F484709

General Info

Members Datasets Scaffolds Average Seq Length
886 287 872 321

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0061795|Ga0501044_0061795_2629_3747
Length 372
Sequence MVDAVAGVAGCPCVAAPGAVVFPVRTQCFPGMAIVTGPACPKIARFAASLADVRITTMPNQETTVRLLPDVAVHAQPHLAGALDWVGMAEIQVPVLFDAGDGQPQRSSARVGAFVNLKRPDKRGIHMSRLYLQVEQALSTQPLGVDMLCSLLRGFLDSHRDLSDRACLSIHFEHLVRRPALKSANSGWRAYPVCIEASLVGDQFLLEFGTEVVYSSTCPASAALSRQLIQDQFARDFAPEQTLDHAAVLAWLGSEKGIVAAAHAQRSVARLRVRPAAGAGFHLVELIDRVESALGTPVQTAVKREDEQAFALANGSNLMFCEDAARRIQKALDADDRLGDFHIRVEHQESLHPHDAVAYASKGVEGGYGSMA

Samples

Sample ID Description Type Environment
1 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
2 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
3 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
4 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
5 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
6 2739367700 Dyella sp. YR388 Isolate Unclassified
7 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
8 2884411467 Dyella sp. AD56 Isolate Rhizosphere
9 2895395659 Rhodanobacter sp. T12-5 Isolate Unclassified
10 2928963466 Dyella japonica 1073 Isolate Unclassified
11 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
12 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
16 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
17 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
18 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
19 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
20 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
21 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
22 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
23 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
24 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
25 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
26 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
27 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
28 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
29 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
32 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
33 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
34 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
35 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
36 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
47 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
48 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
66 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
113 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
114 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
115 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
131 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
195 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
201 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
202 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
203 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
204 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
205 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
206 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
207 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
217 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
222 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
223 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
243 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
273 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
274 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
281 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
282 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
283 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
284 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
285 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.82
Metatranscriptomes 2.6
Isolates 1.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.29
Nodule 0
Rhizoplane 2.6
Rhizosphere 77.2
Stem 0
Stem Tuber 0
Unclassified 8.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000953 3300001915 Bacteria 8727
2 JGI24741J21665_1003038 3300001915 Bacteria 4149
3 JGI24741J21665_1005804 3300001915 Bacteria 2537
4 JGI24740J21852_10000025 3300001979 Bacteria 49637
5 JGI24740J21852_10000903 3300001979 Bacteria 13160
6 JGI24739J22299_10001277 3300001989 Bacteria 9467
7 JGI24737J22298_10000547 3300001990 Bacteria 13144
8 JGI24735J21928_10000402 3300002067 Bacteria 15100
9 JGI24735J21928_10000765 3300002067 Bacteria 11440
10 JGI24735J21928_10026879 3300002067 Bacteria 1727
11 JGI24738J21930_10000095 3300002075 Bacteria 20134
12 JGI25156J39149_1001220 3300002705 Bacteria 11373
13 JGI25156J39149_1004438 3300002705 Bacteria 4273
14 JGI25162J39368_1000163 3300002737 Bacteria 74121
15 JGI25162J39368_1000895 3300002737 Bacteria 19431
16 JGI25162J39368_1001009 3300002737 Bacteria 17538
17 JGI25162J39368_1001817 3300002737 Bacteria 10019
18 JGI25162J39368_1003662 3300002737 Bacteria 4210
19 JGI25162J39368_1005918 3300002737 Bacteria 2242
20 JGI25154J39366_1004347 3300002738 Bacteria 2572
21 JGI25154J39366_1007031 3300002738 Bacteria 1579
22 JGI25157J39369_1000229 3300002741 Bacteria 43921
23 JGI25157J39369_1000654 3300002741 Bacteria 19192
24 JGI25157J39369_1000804 3300002741 Bacteria 15869
25 JGI25157J39369_1001590 3300002741 Bacteria 7978
26 JGI25157J39369_1001594 3300002741 Bacteria 7966
27 JGI25157J39369_1002354 3300002741 Bacteria 4850
28 JGI25163J39215_1002482 3300002771 Bacteria 1868
29 JGI25164J39214_1000045 3300002772 Bacteria 125909
30 JGI25164J39214_1000285 3300002772 Bacteria 35663
31 JGI25164J39214_1000895 3300002772 Bacteria 10019
32 JGI25164J39214_1003165 3300002772 Bacteria 2178
33 JGI25165J46597_1000072 3300003214 Bacteria 192184
34 JGI25165J46597_1000215 3300003214 Bacteria 81941
35 JGI25165J46597_1001691 3300003214 Bacteria 9962
36 JGI25165J46597_1005009 3300003214 Bacteria 2655
37 rootH2_10012587 3300003320 Bacteria 26291
38 rootH1_10099388 3300003323 Bacteria 3088
39 Ga0055538_1001323 3300003751 Bacteria 4968
40 Ga0055533_1001642 3300003756 Bacteria 5755
41 Ga0055533_1003637 3300003756 Bacteria 3036
42 Ga0055533_1008192 3300003756 Bacteria 1346
43 Ga0055525_1000027 3300003759 Bacteria 340506
44 Ga0055527_1000082 3300003760 Bacteria 75048
45 Ga0055527_1000209 3300003760 Bacteria 37913
46 Ga0055527_1001667 3300003760 Bacteria 4381
47 Ga0055535_1000124 3300003761 Bacteria 81941
48 Ga0055535_1000143 3300003761 Bacteria 75049
49 Ga0055535_1000451 3300003761 Bacteria 37913
50 Ga0055535_1001467 3300003761 Bacteria 11877
51 Ga0055535_1001833 3300003761 Bacteria 9117
52 Ga0055542_1000082 3300003762 Bacteria 128120
53 Ga0055542_1000190 3300003762 Bacteria 75049
54 Ga0055542_1000197 3300003762 Bacteria 74121
55 Ga0055542_1000466 3300003762 Bacteria 37913
56 Ga0055542_1001205 3300003762 Bacteria 14614
57 Ga0055542_1001440 3300003762 Bacteria 11865
58 Ga0055542_1001764 3300003762 Bacteria 9117
59 Ga0055529_1000197 3300003763 Bacteria 81941
60 Ga0055529_1000204 3300003763 Bacteria 78293
61 Ga0055529_1000217 3300003763 Bacteria 75049
62 Ga0055529_1000671 3300003763 Bacteria 23784
63 Ga0055529_1004561 3300003763 Bacteria 2092
64 Ga0058861_10165984 3300004800 Bacteria 1771
65 Ga0058861_10177485 3300004800 Bacteria 1710
66 Ga0058862_10138123 3300004803 Bacteria 1752
67 Ga0070658_10004522 3300005327 Bacteria 11309
68 Ga0070683_100137528 3300005329 Bacteria 2314
69 Ga0070683_100187808 3300005329 Bacteria 1962
70 Ga0070666_10000005 3300005335 Bacteria 343092
71 Ga0070666_10000429 3300005335 Bacteria 25800
72 Ga0070666_10074612 3300005335 Bacteria 2312
73 Ga0070680_100000867 3300005336 Bacteria 21467
74 Ga0070680_100001693 3300005336 Bacteria 16162
75 Ga0070680_100054805 3300005336 Bacteria 3257
76 Ga0070680_100175740 3300005336 Bacteria 1803
77 Ga0070682_100001204 3300005337 Bacteria 14746
78 Ga0070682_100005295 3300005337 Bacteria 7180
79 Ga0070682_100011835 3300005337 Bacteria 4991
80 Ga0070682_100083069 3300005337 Bacteria 2078
81 Ga0068868_100573956 3300005338 Bacteria 996
82 Ga0070660_100015081 3300005339 Bacteria 5576
83 Ga0070660_100015362 3300005339 Bacteria 5525
84 Ga0070660_100078109 3300005339 Bacteria 2595
85 Ga0070689_100000503 3300005340 Bacteria 23097
86 Ga0070689_100002151 3300005340 Bacteria 12768
87 Ga0070691_10001587 3300005341 Bacteria 9819
88 Ga0070691_10023747 3300005341 Bacteria 2848
89 Ga0070661_100002927 3300005344 Bacteria 11769
90 Ga0070661_100003250 3300005344 Bacteria 11206
91 Ga0070661_100007160 3300005344 Bacteria 7692
92 Ga0070661_100008824 3300005344 Bacteria 6976
93 Ga0070661_100027284 3300005344 Bacteria 4110
94 Ga0070661_100141074 3300005344 Bacteria 1816
95 Ga0070661_100386507 3300005344 Bacteria 1104
96 Ga0070692_10006380 3300005345 Bacteria 5120
97 Ga0070692_10049729 3300005345 Bacteria 2175
98 Ga0070668_100004670 3300005347 Bacteria 10152
99 Ga0070668_100169158 3300005347 Bacteria 1778
100 Ga0070668_100386831 3300005347 Bacteria 1192
101 Ga0070668_100528591 3300005347 Bacteria 1024
102 Ga0070673_100178512 3300005364 Bacteria 1816
103 Ga0070688_100007703 3300005365 Bacteria 5816
104 Ga0070659_100008535 3300005366 Bacteria 7486
105 Ga0070659_100022166 3300005366 Bacteria 4846
106 Ga0070659_100035051 3300005366 Bacteria 3905
107 Ga0070659_100137509 3300005366 Bacteria 1987
108 Ga0070667_100000084 3300005367 Bacteria 118027
109 Ga0070667_100008020 3300005367 Bacteria 8760
110 Ga0070667_100150076 3300005367 Bacteria 2047
111 Ga0070667_100457849 3300005367 Bacteria 1166
112 Ga0070714_100002041 3300005435 Bacteria 14793
113 Ga0070714_100003673 3300005435 Bacteria 11488
114 Ga0070714_100030246 3300005435 Bacteria 4505
115 Ga0070713_100002146 3300005436 Bacteria 12752
116 Ga0070694_100366495 3300005444 Bacteria 1120
117 Ga0070663_100005118 3300005455 Bacteria 7763
118 Ga0070663_100024906 3300005455 Bacteria 4034
119 Ga0070663_100071487 3300005455 Bacteria 2525
120 Ga0070663_100133103 3300005455 Bacteria 1890
121 Ga0070663_100147423 3300005455 Bacteria 1801
122 Ga0070663_100225789 3300005455 Bacteria 1472
123 Ga0070663_100335101 3300005455 Bacteria 1220
124 Ga0070663_100457587 3300005455 Bacteria 1053
125 Ga0070662_100002882 3300005457 Bacteria 10670
126 Ga0070681_10000082 3300005458 Bacteria 71460
127 Ga0070681_10002020 3300005458 Bacteria 18373
128 Ga0070681_10017269 3300005458 Bacteria 7211
129 Ga0070681_10033942 3300005458 Bacteria 5122
130 Ga0068867_100020723 3300005459 Bacteria 4686
131 Ga0068867_100102866 3300005459 Bacteria 2184
132 Ga0068867_100246607 3300005459 Bacteria 1451
133 Ga0070685_10002217 3300005466 Bacteria 10022
134 Ga0070685_10003104 3300005466 Bacteria 8443
135 Ga0070685_10210674 3300005466 Bacteria 1268
136 Ga0070685_10215320 3300005466 Bacteria 1256
137 Ga0070679_100002079 3300005530 Bacteria 18018
138 Ga0070679_100002690 3300005530 Bacteria 16189
139 Ga0068853_100000519 3300005539 Bacteria 26137
140 Ga0068853_100002365 3300005539 Bacteria 14105
141 Ga0068853_100005078 3300005539 Bacteria 10270
142 Ga0068853_100035671 3300005539 Bacteria 4225
143 Ga0068853_100143402 3300005539 Bacteria 2145
144 Ga0068853_100255161 3300005539 Bacteria 1610
145 Ga0068853_100305432 3300005539 Bacteria 1472
146 Ga0070672_100134586 3300005543 Bacteria 2034
147 Ga0070686_100175430 3300005544 Bacteria 1519
148 Ga0070696_100007828 3300005546 Bacteria 7135
149 Ga0070693_100002312 3300005547 Bacteria 8745
150 Ga0070693_100033654 3300005547 Bacteria 2830
151 Ga0070665_100000669 3300005548 Bacteria 46135
152 Ga0070665_100009836 3300005548 Bacteria 9666
153 Ga0070665_100031284 3300005548 Bacteria 5356
154 Ga0070665_100090176 3300005548 Bacteria 3071
155 Ga0070665_100181665 3300005548 Bacteria 2105
156 Ga0068855_100004675 3300005563 Bacteria 16725
157 Ga0068855_100005634 3300005563 Bacteria 15280
158 Ga0068855_100019558 3300005563 Bacteria 8133
159 Ga0068855_100020454 3300005563 Bacteria 7937
160 Ga0068855_100031508 3300005563 Bacteria 6331
161 Ga0068855_100044766 3300005563 Bacteria 5237
162 Ga0068855_100068207 3300005563 Bacteria 4141
163 Ga0068855_100127301 3300005563 Bacteria 2911
164 Ga0068855_100358330 3300005563 Bacteria 1605
165 Ga0068855_100428074 3300005563 Bacteria 1447
166 Ga0070664_100028294 3300005564 Bacteria 4662
167 Ga0070664_100056433 3300005564 Bacteria 3337
168 Ga0068857_100000591 3300005577 Bacteria 26568
169 Ga0068857_100016068 3300005577 Bacteria 6558
170 Ga0068857_100038368 3300005577 Bacteria 4243
171 Ga0068857_100185690 3300005577 Bacteria 1893
172 Ga0068857_100310632 3300005577 Bacteria 1454
173 Ga0068857_100422540 3300005577 Bacteria 1243
174 Ga0068854_100001805 3300005578 Bacteria 13020
175 Ga0068854_100045299 3300005578 Bacteria 3127
176 Ga0068854_100229912 3300005578 Bacteria 1471
177 Ga0068856_100000416 3300005614 Bacteria 46989
178 Ga0068856_100000920 3300005614 Bacteria 31509
179 Ga0068856_100004209 3300005614 Bacteria 14362
180 Ga0068856_100008712 3300005614 Bacteria 9869
181 Ga0068856_100011913 3300005614 Bacteria 8419
182 Ga0068856_100016547 3300005614 Bacteria 7138
183 Ga0068856_100223920 3300005614 Bacteria 1896
184 Ga0068852_100129830 3300005616 Bacteria 2319
185 Ga0068852_100314759 3300005616 Bacteria 1518
186 Ga0068859_100000750 3300005617 Bacteria 32728
187 Ga0068859_100070799 3300005617 Bacteria 3523
188 Ga0068866_10181625 3300005718 Bacteria 1243
189 Ga0068861_100284541 3300005719 Bacteria 1425
190 Ga0068851_10009883 3300005834 Bacteria 4443
191 Ga0068863_100005401 3300005841 Bacteria 12603
192 Ga0068863_100028530 3300005841 Bacteria 5329
193 Ga0068863_100095264 3300005841 Bacteria 2825
194 Ga0068863_100190308 3300005841 Bacteria 1972
195 Ga0068863_100362591 3300005841 Bacteria 1413
196 Ga0068858_100026962 3300005842 Bacteria 5337
197 Ga0068858_100159888 3300005842 Bacteria 2121
198 Ga0068860_100005130 3300005843 Bacteria 13321
199 Ga0068860_100016313 3300005843 Bacteria 7243
200 Ga0068860_100038696 3300005843 Bacteria 4563
201 Ga0068860_100177135 3300005843 Bacteria 2061
202 Ga0068862_100004101 3300005844 Bacteria 12353
203 Ga0068862_100221011 3300005844 Bacteria 1715
204 Ga0081540_1012608 3300005983 Bacteria 5548
205 Ga0097621_100018988 3300006237 Bacteria 5268
206 Ga0097621_100050812 3300006237 Bacteria 3372
207 Ga0068871_100044939 3300006358 Bacteria 3553
208 Ga0068871_100049265 3300006358 Bacteria 3404
209 Ga0068871_100102711 3300006358 Bacteria 2396
210 Ga0068865_100038734 3300006881 Bacteria 3228
211 Ga0097620_100000750 3300006931 Bacteria 32728
212 Ga0097620_100070798 3300006931 Bacteria 3523
213 Ga0105240_10017472 3300009093 Bacteria 9666
214 Ga0105240_10017515 3300009093 Bacteria 9652
215 Ga0105240_10025699 3300009093 Bacteria 7736
216 Ga0105240_10032828 3300009093 Bacteria 6715
217 Ga0105240_10057571 3300009093 Bacteria 4855
218 Ga0105240_10108164 3300009093 Bacteria 3369
219 Ga0105240_10116726 3300009093 Bacteria 3219
220 Ga0105240_10133524 3300009093 Bacteria 2974
221 Ga0105245_10063906 3300009098 Bacteria 3325
222 Ga0105241_10005386 3300009174 Bacteria 9459
223 Ga0105241_10013404 3300009174 Bacteria 6009
224 Ga0105241_10030885 3300009174 Bacteria 4007
225 Ga0105241_10038015 3300009174 Bacteria 3629
226 Ga0105241_10527965 3300009174 Bacteria 1056
227 Ga0105248_10095471 3300009177 Bacteria 3348
228 Ga0105237_10000007 3300009545 Bacteria 367690
229 Ga0105237_10000064 3300009545 Bacteria 139463
230 Ga0105237_10000371 3300009545 Bacteria 63699
231 Ga0105237_10001616 3300009545 Bacteria 29259
232 Ga0105237_10006583 3300009545 Bacteria 12852
233 Ga0105237_10011148 3300009545 Bacteria 9530
234 Ga0105237_10033844 3300009545 Bacteria 5178
235 Ga0105237_10144806 3300009545 Bacteria 2371
236 Ga0105237_10430979 3300009545 Bacteria 1324
237 Ga0105238_10004930 3300009551 Bacteria 13211
238 Ga0105238_10005956 3300009551 Bacteria 12084
239 Ga0105238_10012802 3300009551 Bacteria 8465
240 Ga0105238_10016609 3300009551 Bacteria 7454
241 Ga0105238_10018736 3300009551 Bacteria 7049
242 Ga0105238_10027910 3300009551 Bacteria 5753
243 Ga0105238_10034487 3300009551 Bacteria 5149
244 Ga0105238_10071157 3300009551 Bacteria 3475
245 Ga0105238_10161508 3300009551 Bacteria 2216
246 Ga0105238_10162582 3300009551 Bacteria 2208
247 Ga0105238_10177957 3300009551 Bacteria 2104
248 Ga0105249_10000170 3300009553 Bacteria 76693
249 Ga0105249_10035940 3300009553 Bacteria 4494
250 Ga0105249_10298900 3300009553 Bacteria 1614
251 Ga0105249_10444704 3300009553 Bacteria 1334
252 Ga0105239_10000030 3300010375 Bacteria 233669
253 Ga0105239_10002288 3300010375 Bacteria 24464
254 Ga0105239_10007364 3300010375 Bacteria 12639
255 Ga0105239_10028018 3300010375 Bacteria 6199
256 Ga0105239_10030930 3300010375 Bacteria 5889
257 Ga0105239_10125653 3300010375 Bacteria 2850
258 Ga0105246_10014746 3300011119 Bacteria 4921
259 Ga0157314_1000130 3300012500 Bacteria 8211
260 Ga0157373_10004360 3300013100 Bacteria 10659
261 Ga0157371_10007084 3300013102 Bacteria 9118
262 Ga0157371_10012309 3300013102 Bacteria 6546
263 Ga0157371_10022989 3300013102 Bacteria 4558
264 Ga0157371_10193399 3300013102 Bacteria 1457
265 Ga0157370_10001525 3300013104 Bacteria 28645
266 Ga0157370_10019471 3300013104 Bacteria 6807
267 Ga0157370_10044325 3300013104 Bacteria 4276
268 Ga0157370_10054917 3300013104 Bacteria 3797
269 Ga0157370_10070652 3300013104 Bacteria 3295
270 Ga0157370_10222944 3300013104 Bacteria 1746
271 Ga0157370_10245217 3300013104 Bacteria 1657
272 Ga0157370_10363281 3300013104 Bacteria 1334
273 Ga0157369_10010587 3300013105 Bacteria 10499
274 Ga0157369_10018469 3300013105 Bacteria 7817
275 Ga0157369_10045493 3300013105 Bacteria 4773
276 Ga0157369_10053631 3300013105 Bacteria 4357
277 Ga0157369_10237333 3300013105 Bacteria 1905
278 Ga0157369_10238588 3300013105 Bacteria 1899
279 Ga0157374_10035342 3300013296 Bacteria 4572
280 Ga0157378_10000064 3300013297 Bacteria 93614
281 Ga0157378_10186471 3300013297 Bacteria 1954
282 Ga0163162_10000489 3300013306 Bacteria 36741
283 Ga0163162_10051171 3300013306 Bacteria 4144
284 Ga0157372_10001376 3300013307 Bacteria 26252
285 Ga0157372_10010749 3300013307 Bacteria 9744
286 Ga0157372_10016749 3300013307 Bacteria 7869
287 Ga0157372_10020714 3300013307 Bacteria 7097
288 Ga0157372_10033446 3300013307 Bacteria 5648
289 Ga0157372_10160964 3300013307 Bacteria 2594
290 Ga0157372_10276916 3300013307 Bacteria 1950
291 Ga0157375_10045710 3300013308 Bacteria 4263
292 Ga0163163_10000105 3300014325 Bacteria 89594
293 Ga0163163_10011034 3300014325 Bacteria 8170
294 Ga0182008_10004608 3300014497 Bacteria 8025
295 Ga0182008_10016163 3300014497 Bacteria 3883
296 Ga0182008_10021939 3300014497 Bacteria 3274
297 Ga0157379_10002818 3300014968 Bacteria 14645
298 Ga0157379_10295866 3300014968 Bacteria 1475
299 Ga0157376_10001752 3300014969 Bacteria 14453
300 Ga0157376_10013358 3300014969 Bacteria 6125
301 Ga0182006_1006386 3300015261 Bacteria 5487
302 Ga0182007_10011387 3300015262 Bacteria 3464
303 Ga0182007_10021739 3300015262 Bacteria 2273
304 Ga0182005_1001560 3300015265 Bacteria 9061
305 Ga0183369_1007 3300015685 Bacteria 414878
306 Ga0183368_1002 3300015687 Bacteria 1865598
307 Ga0183368_1003 3300015687 Bacteria 1276390
308 Ga0197907_10080030 3300020069 Bacteria 6332
309 Ga0197907_10144248 3300020069 Bacteria 1734
310 Ga0206356_10703880 3300020070 Bacteria 4367
311 Ga0206356_11479570 3300020070 Bacteria 3432
312 Ga0206356_11634425 3300020070 Bacteria 3577
313 Ga0206351_10823014 3300020077 Bacteria 3824
314 Ga0206352_10839414 3300020078 Bacteria 6426
315 Ga0206350_11098259 3300020080 Bacteria 4006
316 Ga0206350_11224783 3300020080 Bacteria 2356
317 Ga0206354_10681047 3300020081 Bacteria 2496
318 Ga0206354_10883312 3300020081 Bacteria 13243
319 Ga0206354_11560905 3300020081 Bacteria 3399
320 Ga0206353_10063786 3300020082 Bacteria 9300
321 Ga0206353_10205581 3300020082 Bacteria 3265
322 Ga0206353_11416403 3300020082 Bacteria 3846
323 Ga0206353_11944126 3300020082 Bacteria 4124
324 Ga0154015_1414264 3300020610 Bacteria 1302
325 Ga0154015_1526048 3300020610 Bacteria 8561
326 Ga0154015_1559805 3300020610 Bacteria 1356
327 Ga0224712_10002705 3300022467 Bacteria 4447
328 Ga0209784_100120 3300025224 Bacteria 82684
329 Ga0209566_104681 3300025225 Bacteria 1827
330 Ga0209674_100012 3300025226 Bacteria 950162
331 Ga0209674_100043 3300025226 Bacteria 369728
332 Ga0209674_100119 3300025226 Bacteria 135468
333 Ga0209674_101621 3300025226 Bacteria 5639
334 Ga0209672_100005 3300025228 Bacteria 1069303
335 Ga0209672_100016 3300025228 Bacteria 522604
336 Ga0209672_100277 3300025228 Bacteria 37238
337 Ga0209672_101154 3300025228 Bacteria 10845
338 Ga0209672_101232 3300025228 Bacteria 10326
339 Ga0209563_100023 3300025230 Bacteria 636844
340 Ga0207427_100013 3300025231 Bacteria 581419
341 Ga0207427_100055 3300025231 Bacteria 209093
342 Ga0207427_100244 3300025231 Bacteria 43765
343 Ga0207427_100248 3300025231 Bacteria 42623
344 Ga0207427_101389 3300025231 Bacteria 8868
345 Ga0209437_100015 3300025233 Bacteria 713457
346 Ga0209437_100020 3300025233 Bacteria 656374
347 Ga0209437_100079 3300025233 Bacteria 275948
348 Ga0209437_100161 3300025233 Bacteria 148264
349 Ga0209437_100194 3300025233 Bacteria 121991
350 Ga0209437_100224 3300025233 Bacteria 101515
351 Ga0209437_108589 3300025233 Bacteria 1628
352 Ga0209258_100006 3300025242 Bacteria 1069303
353 Ga0209258_100012 3300025242 Bacteria 825544
354 Ga0209258_100049 3300025242 Bacteria 358328
355 Ga0209258_100064 3300025242 Bacteria 293837
356 Ga0209258_100186 3300025242 Bacteria 132381
357 Ga0209258_100635 3300025242 Bacteria 27631
358 Ga0209258_101044 3300025242 Bacteria 12271
359 Ga0209258_101483 3300025242 Bacteria 8084
360 Ga0209258_101496 3300025242 Bacteria 7989
361 Ga0209646_1001117 3300025246 Bacteria 7912
362 Ga0209646_1001176 3300025246 Bacteria 7603
363 Ga0209646_1001570 3300025246 Bacteria 5993
364 Ga0209646_1005670 3300025246 Bacteria 2154
365 Ga0209026_1000037 3300025250 Bacteria 282562
366 Ga0209026_1000191 3300025250 Bacteria 88578
367 Ga0209026_1000204 3300025250 Bacteria 81999
368 Ga0209026_1000375 3300025250 Bacteria 41000
369 Ga0209026_1000541 3300025250 Bacteria 26051
370 Ga0209026_1000835 3300025250 Bacteria 16270
371 Ga0209026_1005804 3300025250 Bacteria 3205
372 Ga0209677_101790 3300025253 Bacteria 8864
373 Ga0209148_1000002 3300025254 Bacteria 2399500
374 Ga0209148_1000005 3300025254 Bacteria 1806504
375 Ga0209148_1000010 3300025254 Bacteria 1265567
376 Ga0209148_1000012 3300025254 Bacteria 1069303
377 Ga0209148_1000014 3300025254 Bacteria 925277
378 Ga0209148_1000073 3300025254 Bacteria 320851
379 Ga0209148_1000142 3300025254 Bacteria 163404
380 Ga0209759_1000103 3300025256 Bacteria 153195
381 Ga0209759_1000672 3300025256 Bacteria 31426
382 Ga0209759_1000792 3300025256 Bacteria 25985
383 Ga0209759_1001117 3300025256 Bacteria 17277
384 Ga0209759_1005678 3300025256 Bacteria 4310
385 Ga0209759_1006568 3300025256 Bacteria 3886
386 Ga0209759_1013773 3300025256 Bacteria 2171
387 Ga0209233_1000009 3300025261 Bacteria 1265567
388 Ga0209233_1000020 3300025261 Bacteria 798224
389 Ga0209233_1000063 3300025261 Bacteria 395810
390 Ga0209233_1000147 3300025261 Bacteria 186517
391 Ga0209455_1000008 3300025272 Bacteria 1069303
392 Ga0209455_1000014 3300025272 Bacteria 806601
393 Ga0209455_1000082 3300025272 Bacteria 257909
394 Ga0209455_1000177 3300025272 Bacteria 106026
395 Ga0209455_1000344 3300025272 Bacteria 43864
396 Ga0209455_1000380 3300025272 Bacteria 40273
397 Ga0209758_1003436 3300025297 Bacteria 14415
398 Ga0207680_10000005 3300025903 Bacteria 660983
399 Ga0207680_10000433 3300025903 Bacteria 19782
400 Ga0207647_10001268 3300025904 Bacteria 19437
401 Ga0207647_10007200 3300025904 Bacteria 8058
402 Ga0207647_10020606 3300025904 Bacteria 4418
403 Ga0207647_10034547 3300025904 Bacteria 3227
404 Ga0207647_10059960 3300025904 Bacteria 2327
405 Ga0207647_10086262 3300025904 Bacteria 1876
406 Ga0207647_10174380 3300025904 Bacteria 1251
407 Ga0207705_10000029 3300025909 Bacteria 239897
408 Ga0207705_10000439 3300025909 Bacteria 35994
409 Ga0207705_10000614 3300025909 Bacteria 29837
410 Ga0207705_10000810 3300025909 Bacteria 25657
411 Ga0207705_10002446 3300025909 Bacteria 14328
412 Ga0207705_10027148 3300025909 Bacteria 4080
413 Ga0207654_10082414 3300025911 Bacteria 1940
414 Ga0207654_10084396 3300025911 Bacteria 1920
415 Ga0207654_10236020 3300025911 Bacteria 1220
416 Ga0207707_10000042 3300025912 Bacteria 126050
417 Ga0207707_10001117 3300025912 Bacteria 25494
418 Ga0207707_10001192 3300025912 Bacteria 24480
419 Ga0207707_10001753 3300025912 Bacteria 19927
420 Ga0207707_10008818 3300025912 Bacteria 8757
421 Ga0207707_10013350 3300025912 Bacteria 7159
422 Ga0207707_10028042 3300025912 Bacteria 4921
423 Ga0207695_10000182 3300025913 Bacteria 184125
424 Ga0207695_10001055 3300025913 Bacteria 48329
425 Ga0207695_10001683 3300025913 Bacteria 35550
426 Ga0207695_10003105 3300025913 Bacteria 23782
427 Ga0207695_10004047 3300025913 Bacteria 20165
428 Ga0207695_10004100 3300025913 Bacteria 20029
429 Ga0207695_10004907 3300025913 Bacteria 18022
430 Ga0207695_10010974 3300025913 Bacteria 11012
431 Ga0207695_10013533 3300025913 Bacteria 9722
432 Ga0207695_10026471 3300025913 Bacteria 6474
433 Ga0207695_10046289 3300025913 Bacteria 4611
434 Ga0207695_10050523 3300025913 Bacteria 4373
435 Ga0207671_10000061 3300025914 Bacteria 175061
436 Ga0207671_10000074 3300025914 Bacteria 156482
437 Ga0207671_10001037 3300025914 Bacteria 33796
438 Ga0207671_10001766 3300025914 Bacteria 24288
439 Ga0207671_10002057 3300025914 Bacteria 22047
440 Ga0207671_10002248 3300025914 Bacteria 20904
441 Ga0207671_10014747 3300025914 Bacteria 6161
442 Ga0207660_10000206 3300025917 Bacteria 37525
443 Ga0207660_10000467 3300025917 Bacteria 26805
444 Ga0207660_10000948 3300025917 Bacteria 19217
445 Ga0207660_10003795 3300025917 Bacteria 9840
446 Ga0207660_10027285 3300025917 Bacteria 3895
447 Ga0207657_10018181 3300025919 Bacteria 6724
448 Ga0207657_10028402 3300025919 Bacteria 5103
449 Ga0207657_10032199 3300025919 Bacteria 4740
450 Ga0207657_10047247 3300025919 Bacteria 3765
451 Ga0207649_10000219 3300025920 Bacteria 46974
452 Ga0207649_10000873 3300025920 Bacteria 19102
453 Ga0207649_10015150 3300025920 Bacteria 4329
454 Ga0207649_10016581 3300025920 Bacteria 4158
455 Ga0207649_10023448 3300025920 Bacteria 3574
456 Ga0207649_10023845 3300025920 Bacteria 3548
457 Ga0207649_10033090 3300025920 Bacteria 3087
458 Ga0207649_10064539 3300025920 Bacteria 2315
459 Ga0207649_10105402 3300025920 Bacteria 1874
460 Ga0207649_10117326 3300025920 Bacteria 1789
461 Ga0207652_10000099 3300025921 Bacteria 93755
462 Ga0207652_10001601 3300025921 Bacteria 19926
463 Ga0207652_10002446 3300025921 Bacteria 15682
464 Ga0207652_10071450 3300025921 Bacteria 3016
465 Ga0207694_10001362 3300025924 Bacteria 21050
466 Ga0207694_10001608 3300025924 Bacteria 19045
467 Ga0207694_10017642 3300025924 Bacteria 5396
468 Ga0207694_10029488 3300025924 Bacteria 4187
469 Ga0207694_10062681 3300025924 Bacteria 2895
470 Ga0207650_10326052 3300025925 Bacteria 1258
471 Ga0207687_10108080 3300025927 Bacteria 2059
472 Ga0207700_10184227 3300025928 Bacteria 1750
473 Ga0207664_10000026 3300025929 Bacteria 194571
474 Ga0207664_10001714 3300025929 Bacteria 14452
475 Ga0207644_10141411 3300025931 Bacteria 1854
476 Ga0207644_10242721 3300025931 Bacteria 1435
477 Ga0207690_10000096 3300025932 Bacteria 72704
478 Ga0207690_10001160 3300025932 Bacteria 16674
479 Ga0207690_10002264 3300025932 Bacteria 11741
480 Ga0207690_10002499 3300025932 Bacteria 11123
481 Ga0207690_10003314 3300025932 Bacteria 9634
482 Ga0207690_10003820 3300025932 Bacteria 8911
483 Ga0207690_10017628 3300025932 Bacteria 4365
484 Ga0207706_10003820 3300025933 Bacteria 14360
485 Ga0207706_10029991 3300025933 Bacteria 4854
486 Ga0207670_10000709 3300025936 Bacteria 17570
487 Ga0207670_10000897 3300025936 Bacteria 15695
488 Ga0207669_10262741 3300025937 Bacteria 1292
489 Ga0207691_10094705 3300025940 Bacteria 2672
490 Ga0207711_10000503 3300025941 Bacteria 40349
491 Ga0207711_10404311 3300025941 Bacteria 1269
492 Ga0207689_10137001 3300025942 Bacteria 2016
493 Ga0207689_10185544 3300025942 Bacteria 1715
494 Ga0207661_10009873 3300025944 Bacteria 6856
495 Ga0207679_10019411 3300025945 Bacteria 4565
496 Ga0207667_10000075 3300025949 Bacteria 169836
497 Ga0207667_10000119 3300025949 Bacteria 124365
498 Ga0207667_10002530 3300025949 Bacteria 22759
499 Ga0207667_10003156 3300025949 Bacteria 20387
500 Ga0207667_10005743 3300025949 Bacteria 15144
501 Ga0207667_10005981 3300025949 Bacteria 14799
502 Ga0207667_10013444 3300025949 Bacteria 9368
503 Ga0207667_10032928 3300025949 Bacteria 5578
504 Ga0207667_10085827 3300025949 Bacteria 3258
505 Ga0207667_10165298 3300025949 Bacteria 2275
506 Ga0207667_10400190 3300025949 Bacteria 1398
507 Ga0207651_10274724 3300025960 Bacteria 1390
508 Ga0207712_10000699 3300025961 Bacteria 25897
509 Ga0207712_10076833 3300025961 Bacteria 2418
510 Ga0207668_10509738 3300025972 Bacteria 1036
511 Ga0207640_10000682 3300025981 Bacteria 19736
512 Ga0207640_10000797 3300025981 Bacteria 17930
513 Ga0207640_10002087 3300025981 Bacteria 10754
514 Ga0207640_10009780 3300025981 Bacteria 5377
515 Ga0207640_10012906 3300025981 Bacteria 4773
516 Ga0207640_10016636 3300025981 Bacteria 4284
517 Ga0207640_10021327 3300025981 Bacteria 3860
518 Ga0207640_10046417 3300025981 Bacteria 2795
519 Ga0207658_10000286 3300025986 Bacteria 52832
520 Ga0207658_10018784 3300025986 Bacteria 4779
521 Ga0207658_10103513 3300025986 Bacteria 2235
522 Ga0207658_10141608 3300025986 Bacteria 1947
523 Ga0207703_10228648 3300026035 Bacteria 1667
524 Ga0207703_10316342 3300026035 Bacteria 1428
525 Ga0207639_10000403 3300026041 Bacteria 29844
526 Ga0207639_10000467 3300026041 Bacteria 27884
527 Ga0207639_10001846 3300026041 Bacteria 14260
528 Ga0207639_10002484 3300026041 Bacteria 12355
529 Ga0207639_10012910 3300026041 Bacteria 5827
530 Ga0207639_10013353 3300026041 Bacteria 5748
531 Ga0207639_10029146 3300026041 Bacteria 4038
532 Ga0207639_10033451 3300026041 Bacteria 3793
533 Ga0207639_10049321 3300026041 Bacteria 3192
534 Ga0207639_10060749 3300026041 Bacteria 2916
535 Ga0207639_10202320 3300026041 Bacteria 1704
536 Ga0207678_10000612 3300026067 Bacteria 32677
537 Ga0207678_10000645 3300026067 Bacteria 32076
538 Ga0207678_10001123 3300026067 Bacteria 24559
539 Ga0207678_10002596 3300026067 Bacteria 16458
540 Ga0207678_10010848 3300026067 Bacteria 8007
541 Ga0207678_10011217 3300026067 Bacteria 7873
542 Ga0207678_10016567 3300026067 Bacteria 6472
543 Ga0207678_10017625 3300026067 Bacteria 6268
544 Ga0207678_10053286 3300026067 Bacteria 3487
545 Ga0207678_10084481 3300026067 Bacteria 2715
546 Ga0207702_10000185 3300026078 Bacteria 74602
547 Ga0207702_10000608 3300026078 Bacteria 39599
548 Ga0207702_10000937 3300026078 Bacteria 30118
549 Ga0207702_10005706 3300026078 Bacteria 10855
550 Ga0207702_10007572 3300026078 Bacteria 9249
551 Ga0207702_10009841 3300026078 Bacteria 8015
552 Ga0207702_10032311 3300026078 Bacteria 4367
553 Ga0207702_10074636 3300026078 Bacteria 2927
554 Ga0207702_10091309 3300026078 Bacteria 2666
555 Ga0207641_10004615 3300026088 Bacteria 11894
556 Ga0207641_10041728 3300026088 Bacteria 3846
557 Ga0207641_10053337 3300026088 Bacteria 3427
558 Ga0207641_10069252 3300026088 Bacteria 3028
559 Ga0207641_10105567 3300026088 Bacteria 2488
560 Ga0207648_10027641 3300026089 Bacteria 5034
561 Ga0207648_10044776 3300026089 Bacteria 3883
562 Ga0207676_10034330 3300026095 Bacteria 3840
563 Ga0207674_10000226 3300026116 Bacteria 70605
564 Ga0207674_10004576 3300026116 Bacteria 16605
565 Ga0207674_10008303 3300026116 Bacteria 12020
566 Ga0207674_10020397 3300026116 Bacteria 7160
567 Ga0207674_10037842 3300026116 Bacteria 5013
568 Ga0207674_10108990 3300026116 Bacteria 2745
569 Ga0207674_10226465 3300026116 Bacteria 1818
570 Ga0207683_10033766 3300026121 Bacteria 4446
571 Ga0207698_10000152 3300026142 Bacteria 44402
572 Ga0207698_10001073 3300026142 Bacteria 15905
573 Ga0207698_10008474 3300026142 Bacteria 6507
574 Ga0207698_10033318 3300026142 Bacteria 3743
575 Ga0207698_10110534 3300026142 Bacteria 2302
576 Ga0207698_10118938 3300026142 Bacteria 2232
577 Ga0207698_10183165 3300026142 Bacteria 1857
578 Ga0268266_10000001 3300028379 Bacteria 4040580
579 Ga0268266_10000004 3300028379 Bacteria 1495817
580 Ga0268266_10032349 3300028379 Bacteria 4445
581 Ga0268266_10075835 3300028379 Bacteria 2921
582 Ga0268266_10174503 3300028379 Bacteria 1953
583 Ga0268266_10210493 3300028379 Bacteria 1783
584 Ga0268266_10344714 3300028379 Bacteria 1399
585 Ga0268265_10000351 3300028380 Bacteria 49884
586 Ga0268265_10226607 3300028380 Bacteria 1639
587 Ga0268264_10010701 3300028381 Bacteria 7577
588 Ga0268264_10039882 3300028381 Bacteria 3879
589 Ga0307516_10061965 3300031730 Bacteria 3626
590 Ga0307412_10002655 3300031911 Bacteria 9920
591 Ga0307510_10006545 3300033180 Bacteria 13894
592 Ga0373937_0009963 3300036401 Bacteria 8288
593 Ga0395899_0000108 3300037312 Bacteria 142347
594 Ga0395899_0003966 3300037312 Bacteria 11658
595 Ga0395899_0075125 3300037312 Bacteria 2468
596 Ga0395900_0000144 3300037418 Bacteria 119971
597 Ga0395900_0002611 3300037418 Bacteria 19685
598 Ga0395900_0004074 3300037418 Bacteria 15582
599 Ga0395900_0108303 3300037418 Bacteria 2854
600 Ga0395900_0472415 3300037418 Bacteria 1207
601 Ga0395898_0000018 3300037466 Bacteria 418600
602 Ga0395898_0000049 3300037466 Bacteria 284792
603 Ga0395898_0010070 3300037466 Bacteria 9895
604 Ga0395901_0007941 3300038443 Bacteria 10703
605 Ga0395901_0008614 3300038443 Bacteria 10309
606 Ga0395901_0026088 3300038443 Bacteria 6000
607 Ga0395901_0046899 3300038443 Bacteria 4489
608 Ga0395901_0068848 3300038443 Bacteria 3686
609 Ga0395901_0077574 3300038443 Bacteria 3467
610 Ga0395901_0147990 3300038443 Bacteria 2468
611 Ga0395901_0203208 3300038443 Bacteria 2076
612 Ga0439436_0000063 3300041404 Bacteria 29794
613 Ga0439465_0013655 3300041413 Bacteria 2530
614 Ga0451793_0124576 3300041452 Bacteria 3666
615 Ga0451793_1156137 3300041452 Bacteria 2961
616 Ga0451804_0735999 3300041463 Bacteria 1348
617 Ga0451807_1232108 3300041486 Bacteria 1741
618 Ga0451843_0301553 3300041509 Bacteria 1287
619 Ga0451853_2407517 3300041512 Bacteria 2856
620 Ga0439437_008628 3300042000 Bacteria 1147
621 Ga0439448_0039460 3300042005 Bacteria 1523
622 Ga0450908_000063 3300042184 Bacteria 21431
623 Ga0439459_0000417 3300042438 Bacteria 5418
624 Ga0439459_0000559 3300042438 Bacteria 4954
625 Ga0466988_0043848 3300044536 Bacteria 2602
626 Ga0466969_0001731 3300044656 Bacteria 11648
627 Ga0466969_0006502 3300044656 Bacteria 6219
628 Ga0466969_0006507 3300044656 Bacteria 6214
629 Ga0466969_0047320 3300044656 Bacteria 2129
630 Ga0466975_0041644 3300044661 Bacteria 3251
631 Ga0466982_0000003 3300044672 Bacteria 417243
632 Ga0466965_0031818 3300044683 Bacteria 2574
633 Ga0466966_0003978 3300044684 Bacteria 9768
634 Ga0466966_0009639 3300044684 Bacteria 6390
635 Ga0466966_0021163 3300044684 Bacteria 4270
636 Ga0466966_0021164 3300044684 Bacteria 4270
637 Ga0466961_0008289 3300044693 Bacteria 6617
638 Ga0466961_0008586 3300044693 Bacteria 6509
639 Ga0466961_0016516 3300044693 Bacteria 4742
640 Ga0466961_0024137 3300044693 Bacteria 3911
641 Ga0466961_0102195 3300044693 Bacteria 1805
642 Ga0466961_0142850 3300044693 Bacteria 1498
643 Ga0466964_0010916 3300044706 Bacteria 3432
644 Ga0466964_0031741 3300044706 Bacteria 2096
645 Ga0466971_0003433 3300044719 Bacteria 6777
646 Ga0466971_0006777 3300044719 Bacteria 4984
647 Ga0466971_0009181 3300044719 Bacteria 4324
648 Ga0466968_0001048 3300044735 Bacteria 9788
649 Ga0466970_0013063 3300044765 Bacteria 4254
650 Ga0466970_0017321 3300044765 Bacteria 3722
651 Ga0466970_0077180 3300044765 Bacteria 1795
652 Ga0466957_0007781 3300044842 Bacteria 6067
653 Ga0466957_0044010 3300044842 Bacteria 2705
654 Ga0466960_0088191 3300044901 Bacteria 1576
655 Ga0466959_0000194 3300045049 Bacteria 39999
656 Ga0466959_0058983 3300045049 Bacteria 2795
657 Ga0466959_0115258 3300045049 Bacteria 1914
658 Ga0466959_0123144 3300045049 Bacteria 1842
659 Ga0466959_0159996 3300045049 Bacteria 1583
660 Ga0466958_0013431 3300045836 Bacteria 4663
661 Ga0466958_0305086 3300045836 Bacteria 1022
662 Ga0466967_0193402 3300045976 Bacteria 1924
663 Ga0495629_0228725 3300046459 Bacteria 1282
664 Ga0495638_0000038 3300046460 Bacteria 249534
665 Ga0495638_0000065 3300046460 Bacteria 170849
666 Ga0495638_0000234 3300046460 Bacteria 75860
667 Ga0495638_0000246 3300046460 Bacteria 74281
668 Ga0495638_0001171 3300046460 Bacteria 25181
669 Ga0495650_0000337 3300046471 Bacteria 83530
670 Ga0495650_0001325 3300046471 Bacteria 24874
671 Ga0495606_0000401 3300046507 Bacteria 73149
672 Ga0495606_0001737 3300046507 Bacteria 27992
673 Ga0495606_0090711 3300046507 Bacteria 1880
674 Ga0495606_0121965 3300046507 Bacteria 1559
675 Ga0495610_0002695 3300046512 Bacteria 14636
676 Ga0495622_0008848 3300046557 Bacteria 4662
677 Ga0495622_0016400 3300046557 Bacteria 3449
678 Ga0495625_0015363 3300046660 Bacteria 6067
679 Ga0495625_0059153 3300046660 Bacteria 2720
680 Ga0495625_0073623 3300046660 Bacteria 2394
681 Ga0495625_0077739 3300046660 Bacteria 2318
682 Ga0495588_0048477 3300046674 Bacteria 2182
683 Ga0495670_0000602 3300046691 Bacteria 17157
684 Ga0495649_0000553 3300046694 Bacteria 31708
685 Ga0495649_0003118 3300046694 Bacteria 11354
686 Ga0495649_0023284 3300046694 Bacteria 3461
687 Ga0495660_0112300 3300046810 Bacteria 1389
688 Ga0495660_0151856 3300046810 Bacteria 1143
689 Ga0495674_0315907 3300047319 Bacteria 1274
690 Ga0496100_0105631 3300048903 Bacteria 1948
691 Ga0496102_0110205 3300048905 Bacteria 2566
692 Ga0496104_0020445 3300048907 Bacteria 6068
693 Ga0496104_0228917 3300048907 Bacteria 1771
694 Ga0496105_0086219 3300048908 Bacteria 2595
695 Ga0496105_0222838 3300048908 Bacteria 1535
696 Ga0496106_0115344 3300048909 Bacteria 2095
697 Ga0496107_0015203 3300048910 Bacteria 5392
698 Ga0496113_0007592 3300048916 Bacteria 6996
699 Ga0496113_0265861 3300048916 Bacteria 1370
700 Ga0496115_0000032 3300048918 Bacteria 136928
701 Ga0496115_0000072 3300048918 Bacteria 91408
702 Ga0496115_0000503 3300048918 Bacteria 30610
703 Ga0496115_0002471 3300048918 Bacteria 13281
704 Ga0496115_0012375 3300048918 Bacteria 6418
705 Ga0496115_0020489 3300048918 Bacteria 5102
706 Ga0496115_0034829 3300048918 Bacteria 3979
707 Ga0496115_0087284 3300048918 Bacteria 2545
708 Ga0496115_0313715 3300048918 Bacteria 1284
709 Ga0496116_0024215 3300048919 Bacteria 4495
710 Ga0496117_0002308 3300048920 Bacteria 24516
711 Ga0496117_0022702 3300048920 Bacteria 5025
712 Ga0496117_0023610 3300048920 Bacteria 4893
713 Ga0496118_0003813 3300048921 Bacteria 18578
714 Ga0496118_0018381 3300048921 Bacteria 6310
715 Ga0496118_0018478 3300048921 Bacteria 6288
716 Ga0496119_0000430 3300048922 Bacteria 57802
717 Ga0496119_0008458 3300048922 Bacteria 9034
718 Ga0496119_0079198 3300048922 Bacteria 1899
719 Ga0496120_0001482 3300048923 Bacteria 27908
720 Ga0496120_0002085 3300048923 Bacteria 21429
721 Ga0496120_0063082 3300048923 Bacteria 2063
722 Ga0496121_0000743 3300048924 Bacteria 59998
723 Ga0496121_0034829 3300048924 Bacteria 4524
724 Ga0496121_0049835 3300048924 Bacteria 3545
725 Ga0496121_0059963 3300048924 Bacteria 3134
726 Ga0496121_0062223 3300048924 Bacteria 3058
727 Ga0496121_0096666 3300048924 Bacteria 2291
728 Ga0496122_0000440 3300048925 Bacteria 87364
729 Ga0496122_0170261 3300048925 Bacteria 1314
730 Ga0496123_0000407 3300048926 Bacteria 78763
731 Ga0496125_0000330 3300048928 Bacteria 91043
732 Ga0496126_0003181 3300048929 Bacteria 21118
733 Ga0496126_0007800 3300048929 Bacteria 11669
734 Ga0496126_0040236 3300048929 Bacteria 4334
735 Ga0496126_0061006 3300048929 Bacteria 3389
736 Ga0496126_0065861 3300048929 Bacteria 3240
737 Ga0496126_0076754 3300048929 Bacteria 2963
738 Ga0496126_0077576 3300048929 Bacteria 2945
739 Ga0495678_019726 3300049459 Bacteria 3000
740 Ga0495678_027635 3300049459 Bacteria 2405
741 Ga0495682_0003681 3300049460 Bacteria 6759
742 Ga0495682_0021421 3300049460 Bacteria 2422
743 Ga0501032_0000363 3300049569 Bacteria 37822
744 Ga0501032_0016603 3300049569 Bacteria 5176
745 Ga0501032_0023087 3300049569 Bacteria 4306
746 Ga0501032_0025306 3300049569 Bacteria 4092
747 Ga0501032_0053867 3300049569 Bacteria 2708
748 Ga0501032_0066447 3300049569 Bacteria 2410
749 Ga0501033_0001746 3300049570 Bacteria 19003
750 Ga0501033_0006702 3300049570 Bacteria 8996
751 Ga0501033_0031168 3300049570 Bacteria 4008
752 Ga0501033_0082593 3300049570 Bacteria 2355
753 Ga0501034_0001123 3300049571 Bacteria 37411
754 Ga0501034_0003950 3300049571 Bacteria 16663
755 Ga0501034_0004365 3300049571 Bacteria 15758
756 Ga0501036_0007040 3300049572 Bacteria 9150
757 Ga0501036_0033958 3300049572 Bacteria 4315
758 Ga0501036_0047314 3300049572 Bacteria 3643
759 Ga0501036_0131156 3300049572 Bacteria 2116
760 Ga0501036_0190600 3300049572 Bacteria 1725
761 Ga0501036_0237302 3300049572 Bacteria 1529
762 Ga0501037_0002802 3300049573 Bacteria 12632
763 Ga0501037_0005496 3300049573 Bacteria 9239
764 Ga0501037_0016373 3300049573 Bacteria 5455
765 Ga0501037_0063252 3300049573 Bacteria 2697
766 Ga0501037_0316266 3300049573 Bacteria 1081
767 Ga0501038_0005816 3300049574 Bacteria 11413
768 Ga0501038_0023872 3300049574 Bacteria 5460
769 Ga0501038_0025945 3300049574 Bacteria 5219
770 Ga0501038_0038393 3300049574 Bacteria 4193
771 Ga0501038_0044973 3300049574 Bacteria 3834
772 Ga0501038_0095087 3300049574 Bacteria 2489
773 Ga0501039_0002500 3300049575 Bacteria 13690
774 Ga0501040_0118048 3300049576 Bacteria 1860
775 Ga0501042_0227039 3300049578 Bacteria 1347
776 Ga0501043_0004046 3300049579 Bacteria 11994
777 Ga0501043_0014443 3300049579 Bacteria 6180
778 Ga0501043_0019217 3300049579 Bacteria 5364
779 Ga0501043_0034124 3300049579 Bacteria 4003
780 Ga0501043_0039964 3300049579 Bacteria 3687
781 Ga0501043_0167929 3300049579 Bacteria 1713
782 Ga0501043_0257436 3300049579 Bacteria 1343
783 Ga0501046_0001164 3300049580 Bacteria 25601
784 Ga0501046_0011780 3300049580 Bacteria 7466
785 Ga0501046_0047005 3300049580 Bacteria 3424
786 Ga0501046_0047222 3300049580 Bacteria 3414
787 Ga0501046_0069684 3300049580 Bacteria 2736
788 Ga0501046_0109515 3300049580 Bacteria 2111
789 Ga0501047_0000349 3300049581 Bacteria 52184
790 Ga0501047_0000442 3300049581 Bacteria 45876
791 Ga0501047_0004981 3300049581 Bacteria 12468
792 Ga0501047_0006844 3300049581 Bacteria 10712
793 Ga0501047_0014768 3300049581 Bacteria 7432
794 Ga0501047_0099357 3300049581 Bacteria 2789
795 Ga0501047_0100666 3300049581 Bacteria 2769
796 Ga0501047_0154848 3300049581 Bacteria 2166
797 Ga0501047_0241201 3300049581 Bacteria 1658
798 Ga0501047_0514310 3300049581 Bacteria 1023
799 Ga0501047_0539480 3300049581 Bacteria 991
800 Ga0501048_0026348 3300049582 Bacteria 4233
801 Ga0501048_0045146 3300049582 Bacteria 3149
802 Ga0501048_0158105 3300049582 Bacteria 1603
803 Ga0501067_0001081 3300049583 Bacteria 14698
804 Ga0501068_0013357 3300049584 Bacteria 4670
805 Ga0501068_0047726 3300049584 Bacteria 2583
806 Ga0501070_0015875 3300049586 Bacteria 6331
807 Ga0501070_0022463 3300049586 Bacteria 5283
808 Ga0501070_0081823 3300049586 Bacteria 2672
809 Ga0501070_0124071 3300049586 Bacteria 2134
810 Ga0501070_0271825 3300049586 Bacteria 1384
811 Ga0501070_0277422 3300049586 Bacteria 1368
812 Ga0501071_0146232 3300049587 Bacteria 1762
813 Ga0501072_0005374 3300049588 Bacteria 9751
814 Ga0501073_0001457 3300049589 Bacteria 17509
815 Ga0501073_0003157 3300049589 Bacteria 12356
816 Ga0501073_0016777 3300049589 Bacteria 5306
817 Ga0501073_0071916 3300049589 Bacteria 2409
818 Ga0501073_0081967 3300049589 Bacteria 2244
819 Ga0501073_0199925 3300049589 Bacteria 1382
820 Ga0501074_0000064 3300049590 Bacteria 50638
821 Ga0501074_0014817 3300049590 Bacteria 5670
822 Ga0501074_0032348 3300049590 Bacteria 3789
823 Ga0501074_0034046 3300049590 Bacteria 3693
824 Ga0501074_0346614 3300049590 Bacteria 1054
825 Ga0501077_0014144 3300049593 Bacteria 5008
826 Ga0501079_0016439 3300049741 Bacteria 5650
827 Ga0501079_0028469 3300049741 Bacteria 4288
828 Ga0501079_0221507 3300049741 Bacteria 1478
829 Ga0501080_0000816 3300049742 Bacteria 25408
830 Ga0501080_0007440 3300049742 Bacteria 9884
831 Ga0501080_0007767 3300049742 Bacteria 9696
832 Ga0501080_0008937 3300049742 Bacteria 9109
833 Ga0501080_0014704 3300049742 Bacteria 7206
834 Ga0501080_0039628 3300049742 Bacteria 4397
835 Ga0501080_0092338 3300049742 Bacteria 2811
836 Ga0501080_0152534 3300049742 Bacteria 2135
837 Ga0501083_0001472 3300049744 Bacteria 16091
838 Ga0501035_0001816 3300049822 Bacteria 21577
839 Ga0501035_0001993 3300049822 Bacteria 20407
840 Ga0501035_0005013 3300049822 Bacteria 12539
841 Ga0501035_0020333 3300049822 Bacteria 6095
842 Ga0501035_0036671 3300049822 Bacteria 4442
843 Ga0501035_0090941 3300049822 Bacteria 2686
844 Ga0501035_0092144 3300049822 Bacteria 2667
845 Ga0501035_0113619 3300049822 Bacteria 2372
846 Ga0501044_0001578 3300049823 Bacteria 26661
847 Ga0501044_0004055 3300049823 Bacteria 16431
848 Ga0501044_0005303 3300049823 Bacteria 14336
849 Ga0501044_0013654 3300049823 Bacteria 8777
850 Ga0501044_0040424 3300049823 Bacteria 4860
851 Ga0501044_0061795 3300049823 Bacteria 3831
852 Ga0501044_0068973 3300049823 Bacteria 3600
853 Ga0501044_0122019 3300049823 Bacteria 2606
854 Ga0501044_0122580 3300049823 Bacteria 2599
855 Ga0501044_0268523 3300049823 Bacteria 1642
856 Ga0501044_0401926 3300049823 Bacteria 1282
857 Ga0501044_0494063 3300049823 Bacteria 1125
858 Ga0501044_0752649 3300049823 Bacteria 856
859 Ga0500610_0001778 3300053079 Bacteria 7572
860 Ga0500643_018432 3300053087 Bacteria 2316
861 Ga0500651_0002824 3300053093 Bacteria 9318
862 Ga0500651_0005358 3300053093 Bacteria 7322
863 Ga0500566_0139771 3300053094 Bacteria 1286
864 Ga0500597_000097 3300053120 Bacteria 18127
865 Ga0500559_0125911 3300053136 Bacteria 1194
866 Ga0500620_001128 3300053155 Bacteria 4738
867 Ga0501084_0170469 3300054114 Bacteria 1837
868 Ga0501082_0000606 3300060353 Bacteria 31610
869 Ga0501082_0063029 3300060353 Bacteria 3192
870 Ga0501082_0063599 3300060353 Bacteria 3177
871 Ga0501082_0093544 3300060353 Bacteria 2598
872 Ga0466962_0007290 3300061719 Bacteria 5303

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049823 Ga0501044_0752649 Ga0501044_0752649_11_784 257
2 3300046507 Ga0495606_0121965 Ga0495606_0121965_599_1510 301
3 iso_pu_bacteria 2739367700 2739730448 301
4 iso_pu_bacteria 2842918807 2842920558 301
5 3300013297 Ga0157378_10000064 Ga0157378_1000006473 302
6 iso_pu_bacteria 2953994433 2953995843 302
7 3300049569 Ga0501032_0025306 Ga0501032_0025306_2161_3111 303
8 3300049580 Ga0501046_0047222 Ga0501046_0047222_306_1256 303
9 iso_pu_bacteria 2928963466 2928964489 303
10 3300005365 Ga0070688_100007703 Ga0070688_1000077035 304
11 3300005466 Ga0070685_10003104 Ga0070685_100031044 304
12 3300014325 Ga0163163_10000105 Ga0163163_1000010547 304
13 3300002075 JGI24738J21930_10000095 JGI24738J21930_1000009513 305
14 3300005563 Ga0068855_100127301 Ga0068855_1001273014 305
15 3300015265 Ga0182005_1001560 Ga0182005_10015603 305
16 3300025228 Ga0209672_101232 Ga0209672_1012327 305
17 3300031911 Ga0307412_10002655 Ga0307412_100026558 305
18 3300041404 Ga0439436_0000063 Ga0439436_0000063_26182_27099 305
19 3300046460 Ga0495638_0000065 Ga0495638_0000065_104952_105869 305
20 3300046507 Ga0495606_0001737 Ga0495606_0001737_17590_18507 305
21 3300046507 Ga0495606_0090711 Ga0495606_0090711_158_1075 305
22 3300046512 Ga0495610_0002695 Ga0495610_0002695_8350_9267 305
23 3300046557 Ga0495622_0016400 Ga0495622_0016400_122_1039 305
24 3300046660 Ga0495625_0073623 Ga0495625_0073623_972_1889 305
25 3300046660 Ga0495625_0077739 Ga0495625_0077739_408_1325 305
26 3300046691 Ga0495670_0000602 Ga0495670_0000602_14346_15263 305
27 3300046694 Ga0495649_0003118 Ga0495649_0003118_1889_2806 305
28 3300046694 Ga0495649_0023284 Ga0495649_0023284_776_1693 305
29 3300046810 Ga0495660_0112300 Ga0495660_0112300_22_939 305
30 3300048918 Ga0496115_0000072 Ga0496115_0000072_26780_27697 305
31 3300048918 Ga0496115_0020489 Ga0496115_0020489_3231_4148 305
32 3300048918 Ga0496115_0313715 Ga0496115_0313715_240_1157 305
33 3300048922 Ga0496119_0079198 Ga0496119_0079198_668_1585 305
34 3300048923 Ga0496120_0063082 Ga0496120_0063082_99_1016 305
35 3300048929 Ga0496126_0007800 Ga0496126_0007800_7535_8452 305
36 3300048929 Ga0496126_0076754 Ga0496126_0076754_1043_1960 305
37 3300049459 Ga0495678_019726 Ga0495678_019726_369_1286 305
38 3300049460 Ga0495682_0003681 Ga0495682_0003681_3483_4400 305
39 3300002067 JGI24735J21928_10026879 JGI24735J21928_100268792 306
40 3300005327 Ga0070658_10004522 Ga0070658_100045228 306
41 3300005335 Ga0070666_10000005 Ga0070666_10000005116 306
42 3300005340 Ga0070689_100002151 Ga0070689_1000021519 306
43 3300005344 Ga0070661_100386507 Ga0070661_1003865071 306
44 3300005347 Ga0070668_100169158 Ga0070668_1001691582 306
45 3300005367 Ga0070667_100008020 Ga0070667_1000080203 306
46 3300005466 Ga0070685_10210674 Ga0070685_102106742 306
47 3300005548 Ga0070665_100031284 Ga0070665_1000312842 306
48 3300005842 Ga0068858_100026962 Ga0068858_1000269623 306
49 3300009551 Ga0105238_10016609 Ga0105238_100166097 306
50 3300009551 Ga0105238_10018736 Ga0105238_100187362 306
51 3300013306 Ga0163162_10000489 Ga0163162_1000048924 306
52 3300013306 Ga0163162_10051171 Ga0163162_100511712 306
53 3300025903 Ga0207680_10000005 Ga0207680_10000005474 306
54 3300025909 Ga0207705_10002446 Ga0207705_100024467 306
55 3300025920 Ga0207649_10016581 Ga0207649_100165814 306
56 3300025924 Ga0207694_10001362 Ga0207694_1000136211 306
57 3300025924 Ga0207694_10062681 Ga0207694_100626814 306
58 3300025936 Ga0207670_10000897 Ga0207670_1000089716 306
59 3300025986 Ga0207658_10103513 Ga0207658_101035132 306
60 3300028379 Ga0268266_10000004 Ga0268266_100000041059 306
61 3300033180 Ga0307510_10006545 Ga0307510_100065458 306
62 3300041413 Ga0439465_0013655 Ga0439465_0013655_1380_2300 306
63 3300046459 Ga0495629_0228725 Ga0495629_0228725_319_1239 306
64 3300046471 Ga0495650_0001325 Ga0495650_0001325_15850_16776 306
65 3300046660 Ga0495625_0059153 Ga0495625_0059153_305_1231 306
66 3300047319 Ga0495674_0315907 Ga0495674_0315907_186_1106 306
67 3300048907 Ga0496104_0228917 Ga0496104_0228917_699_1619 306
68 3300048909 Ga0496106_0115344 Ga0496106_0115344_302_1222 306
69 3300048918 Ga0496115_0034829 Ga0496115_0034829_2348_3268 306
70 3300048924 Ga0496121_0049835 Ga0496121_0049835_1290_2210 306
71 3300048924 Ga0496121_0096666 Ga0496121_0096666_1096_2022 306
72 3300048925 Ga0496122_0170261 Ga0496122_0170261_336_1256 306
73 3300048929 Ga0496126_0061006 Ga0496126_0061006_1244_2170 306
74 3300053136 Ga0500559_0125911 Ga0500559_0125911_134_1054 306
75 3300002737 JGI25162J39368_1003662 JGI25162J39368_10036624 307
76 3300003762 Ga0055542_1000082 Ga0055542_100008220 307
77 3300005455 Ga0070663_100457587 Ga0070663_1004575871 307
78 3300005459 Ga0068867_100246607 Ga0068867_1002466072 307
79 3300025231 Ga0207427_101389 Ga0207427_1013899 307
80 3300025233 Ga0209437_100194 Ga0209437_10019495 307
81 3300025242 Ga0209258_101496 Ga0209258_1014968 307
82 3300025254 Ga0209148_1000002 Ga0209148_10000021631 307
83 3300041452 Ga0451793_0124576 Ga0451793_0124576_1425_2348 307
84 3300042438 Ga0439459_0000417 Ga0439459_0000417_3689_4612 307
85 3300042438 Ga0439459_0000559 Ga0439459_0000559_3506_4429 307
86 3300046460 Ga0495638_0000246 Ga0495638_0000246_1806_2729 307
87 3300049582 Ga0501048_0045146 Ga0501048_0045146_12_935 307
88 3300053093 Ga0500651_0002824 Ga0500651_0002824_8272_9195 307
89 3300005459 Ga0068867_100102866 Ga0068867_1001028662 308
90 3300005563 Ga0068855_100428074 Ga0068855_1004280742 308
91 3300026089 Ga0207648_10044776 Ga0207648_100447762 308
92 3300025225 Ga0209566_104681 Ga0209566_1046812 309
93 3300025246 Ga0209646_1005670 Ga0209646_10056702 309
94 3300025256 Ga0209759_1001117 Ga0209759_100111714 309
95 3300049569 Ga0501032_0023087 Ga0501032_0023087_2241_3170 309
96 3300049571 Ga0501034_0001123 Ga0501034_0001123_12543_13472 309
97 3300049574 Ga0501038_0025945 Ga0501038_0025945_1187_2116 309
98 3300049581 Ga0501047_0000349 Ga0501047_0000349_1331_2260 309
99 3300049581 Ga0501047_0004981 Ga0501047_0004981_7550_8479 309
100 3300049581 Ga0501047_0539480 Ga0501047_0539480_45_974 309
101 3300049583 Ga0501067_0001081 Ga0501067_0001081_1236_2165 309
102 3300049584 Ga0501068_0013357 Ga0501068_0013357_2269_3198 309
103 3300049586 Ga0501070_0015875 Ga0501070_0015875_3232_4161 309
104 3300049586 Ga0501070_0022463 Ga0501070_0022463_2602_3531 309
105 3300049586 Ga0501070_0081823 Ga0501070_0081823_887_1816 309
106 3300049588 Ga0501072_0005374 Ga0501072_0005374_7570_8499 309
107 3300049589 Ga0501073_0199925 Ga0501073_0199925_404_1333 309
108 3300049590 Ga0501074_0032348 Ga0501074_0032348_2333_3262 309
109 3300049741 Ga0501079_0016439 Ga0501079_0016439_3655_4584 309
110 3300049741 Ga0501079_0221507 Ga0501079_0221507_217_1146 309
111 3300049742 Ga0501080_0007440 Ga0501080_0007440_827_1756 309
112 3300049742 Ga0501080_0008937 Ga0501080_0008937_6428_7357 309
113 3300049742 Ga0501080_0014704 Ga0501080_0014704_5344_6273 309
114 3300049744 Ga0501083_0001472 Ga0501083_0001472_13894_14823 309
115 3300049823 Ga0501044_0001578 Ga0501044_0001578_8472_9401 309
116 3300054114 Ga0501084_0170469 Ga0501084_0170469_17_946 309
117 3300060353 Ga0501082_0063599 Ga0501082_0063599_1334_2263 309
118 3300060353 Ga0501082_0093544 Ga0501082_0093544_1597_2526 309
119 3300005344 Ga0070661_100141074 Ga0070661_1001410742 311
120 3300009098 Ga0105245_10063906 Ga0105245_100639063 311
121 3300009551 Ga0105238_10004930 Ga0105238_100049309 311
122 3300010375 Ga0105239_10028018 Ga0105239_100280182 311
123 3300025920 Ga0207649_10117326 Ga0207649_101173262 311
124 3300025927 Ga0207687_10108080 Ga0207687_101080802 311
125 3300025931 Ga0207644_10242721 Ga0207644_102427212 311
126 3300042184 Ga0450908_000063 Ga0450908_000063_208_1143 311
127 3300049572 Ga0501036_0190600 Ga0501036_0190600_323_1258 311
128 3300049579 Ga0501043_0039964 Ga0501043_0039964_2456_3391 311
129 3300049580 Ga0501046_0047005 Ga0501046_0047005_1160_2095 311
130 3300049581 Ga0501047_0000442 Ga0501047_0000442_39103_40038 311
131 3300049589 Ga0501073_0071916 Ga0501073_0071916_475_1410 311
132 3300049590 Ga0501074_0014817 Ga0501074_0014817_1063_1998 311
133 3300049742 Ga0501080_0092338 Ga0501080_0092338_1136_2071 311
134 iso_pu_bacteria 2537561836 2538832279 311
135 iso_pu_bacteria 2643221562 2643830289 311
136 iso_pu_bacteria 2895395659 2895397676 311
137 iso_pu_bacteria 2939611941 2939612509 311
138 3300002737 JGI25162J39368_1000163 JGI25162J39368_100016368 312
139 3300002738 JGI25154J39366_1004347 JGI25154J39366_10043473 312
140 3300002741 JGI25157J39369_1000804 JGI25157J39369_100080410 312
141 3300002771 JGI25163J39215_1002482 JGI25163J39215_10024822 312
142 3300002772 JGI25164J39214_1000285 JGI25164J39214_100028529 312
143 3300003214 JGI25165J46597_1000215 JGI25165J46597_100021510 312
144 3300003751 Ga0055538_1001323 Ga0055538_10013232 312
145 3300003761 Ga0055535_1000124 Ga0055535_100012410 312
146 3300003762 Ga0055542_1000197 Ga0055542_100019710 312
147 3300003763 Ga0055529_1000197 Ga0055529_100019772 312
148 3300005335 Ga0070666_10000429 Ga0070666_1000042915 312
149 3300005841 Ga0068863_100362591 Ga0068863_1003625912 312
150 3300025224 Ga0209784_100120 Ga0209784_1001209 312
151 3300025231 Ga0207427_100013 Ga0207427_100013527 312
152 3300025233 Ga0209437_100015 Ga0209437_1000159 312
153 3300025242 Ga0209258_100049 Ga0209258_100049116 312
154 3300025246 Ga0209646_1001176 Ga0209646_10011766 312
155 3300025250 Ga0209026_1000204 Ga0209026_10002049 312
156 3300025254 Ga0209148_1000010 Ga0209148_1000010904 312
157 3300025256 Ga0209759_1000672 Ga0209759_10006729 312
158 3300025261 Ga0209233_1000009 Ga0209233_1000009266 312
159 3300025272 Ga0209455_1000082 Ga0209455_10000829 312
160 3300025903 Ga0207680_10000433 Ga0207680_1000043311 312
161 iso_pu_bacteria 2643221577 2643896774 312
162 iso_pu_bacteria 2643221685 2644478979 312
163 iso_pu_bacteria 2687453130 2687583762 312
164 3300002741 JGI25157J39369_1002354 JGI25157J39369_10023544 313
165 3300003763 Ga0055529_1004561 Ga0055529_10045612 313
166 3300005337 Ga0070682_100083069 Ga0070682_1000830692 313
167 3300005338 Ga0068868_100573956 Ga0068868_1005739561 313
168 3300005367 Ga0070667_100457849 Ga0070667_1004578491 313
169 3300005455 Ga0070663_100147423 Ga0070663_1001474232 313
170 3300005455 Ga0070663_100225789 Ga0070663_1002257892 313
171 3300005466 Ga0070685_10215320 Ga0070685_102153201 313
172 3300005539 Ga0068853_100000519 Ga0068853_1000005198 313
173 3300005539 Ga0068853_100005078 Ga0068853_1000050785 313
174 3300005548 Ga0070665_100009836 Ga0070665_1000098365 313
175 3300005563 Ga0068855_100004675 Ga0068855_1000046754 313
176 3300005563 Ga0068855_100005634 Ga0068855_1000056349 313
177 3300005577 Ga0068857_100422540 Ga0068857_1004225402 313
178 3300005578 Ga0068854_100229912 Ga0068854_1002299122 313
179 3300005614 Ga0068856_100000416 Ga0068856_1000004167 313
180 3300005617 Ga0068859_100070799 Ga0068859_1000707992 313
181 3300005841 Ga0068863_100005401 Ga0068863_10000540113 313
182 3300005841 Ga0068863_100028530 Ga0068863_1000285303 313
183 3300005843 Ga0068860_100005130 Ga0068860_10000513014 313
184 3300006931 Ga0097620_100070798 Ga0097620_1000707982 313
185 3300009093 Ga0105240_10057571 Ga0105240_100575714 313
186 3300009174 Ga0105241_10527965 Ga0105241_105279651 313
187 3300009177 Ga0105248_10095471 Ga0105248_100954711 313
188 3300009545 Ga0105237_10000007 Ga0105237_10000007149 313
189 3300009553 Ga0105249_10035940 Ga0105249_100359404 313
190 3300010375 Ga0105239_10002288 Ga0105239_1000228814 313
191 3300011119 Ga0105246_10014746 Ga0105246_100147464 313
192 3300013104 Ga0157370_10363281 Ga0157370_103632812 313
193 3300014325 Ga0163163_10011034 Ga0163163_100110343 313
194 3300014968 Ga0157379_10002818 Ga0157379_100028188 313
195 3300015685 Ga0183369_1007 Ga0183369_1007384 313
196 3300020070 Ga0206356_11634425 Ga0206356_116344252 313
197 3300025250 Ga0209026_1000835 Ga0209026_100083514 313
198 3300025256 Ga0209759_1006568 Ga0209759_10065684 313
199 3300025272 Ga0209455_1000344 Ga0209455_100034423 313
200 3300025904 Ga0207647_10174380 Ga0207647_101743801 313
201 3300025913 Ga0207695_10026471 Ga0207695_100264716 313
202 3300025914 Ga0207671_10000074 Ga0207671_10000074110 313
203 3300025920 Ga0207649_10015150 Ga0207649_100151502 313
204 3300025941 Ga0207711_10404311 Ga0207711_104043111 313
205 3300025949 Ga0207667_10005981 Ga0207667_100059815 313
206 3300025949 Ga0207667_10085827 Ga0207667_100858272 313
207 3300025981 Ga0207640_10012906 Ga0207640_100129065 313
208 3300026035 Ga0207703_10228648 Ga0207703_102286481 313
209 3300026041 Ga0207639_10002484 Ga0207639_100024848 313
210 3300026067 Ga0207678_10010848 Ga0207678_100108482 313
211 3300026067 Ga0207678_10053286 Ga0207678_100532862 313
212 3300026078 Ga0207702_10000185 Ga0207702_1000018549 313
213 3300026088 Ga0207641_10004615 Ga0207641_100046154 313
214 3300026088 Ga0207641_10041728 Ga0207641_100417284 313
215 3300026095 Ga0207676_10034330 Ga0207676_100343303 313
216 3300026116 Ga0207674_10108990 Ga0207674_101089902 313
217 3300028379 Ga0268266_10032349 Ga0268266_100323494 313
218 3300028379 Ga0268266_10075835 Ga0268266_100758354 313
219 3300038443 Ga0395901_0026088 Ga0395901_0026088_1165_2106 313
220 3300041463 Ga0451804_0735999 Ga0451804_0735999_334_1296 313
221 3300041512 Ga0451853_2407517 Ga0451853_2407517_1592_2533 313
222 3300049579 Ga0501043_0167929 Ga0501043_0167929_236_1186 313
223 3300049581 Ga0501047_0099357 Ga0501047_0099357_1648_2589 313
224 3300049586 Ga0501070_0277422 Ga0501070_0277422_155_1096 313
225 3300049822 Ga0501035_0113619 Ga0501035_0113619_1360_2304 313
226 3300049823 Ga0501044_0122019 Ga0501044_0122019_781_1722 313
227 3300049823 Ga0501044_0122580 Ga0501044_0122580_664_1608 313
228 iso_pu_bacteria 2739367700 2739730266 313
229 iso_pu_bacteria 2884411467 2884412138 313
230 iso_pu_bacteria 2928963466 2928967702 313
231 3300005842 Ga0068858_100159888 Ga0068858_1001598881 314
232 3300006358 Ga0068871_100044939 Ga0068871_1000449392 314
233 3300006881 Ga0068865_100038734 Ga0068865_1000387343 314
234 3300009545 Ga0105237_10430979 Ga0105237_104309792 314
235 3300014968 Ga0157379_10295866 Ga0157379_102958662 314
236 3300025925 Ga0207650_10326052 Ga0207650_103260522 314
237 3300026035 Ga0207703_10316342 Ga0207703_103163422 314
238 3300026041 Ga0207639_10033451 Ga0207639_100334513 314
239 3300026088 Ga0207641_10053337 Ga0207641_100533373 314
240 3300026116 Ga0207674_10226465 Ga0207674_102264652 314
241 3300044536 Ga0466988_0043848 Ga0466988_0043848_410_1354 314
242 3300044656 Ga0466969_0001731 Ga0466969_0001731_4904_5848 314
243 3300044684 Ga0466966_0009639 Ga0466966_0009639_1333_2277 314
244 3300044693 Ga0466961_0008289 Ga0466961_0008289_1294_2238 314
245 3300044719 Ga0466971_0009181 Ga0466971_0009181_1214_2158 314
246 3300045049 Ga0466959_0159996 Ga0466959_0159996_122_1066 314
247 3300048922 Ga0496119_0008458 Ga0496119_0008458_5032_5976 314
248 3300049570 Ga0501033_0006702 Ga0501033_0006702_3218_4162 314
249 3300049570 Ga0501033_0082593 Ga0501033_0082593_525_1469 314
250 3300049573 Ga0501037_0063252 Ga0501037_0063252_1169_2113 314
251 3300049574 Ga0501038_0023872 Ga0501038_0023872_2998_3942 314
252 3300049579 Ga0501043_0014443 Ga0501043_0014443_2230_3174 314
253 3300049579 Ga0501043_0257436 Ga0501043_0257436_94_1038 314
254 3300049581 Ga0501047_0154848 Ga0501047_0154848_1058_2002 314
255 3300049581 Ga0501047_0241201 Ga0501047_0241201_10_954 314
256 3300049581 Ga0501047_0514310 Ga0501047_0514310_46_990 314
257 3300049586 Ga0501070_0271825 Ga0501070_0271825_21_965 314
258 3300049590 Ga0501074_0346614 Ga0501074_0346614_17_961 314
259 3300049742 Ga0501080_0152534 Ga0501080_0152534_1138_2082 314
260 3300049822 Ga0501035_0020333 Ga0501035_0020333_3906_4850 314
261 3300049822 Ga0501035_0090941 Ga0501035_0090941_576_1520 314
262 3300049823 Ga0501044_0013654 Ga0501044_0013654_3259_4203 314
263 3300049823 Ga0501044_0494063 Ga0501044_0494063_168_1112 314
264 3300060353 Ga0501082_0000606 Ga0501082_0000606_22517_23461 314
265 3300002737 JGI25162J39368_1001817 JGI25162J39368_10018172 315
266 3300002737 JGI25162J39368_1005918 JGI25162J39368_10059181 315
267 3300002741 JGI25157J39369_1000654 JGI25157J39369_10006542 315
268 3300002772 JGI25164J39214_1000895 JGI25164J39214_10008952 315
269 3300002772 JGI25164J39214_1003165 JGI25164J39214_10031652 315
270 3300003214 JGI25165J46597_1001691 JGI25165J46597_10016911 315
271 3300003214 JGI25165J46597_1005009 JGI25165J46597_10050092 315
272 3300005335 Ga0070666_10074612 Ga0070666_100746122 315
273 3300005336 Ga0070680_100175740 Ga0070680_1001757402 315
274 3300005337 Ga0070682_100005295 Ga0070682_1000052953 315
275 3300005337 Ga0070682_100011835 Ga0070682_1000118355 315
276 3300005339 Ga0070660_100015081 Ga0070660_1000150816 315
277 3300005339 Ga0070660_100015362 Ga0070660_1000153626 315
278 3300005339 Ga0070660_100078109 Ga0070660_1000781092 315
279 3300005344 Ga0070661_100027284 Ga0070661_1000272846 315
280 3300005366 Ga0070659_100008535 Ga0070659_1000085356 315
281 3300005366 Ga0070659_100137509 Ga0070659_1001375092 315
282 3300005435 Ga0070714_100002041 Ga0070714_10000204110 315
283 3300005435 Ga0070714_100003673 Ga0070714_1000036738 315
284 3300005435 Ga0070714_100030246 Ga0070714_1000302463 315
285 3300005436 Ga0070713_100002146 Ga0070713_1000021469 315
286 3300005444 Ga0070694_100366495 Ga0070694_1003664952 315
287 3300005455 Ga0070663_100071487 Ga0070663_1000714872 315
288 3300005458 Ga0070681_10017269 Ga0070681_100172692 315
289 3300005458 Ga0070681_10033942 Ga0070681_100339426 315
290 3300005539 Ga0068853_100002365 Ga0068853_1000023657 315
291 3300005539 Ga0068853_100255161 Ga0068853_1002551611 315
292 3300005547 Ga0070693_100033654 Ga0070693_1000336542 315
293 3300005548 Ga0070665_100090176 Ga0070665_1000901763 315
294 3300005548 Ga0070665_100181665 Ga0070665_1001816652 315
295 3300005563 Ga0068855_100044766 Ga0068855_1000447665 315
296 3300005577 Ga0068857_100016068 Ga0068857_1000160686 315
297 3300005578 Ga0068854_100045299 Ga0068854_1000452993 315
298 3300005614 Ga0068856_100011913 Ga0068856_1000119133 315
299 3300005616 Ga0068852_100314759 Ga0068852_1003147591 315
300 3300005843 Ga0068860_100016313 Ga0068860_1000163132 315
301 3300005983 Ga0081540_1012608 Ga0081540_10126086 315
302 3300006237 Ga0097621_100050812 Ga0097621_1000508124 315
303 3300009093 Ga0105240_10116726 Ga0105240_101167263 315
304 3300009174 Ga0105241_10005386 Ga0105241_100053869 315
305 3300009174 Ga0105241_10013404 Ga0105241_100134047 315
306 3300009174 Ga0105241_10038015 Ga0105241_100380154 315
307 3300009545 Ga0105237_10011148 Ga0105237_100111482 315
308 3300009545 Ga0105237_10033844 Ga0105237_100338445 315
309 3300009551 Ga0105238_10005956 Ga0105238_100059564 315
310 3300009551 Ga0105238_10012802 Ga0105238_100128028 315
311 3300009551 Ga0105238_10034487 Ga0105238_100344873 315
312 3300009551 Ga0105238_10071157 Ga0105238_100711572 315
313 3300009553 Ga0105249_10298900 Ga0105249_102989002 315
314 3300010375 Ga0105239_10007364 Ga0105239_1000736414 315
315 3300010375 Ga0105239_10030930 Ga0105239_100309302 315
316 3300013102 Ga0157371_10007084 Ga0157371_100070849 315
317 3300013104 Ga0157370_10001525 Ga0157370_100015256 315
318 3300013104 Ga0157370_10019471 Ga0157370_100194718 315
319 3300013104 Ga0157370_10044325 Ga0157370_100443252 315
320 3300013104 Ga0157370_10054917 Ga0157370_100549173 315
321 3300013104 Ga0157370_10070652 Ga0157370_100706521 315
322 3300013105 Ga0157369_10045493 Ga0157369_100454932 315
323 3300013307 Ga0157372_10001376 Ga0157372_1000137623 315
324 3300013307 Ga0157372_10016749 Ga0157372_100167496 315
325 3300013307 Ga0157372_10276916 Ga0157372_102769161 315
326 3300014497 Ga0182008_10004608 Ga0182008_100046084 315
327 3300014497 Ga0182008_10016163 Ga0182008_100161634 315
328 3300014497 Ga0182008_10021939 Ga0182008_100219394 315
329 3300014969 Ga0157376_10013358 Ga0157376_100133586 315
330 3300015261 Ga0182006_1006386 Ga0182006_10063862 315
331 3300015262 Ga0182007_10011387 Ga0182007_100113873 315
332 3300015262 Ga0182007_10021739 Ga0182007_100217391 315
333 3300025226 Ga0209674_101621 Ga0209674_1016213 315
334 3300025231 Ga0207427_100244 Ga0207427_10024436 315
335 3300025231 Ga0207427_100248 Ga0207427_10024834 315
336 3300025233 Ga0209437_100020 Ga0209437_100020395 315
337 3300025233 Ga0209437_100079 Ga0209437_10007910 315
338 3300025250 Ga0209026_1000037 Ga0209026_1000037116 315
339 3300025253 Ga0209677_101790 Ga0209677_1017902 315
340 3300025256 Ga0209759_1013773 Ga0209759_10137731 315
341 3300025261 Ga0209233_1000020 Ga0209233_1000020231 315
342 3300025261 Ga0209233_1000147 Ga0209233_100014734 315
343 3300025904 Ga0207647_10007200 Ga0207647_100072002 315
344 3300025911 Ga0207654_10082414 Ga0207654_100824142 315
345 3300025911 Ga0207654_10084396 Ga0207654_100843962 315
346 3300025911 Ga0207654_10236020 Ga0207654_102360201 315
347 3300025912 Ga0207707_10008818 Ga0207707_100088186 315
348 3300025912 Ga0207707_10013350 Ga0207707_100133506 315
349 3300025913 Ga0207695_10000182 Ga0207695_100001822 315
350 3300025913 Ga0207695_10004100 Ga0207695_1000410019 315
351 3300025914 Ga0207671_10001037 Ga0207671_1000103737 315
352 3300025914 Ga0207671_10001766 Ga0207671_100017666 315
353 3300025919 Ga0207657_10028402 Ga0207657_100284026 315
354 3300025920 Ga0207649_10000873 Ga0207649_100008739 315
355 3300025921 Ga0207652_10071450 Ga0207652_100714503 315
356 3300025924 Ga0207694_10001608 Ga0207694_1000160818 315
357 3300025924 Ga0207694_10017642 Ga0207694_100176422 315
358 3300025928 Ga0207700_10184227 Ga0207700_101842272 315
359 3300025929 Ga0207664_10000026 Ga0207664_100000266 315
360 3300025929 Ga0207664_10001714 Ga0207664_100017146 315
361 3300025932 Ga0207690_10001160 Ga0207690_100011603 315
362 3300025932 Ga0207690_10002499 Ga0207690_100024993 315
363 3300025932 Ga0207690_10003314 Ga0207690_100033145 315
364 3300025932 Ga0207690_10003820 Ga0207690_100038202 315
365 3300025933 Ga0207706_10029991 Ga0207706_100299912 315
366 3300025949 Ga0207667_10005743 Ga0207667_100057438 315
367 3300025949 Ga0207667_10032928 Ga0207667_100329283 315
368 3300025949 Ga0207667_10165298 Ga0207667_101652982 315
369 3300025961 Ga0207712_10076833 Ga0207712_100768332 315
370 3300025981 Ga0207640_10016636 Ga0207640_100166364 315
371 3300026041 Ga0207639_10000467 Ga0207639_1000046727 315
372 3300026041 Ga0207639_10013353 Ga0207639_100133536 315
373 3300026041 Ga0207639_10029146 Ga0207639_100291462 315
374 3300026067 Ga0207678_10084481 Ga0207678_100844812 315
375 3300026078 Ga0207702_10091309 Ga0207702_100913093 315
376 3300026116 Ga0207674_10020397 Ga0207674_100203976 315
377 3300026142 Ga0207698_10033318 Ga0207698_100333183 315
378 3300028379 Ga0268266_10174503 Ga0268266_101745032 315
379 3300028379 Ga0268266_10344714 Ga0268266_103447142 315
380 3300028381 Ga0268264_10010701 Ga0268264_100107012 315
381 3300036401 Ga0373937_0009963 Ga0373937_0009963_710_1657 315
382 3300037312 Ga0395899_0003966 Ga0395899_0003966_8417_9364 315
383 3300037312 Ga0395899_0075125 Ga0395899_0075125_545_1492 315
384 3300037418 Ga0395900_0002611 Ga0395900_0002611_7577_8524 315
385 3300037418 Ga0395900_0004074 Ga0395900_0004074_8543_9490 315
386 3300037418 Ga0395900_0472415 Ga0395900_0472415_239_1186 315
387 3300037466 Ga0395898_0010070 Ga0395898_0010070_545_1492 315
388 3300038443 Ga0395901_0007941 Ga0395901_0007941_640_1587 315
389 3300038443 Ga0395901_0068848 Ga0395901_0068848_2534_3481 315
390 3300041452 Ga0451793_1156137 Ga0451793_1156137_841_1788 315
391 3300042000 Ga0439437_008628 Ga0439437_008628_106_1053 315
392 3300042005 Ga0439448_0039460 Ga0439448_0039460_243_1190 315
393 3300044683 Ga0466965_0031818 Ga0466965_0031818_663_1610 315
394 3300044719 Ga0466971_0003433 Ga0466971_0003433_4640_5587 315
395 3300044842 Ga0466957_0007781 Ga0466957_0007781_2144_3091 315
396 3300045836 Ga0466958_0013431 Ga0466958_0013431_2391_3338 315
397 3300046460 Ga0495638_0000038 Ga0495638_0000038_162323_163270 315
398 3300046674 Ga0495588_0048477 Ga0495588_0048477_165_1112 315
399 3300049569 Ga0501032_0016603 Ga0501032_0016603_763_1710 315
400 3300049570 Ga0501033_0031168 Ga0501033_0031168_1129_2076 315
401 3300049572 Ga0501036_0033958 Ga0501036_0033958_1476_2423 315
402 3300049574 Ga0501038_0044973 Ga0501038_0044973_2361_3308 315
403 3300049579 Ga0501043_0019217 Ga0501043_0019217_3792_4739 315
404 3300049580 Ga0501046_0069684 Ga0501046_0069684_1324_2271 315
405 3300049581 Ga0501047_0006844 Ga0501047_0006844_5728_6675 315
406 3300049581 Ga0501047_0014768 Ga0501047_0014768_1708_2655 315
407 3300049822 Ga0501035_0001816 Ga0501035_0001816_3890_4837 315
408 3300053079 Ga0500610_0001778 Ga0500610_0001778_158_1105 315
409 3300002705 JGI25156J39149_1001220 JGI25156J39149_100122013 316
410 3300002737 JGI25162J39368_1000895 JGI25162J39368_10008954 316
411 3300002738 JGI25154J39366_1007031 JGI25154J39366_10070311 316
412 3300002741 JGI25157J39369_1000229 JGI25157J39369_100022911 316
413 3300002741 JGI25157J39369_1001594 JGI25157J39369_10015948 316
414 3300002772 JGI25164J39214_1000045 JGI25164J39214_100004583 316
415 3300003214 JGI25165J46597_1000072 JGI25165J46597_100007283 316
416 3300003320 rootH2_10012587 rootH2_1001258717 316
417 3300003756 Ga0055533_1001642 Ga0055533_10016423 316
418 3300003759 Ga0055525_1000027 Ga0055525_1000027184 316
419 3300003760 Ga0055527_1000082 Ga0055527_100008269 316
420 3300003760 Ga0055527_1000209 Ga0055527_10002097 316
421 3300003760 Ga0055527_1001667 Ga0055527_10016673 316
422 3300003761 Ga0055535_1000143 Ga0055535_100014369 316
423 3300003761 Ga0055535_1000451 Ga0055535_10004517 316
424 3300003761 Ga0055535_1001467 Ga0055535_10014674 316
425 3300003761 Ga0055535_1001833 Ga0055535_10018335 316
426 3300003762 Ga0055542_1000190 Ga0055542_10001907 316
427 3300003762 Ga0055542_1000466 Ga0055542_10004667 316
428 3300003762 Ga0055542_1001440 Ga0055542_100144010 316
429 3300003762 Ga0055542_1001764 Ga0055542_10017647 316
430 3300003763 Ga0055529_1000204 Ga0055529_100020410 316
431 3300003763 Ga0055529_1000217 Ga0055529_10002177 316
432 3300003763 Ga0055529_1000671 Ga0055529_100067120 316
433 3300005347 Ga0070668_100004670 Ga0070668_1000046702 316
434 3300005364 Ga0070673_100178512 Ga0070673_1001785122 316
435 3300005539 Ga0068853_100035671 Ga0068853_1000356714 316
436 3300005543 Ga0070672_100134586 Ga0070672_1001345863 316
437 3300005614 Ga0068856_100008712 Ga0068856_1000087127 316
438 3300005617 Ga0068859_100000750 Ga0068859_10000075026 316
439 3300005719 Ga0068861_100284541 Ga0068861_1002845412 316
440 3300005841 Ga0068863_100095264 Ga0068863_1000952643 316
441 3300005843 Ga0068860_100038696 Ga0068860_1000386964 316
442 3300005844 Ga0068862_100004101 Ga0068862_10000410112 316
443 3300006931 Ga0097620_100000750 Ga0097620_1000007508 316
444 3300009545 Ga0105237_10006583 Ga0105237_1000658310 316
445 3300009551 Ga0105238_10161508 Ga0105238_101615082 316
446 3300010375 Ga0105239_10125653 Ga0105239_101256533 316
447 3300013297 Ga0157378_10186471 Ga0157378_101864712 316
448 3300025226 Ga0209674_100119 Ga0209674_10011997 316
449 3300025228 Ga0209672_100005 Ga0209672_100005686 316
450 3300025228 Ga0209672_100016 Ga0209672_100016333 316
451 3300025228 Ga0209672_100277 Ga0209672_10027738 316
452 3300025230 Ga0209563_100023 Ga0209563_100023345 316
453 3300025231 Ga0207427_100055 Ga0207427_100055128 316
454 3300025233 Ga0209437_100161 Ga0209437_100161101 316
455 3300025242 Ga0209258_100006 Ga0209258_100006686 316
456 3300025242 Ga0209258_100012 Ga0209258_100012474 316
457 3300025242 Ga0209258_100064 Ga0209258_100064214 316
458 3300025242 Ga0209258_100186 Ga0209258_10018643 316
459 3300025246 Ga0209646_1001570 Ga0209646_10015702 316
460 3300025250 Ga0209026_1000375 Ga0209026_100037526 316
461 3300025250 Ga0209026_1000541 Ga0209026_100054121 316
462 3300025254 Ga0209148_1000012 Ga0209148_1000012686 316
463 3300025254 Ga0209148_1000014 Ga0209148_1000014182 316
464 3300025254 Ga0209148_1000073 Ga0209148_100007399 316
465 3300025254 Ga0209148_1000142 Ga0209148_100014273 316
466 3300025256 Ga0209759_1000103 Ga0209759_1000103102 316
467 3300025256 Ga0209759_1000792 Ga0209759_100079221 316
468 3300025261 Ga0209233_1000063 Ga0209233_1000063278 316
469 3300025272 Ga0209455_1000008 Ga0209455_1000008686 316
470 3300025272 Ga0209455_1000014 Ga0209455_100001470 316
471 3300025272 Ga0209455_1000177 Ga0209455_100017743 316
472 3300025914 Ga0207671_10014747 Ga0207671_100147476 316
473 3300025940 Ga0207691_10094705 Ga0207691_100947051 316
474 3300026078 Ga0207702_10000937 Ga0207702_100009377 316
475 3300028379 Ga0268266_10210493 Ga0268266_102104932 316
476 3300028380 Ga0268265_10000351 Ga0268265_1000035145 316
477 3300028381 Ga0268264_10039882 Ga0268264_100398823 316
478 3300037312 Ga0395899_0000108 Ga0395899_0000108_76162_77112 316
479 3300037418 Ga0395900_0000144 Ga0395900_0000144_23213_24163 316
480 3300037466 Ga0395898_0000018 Ga0395898_0000018_337498_338448 316
481 3300037466 Ga0395898_0000049 Ga0395898_0000049_202530_203480 316
482 3300038443 Ga0395901_0077574 Ga0395901_0077574_1707_2657 316
483 3300044656 Ga0466969_0006502 Ga0466969_0006502_4282_5232 316
484 3300044656 Ga0466969_0006507 Ga0466969_0006507_4284_5234 316
485 3300044661 Ga0466975_0041644 Ga0466975_0041644_1020_1970 316
486 3300044684 Ga0466966_0021163 Ga0466966_0021163_1633_2583 316
487 3300044684 Ga0466966_0021164 Ga0466966_0021164_1688_2638 316
488 3300044693 Ga0466961_0008586 Ga0466961_0008586_3338_4288 316
489 3300044693 Ga0466961_0016516 Ga0466961_0016516_585_1535 316
490 3300044693 Ga0466961_0024137 Ga0466961_0024137_983_1933 316
491 3300044693 Ga0466961_0102195 Ga0466961_0102195_270_1220 316
492 3300044706 Ga0466964_0010916 Ga0466964_0010916_1474_2424 316
493 3300044765 Ga0466970_0013063 Ga0466970_0013063_971_1921 316
494 3300044765 Ga0466970_0017321 Ga0466970_0017321_461_1411 316
495 3300044765 Ga0466970_0077180 Ga0466970_0077180_233_1183 316
496 3300044842 Ga0466957_0044010 Ga0466957_0044010_826_1776 316
497 3300045049 Ga0466959_0000194 Ga0466959_0000194_13051_14001 316
498 3300045049 Ga0466959_0058983 Ga0466959_0058983_863_1813 316
499 3300045049 Ga0466959_0115258 Ga0466959_0115258_364_1314 316
500 3300045049 Ga0466959_0123144 Ga0466959_0123144_690_1640 316
501 3300045836 Ga0466958_0305086 Ga0466958_0305086_25_975 316
502 3300045976 Ga0466967_0193402 Ga0466967_0193402_919_1869 316
503 3300001989 JGI24739J22299_10001277 JGI24739J22299_100012772 317
504 3300001990 JGI24737J22298_10000547 JGI24737J22298_1000054714 317
505 3300002067 JGI24735J21928_10000765 JGI24735J21928_1000076513 317
506 3300002737 JGI25162J39368_1001009 JGI25162J39368_100100910 317
507 3300003756 Ga0055533_1008192 Ga0055533_10081922 317
508 3300003762 Ga0055542_1001205 Ga0055542_10012059 317
509 3300005340 Ga0070689_100000503 Ga0070689_10000050318 317
510 3300005344 Ga0070661_100007160 Ga0070661_1000071608 317
511 3300005347 Ga0070668_100386831 Ga0070668_1003868311 317
512 3300005367 Ga0070667_100000084 Ga0070667_10000008429 317
513 3300005455 Ga0070663_100005118 Ga0070663_1000051186 317
514 3300005455 Ga0070663_100024906 Ga0070663_1000249062 317
515 3300005455 Ga0070663_100335101 Ga0070663_1003351011 317
516 3300005466 Ga0070685_10002217 Ga0070685_100022176 317
517 3300005563 Ga0068855_100019558 Ga0068855_1000195585 317
518 3300005563 Ga0068855_100020454 Ga0068855_1000204547 317
519 3300005563 Ga0068855_100031508 Ga0068855_1000315087 317
520 3300005564 Ga0070664_100056433 Ga0070664_1000564334 317
521 3300005577 Ga0068857_100000591 Ga0068857_10000059116 317
522 3300005577 Ga0068857_100185690 Ga0068857_1001856902 317
523 3300005578 Ga0068854_100001805 Ga0068854_1000018055 317
524 3300005843 Ga0068860_100177135 Ga0068860_1001771353 317
525 3300005844 Ga0068862_100221011 Ga0068862_1002210112 317
526 3300009093 Ga0105240_10025699 Ga0105240_100256997 317
527 3300009093 Ga0105240_10032828 Ga0105240_100328286 317
528 3300009093 Ga0105240_10108164 Ga0105240_101081643 317
529 3300009545 Ga0105237_10000064 Ga0105237_1000006438 317
530 3300009551 Ga0105238_10027910 Ga0105238_100279103 317
531 3300012500 Ga0157314_1000130 Ga0157314_10001302 317
532 3300013105 Ga0157369_10053631 Ga0157369_100536313 317
533 3300015687 Ga0183368_1003 Ga0183368_1003733 317
534 3300025226 Ga0209674_100012 Ga0209674_100012484 317
535 3300025228 Ga0209672_101154 Ga0209672_1011547 317
536 3300025233 Ga0209437_100224 Ga0209437_10022434 317
537 3300025233 Ga0209437_108589 Ga0209437_1085892 317
538 3300025242 Ga0209258_101044 Ga0209258_1010448 317
539 3300025242 Ga0209258_101483 Ga0209258_1014837 317
540 3300025250 Ga0209026_1005804 Ga0209026_10058042 317
541 3300025254 Ga0209148_1000005 Ga0209148_1000005980 317
542 3300025297 Ga0209758_1003436 Ga0209758_100343610 317
543 3300025904 Ga0207647_10020606 Ga0207647_100206062 317
544 3300025904 Ga0207647_10059960 Ga0207647_100599601 317
545 3300025913 Ga0207695_10003105 Ga0207695_1000310511 317
546 3300025913 Ga0207695_10046289 Ga0207695_100462894 317
547 3300025913 Ga0207695_10050523 Ga0207695_100505236 317
548 3300025914 Ga0207671_10000061 Ga0207671_1000006198 317
549 3300025914 Ga0207671_10002248 Ga0207671_1000224815 317
550 3300025920 Ga0207649_10033090 Ga0207649_100330901 317
551 3300025920 Ga0207649_10105402 Ga0207649_101054022 317
552 3300025924 Ga0207694_10029488 Ga0207694_100294883 317
553 3300025936 Ga0207670_10000709 Ga0207670_1000070911 317
554 3300025941 Ga0207711_10000503 Ga0207711_1000050326 317
555 3300025942 Ga0207689_10137001 Ga0207689_101370012 317
556 3300025949 Ga0207667_10000119 Ga0207667_100001197 317
557 3300025949 Ga0207667_10003156 Ga0207667_1000315617 317
558 3300025960 Ga0207651_10274724 Ga0207651_102747242 317
559 3300025961 Ga0207712_10000699 Ga0207712_1000069919 317
560 3300025981 Ga0207640_10000797 Ga0207640_1000079716 317
561 3300025981 Ga0207640_10009780 Ga0207640_100097807 317
562 3300025986 Ga0207658_10000286 Ga0207658_1000028616 317
563 3300026041 Ga0207639_10012910 Ga0207639_100129103 317
564 3300026067 Ga0207678_10000645 Ga0207678_1000064522 317
565 3300026067 Ga0207678_10016567 Ga0207678_100165675 317
566 3300026116 Ga0207674_10000226 Ga0207674_1000022649 317
567 3300026116 Ga0207674_10037842 Ga0207674_100378426 317
568 3300026142 Ga0207698_10110534 Ga0207698_101105341 317
569 3300028380 Ga0268265_10226607 Ga0268265_102266072 317
570 3300044656 Ga0466969_0047320 Ga0466969_0047320_1117_2070 317
571 3300044672 Ga0466982_0000003 Ga0466982_0000003_335873_336826 317
572 3300044684 Ga0466966_0003978 Ga0466966_0003978_5040_5993 317
573 3300044693 Ga0466961_0142850 Ga0466961_0142850_294_1247 317
574 3300044706 Ga0466964_0031741 Ga0466964_0031741_403_1356 317
575 3300044719 Ga0466971_0006777 Ga0466971_0006777_3691_4644 317
576 3300044735 Ga0466968_0001048 Ga0466968_0001048_773_1726 317
577 3300044901 Ga0466960_0088191 Ga0466960_0088191_178_1131 317
578 3300046460 Ga0495638_0000234 Ga0495638_0000234_65819_66772 317
579 3300046460 Ga0495638_0001171 Ga0495638_0001171_5991_6944 317
580 3300046471 Ga0495650_0000337 Ga0495650_0000337_65397_66350 317
581 3300046507 Ga0495606_0000401 Ga0495606_0000401_45273_46226 317
582 3300046557 Ga0495622_0008848 Ga0495622_0008848_3644_4597 317
583 3300046660 Ga0495625_0015363 Ga0495625_0015363_1442_2395 317
584 3300046694 Ga0495649_0000553 Ga0495649_0000553_22418_23371 317
585 3300046810 Ga0495660_0151856 Ga0495660_0151856_177_1130 317
586 3300048908 Ga0496105_0222838 Ga0496105_0222838_261_1220 317
587 3300048916 Ga0496113_0007592 Ga0496113_0007592_4456_5409 317
588 3300048918 Ga0496115_0000503 Ga0496115_0000503_599_1552 317
589 3300048918 Ga0496115_0002471 Ga0496115_0002471_8851_9804 317
590 3300048918 Ga0496115_0012375 Ga0496115_0012375_4581_5534 317
591 3300048918 Ga0496115_0087284 Ga0496115_0087284_1459_2412 317
592 3300048924 Ga0496121_0059963 Ga0496121_0059963_974_1927 317
593 3300048928 Ga0496125_0000330 Ga0496125_0000330_69694_70647 317
594 3300048929 Ga0496126_0040236 Ga0496126_0040236_1074_2027 317
595 3300048929 Ga0496126_0065861 Ga0496126_0065861_2207_3160 317
596 3300049459 Ga0495678_027635 Ga0495678_027635_1211_2164 317
597 3300049460 Ga0495682_0021421 Ga0495682_0021421_982_1935 317
598 3300053087 Ga0500643_018432 Ga0500643_018432_995_1948 317
599 3300053093 Ga0500651_0005358 Ga0500651_0005358_5959_6912 317
600 3300053120 Ga0500597_000097 Ga0500597_000097_6194_7147 317
601 3300053155 Ga0500620_001128 Ga0500620_001128_168_1121 317
602 3300061719 Ga0466962_0007290 Ga0466962_0007290_3827_4780 317
603 3300005548 Ga0070665_100000669 Ga0070665_10000066939 318
604 3300009093 Ga0105240_10017515 Ga0105240_100175153 318
605 3300025913 Ga0207695_10004047 Ga0207695_100040477 318
606 3300025986 Ga0207658_10018784 Ga0207658_100187843 318
607 3300028379 Ga0268266_10000001 Ga0268266_100000013066 318
608 3300053094 Ga0500566_0139771 Ga0500566_0139771_262_1218 318
609 3300002067 JGI24735J21928_10000402 JGI24735J21928_100004022 319
610 3300003756 Ga0055533_1003637 Ga0055533_10036373 319
611 3300005577 Ga0068857_100038368 Ga0068857_1000383683 319
612 3300009093 Ga0105240_10017472 Ga0105240_100174724 319
613 3300010375 Ga0105239_10000030 Ga0105239_10000030158 319
614 3300013105 Ga0157369_10238588 Ga0157369_102385882 319
615 3300015687 Ga0183368_1002 Ga0183368_100296 319
616 3300025226 Ga0209674_100043 Ga0209674_10004381 319
617 3300025242 Ga0209258_100635 Ga0209258_10063519 319
618 3300025904 Ga0207647_10034547 Ga0207647_100345473 319
619 3300025913 Ga0207695_10004907 Ga0207695_100049073 319
620 3300048903 Ga0496100_0105631 Ga0496100_0105631_834_1793 319
621 3300048905 Ga0496102_0110205 Ga0496102_0110205_35_994 319
622 3300048907 Ga0496104_0020445 Ga0496104_0020445_1208_2167 319
623 3300048908 Ga0496105_0086219 Ga0496105_0086219_502_1461 319
624 3300048910 Ga0496107_0015203 Ga0496107_0015203_2469_3428 319
625 3300048916 Ga0496113_0265861 Ga0496113_0265861_300_1265 319
626 3300048918 Ga0496115_0000032 Ga0496115_0000032_95508_96473 319
627 3300048919 Ga0496116_0024215 Ga0496116_0024215_2718_3677 319
628 3300048920 Ga0496117_0002308 Ga0496117_0002308_17402_18361 319
629 3300048920 Ga0496117_0022702 Ga0496117_0022702_1822_2781 319
630 3300048920 Ga0496117_0023610 Ga0496117_0023610_1097_2056 319
631 3300048921 Ga0496118_0003813 Ga0496118_0003813_1956_2915 319
632 3300048921 Ga0496118_0018381 Ga0496118_0018381_2906_3865 319
633 3300048921 Ga0496118_0018478 Ga0496118_0018478_2423_3382 319
634 3300048922 Ga0496119_0000430 Ga0496119_0000430_52344_53303 319
635 3300048923 Ga0496120_0001482 Ga0496120_0001482_3869_4828 319
636 3300048923 Ga0496120_0002085 Ga0496120_0002085_6910_7869 319
637 3300048924 Ga0496121_0000743 Ga0496121_0000743_14983_15942 319
638 3300048924 Ga0496121_0034829 Ga0496121_0034829_1778_2737 319
639 3300048924 Ga0496121_0062223 Ga0496121_0062223_1478_2437 319
640 3300048929 Ga0496126_0003181 Ga0496126_0003181_15591_16550 319
641 3300048929 Ga0496126_0077576 Ga0496126_0077576_663_1622 319
642 3300049572 Ga0501036_0131156 Ga0501036_0131156_21_980 319
643 3300009093 Ga0105240_10133524 Ga0105240_101335243 320
644 3300009545 Ga0105237_10000371 Ga0105237_1000037137 320
645 3300009551 Ga0105238_10177957 Ga0105238_101779572 320
646 3300031730 Ga0307516_10061965 Ga0307516_100619653 320
647 3300005347 Ga0070668_100528591 Ga0070668_1005285911 321
648 3300005367 Ga0070667_100150076 Ga0070667_1001500762 321
649 3300005459 Ga0068867_100020723 Ga0068867_1000207232 321
650 3300005544 Ga0070686_100175430 Ga0070686_1001754302 321
651 3300005614 Ga0068856_100016547 Ga0068856_1000165473 321
652 3300005718 Ga0068866_10181625 Ga0068866_101816251 321
653 3300005841 Ga0068863_100190308 Ga0068863_1001903082 321
654 3300006237 Ga0097621_100018988 Ga0097621_1000189882 321
655 3300006358 Ga0068871_100049265 Ga0068871_1000492654 321
656 3300006358 Ga0068871_100102711 Ga0068871_1001027112 321
657 3300009553 Ga0105249_10444704 Ga0105249_104447042 321
658 3300014969 Ga0157376_10001752 Ga0157376_100017527 321
659 3300025931 Ga0207644_10141411 Ga0207644_101414112 321
660 3300025937 Ga0207669_10262741 Ga0207669_102627412 321
661 3300025942 Ga0207689_10185544 Ga0207689_101855441 321
662 3300025949 Ga0207667_10400190 Ga0207667_104001901 321
663 3300025972 Ga0207668_10509738 Ga0207668_105097381 321
664 3300025986 Ga0207658_10141608 Ga0207658_101416082 321
665 3300026041 Ga0207639_10049321 Ga0207639_100493213 321
666 3300026041 Ga0207639_10202320 Ga0207639_102023202 321
667 3300026078 Ga0207702_10007572 Ga0207702_100075723 321
668 3300026088 Ga0207641_10069252 Ga0207641_100692524 321
669 3300026088 Ga0207641_10105567 Ga0207641_101055672 321
670 3300026089 Ga0207648_10027641 Ga0207648_100276414 321
671 3300026121 Ga0207683_10033766 Ga0207683_100337662 321
672 3300026142 Ga0207698_10183165 Ga0207698_101831652 321
673 3300037418 Ga0395900_0108303 Ga0395900_0108303_1699_2664 321
674 3300041486 Ga0451807_1232108 Ga0451807_1232108_657_1622 321
675 3300041509 Ga0451843_0301553 Ga0451843_0301553_171_1136 321
676 3300049569 Ga0501032_0053867 Ga0501032_0053867_1180_2145 321
677 3300049572 Ga0501036_0047314 Ga0501036_0047314_2187_3152 321
678 3300049573 Ga0501037_0016373 Ga0501037_0016373_1016_1981 321
679 3300049574 Ga0501038_0095087 Ga0501038_0095087_976_1941 321
680 3300049580 Ga0501046_0011780 Ga0501046_0011780_5572_6537 321
681 3300049582 Ga0501048_0158105 Ga0501048_0158105_26_991 321
682 3300049587 Ga0501071_0146232 Ga0501071_0146232_366_1331 321
683 3300049589 Ga0501073_0016777 Ga0501073_0016777_3475_4440 321
684 3300049741 Ga0501079_0028469 Ga0501079_0028469_1862_2827 321
685 3300049742 Ga0501080_0039628 Ga0501080_0039628_3167_4132 321
686 3300049822 Ga0501035_0036671 Ga0501035_0036671_412_1377 321
687 3300049823 Ga0501044_0268523 Ga0501044_0268523_266_1231 321
688 3300049581 Ga0501047_0100666 Ga0501047_0100666_671_1648 324
689 3300049589 Ga0501073_0003157 Ga0501073_0003157_9517_10494 324
690 3300049590 Ga0501074_0000064 Ga0501074_0000064_23839_24816 324
691 3300049742 Ga0501080_0000816 Ga0501080_0000816_1498_2475 324
692 3300049822 Ga0501035_0092144 Ga0501035_0092144_603_1580 324
693 3300049823 Ga0501044_0005303 Ga0501044_0005303_7699_8676 324
694 3300049569 Ga0501032_0000363 Ga0501032_0000363_27090_28067 325
695 3300049570 Ga0501033_0001746 Ga0501033_0001746_9574_10551 325
696 3300049571 Ga0501034_0003950 Ga0501034_0003950_2164_3141 325
697 3300049572 Ga0501036_0007040 Ga0501036_0007040_723_1700 325
698 3300049573 Ga0501037_0002802 Ga0501037_0002802_7647_8624 325
699 3300049574 Ga0501038_0005816 Ga0501038_0005816_1041_2018 325
700 3300049575 Ga0501039_0002500 Ga0501039_0002500_5829_6806 325
701 3300049576 Ga0501040_0118048 Ga0501040_0118048_197_1174 325
702 3300049579 Ga0501043_0004046 Ga0501043_0004046_6803_7780 325
703 3300049580 Ga0501046_0001164 Ga0501046_0001164_17505_18482 325
704 3300049582 Ga0501048_0026348 Ga0501048_0026348_1459_2436 325
705 3300049589 Ga0501073_0001457 Ga0501073_0001457_1299_2276 325
706 3300049742 Ga0501080_0007767 Ga0501080_0007767_1693_2670 325
707 3300049823 Ga0501044_0004055 Ga0501044_0004055_6058_7035 325
708 3300009545 Ga0105237_10144806 Ga0105237_101448062 327
709 3300038443 Ga0395901_0008614 Ga0395901_0008614_428_1417 327
710 3300038443 Ga0395901_0046899 Ga0395901_0046899_1898_2887 327
711 3300049572 Ga0501036_0237302 Ga0501036_0237302_328_1314 328
712 3300049573 Ga0501037_0316266 Ga0501037_0316266_26_1012 328
713 3300049574 Ga0501038_0038393 Ga0501038_0038393_2978_3964 328
714 3300049580 Ga0501046_0109515 Ga0501046_0109515_255_1241 328
715 3300049584 Ga0501068_0047726 Ga0501068_0047726_230_1216 328
716 3300060353 Ga0501082_0063029 Ga0501082_0063029_834_1820 328
717 3300009545 Ga0105237_10001616 Ga0105237_1000161614 330
718 3300009553 Ga0105249_10000170 Ga0105249_100001709 330
719 3300038443 Ga0395901_0147990 Ga0395901_0147990_462_1502 330
720 3300048925 Ga0496122_0000440 Ga0496122_0000440_59238_60347 330
721 3300048926 Ga0496123_0000407 Ga0496123_0000407_59278_60387 330
722 3300009551 Ga0105238_10162582 Ga0105238_101625821 331
723 3300049589 Ga0501073_0081967 Ga0501073_0081967_1061_2056 331
724 3300049590 Ga0501074_0034046 Ga0501074_0034046_1540_2535 331
725 3300049823 Ga0501044_0068973 Ga0501044_0068973_248_1243 331
726 3300049823 Ga0501044_0401926 Ga0501044_0401926_22_1017 331
727 3300002705 JGI25156J39149_1004438 JGI25156J39149_10044385 334
728 3300002741 JGI25157J39369_1001590 JGI25157J39369_10015907 334
729 3300005614 Ga0068856_100000920 Ga0068856_1000009206 334
730 3300013104 Ga0157370_10222944 Ga0157370_102229442 334
731 3300013105 Ga0157369_10018469 Ga0157369_100184695 334
732 3300020082 Ga0206353_10205581 Ga0206353_102055812 334
733 3300025246 Ga0209646_1001117 Ga0209646_10011174 334
734 3300025250 Ga0209026_1000191 Ga0209026_100019148 334
735 3300025256 Ga0209759_1005678 Ga0209759_10056782 334
736 3300025272 Ga0209455_1000380 Ga0209455_100038018 334
737 3300025904 Ga0207647_10086262 Ga0207647_100862621 334
738 3300025914 Ga0207671_10002057 Ga0207671_1000205712 334
739 3300025981 Ga0207640_10046417 Ga0207640_100464173 334
740 3300026067 Ga0207678_10001123 Ga0207678_1000112316 334
741 3300026078 Ga0207702_10000608 Ga0207702_1000060817 334
742 3300049823 Ga0501044_0040424 Ga0501044_0040424_424_1431 334
743 3300049578 Ga0501042_0227039 Ga0501042_0227039_321_1337 335
744 3300049586 Ga0501070_0124071 Ga0501070_0124071_578_1591 335
745 3300013296 Ga0157374_10035342 Ga0157374_100353423 336
746 3300013308 Ga0157375_10045710 Ga0157375_100457102 336
747 3300049569 Ga0501032_0066447 Ga0501032_0066447_456_1481 338
748 3300049571 Ga0501034_0004365 Ga0501034_0004365_7468_8493 338
749 3300049573 Ga0501037_0005496 Ga0501037_0005496_2684_3709 338
750 3300049579 Ga0501043_0034124 Ga0501043_0034124_827_1852 338
751 3300049822 Ga0501035_0005013 Ga0501035_0005013_2712_3737 338
752 3300013102 Ga0157371_10193399 Ga0157371_101933992 339
753 3300013307 Ga0157372_10010749 Ga0157372_100107499 339
754 3300005345 Ga0070692_10006380 Ga0070692_100063806 340
755 3300020082 Ga0206353_11944126 Ga0206353_119441265 340
756 3300025919 Ga0207657_10047247 Ga0207657_100472472 340
757 3300005336 Ga0070680_100054805 Ga0070680_1000548053 341
758 3300005341 Ga0070691_10023747 Ga0070691_100237473 341
759 3300005344 Ga0070661_100002927 Ga0070661_10000292711 341
760 3300005539 Ga0068853_100143402 Ga0068853_1001434022 341
761 3300013105 Ga0157369_10237333 Ga0157369_102373332 341
762 3300013307 Ga0157372_10033446 Ga0157372_100334462 341
763 3300020610 Ga0154015_1559805 Ga0154015_15598052 341
764 3300025909 Ga0207705_10027148 Ga0207705_100271483 341
765 3300025913 Ga0207695_10001683 Ga0207695_1000168326 341
766 3300025917 Ga0207660_10027285 Ga0207660_100272854 341
767 3300025920 Ga0207649_10064539 Ga0207649_100645392 341
768 3300025932 Ga0207690_10002264 Ga0207690_1000226410 341
769 3300025949 Ga0207667_10013444 Ga0207667_100134446 341
770 3300025981 Ga0207640_10002087 Ga0207640_100020872 341
771 3300026041 Ga0207639_10001846 Ga0207639_100018462 341
772 3300026067 Ga0207678_10000612 Ga0207678_1000061223 341
773 3300026142 Ga0207698_10118938 Ga0207698_101189382 341
774 3300001979 JGI24740J21852_10000025 JGI24740J21852_1000002537 342
775 3300013307 Ga0157372_10160964 Ga0157372_101609642 342
776 3300025912 Ga0207707_10028042 Ga0207707_100280422 342
777 3300026067 Ga0207678_10002596 Ga0207678_1000259612 342
778 3300026116 Ga0207674_10004576 Ga0207674_100045764 342
779 3300049823 Ga0501044_0061795 Ga0501044_0061795_2629_3747 343
780 3300001915 JGI24741J21665_1003038 JGI24741J21665_10030384 344
781 3300004800 Ga0058861_10165984 Ga0058861_101659842 344
782 3300005337 Ga0070682_100001204 Ga0070682_10000120411 344
783 3300005457 Ga0070662_100002882 Ga0070662_10000288210 344
784 3300005546 Ga0070696_100007828 Ga0070696_1000078282 344
785 3300005547 Ga0070693_100002312 Ga0070693_1000023123 344
786 3300005834 Ga0068851_10009883 Ga0068851_100098835 344
787 3300020069 Ga0197907_10080030 Ga0197907_100800303 344
788 3300020070 Ga0206356_11479570 Ga0206356_114795704 344
789 3300020080 Ga0206350_11224783 Ga0206350_112247832 344
790 3300020081 Ga0206354_10883312 Ga0206354_1088331211 344
791 3300020082 Ga0206353_11416403 Ga0206353_114164032 344
792 3300020610 Ga0154015_1414264 Ga0154015_14142642 344
793 3300025904 Ga0207647_10001268 Ga0207647_1000126816 344
794 3300025909 Ga0207705_10000029 Ga0207705_10000029118 344
795 3300025909 Ga0207705_10000614 Ga0207705_100006144 344
796 3300025913 Ga0207695_10001055 Ga0207695_1000105531 344
797 3300025920 Ga0207649_10000219 Ga0207649_1000021932 344
798 3300025932 Ga0207690_10000096 Ga0207690_1000009653 344
799 3300025933 Ga0207706_10003820 Ga0207706_100038203 344
800 3300025949 Ga0207667_10000075 Ga0207667_1000007553 344
801 3300026041 Ga0207639_10000403 Ga0207639_100004034 344
802 3300026078 Ga0207702_10005706 Ga0207702_100057063 344
803 3300026142 Ga0207698_10000152 Ga0207698_1000015231 344
804 3300049822 Ga0501035_0001993 Ga0501035_0001993_278_1324 348
805 3300049593 Ga0501077_0014144 Ga0501077_0014144_2239_3303 354
806 3300003323 rootH1_10099388 rootH1_100993883 355
807 3300009174 Ga0105241_10030885 Ga0105241_100308853 355
808 3300038443 Ga0395901_0203208 Ga0395901_0203208_897_1964 355
809 3300001915 JGI24741J21665_1000953 JGI24741J21665_10009539 357
810 3300001915 JGI24741J21665_1005804 JGI24741J21665_10058042 357
811 3300001979 JGI24740J21852_10000903 JGI24740J21852_100009032 357
812 3300004800 Ga0058861_10177485 Ga0058861_101774852 357
813 3300004803 Ga0058862_10138123 Ga0058862_101381232 357
814 3300005329 Ga0070683_100137528 Ga0070683_1001375282 357
815 3300005329 Ga0070683_100187808 Ga0070683_1001878082 357
816 3300005336 Ga0070680_100000867 Ga0070680_1000008676 357
817 3300005336 Ga0070680_100001693 Ga0070680_10000169315 357
818 3300005341 Ga0070691_10001587 Ga0070691_100015876 357
819 3300005344 Ga0070661_100003250 Ga0070661_1000032507 357
820 3300005344 Ga0070661_100008824 Ga0070661_1000088243 357
821 3300005345 Ga0070692_10049729 Ga0070692_100497292 357
822 3300005366 Ga0070659_100022166 Ga0070659_1000221663 357
823 3300005366 Ga0070659_100035051 Ga0070659_1000350511 357
824 3300005455 Ga0070663_100133103 Ga0070663_1001331032 357
825 3300005458 Ga0070681_10000082 Ga0070681_1000008213 357
826 3300005458 Ga0070681_10002020 Ga0070681_100020209 357
827 3300005530 Ga0070679_100002079 Ga0070679_10000207913 357
828 3300005530 Ga0070679_100002690 Ga0070679_10000269015 357
829 3300005539 Ga0068853_100305432 Ga0068853_1003054321 357
830 3300005563 Ga0068855_100068207 Ga0068855_1000682073 357
831 3300005563 Ga0068855_100358330 Ga0068855_1003583302 357
832 3300005564 Ga0070664_100028294 Ga0070664_1000282942 357
833 3300005577 Ga0068857_100310632 Ga0068857_1003106321 357
834 3300005614 Ga0068856_100004209 Ga0068856_1000042099 357
835 3300005614 Ga0068856_100223920 Ga0068856_1002239202 357
836 3300005616 Ga0068852_100129830 Ga0068852_1001298302 357
837 3300013100 Ga0157373_10004360 Ga0157373_100043608 357
838 3300013102 Ga0157371_10012309 Ga0157371_100123092 357
839 3300013102 Ga0157371_10022989 Ga0157371_100229892 357
840 3300013104 Ga0157370_10245217 Ga0157370_102452172 357
841 3300013105 Ga0157369_10010587 Ga0157369_100105874 357
842 3300013307 Ga0157372_10020714 Ga0157372_100207143 357
843 3300020069 Ga0197907_10144248 Ga0197907_101442482 357
844 3300020070 Ga0206356_10703880 Ga0206356_107038804 357
845 3300020077 Ga0206351_10823014 Ga0206351_108230144 357
846 3300020078 Ga0206352_10839414 Ga0206352_108394146 357
847 3300020080 Ga0206350_11098259 Ga0206350_110982593 357
848 3300020081 Ga0206354_10681047 Ga0206354_106810472 357
849 3300020081 Ga0206354_11560905 Ga0206354_115609053 357
850 3300020082 Ga0206353_10063786 Ga0206353_100637865 357
851 3300020610 Ga0154015_1526048 Ga0154015_15260484 357
852 3300022467 Ga0224712_10002705 Ga0224712_100027052 357
853 3300025909 Ga0207705_10000439 Ga0207705_1000043922 357
854 3300025909 Ga0207705_10000810 Ga0207705_1000081014 357
855 3300025912 Ga0207707_10000042 Ga0207707_10000042125 357
856 3300025912 Ga0207707_10001117 Ga0207707_1000111714 357
857 3300025912 Ga0207707_10001192 Ga0207707_1000119219 357
858 3300025912 Ga0207707_10001753 Ga0207707_1000175317 357
859 3300025913 Ga0207695_10010974 Ga0207695_100109745 357
860 3300025913 Ga0207695_10013533 Ga0207695_100135334 357
861 3300025917 Ga0207660_10000206 Ga0207660_1000020625 357
862 3300025917 Ga0207660_10000467 Ga0207660_1000046713 357
863 3300025917 Ga0207660_10000948 Ga0207660_100009488 357
864 3300025917 Ga0207660_10003795 Ga0207660_100037956 357
865 3300025919 Ga0207657_10018181 Ga0207657_100181813 357
866 3300025919 Ga0207657_10032199 Ga0207657_100321994 357
867 3300025920 Ga0207649_10023448 Ga0207649_100234484 357
868 3300025920 Ga0207649_10023845 Ga0207649_100238453 357
869 3300025921 Ga0207652_10000099 Ga0207652_1000009975 357
870 3300025921 Ga0207652_10001601 Ga0207652_1000160117 357
871 3300025921 Ga0207652_10002446 Ga0207652_100024466 357
872 3300025932 Ga0207690_10017628 Ga0207690_100176283 357
873 3300025944 Ga0207661_10009873 Ga0207661_100098732 357
874 3300025945 Ga0207679_10019411 Ga0207679_100194115 357
875 3300025949 Ga0207667_10002530 Ga0207667_1000253010 357
876 3300025981 Ga0207640_10000682 Ga0207640_1000068212 357
877 3300025981 Ga0207640_10021327 Ga0207640_100213272 357
878 3300026041 Ga0207639_10060749 Ga0207639_100607493 357
879 3300026067 Ga0207678_10011217 Ga0207678_100112177 357
880 3300026067 Ga0207678_10017625 Ga0207678_100176252 357
881 3300026078 Ga0207702_10009841 Ga0207702_100098414 357
882 3300026078 Ga0207702_10032311 Ga0207702_100323115 357
883 3300026078 Ga0207702_10074636 Ga0207702_100746362 357
884 3300026116 Ga0207674_10008303 Ga0207674_100083037 357
885 3300026142 Ga0207698_10001073 Ga0207698_1000107314 357
886 3300026142 Ga0207698_10008474 Ga0207698_100084742 357

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02649

GCHY-1

Type I GTP cyclohydrolase folE2

68

358

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.905 59 341
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.9046 53 340
2r5r-assembly1.cif.gz_A the crystal structure of duf198 from nitrosomonas europaea atcc 19718 0.8945 59 341
3d2o-assembly1.cif.gz_A crystal structure of manganese-metallated gtp cyclohydrolase type ib 0.8941 53 340
5k95-assembly1.cif.gz_A crystal structure of gtp cyclohydrolase-ib with 8-oxo-gtp 0.8844 57 341
ID Description Score Start End Superfamily
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9343 59 340 3.10.270.10
3d2oB00 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.9234 59 340 3.10.270.10
af_Q2G0L1_30_291_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8669 46 341 3.10.270.10
af_Q2G0L1_30_291_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8545 46 341 3.10.270.10
af_Q58185_15_301_3.10.270.10 Alpha Beta;Roll;Urate Oxidase;Urate Oxidase; 0.8136 59 341 3.10.270.10
ID Description Score Start End GO Terms
AF-A0A5E6UZQ7-F1-model_v4 GTP cyclohydrolase FolE2 (EC 3.5.4.16) 0.9719 67 343 GO:0003934
AF-F2K767-F1-model_v4 GTP cyclohydrolase FolE2 0.9707 67 341 GO:0003934
AF-A0A380STV9-F1-model_v4 GTP cyclohydrolase FolE2 (EC 3.5.4.16) 0.9705 67 343 GO:0003934
AF-A0A5E6UZQ7-F1-model_v4 GTP cyclohydrolase FolE2 (EC 3.5.4.16) 0.9684 67 343 GO:0003934
AF-A0A380STV9-F1-model_v4 GTP cyclohydrolase FolE2 (EC 3.5.4.16) 0.967 67 343 GO:0003934

Feature Viewer

pLDDT pTM Quality
80.64 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map