||
| 1724 | nmdc:mga08y16_178663_c1 | |||
| 1725 | nmdc:mga08y16_27785_c1 | |||
| 1726 | nmdc:mga08y16_279118_c1 | |||
| 1727 | nmdc:mga08y16_469887_c1 | |||
| 1728 | nmdc:mga08y16_60710_c1 | |||
| 1729 | nmdc:mga0n895_14233_c1 | |||
| 1730 | nmdc:mga0n895_455325_c1 | |||
| 1731 | nmdc:mga0n895_97399_c1 | |||
| 1732 | nmdc:mga0rr50_121001_c1 | |||
| 1733 | nmdc:mga0rr50_20546_c1 | |||
| 1734 | nmdc:mga0rr50_66409_c1 | |||
| 1735 | nmdc:mga0a205_107563_c1 | |||
| 1736 | nmdc:mga0a205_110063_c1 | |||
| 1737 | nmdc:mga0a205_231295_c1 | |||
| 1738 | nmdc:mga0a205_9352_c1 | |||
| 1739 | Ga0495601_0000238 | |||
| 1740 | Ga0495601_0008450 | |||
| 1741 | Ga0495601_0011451 | |||
| 1742 | Ga0495601_0023900 | |||
| 1743 | Ga0495601_0071041 | |||
| 1744 | Ga0495601_0081458 | |||
| 1745 | Ga0495601_0230248 | |||
| 1746 | Ga0495612_0054128 | |||
| 1747 | Ga0495595_0028779 | |||
| 1748 | Ga0495595_0043033 | |||
| 1749 | Ga0495595_0053527 | |||
| 1750 | Ga0495619_0000200 | |||
| 1751 | Ga0495619_0033926 | |||
| 1752 | Ga0495619_0041021 | |||
| 1753 | Ga0495619_0056785 | |||
| 1754 | Ga0495619_0121542 | |||
| 1755 | Ga0501084_0004886 | |||
| 1756 | Ga0501084_0037442 | |||
| 1757 | Ga0501084_0040580 | |||
| 1758 | Ga0501084_0089049 | |||
| 1759 | Ga0501084_0282052 | |||
| 1760 | Ga0501084_0398125 | |||
| 1761 | Ga0501082_0019554 | |||
| 1762 | Ga0501082_0045737 | |||
| 1763 | Ga0501082_0046905 | |||
| 1764 | Ga0501082_0143066 | |||
| 1765 | Ga0501082_0163468 | |||
| 1766 | Ga0466962_0001269 | |||
| 1767 | Ga0466962_0076178 | |||
| 1768 | Ga0466962_0117162 | |||
| 1769 | Ga0530510_0002748 | |||
| 1770 | Ga0530510_0009540 | |||
| 1771 | Ga0530510_0065593 | |||
| 1772 | Ga0530510_0126812 | |||
| 1773 | Ga0530510_0127397 | |||
| 1774 | 2867511325 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wsf-assembly1.cif.gz_D | crystal structure of a cupin protein (tm1459) in osmium (os)-substituted form ii | 0.9585 | 194 | 283 |
| 6l2e-assembly1.cif.gz_B | crystal structure of a cupin protein (tm1459, h52a mutant) in copper (cu) substituted form | 0.9501 | 194 | 283 |
| 3fjs-assembly2.cif.gz_D | crystal structure of a putative biosynthetic protein with rmlc-like cupin fold (reut_b4087) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.9414 | 197 | 283 |
| 8ch4-assembly1.cif.gz_C | crystal structure of the ring cleaving dioxygenase 5-nitrosalicylate 1,2-dioxygenase from bradyrhizobium sp. | 0.9373 | 210 | 283 |
| 2ozj-assembly2.cif.gz_B-3 | crystal structure of a cupin superfamily protein (dsy2733) from desulfitobacterium hafniense dcb-2 at 1.60 a resolution | 0.9309 | 195 | 283 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5wsdA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9408 | 194 | 282 | 2.60.120.10 |
| af_P17410_9_96_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9348 | 210 | 282 | 2.60.120.10 |
| 3fjsA00 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9318 | 206 | 283 | 2.60.120.10 |
| af_A0A1D8PPZ7_421_512_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9254 | 194 | 283 | 2.60.120.10 |
| af_Q03188_852_942_2.60.120.10 | Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls | 0.9216 | 194 | 284 | 2.60.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A524A6Q0-F1-model_v4 | Cupin domain-containing protein | 0.9735 | 194 | 284 |
|
| AF-A0A117SU88-F1-model_v4 | Cupin | 0.9729 | 197 | 286 |
|
| AF-L8P7J5-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9724 | 186 | 283 |
|
| AF-B5I9V5-F1-model_v4 | deleted | 0.9704 | 193 | 284 |
|
| AF-A0A432HEA0-F1-model_v4 | Cupin type-2 domain-containing protein | 0.9671 | 193 | 284 |
|