F484678
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 885 | 268 | 1770 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300046516|Ga0495628_0185266|Ga0495628_0185266_642_1355 |
| Length | 237 |
| Sequence | MASPYGWNITGVKSGYPSAFNYRHGKDEPMTTTTTPDRFTALPDEQALTTTVTALEEHGFSVEVVDSLDAARTATLARIPHXXXXMTNTSMTLAETGIADAVNDGGPYESARNRMFALDFATQAQEMKAIGGQPDYALGSVHAITRDGTLVIASASGSQLASYAWGAANVIFVVGAQKLVATLEDAHQRIYQHSLKLEDARAQAAYGQHSQVGKVLEIHQELPGRIHIVLIRQVVGF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 87 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 90 | 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 108 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 162 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 163 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 164 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 165 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 166 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 167 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 171 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 179 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 180 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 181 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 187 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 188 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 189 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 191 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 196 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 243 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 244 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 245 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 246 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 247 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 248 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 249 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 251 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 254 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 7.01 |
| Rhizosphere | 92.88 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.62 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495628_0185266 | 3300046516 | Bacteria | 1573 |
| 2 | Ga0070683_100470163 | 3300005329 | Bacteria | 1200 |
| 3 | Ga0070683_100697053 | 3300005329 | Bacteria | 972 |
| 4 | Ga0070683_101033962 | 3300005329 | Bacteria | 789 |
| 5 | Ga0068869_100128947 | 3300005334 | Bacteria | 1942 |
| 6 | Ga0068869_100517962 | 3300005334 | Bacteria | 998 |
| 7 | Ga0070666_10121134 | 3300005335 | Bacteria | 1814 |
| 8 | Ga0070682_100132888 | 3300005337 | Unclassified | 1686 |
| 9 | Ga0070682_100263680 | 3300005337 | Bacteria | 1248 |
| 10 | Ga0068868_100767527 | 3300005338 | Bacteria | 867 |
| 11 | Ga0070689_100126115 | 3300005340 | Bacteria | 2048 |
| 12 | Ga0070689_100524436 | 3300005340 | Bacteria | 1017 |
| 13 | Ga0070691_10049380 | 3300005341 | Bacteria | 2004 |
| 14 | Ga0070691_10054462 | 3300005341 | Bacteria | 1915 |
| 15 | Ga0070691_10145639 | 3300005341 | Bacteria | 1211 |
| 16 | Ga0070687_100189372 | 3300005343 | Bacteria | 1238 |
| 17 | Ga0070661_100105366 | 3300005344 | Bacteria | 2102 |
| 18 | Ga0070668_100102965 | 3300005347 | Bacteria | 2265 |
| 19 | Ga0070668_100137264 | 3300005347 | Bacteria | 1968 |
| 20 | Ga0070669_100521678 | 3300005353 | Bacteria | 988 |
| 21 | Ga0070675_100047009 | 3300005354 | Bacteria | 3535 |
| 22 | Ga0070671_100540407 | 3300005355 | Bacteria | 1004 |
| 23 | Ga0070674_100203670 | 3300005356 | Bacteria | 1530 |
| 24 | Ga0070674_100644649 | 3300005356 | Unclassified | 900 |
| 25 | Ga0070673_100179117 | 3300005364 | Bacteria | 1814 |
| 26 | Ga0070659_100046748 | 3300005366 | Bacteria | 3393 |
| 27 | Ga0070667_100558410 | 3300005367 | Bacteria | 1053 |
| 28 | Ga0070709_10008029 | 3300005434 | Bacteria | 5792 |
| 29 | Ga0070709_10008777 | 3300005434 | Bacteria | 5561 |
| 30 | Ga0070709_10011509 | 3300005434 | Bacteria | 4935 |
| 31 | Ga0070709_10014405 | 3300005434 | Bacteria | 4472 |
| 32 | Ga0070709_10027499 | 3300005434 | Bacteria | 3382 |
| 33 | Ga0070709_10034447 | 3300005434 | Bacteria | 3070 |
| 34 | Ga0070709_10304737 | 3300005434 | Bacteria | 1164 |
| 35 | Ga0070714_100003083 | 3300005435 | Bacteria | 12367 |
| 36 | Ga0070714_100021540 | 3300005435 | Bacteria | 5275 |
| 37 | Ga0070714_100043012 | 3300005435 | Bacteria | 3818 |
| 38 | Ga0070714_100046236 | 3300005435 | Bacteria | 3691 |
| 39 | Ga0070714_100052272 | 3300005435 | Bacteria | 3484 |
| 40 | Ga0070714_100075615 | 3300005435 | Bacteria | 2922 |
| 41 | Ga0070714_100108446 | 3300005435 | Bacteria | 2455 |
| 42 | Ga0070714_100178353 | 3300005435 | Bacteria | 1932 |
| 43 | Ga0070714_100228782 | 3300005435 | Unclassified | 1712 |
| 44 | Ga0070714_100418706 | 3300005435 | Bacteria | 1269 |
| 45 | Ga0070713_100002609 | 3300005436 | Bacteria | 11775 |
| 46 | Ga0070713_100007436 | 3300005436 | Bacteria | 7688 |
| 47 | Ga0070713_100018746 | 3300005436 | Bacteria | 5265 |
| 48 | Ga0070713_100020870 | 3300005436 | Bacteria | 5029 |
| 49 | Ga0070713_100031705 | 3300005436 | Bacteria | 4213 |
| 50 | Ga0070713_100051518 | 3300005436 | Bacteria | 3404 |
| 51 | Ga0070713_100062450 | 3300005436 | Bacteria | 3120 |
| 52 | Ga0070713_100126109 | 3300005436 | Bacteria | 2252 |
| 53 | Ga0070713_100234417 | 3300005436 | Bacteria | 1669 |
| 54 | Ga0070713_100261248 | 3300005436 | Bacteria | 1582 |
| 55 | Ga0070713_100451311 | 3300005436 | Bacteria | 1208 |
| 56 | Ga0070713_100555425 | 3300005436 | Bacteria | 1087 |
| 57 | Ga0070713_100718724 | 3300005436 | Unclassified | 954 |
| 58 | Ga0070710_10003502 | 3300005437 | Bacteria | 7438 |
| 59 | Ga0070710_10008426 | 3300005437 | Bacteria | 5019 |
| 60 | Ga0070710_10009481 | 3300005437 | Bacteria | 4763 |
| 61 | Ga0070710_10024791 | 3300005437 | Bacteria | 3168 |
| 62 | Ga0070710_10033622 | 3300005437 | Bacteria | 2785 |
| 63 | Ga0070710_10034216 | 3300005437 | Bacteria | 2764 |
| 64 | Ga0070710_10072514 | 3300005437 | Bacteria | 1989 |
| 65 | Ga0070710_10295536 | 3300005437 | Bacteria | 1055 |
| 66 | Ga0070701_10027455 | 3300005438 | Bacteria | 2789 |
| 67 | Ga0070711_100026642 | 3300005439 | Bacteria | 3789 |
| 68 | Ga0070711_100104178 | 3300005439 | Bacteria | 2069 |
| 69 | Ga0070711_100158726 | 3300005439 | Bacteria | 1713 |
| 70 | Ga0070711_100273574 | 3300005439 | Bacteria | 1333 |
| 71 | Ga0070711_100337855 | 3300005439 | Bacteria | 1208 |
| 72 | Ga0070711_100378062 | 3300005439 | Bacteria | 1145 |
| 73 | Ga0070711_100405542 | 3300005439 | Bacteria | 1107 |
| 74 | Ga0070705_100122468 | 3300005440 | Bacteria | 1682 |
| 75 | Ga0070700_100220101 | 3300005441 | Bacteria | 1345 |
| 76 | Ga0070708_100008385 | 3300005445 | Bacteria | 8299 |
| 77 | Ga0070708_100018479 | 3300005445 | Bacteria | 5834 |
| 78 | Ga0070708_100171003 | 3300005445 | Bacteria | 2028 |
| 79 | Ga0070708_100219325 | 3300005445 | Bacteria | 1783 |
| 80 | Ga0070708_100231612 | 3300005445 | Bacteria | 1733 |
| 81 | Ga0070708_100233389 | 3300005445 | Bacteria | 1726 |
| 82 | Ga0070708_100248225 | 3300005445 | Bacteria | 1672 |
| 83 | Ga0070708_100251958 | 3300005445 | Bacteria | 1659 |
| 84 | Ga0070708_100663275 | 3300005445 | Bacteria | 983 |
| 85 | Ga0070663_100049224 | 3300005455 | Bacteria | 2991 |
| 86 | Ga0070663_100503000 | 3300005455 | Bacteria | 1007 |
| 87 | Ga0070678_100214364 | 3300005456 | Bacteria | 1597 |
| 88 | Ga0070662_100235214 | 3300005457 | Bacteria | 1467 |
| 89 | Ga0070681_10653298 | 3300005458 | Bacteria | 966 |
| 90 | Ga0068867_100561817 | 3300005459 | Bacteria | 990 |
| 91 | Ga0068867_100654753 | 3300005459 | Bacteria | 922 |
| 92 | Ga0070706_100017573 | 3300005467 | Bacteria | 6600 |
| 93 | Ga0070706_100039392 | 3300005467 | Bacteria | 4363 |
| 94 | Ga0070706_100067237 | 3300005467 | Bacteria | 3314 |
| 95 | Ga0070706_100073297 | 3300005467 | Unclassified | 3169 |
| 96 | Ga0070706_100175508 | 3300005467 | Unclassified | 2001 |
| 97 | Ga0070706_100176671 | 3300005467 | Bacteria | 1994 |
| 98 | Ga0070706_100234414 | 3300005467 | Bacteria | 1713 |
| 99 | Ga0070706_100276702 | 3300005467 | Bacteria | 1566 |
| 100 | Ga0070706_100850077 | 3300005467 | Bacteria | 844 |
| 101 | Ga0070707_100016241 | 3300005468 | Bacteria | 6988 |
| 102 | Ga0070707_100042695 | 3300005468 | Bacteria | 4342 |
| 103 | Ga0070707_100050684 | 3300005468 | Bacteria | 3979 |
| 104 | Ga0070707_100061845 | 3300005468 | Bacteria | 3591 |
| 105 | Ga0070707_100088248 | 3300005468 | Bacteria | 3000 |
| 106 | Ga0070707_100208364 | 3300005468 | Unclassified | 1906 |
| 107 | Ga0070707_100248875 | 3300005468 | Bacteria | 1729 |
| 108 | Ga0070707_100345801 | 3300005468 | Bacteria | 1445 |
| 109 | Ga0070707_100751547 | 3300005468 | Bacteria | 938 |
| 110 | Ga0070707_101044228 | 3300005468 | Unclassified | 783 |
| 111 | Ga0070698_100001890 | 3300005471 | Bacteria | 23323 |
| 112 | Ga0070698_100006119 | 3300005471 | Bacteria | 13103 |
| 113 | Ga0070698_100014708 | 3300005471 | Bacteria | 8265 |
| 114 | Ga0070698_100028270 | 3300005471 | Bacteria | 5827 |
| 115 | Ga0070698_100030483 | 3300005471 | Bacteria | 5591 |
| 116 | Ga0070698_100063335 | 3300005471 | Bacteria | 3729 |
| 117 | Ga0070698_100105827 | 3300005471 | Bacteria | 2782 |
| 118 | Ga0070698_100223031 | 3300005471 | Unclassified | 1818 |
| 119 | Ga0070699_100001763 | 3300005518 | Bacteria | 19727 |
| 120 | Ga0070699_100003475 | 3300005518 | Bacteria | 13933 |
| 121 | Ga0070699_100430746 | 3300005518 | Bacteria | 1195 |
| 122 | Ga0070684_100128257 | 3300005535 | Bacteria | 2287 |
| 123 | Ga0070697_100066124 | 3300005536 | Bacteria | 2956 |
| 124 | Ga0070697_100506722 | 3300005536 | Bacteria | 1056 |
| 125 | Ga0068853_100053867 | 3300005539 | Bacteria | 3465 |
| 126 | Ga0068853_100385449 | 3300005539 | Bacteria | 1309 |
| 127 | Ga0070695_100295527 | 3300005545 | Bacteria | 1195 |
| 128 | Ga0070696_100099772 | 3300005546 | Bacteria | 2079 |
| 129 | Ga0070696_100256389 | 3300005546 | Bacteria | 1325 |
| 130 | Ga0070693_100039155 | 3300005547 | Bacteria | 2654 |
| 131 | Ga0070693_100119147 | 3300005547 | Bacteria | 1635 |
| 132 | Ga0070665_100126835 | 3300005548 | Bacteria | 2554 |
| 133 | Ga0070665_100436314 | 3300005548 | Bacteria | 1319 |
| 134 | Ga0070664_100258230 | 3300005564 | Bacteria | 1567 |
| 135 | Ga0068857_100074415 | 3300005577 | Bacteria | 3026 |
| 136 | Ga0068857_100231504 | 3300005577 | Bacteria | 1690 |
| 137 | Ga0068854_100080604 | 3300005578 | Bacteria | 2402 |
| 138 | Ga0068856_100052789 | 3300005614 | Bacteria | 4009 |
| 139 | Ga0068856_100200111 | 3300005614 | Bacteria | 2012 |
| 140 | Ga0068856_100295042 | 3300005614 | Bacteria | 1638 |
| 141 | Ga0070702_100107689 | 3300005615 | Bacteria | 1721 |
| 142 | Ga0070702_100152852 | 3300005615 | Bacteria | 1483 |
| 143 | Ga0068852_100044513 | 3300005616 | Bacteria | 3770 |
| 144 | Ga0068852_100531049 | 3300005616 | Bacteria | 1175 |
| 145 | Ga0068852_101381296 | 3300005616 | Unclassified | 726 |
| 146 | Ga0068864_100174972 | 3300005618 | Unclassified | 1959 |
| 147 | Ga0068864_100263022 | 3300005618 | Bacteria | 1605 |
| 148 | Ga0068866_10244454 | 3300005718 | Bacteria | 1095 |
| 149 | Ga0068861_100964021 | 3300005719 | Bacteria | 812 |
| 150 | Ga0068851_10061795 | 3300005834 | Bacteria | 1921 |
| 151 | Ga0068870_10084314 | 3300005840 | Bacteria | 1764 |
| 152 | Ga0068870_10144085 | 3300005840 | Unclassified | 1397 |
| 153 | Ga0068863_100026311 | 3300005841 | Bacteria | 5551 |
| 154 | Ga0068863_100169350 | 3300005841 | Bacteria | 2094 |
| 155 | Ga0068858_100193158 | 3300005842 | Bacteria | 1923 |
| 156 | Ga0068858_100196924 | 3300005842 | Bacteria | 1904 |
| 157 | Ga0068860_100155519 | 3300005843 | Bacteria | 2203 |
| 158 | Ga0068860_100186351 | 3300005843 | Bacteria | 2007 |
| 159 | Ga0081455_10325194 | 3300005937 | Bacteria | 1094 |
| 160 | Ga0081540_1000505 | 3300005983 | Bacteria | 38435 |
| 161 | Ga0081540_1012672 | 3300005983 | Bacteria | 5531 |
| 162 | Ga0070717_10019547 | 3300006028 | Bacteria | 5315 |
| 163 | Ga0070717_10020149 | 3300006028 | Bacteria | 5241 |
| 164 | Ga0070717_10046450 | 3300006028 | Bacteria | 3553 |
| 165 | Ga0070717_10049745 | 3300006028 | Bacteria | 3442 |
| 166 | Ga0070717_10063693 | 3300006028 | Bacteria | 3061 |
| 167 | Ga0070717_10064646 | 3300006028 | Bacteria | 3039 |
| 168 | Ga0070717_10068574 | 3300006028 | Bacteria | 2952 |
| 169 | Ga0070717_10071140 | 3300006028 | Bacteria | 2901 |
| 170 | Ga0070717_10089149 | 3300006028 | Bacteria | 2601 |
| 171 | Ga0070717_10097940 | 3300006028 | Bacteria | 2485 |
| 172 | Ga0070717_10205869 | 3300006028 | Bacteria | 1725 |
| 173 | Ga0070717_10279156 | 3300006028 | Bacteria | 1481 |
| 174 | Ga0070717_10302248 | 3300006028 | Unclassified | 1423 |
| 175 | Ga0070717_10325192 | 3300006028 | Bacteria | 1371 |
| 176 | Ga0070717_10425047 | 3300006028 | Bacteria | 1195 |
| 177 | Ga0070717_10436157 | 3300006028 | Bacteria | 1179 |
| 178 | Ga0070717_10438339 | 3300006028 | Bacteria | 1176 |
| 179 | Ga0070717_10930218 | 3300006028 | Bacteria | 792 |
| 180 | Ga0070715_10006872 | 3300006163 | Bacteria | 3888 |
| 181 | Ga0070715_10012291 | 3300006163 | Bacteria | 3111 |
| 182 | Ga0070715_10039413 | 3300006163 | Bacteria | 1968 |
| 183 | Ga0070715_10044545 | 3300006163 | Bacteria | 1876 |
| 184 | Ga0070715_10066280 | 3300006163 | Bacteria | 1600 |
| 185 | Ga0070715_10118074 | 3300006163 | Unclassified | 1261 |
| 186 | Ga0070716_100000882 | 3300006173 | Bacteria | 12952 |
| 187 | Ga0070716_100001013 | 3300006173 | Bacteria | 12295 |
| 188 | Ga0070716_100002488 | 3300006173 | Bacteria | 8511 |
| 189 | Ga0070716_100003491 | 3300006173 | Bacteria | 7410 |
| 190 | Ga0070716_100014786 | 3300006173 | Bacteria | 4003 |
| 191 | Ga0070716_100014836 | 3300006173 | Bacteria | 3996 |
| 192 | Ga0070716_100057607 | 3300006173 | Bacteria | 2233 |
| 193 | Ga0070716_100453236 | 3300006173 | Bacteria | 936 |
| 194 | Ga0070712_100013422 | 3300006175 | Bacteria | 5236 |
| 195 | Ga0070712_100018865 | 3300006175 | Bacteria | 4488 |
| 196 | Ga0070712_100023270 | 3300006175 | Bacteria | 4091 |
| 197 | Ga0070712_100049351 | 3300006175 | Bacteria | 2922 |
| 198 | Ga0070712_100055946 | 3300006175 | Bacteria | 2765 |
| 199 | Ga0070712_100106512 | 3300006175 | Bacteria | 2084 |
| 200 | Ga0070712_100154806 | 3300006175 | Bacteria | 1764 |
| 201 | Ga0070712_100345284 | 3300006175 | Bacteria | 1217 |
| 202 | Ga0070712_100359043 | 3300006175 | Bacteria | 1194 |
| 203 | Ga0070712_100435039 | 3300006175 | Bacteria | 1090 |
| 204 | Ga0070712_100582546 | 3300006175 | Bacteria | 945 |
| 205 | Ga0097621_100086681 | 3300006237 | Bacteria | 2614 |
| 206 | Ga0097621_100709667 | 3300006237 | Bacteria | 926 |
| 207 | Ga0068871_100130107 | 3300006358 | Bacteria | 2133 |
| 208 | Ga0068871_100194480 | 3300006358 | Bacteria | 1748 |
| 209 | Ga0075428_100090402 | 3300006844 | Bacteria | 3340 |
| 210 | Ga0075428_100120812 | 3300006844 | Bacteria | 2853 |
| 211 | Ga0075428_101005337 | 3300006844 | Bacteria | 883 |
| 212 | Ga0075430_100149748 | 3300006846 | Bacteria | 1943 |
| 213 | Ga0075433_10205380 | 3300006852 | Bacteria | 1751 |
| 214 | Ga0075433_10332457 | 3300006852 | Bacteria | 1343 |
| 215 | Ga0075433_10507917 | 3300006852 | Bacteria | 1061 |
| 216 | Ga0075434_100036497 | 3300006871 | Bacteria | 4862 |
| 217 | Ga0075434_100181054 | 3300006871 | Bacteria | 2127 |
| 218 | Ga0075434_100212462 | 3300006871 | Bacteria | 1955 |
| 219 | Ga0075434_100259593 | 3300006871 | Bacteria | 1756 |
| 220 | Ga0075434_101024076 | 3300006871 | Bacteria | 839 |
| 221 | Ga0075429_100039673 | 3300006880 | Bacteria | 4097 |
| 222 | Ga0068865_100017084 | 3300006881 | Bacteria | 4658 |
| 223 | Ga0068865_100056870 | 3300006881 | Bacteria | 2727 |
| 224 | Ga0068865_100465856 | 3300006881 | Bacteria | 1048 |
| 225 | Ga0075436_100064578 | 3300006914 | Bacteria | 2530 |
| 226 | Ga0075436_100085027 | 3300006914 | Bacteria | 2196 |
| 227 | Ga0075436_100228875 | 3300006914 | Bacteria | 1320 |
| 228 | Ga0075436_100392494 | 3300006914 | Bacteria | 1005 |
| 229 | Ga0075435_100016758 | 3300007076 | Bacteria | 5529 |
| 230 | Ga0075435_100151716 | 3300007076 | Bacteria | 1948 |
| 231 | Ga0075435_100200333 | 3300007076 | Bacteria | 1691 |
| 232 | Ga0075435_100313894 | 3300007076 | Bacteria | 1341 |
| 233 | Ga0075435_100566294 | 3300007076 | Bacteria | 984 |
| 234 | Ga0099794_10056594 | 3300007265 | Bacteria | 1898 |
| 235 | Ga0099794_10108679 | 3300007265 | Bacteria | 1388 |
| 236 | Ga0099794_10169926 | 3300007265 | Bacteria | 1111 |
| 237 | Ga0099795_10056610 | 3300007788 | Bacteria | 1443 |
| 238 | Ga0099795_10076428 | 3300007788 | Bacteria | 1273 |
| 239 | Ga0099795_10154581 | 3300007788 | Bacteria | 942 |
| 240 | Ga0105240_10755236 | 3300009093 | Bacteria | 1057 |
| 241 | Ga0111539_10022628 | 3300009094 | Bacteria | 7721 |
| 242 | Ga0111539_11055609 | 3300009094 | Bacteria | 944 |
| 243 | Ga0105245_10045218 | 3300009098 | Bacteria | 3931 |
| 244 | Ga0105245_10098182 | 3300009098 | Unclassified | 2706 |
| 245 | Ga0105245_10164325 | 3300009098 | Bacteria | 2108 |
| 246 | Ga0105247_10036308 | 3300009101 | Bacteria | 3004 |
| 247 | Ga0105247_10132660 | 3300009101 | Bacteria | 1625 |
| 248 | Ga0114129_10060899 | 3300009147 | Bacteria | 5276 |
| 249 | Ga0114129_11032827 | 3300009147 | Bacteria | 1033 |
| 250 | Ga0105243_10206118 | 3300009148 | Bacteria | 1728 |
| 251 | Ga0105243_10412722 | 3300009148 | Bacteria | 1257 |
| 252 | Ga0105243_10506568 | 3300009148 | Bacteria | 1145 |
| 253 | Ga0105243_10606530 | 3300009148 | Bacteria | 1055 |
| 254 | Ga0105243_10883354 | 3300009148 | Bacteria | 888 |
| 255 | Ga0105242_10047464 | 3300009176 | Bacteria | 3487 |
| 256 | Ga0105242_10549764 | 3300009176 | Bacteria | 1107 |
| 257 | Ga0105248_10083883 | 3300009177 | Bacteria | 3584 |
| 258 | Ga0105238_10137555 | 3300009551 | Bacteria | 2420 |
| 259 | Ga0105238_10267849 | 3300009551 | Bacteria | 1689 |
| 260 | Ga0105249_10143980 | 3300009553 | Bacteria | 2288 |
| 261 | Ga0105249_10277377 | 3300009553 | Bacteria | 1672 |
| 262 | Ga0099796_10143973 | 3300010159 | Bacteria | 933 |
| 263 | Ga0105239_10318926 | 3300010375 | Bacteria | 1752 |
| 264 | Ga0105239_10450388 | 3300010375 | Bacteria | 1460 |
| 265 | Ga0105246_10038639 | 3300011119 | Bacteria | 3211 |
| 266 | Ga0157335_1006038 | 3300012492 | Bacteria | 867 |
| 267 | Ga0157342_1000926 | 3300012507 | Bacteria | 2006 |
| 268 | Ga0157373_10471300 | 3300013100 | Bacteria | 905 |
| 269 | Ga0157371_10053784 | 3300013102 | Bacteria | 2859 |
| 270 | Ga0157371_10184620 | 3300013102 | Bacteria | 1492 |
| 271 | Ga0157370_10207940 | 3300013104 | Bacteria | 1814 |
| 272 | Ga0157370_10600087 | 3300013104 | Bacteria | 1008 |
| 273 | Ga0157369_10073701 | 3300013105 | Bacteria | 3663 |
| 274 | Ga0157374_10085339 | 3300013296 | Bacteria | 3002 |
| 275 | Ga0157378_10046010 | 3300013297 | Bacteria | 3879 |
| 276 | Ga0157378_10400567 | 3300013297 | Bacteria | 1352 |
| 277 | Ga0163162_10005222 | 3300013306 | Bacteria | 12522 |
| 278 | Ga0163162_10113568 | 3300013306 | Bacteria | 2807 |
| 279 | Ga0163162_10477744 | 3300013306 | Unclassified | 1378 |
| 280 | Ga0163162_10709206 | 3300013306 | Bacteria | 1127 |
| 281 | Ga0163162_11204273 | 3300013306 | Bacteria | 859 |
| 282 | Ga0157372_10197550 | 3300013307 | Unclassified | 2330 |
| 283 | Ga0157372_10693819 | 3300013307 | Bacteria | 1185 |
| 284 | Ga0157372_10766473 | 3300013307 | Bacteria | 1122 |
| 285 | Ga0157375_10097979 | 3300013308 | Bacteria | 3008 |
| 286 | Ga0157375_10286718 | 3300013308 | Bacteria | 1809 |
| 287 | Ga0163163_10039709 | 3300014325 | Bacteria | 4595 |
| 288 | Ga0163163_10104363 | 3300014325 | Bacteria | 2859 |
| 289 | Ga0157380_10048663 | 3300014326 | Bacteria | 3340 |
| 290 | Ga0157380_10084123 | 3300014326 | Bacteria | 2608 |
| 291 | Ga0157380_10562600 | 3300014326 | Bacteria | 1121 |
| 292 | Ga0157377_10024600 | 3300014745 | Bacteria | 3202 |
| 293 | Ga0157379_10113597 | 3300014968 | Bacteria | 2434 |
| 294 | Ga0157376_10087923 | 3300014969 | Bacteria | 2683 |
| 295 | Ga0157376_10157878 | 3300014969 | Bacteria | 2053 |
| 296 | Ga0163161_10125812 | 3300017792 | Bacteria | 1930 |
| 297 | Ga0206353_11196411 | 3300020082 | Bacteria | 1099 |
| 298 | Ga0224572_1018809 | 3300024225 | Bacteria | 1328 |
| 299 | Ga0224572_1027730 | 3300024225 | Bacteria | 1085 |
| 300 | Ga0207713_1130527 | 3300025735 | Bacteria | 832 |
| 301 | Ga0207692_10000906 | 3300025898 | Bacteria | 10731 |
| 302 | Ga0207692_10001229 | 3300025898 | Bacteria | 9510 |
| 303 | Ga0207692_10009869 | 3300025898 | Bacteria | 4003 |
| 304 | Ga0207692_10012375 | 3300025898 | Bacteria | 3663 |
| 305 | Ga0207692_10014285 | 3300025898 | Bacteria | 3466 |
| 306 | Ga0207692_10020061 | 3300025898 | Bacteria | 3033 |
| 307 | Ga0207692_10021348 | 3300025898 | Bacteria | 2961 |
| 308 | Ga0207692_10030514 | 3300025898 | Bacteria | 2572 |
| 309 | Ga0207692_10055175 | 3300025898 | Bacteria | 2033 |
| 310 | Ga0207692_10058124 | 3300025898 | Unclassified | 1991 |
| 311 | Ga0207692_10084215 | 3300025898 | Bacteria | 1708 |
| 312 | Ga0207692_10129609 | 3300025898 | Bacteria | 1423 |
| 313 | Ga0207692_10136137 | 3300025898 | Bacteria | 1392 |
| 314 | Ga0207692_10168364 | 3300025898 | Bacteria | 1268 |
| 315 | Ga0207692_10191899 | 3300025898 | Bacteria | 1196 |
| 316 | Ga0207692_10443253 | 3300025898 | Bacteria | 816 |
| 317 | Ga0207642_10627568 | 3300025899 | Bacteria | 671 |
| 318 | Ga0207710_10150784 | 3300025900 | Bacteria | 1128 |
| 319 | Ga0207688_10039836 | 3300025901 | Bacteria | 2610 |
| 320 | Ga0207688_10141118 | 3300025901 | Bacteria | 1418 |
| 321 | Ga0207688_10184421 | 3300025901 | Unclassified | 1246 |
| 322 | Ga0207680_10102656 | 3300025903 | Bacteria | 1840 |
| 323 | Ga0207680_10201114 | 3300025903 | Bacteria | 1358 |
| 324 | Ga0207647_10073955 | 3300025904 | Bacteria | 2053 |
| 325 | Ga0207647_10275545 | 3300025904 | Bacteria | 961 |
| 326 | Ga0207685_10007944 | 3300025905 | Bacteria | 2992 |
| 327 | Ga0207685_10008898 | 3300025905 | Bacteria | 2888 |
| 328 | Ga0207685_10009317 | 3300025905 | Bacteria | 2847 |
| 329 | Ga0207685_10011073 | 3300025905 | Bacteria | 2696 |
| 330 | Ga0207685_10128313 | 3300025905 | Unclassified | 1122 |
| 331 | Ga0207685_10151700 | 3300025905 | Unclassified | 1049 |
| 332 | Ga0207685_10188580 | 3300025905 | Bacteria | 961 |
| 333 | Ga0207699_10002045 | 3300025906 | Bacteria | 9531 |
| 334 | Ga0207699_10005425 | 3300025906 | Bacteria | 6106 |
| 335 | Ga0207699_10007542 | 3300025906 | Bacteria | 5323 |
| 336 | Ga0207699_10009906 | 3300025906 | Bacteria | 4764 |
| 337 | Ga0207699_10011204 | 3300025906 | Bacteria | 4519 |
| 338 | Ga0207699_10016300 | 3300025906 | Bacteria | 3884 |
| 339 | Ga0207699_10048664 | 3300025906 | Bacteria | 2491 |
| 340 | Ga0207699_10063946 | 3300025906 | Bacteria | 2225 |
| 341 | Ga0207699_10138007 | 3300025906 | Bacteria | 1599 |
| 342 | Ga0207699_10292017 | 3300025906 | Bacteria | 1136 |
| 343 | Ga0207699_10566103 | 3300025906 | Bacteria | 825 |
| 344 | Ga0207645_10289867 | 3300025907 | Bacteria | 1088 |
| 345 | Ga0207643_10167932 | 3300025908 | Bacteria | 1323 |
| 346 | Ga0207684_10011456 | 3300025910 | Bacteria | 7756 |
| 347 | Ga0207684_10013316 | 3300025910 | Bacteria | 7115 |
| 348 | Ga0207684_10028604 | 3300025910 | Bacteria | 4749 |
| 349 | Ga0207684_10090406 | 3300025910 | Bacteria | 2608 |
| 350 | Ga0207684_10094476 | 3300025910 | Bacteria | 2550 |
| 351 | Ga0207684_10138934 | 3300025910 | Bacteria | 2088 |
| 352 | Ga0207684_10155682 | 3300025910 | Bacteria | 1967 |
| 353 | Ga0207684_10219183 | 3300025910 | Bacteria | 1642 |
| 354 | Ga0207684_10489379 | 3300025910 | Bacteria | 1055 |
| 355 | Ga0207684_10503151 | 3300025910 | Unclassified | 1038 |
| 356 | Ga0207695_10572523 | 3300025913 | Bacteria | 1011 |
| 357 | Ga0207693_10003537 | 3300025915 | Bacteria | 13342 |
| 358 | Ga0207693_10007818 | 3300025915 | Bacteria | 8778 |
| 359 | Ga0207693_10013772 | 3300025915 | Bacteria | 6511 |
| 360 | Ga0207693_10015281 | 3300025915 | Bacteria | 6160 |
| 361 | Ga0207693_10021090 | 3300025915 | Bacteria | 5179 |
| 362 | Ga0207693_10023129 | 3300025915 | Bacteria | 4935 |
| 363 | Ga0207693_10027720 | 3300025915 | Bacteria | 4477 |
| 364 | Ga0207693_10032382 | 3300025915 | Bacteria | 4126 |
| 365 | Ga0207693_10056236 | 3300025915 | Bacteria | 3085 |
| 366 | Ga0207693_10062161 | 3300025915 | Bacteria | 2926 |
| 367 | Ga0207693_10078373 | 3300025915 | Bacteria | 2586 |
| 368 | Ga0207693_10203591 | 3300025915 | Unclassified | 1556 |
| 369 | Ga0207693_10223458 | 3300025915 | Bacteria | 1479 |
| 370 | Ga0207663_10013212 | 3300025916 | Bacteria | 4484 |
| 371 | Ga0207663_10019008 | 3300025916 | Bacteria | 3862 |
| 372 | Ga0207663_10033650 | 3300025916 | Bacteria | 3056 |
| 373 | Ga0207663_10033718 | 3300025916 | Bacteria | 3053 |
| 374 | Ga0207663_10039015 | 3300025916 | Bacteria | 2875 |
| 375 | Ga0207663_10099809 | 3300025916 | Bacteria | 1947 |
| 376 | Ga0207663_10147484 | 3300025916 | Bacteria | 1646 |
| 377 | Ga0207663_10841570 | 3300025916 | Bacteria | 732 |
| 378 | Ga0207660_10597045 | 3300025917 | Bacteria | 899 |
| 379 | Ga0207662_10048216 | 3300025918 | Bacteria | 2523 |
| 380 | Ga0207662_10051446 | 3300025918 | Bacteria | 2451 |
| 381 | Ga0207657_10026270 | 3300025919 | Bacteria | 5353 |
| 382 | Ga0207646_10016723 | 3300025922 | Bacteria | 6881 |
| 383 | Ga0207646_10018380 | 3300025922 | Bacteria | 6521 |
| 384 | Ga0207646_10034733 | 3300025922 | Bacteria | 4558 |
| 385 | Ga0207646_10035529 | 3300025922 | Bacteria | 4501 |
| 386 | Ga0207646_10039619 | 3300025922 | Bacteria | 4240 |
| 387 | Ga0207646_10073950 | 3300025922 | Bacteria | 3044 |
| 388 | Ga0207646_10425805 | 3300025922 | Bacteria | 1198 |
| 389 | Ga0207646_10565642 | 3300025922 | Bacteria | 1021 |
| 390 | Ga0207694_10287125 | 3300025924 | Bacteria | 1352 |
| 391 | Ga0207687_10243171 | 3300025927 | Bacteria | 1427 |
| 392 | Ga0207700_10001538 | 3300025928 | Bacteria | 13074 |
| 393 | Ga0207700_10003380 | 3300025928 | Bacteria | 9262 |
| 394 | Ga0207700_10004555 | 3300025928 | Bacteria | 8193 |
| 395 | Ga0207700_10012251 | 3300025928 | Bacteria | 5521 |
| 396 | Ga0207700_10020694 | 3300025928 | Bacteria | 4475 |
| 397 | Ga0207700_10021528 | 3300025928 | Bacteria | 4404 |
| 398 | Ga0207700_10027226 | 3300025928 | Bacteria | 4000 |
| 399 | Ga0207700_10040769 | 3300025928 | Bacteria | 3391 |
| 400 | Ga0207700_10114687 | 3300025928 | Bacteria | 2174 |
| 401 | Ga0207700_10129052 | 3300025928 | Bacteria | 2061 |
| 402 | Ga0207700_10245148 | 3300025928 | Bacteria | 1528 |
| 403 | Ga0207700_10262553 | 3300025928 | Bacteria | 1479 |
| 404 | Ga0207700_10292906 | 3300025928 | Bacteria | 1403 |
| 405 | Ga0207700_10337846 | 3300025928 | Bacteria | 1309 |
| 406 | Ga0207700_10380544 | 3300025928 | Bacteria | 1234 |
| 407 | Ga0207700_10692432 | 3300025928 | Bacteria | 909 |
| 408 | Ga0207700_10761650 | 3300025928 | Bacteria | 865 |
| 409 | Ga0207664_10000393 | 3300025929 | Bacteria | 31358 |
| 410 | Ga0207664_10018595 | 3300025929 | Bacteria | 5119 |
| 411 | Ga0207664_10021419 | 3300025929 | Bacteria | 4806 |
| 412 | Ga0207664_10033058 | 3300025929 | Bacteria | 3970 |
| 413 | Ga0207664_10044684 | 3300025929 | Bacteria | 3470 |
| 414 | Ga0207664_10049339 | 3300025929 | Bacteria | 3313 |
| 415 | Ga0207664_10059063 | 3300025929 | Bacteria | 3053 |
| 416 | Ga0207664_10059833 | 3300025929 | Bacteria | 3035 |
| 417 | Ga0207664_10082031 | 3300025929 | Bacteria | 2626 |
| 418 | Ga0207664_10085296 | 3300025929 | Bacteria | 2577 |
| 419 | Ga0207664_10089227 | 3300025929 | Bacteria | 2524 |
| 420 | Ga0207664_10130313 | 3300025929 | Bacteria | 2116 |
| 421 | Ga0207664_10130768 | 3300025929 | Bacteria | 2113 |
| 422 | Ga0207664_10187675 | 3300025929 | Bacteria | 1778 |
| 423 | Ga0207664_10207890 | 3300025929 | Bacteria | 1692 |
| 424 | Ga0207664_10296691 | 3300025929 | Bacteria | 1421 |
| 425 | Ga0207664_10337101 | 3300025929 | Bacteria | 1333 |
| 426 | Ga0207690_10371067 | 3300025932 | Bacteria | 1135 |
| 427 | Ga0207690_10838471 | 3300025932 | Bacteria | 761 |
| 428 | Ga0207706_10293370 | 3300025933 | Bacteria | 1418 |
| 429 | Ga0207686_10216826 | 3300025934 | Bacteria | 1379 |
| 430 | Ga0207709_10795039 | 3300025935 | Bacteria | 763 |
| 431 | Ga0207669_10537552 | 3300025937 | Unclassified | 941 |
| 432 | Ga0207704_10332289 | 3300025938 | Bacteria | 1177 |
| 433 | Ga0207665_10000212 | 3300025939 | Bacteria | 39344 |
| 434 | Ga0207665_10003975 | 3300025939 | Bacteria | 9877 |
| 435 | Ga0207665_10005779 | 3300025939 | Bacteria | 8227 |
| 436 | Ga0207665_10012784 | 3300025939 | Bacteria | 5521 |
| 437 | Ga0207665_10021946 | 3300025939 | Bacteria | 4198 |
| 438 | Ga0207665_10046918 | 3300025939 | Bacteria | 2895 |
| 439 | Ga0207665_10058062 | 3300025939 | Bacteria | 2615 |
| 440 | Ga0207665_10074084 | 3300025939 | Bacteria | 2330 |
| 441 | Ga0207665_10085645 | 3300025939 | Bacteria | 2176 |
| 442 | Ga0207665_10159080 | 3300025939 | Bacteria | 1624 |
| 443 | Ga0207691_10043240 | 3300025940 | Bacteria | 4152 |
| 444 | Ga0207711_10107740 | 3300025941 | Bacteria | 2474 |
| 445 | Ga0207711_10770738 | 3300025941 | Unclassified | 896 |
| 446 | Ga0207689_10066097 | 3300025942 | Bacteria | 2974 |
| 447 | Ga0207689_10251395 | 3300025942 | Bacteria | 1462 |
| 448 | Ga0207661_11328956 | 3300025944 | Bacteria | 660 |
| 449 | Ga0207679_10328572 | 3300025945 | Bacteria | 1326 |
| 450 | Ga0207667_10444355 | 3300025949 | Bacteria | 1318 |
| 451 | Ga0207651_10505224 | 3300025960 | Bacteria | 1046 |
| 452 | Ga0207712_10258534 | 3300025961 | Unclassified | 1411 |
| 453 | Ga0207668_10930432 | 3300025972 | Bacteria | 775 |
| 454 | Ga0207640_10363213 | 3300025981 | Bacteria | 1167 |
| 455 | Ga0207640_11164169 | 3300025981 | Bacteria | 684 |
| 456 | Ga0207677_10374190 | 3300026023 | Bacteria | 1200 |
| 457 | Ga0207677_10443671 | 3300026023 | Bacteria | 1110 |
| 458 | Ga0207703_10284011 | 3300026035 | Bacteria | 1504 |
| 459 | Ga0207639_10424620 | 3300026041 | Bacteria | 1202 |
| 460 | Ga0207678_10020838 | 3300026067 | Bacteria | 5746 |
| 461 | Ga0207678_10195174 | 3300026067 | Bacteria | 1730 |
| 462 | Ga0207702_10054308 | 3300026078 | Bacteria | 3394 |
| 463 | Ga0207702_10190432 | 3300026078 | Bacteria | 1895 |
| 464 | Ga0207641_10341915 | 3300026088 | Bacteria | 1424 |
| 465 | Ga0207676_10107532 | 3300026095 | Bacteria | 2327 |
| 466 | Ga0207674_10002102 | 3300026116 | Bacteria | 25222 |
| 467 | Ga0207674_10013776 | 3300026116 | Bacteria | 8947 |
| 468 | Ga0207675_100674903 | 3300026118 | Bacteria | 1041 |
| 469 | Ga0207675_100972094 | 3300026118 | Bacteria | 867 |
| 470 | Ga0207683_10011291 | 3300026121 | Bacteria | 7616 |
| 471 | Ga0207683_10445579 | 3300026121 | Bacteria | 1193 |
| 472 | Ga0209588_1093951 | 3300027671 | Bacteria | 966 |
| 473 | Ga0207428_10075309 | 3300027907 | Bacteria | 2645 |
| 474 | Ga0268265_10390704 | 3300028380 | Bacteria | 1283 |
| 475 | Ga0268265_10851951 | 3300028380 | Bacteria | 892 |
| 476 | Ga0265773_1005577 | 3300031018 | Bacteria | 920 |
| 477 | Ga0307513_10564039 | 3300031456 | Bacteria | 850 |
| 478 | Ga0307415_100251223 | 3300032126 | Unclassified | 1437 |
| 479 | Ga0373948_0050200 | 3300034817 | Bacteria | 895 |
| 480 | Ga0373948_0050201 | 3300034817 | Bacteria | 895 |
| 481 | Ga0373959_0010133 | 3300034820 | Bacteria | 1641 |
| 482 | Ga0373926_0000351 | 3300035083 | Bacteria | 11696 |
| 483 | Ga0373926_0028302 | 3300035083 | Unclassified | 1967 |
| 484 | Ga0373926_0050410 | 3300035083 | Bacteria | 1500 |
| 485 | Ga0373928_0070872 | 3300035084 | Bacteria | 862 |
| 486 | Ga0373934_0013934 | 3300035086 | Bacteria | 3042 |
| 487 | Ga0373934_0078797 | 3300035086 | Bacteria | 1322 |
| 488 | Ga0373934_0106340 | 3300035086 | Bacteria | 1136 |
| 489 | Ga0373944_0002690 | 3300035089 | Bacteria | 4532 |
| 490 | Ga0373949_0075902 | 3300035090 | Bacteria | 888 |
| 491 | Ga0373952_0102275 | 3300035092 | Bacteria | 757 |
| 492 | Ga0373923_0004043 | 3300035111 | Bacteria | 4813 |
| 493 | Ga0373923_0008726 | 3300035111 | Bacteria | 3631 |
| 494 | Ga0373923_0038852 | 3300035111 | Bacteria | 1952 |
| 495 | Ga0373923_0051196 | 3300035111 | Bacteria | 1732 |
| 496 | Ga0373923_0208300 | 3300035111 | Bacteria | 906 |
| 497 | Ga0373932_0030949 | 3300035112 | Bacteria | 1487 |
| 498 | Ga0373932_0093099 | 3300035112 | Bacteria | 970 |
| 499 | Ga0373932_0125877 | 3300035112 | Bacteria | 859 |
| 500 | Ga0373936_0000106 | 3300035113 | Bacteria | 29957 |
| 501 | Ga0373936_0009435 | 3300035113 | Bacteria | 3679 |
| 502 | Ga0373936_0125146 | 3300035113 | Bacteria | 1101 |
| 503 | Ga0373939_0023728 | 3300035114 | Bacteria | 1702 |
| 504 | Ga0373945_0000011 | 3300035116 | Bacteria | 40382 |
| 505 | Ga0373945_0022868 | 3300035116 | Bacteria | 2157 |
| 506 | Ga0373945_0077436 | 3300035116 | Bacteria | 1269 |
| 507 | Ga0373945_0245426 | 3300035116 | Bacteria | 755 |
| 508 | Ga0373953_0003747 | 3300035117 | Bacteria | 4777 |
| 509 | Ga0373953_0111658 | 3300035117 | Bacteria | 1156 |
| 510 | Ga0373954_0025478 | 3300035118 | Bacteria | 2704 |
| 511 | Ga0373954_0087169 | 3300035118 | Bacteria | 1496 |
| 512 | Ga0373956_0003134 | 3300035119 | Bacteria | 6686 |
| 513 | Ga0373956_0357638 | 3300035119 | Bacteria | 696 |
| 514 | Ga0373957_0009002 | 3300035120 | Bacteria | 3255 |
| 515 | Ga0373957_0107107 | 3300035120 | Bacteria | 1123 |
| 516 | Ga0373960_0006879 | 3300035121 | Bacteria | 2679 |
| 517 | Ga0373960_0097514 | 3300035121 | Bacteria | 948 |
| 518 | Ga0373943_0000223 | 3300035170 | Bacteria | 23116 |
| 519 | Ga0373943_0036307 | 3300035170 | Bacteria | 2360 |
| 520 | Ga0373943_0038679 | 3300035170 | Bacteria | 2295 |
| 521 | Ga0373943_0139455 | 3300035170 | Bacteria | 1305 |
| 522 | Ga0373946_0000509 | 3300035171 | Bacteria | 12884 |
| 523 | Ga0373946_0053685 | 3300035171 | Bacteria | 1693 |
| 524 | Ga0373946_0098707 | 3300035171 | Bacteria | 1306 |
| 525 | Ga0373946_0118000 | 3300035171 | Bacteria | 1208 |
| 526 | Ga0373946_0183065 | 3300035171 | Bacteria | 995 |
| 527 | Ga0373955_0015063 | 3300035172 | Bacteria | 3777 |
| 528 | Ga0373955_0026838 | 3300035172 | Bacteria | 2971 |
| 529 | Ga0373955_0059828 | 3300035172 | Bacteria | 2099 |
| 530 | Ga0373955_0172298 | 3300035172 | Bacteria | 1281 |
| 531 | Ga0373955_0301979 | 3300035172 | Bacteria | 965 |
| 532 | Ga0373942_0031668 | 3300035207 | Bacteria | 1400 |
| 533 | Ga0373942_0126597 | 3300035207 | Bacteria | 803 |
| 534 | Ga0373962_0060052 | 3300035242 | Bacteria | 1115 |
| 535 | Ga0373924_0009356 | 3300035410 | Bacteria | 3587 |
| 536 | Ga0373924_0010065 | 3300035410 | Bacteria | 3481 |
| 537 | Ga0373924_0054277 | 3300035410 | Bacteria | 1666 |
| 538 | Ga0373924_0062092 | 3300035410 | Bacteria | 1564 |
| 539 | Ga0373924_0129829 | 3300035410 | Bacteria | 1096 |
| 540 | Ga0373931_0024103 | 3300035691 | Bacteria | 3078 |
| 541 | Ga0373931_0045564 | 3300035691 | Bacteria | 2316 |
| 542 | Ga0373931_0106831 | 3300035691 | Bacteria | 1582 |
| 543 | Ga0373931_0337339 | 3300035691 | Bacteria | 940 |
| 544 | Ga0373935_0001332 | 3300035692 | Bacteria | 13659 |
| 545 | Ga0373935_0028504 | 3300035692 | Bacteria | 3452 |
| 546 | Ga0373935_0211866 | 3300035692 | Bacteria | 1343 |
| 547 | Ga0373935_0296506 | 3300035692 | Bacteria | 1142 |
| 548 | Ga0373935_0303838 | 3300035692 | Bacteria | 1128 |
| 549 | Ga0373935_0304426 | 3300035692 | Bacteria | 1127 |
| 550 | Ga0373935_0445923 | 3300035692 | Bacteria | 934 |
| 551 | Ga0373935_0466600 | 3300035692 | Bacteria | 913 |
| 552 | Ga0373927_0001232 | 3300035695 | Bacteria | 19445 |
| 553 | Ga0373927_0350937 | 3300035695 | Bacteria | 972 |
| 554 | Ga0373933_0001230 | 3300035724 | Bacteria | 15147 |
| 555 | Ga0373933_0170058 | 3300035724 | Bacteria | 1386 |
| 556 | Ga0373933_0255271 | 3300035724 | Bacteria | 1129 |
| 557 | Ga0373947_0000678 | 3300035725 | Bacteria | 20245 |
| 558 | Ga0373947_0015730 | 3300035725 | Bacteria | 4346 |
| 559 | Ga0373947_0148468 | 3300035725 | Bacteria | 1508 |
| 560 | Ga0373947_0284746 | 3300035725 | Bacteria | 1099 |
| 561 | Ga0373947_0304993 | 3300035725 | Bacteria | 1062 |
| 562 | Ga0373947_0394498 | 3300035725 | Bacteria | 933 |
| 563 | Ga0373947_0487262 | 3300035725 | Bacteria | 837 |
| 564 | Ga0373947_0554131 | 3300035725 | Bacteria | 783 |
| 565 | Ga0373937_0004426 | 3300036401 | Bacteria | 11941 |
| 566 | Ga0373937_0021560 | 3300036401 | Bacteria | 5781 |
| 567 | Ga0373937_0055133 | 3300036401 | Bacteria | 3648 |
| 568 | Ga0373937_0261126 | 3300036401 | Bacteria | 1633 |
| 569 | Ga0373937_0577499 | 3300036401 | Bacteria | 1067 |
| 570 | Ga0373925_0003810 | 3300037068 | Bacteria | 11581 |
| 571 | Ga0373925_0004138 | 3300037068 | Bacteria | 11010 |
| 572 | Ga0373925_0005610 | 3300037068 | Bacteria | 9343 |
| 573 | Ga0373925_0012071 | 3300037068 | Bacteria | 6255 |
| 574 | Ga0373925_0047159 | 3300037068 | Bacteria | 3206 |
| 575 | Ga0373925_0258966 | 3300037068 | Bacteria | 1397 |
| 576 | Ga0373925_0284185 | 3300037068 | Bacteria | 1333 |
| 577 | Ga0395905_0189469 | 3300037471 | Bacteria | 1930 |
| 578 | Ga0495592_0025646 | 3300046454 | Bacteria | 4473 |
| 579 | Ga0495592_0134164 | 3300046454 | Bacteria | 1728 |
| 580 | Ga0495592_0157158 | 3300046454 | Bacteria | 1567 |
| 581 | Ga0495603_0407159 | 3300046455 | Bacteria | 780 |
| 582 | Ga0495629_0002045 | 3300046459 | Bacteria | 15675 |
| 583 | Ga0495629_0006311 | 3300046459 | Bacteria | 8797 |
| 584 | Ga0495629_0017493 | 3300046459 | Bacteria | 5137 |
| 585 | Ga0495629_0126371 | 3300046459 | Bacteria | 1781 |
| 586 | Ga0495629_0214141 | 3300046459 | Bacteria | 1330 |
| 587 | Ga0495641_0005509 | 3300046461 | Bacteria | 8515 |
| 588 | Ga0495641_0015509 | 3300046461 | Bacteria | 4062 |
| 589 | Ga0495641_0028379 | 3300046461 | Bacteria | 2709 |
| 590 | Ga0495651_0006919 | 3300046462 | Bacteria | 8667 |
| 591 | Ga0495651_0014526 | 3300046462 | Bacteria | 6087 |
| 592 | Ga0495651_0064772 | 3300046462 | Bacteria | 2793 |
| 593 | Ga0495651_0145248 | 3300046462 | Bacteria | 1716 |
| 594 | Ga0495651_0160763 | 3300046462 | Bacteria | 1609 |
| 595 | Ga0495651_0211441 | 3300046462 | Bacteria | 1349 |
| 596 | Ga0495651_0247723 | 3300046462 | Bacteria | 1218 |
| 597 | Ga0495653_0002243 | 3300046463 | Bacteria | 15285 |
| 598 | Ga0495653_0003585 | 3300046463 | Bacteria | 12514 |
| 599 | Ga0495653_0012057 | 3300046463 | Bacteria | 7053 |
| 600 | Ga0495653_0020891 | 3300046463 | Bacteria | 5304 |
| 601 | Ga0495653_0021628 | 3300046463 | Bacteria | 5210 |
| 602 | Ga0495653_0044512 | 3300046463 | Bacteria | 3444 |
| 603 | Ga0495653_0049360 | 3300046463 | Bacteria | 3242 |
| 604 | Ga0495653_0323717 | 3300046463 | Bacteria | 998 |
| 605 | Ga0495580_0318242 | 3300046472 | Bacteria | 1058 |
| 606 | Ga0495582_0005139 | 3300046473 | Bacteria | 7327 |
| 607 | Ga0495582_0009104 | 3300046473 | Bacteria | 5476 |
| 608 | Ga0495582_0016403 | 3300046473 | Bacteria | 4059 |
| 609 | Ga0495582_0286067 | 3300046473 | Bacteria | 947 |
| 610 | Ga0495639_0159100 | 3300046475 | Bacteria | 1092 |
| 611 | Ga0495662_0006434 | 3300046476 | Bacteria | 5865 |
| 612 | Ga0495662_0074406 | 3300046476 | Bacteria | 1648 |
| 613 | Ga0495662_0301281 | 3300046476 | Bacteria | 788 |
| 614 | Ga0495664_0000074 | 3300046477 | Bacteria | 48269 |
| 615 | Ga0495664_0014019 | 3300046477 | Bacteria | 4541 |
| 616 | Ga0495664_0021632 | 3300046477 | Bacteria | 3715 |
| 617 | Ga0495664_0032010 | 3300046477 | Bacteria | 3084 |
| 618 | Ga0495664_0048865 | 3300046477 | Bacteria | 2511 |
| 619 | Ga0495664_0087583 | 3300046477 | Bacteria | 1871 |
| 620 | Ga0495664_0120286 | 3300046477 | Bacteria | 1588 |
| 621 | Ga0495664_0129079 | 3300046477 | Bacteria | 1530 |
| 622 | Ga0495664_0147325 | 3300046477 | Bacteria | 1428 |
| 623 | Ga0495594_0233837 | 3300046499 | Bacteria | 1047 |
| 624 | Ga0495608_0010301 | 3300046511 | Bacteria | 6523 |
| 625 | Ga0495608_0019775 | 3300046511 | Bacteria | 4630 |
| 626 | Ga0495608_0047514 | 3300046511 | Bacteria | 2853 |
| 627 | Ga0495608_0060395 | 3300046511 | Bacteria | 2494 |
| 628 | Ga0495608_0157466 | 3300046511 | Bacteria | 1445 |
| 629 | Ga0495608_0162758 | 3300046511 | Bacteria | 1418 |
| 630 | Ga0495618_0027274 | 3300046514 | Bacteria | 3556 |
| 631 | Ga0495618_0054180 | 3300046514 | Bacteria | 2537 |
| 632 | Ga0495618_0058143 | 3300046514 | Bacteria | 2448 |
| 633 | Ga0495618_0105379 | 3300046514 | Bacteria | 1805 |
| 634 | Ga0495618_0115631 | 3300046514 | Bacteria | 1717 |
| 635 | Ga0495618_0191587 | 3300046514 | Bacteria | 1296 |
| 636 | Ga0495628_0006999 | 3300046516 | Bacteria | 9782 |
| 637 | Ga0495628_0041315 | 3300046516 | Bacteria | 3681 |
| 638 | Ga0495628_0042336 | 3300046516 | Bacteria | 3632 |
| 639 | Ga0495628_0326244 | 3300046516 | Bacteria | 1132 |
| 640 | Ga0495630_0003300 | 3300046517 | Bacteria | 11249 |
| 641 | Ga0495630_0003467 | 3300046517 | Bacteria | 10962 |
| 642 | Ga0495630_0019477 | 3300046517 | Bacteria | 4988 |
| 643 | Ga0495630_0075816 | 3300046517 | Bacteria | 2533 |
| 644 | Ga0495630_0151772 | 3300046517 | Bacteria | 1763 |
| 645 | Ga0495630_0315868 | 3300046517 | Bacteria | 1194 |
| 646 | Ga0495630_0325567 | 3300046517 | Bacteria | 1175 |
| 647 | Ga0495630_0446198 | 3300046517 | Bacteria | 991 |
| 648 | Ga0495663_0020642 | 3300046525 | Bacteria | 1892 |
| 649 | Ga0495652_0003774 | 3300046529 | Bacteria | 14787 |
| 650 | Ga0495652_0026003 | 3300046529 | Bacteria | 5173 |
| 651 | Ga0495652_0053023 | 3300046529 | Bacteria | 3458 |
| 652 | Ga0495652_0364330 | 3300046529 | Bacteria | 1032 |
| 653 | Ga0495665_0006968 | 3300046531 | Bacteria | 6096 |
| 654 | Ga0495665_0015753 | 3300046531 | Bacteria | 4071 |
| 655 | Ga0495665_0024358 | 3300046531 | Bacteria | 3251 |
| 656 | Ga0495665_0029169 | 3300046531 | Bacteria | 2956 |
| 657 | Ga0495640_0019455 | 3300046533 | Bacteria | 5011 |
| 658 | Ga0495640_0085276 | 3300046533 | Bacteria | 2093 |
| 659 | Ga0495640_0088225 | 3300046533 | Bacteria | 2050 |
| 660 | Ga0495640_0090684 | 3300046533 | Bacteria | 2017 |
| 661 | Ga0495640_0134951 | 3300046533 | Bacteria | 1594 |
| 662 | Ga0495640_0165211 | 3300046533 | Bacteria | 1416 |
| 663 | Ga0495640_0256950 | 3300046533 | Bacteria | 1092 |
| 664 | Ga0495587_0004663 | 3300046536 | Bacteria | 9006 |
| 665 | Ga0495587_0008354 | 3300046536 | Bacteria | 6661 |
| 666 | Ga0495587_0038641 | 3300046536 | Bacteria | 2860 |
| 667 | Ga0495587_0060530 | 3300046536 | Bacteria | 2220 |
| 668 | Ga0495587_0121095 | 3300046536 | Bacteria | 1499 |
| 669 | Ga0495587_0192718 | 3300046536 | Bacteria | 1154 |
| 670 | Ga0495587_0255209 | 3300046536 | Unclassified | 985 |
| 671 | Ga0495645_0027793 | 3300046543 | Bacteria | 4110 |
| 672 | Ga0495645_0054285 | 3300046543 | Bacteria | 2911 |
| 673 | Ga0495645_0061359 | 3300046543 | Bacteria | 2724 |
| 674 | Ga0495645_0062247 | 3300046543 | Bacteria | 2703 |
| 675 | Ga0495645_0126322 | 3300046543 | Bacteria | 1797 |
| 676 | Ga0495645_0140348 | 3300046543 | Bacteria | 1686 |
| 677 | Ga0495645_0150853 | 3300046543 | Bacteria | 1615 |
| 678 | Ga0495645_0196207 | 3300046543 | Bacteria | 1372 |
| 679 | Ga0495667_0004794 | 3300046559 | Bacteria | 9146 |
| 680 | Ga0495667_0009182 | 3300046559 | Bacteria | 6716 |
| 681 | Ga0495667_0009944 | 3300046559 | Bacteria | 6442 |
| 682 | Ga0495667_0032929 | 3300046559 | Bacteria | 3469 |
| 683 | Ga0495667_0052635 | 3300046559 | Bacteria | 2681 |
| 684 | Ga0495667_0054015 | 3300046559 | Bacteria | 2644 |
| 685 | Ga0495667_0096710 | 3300046559 | Bacteria | 1911 |
| 686 | Ga0495634_0003827 | 3300046642 | Bacteria | 11952 |
| 687 | Ga0495634_0006194 | 3300046642 | Bacteria | 9115 |
| 688 | Ga0495634_0021922 | 3300046642 | Bacteria | 4506 |
| 689 | Ga0495634_0027823 | 3300046642 | Bacteria | 3930 |
| 690 | Ga0495634_0044194 | 3300046642 | Bacteria | 3016 |
| 691 | Ga0495634_0217226 | 3300046642 | Bacteria | 1181 |
| 692 | Ga0495635_0002312 | 3300046663 | Bacteria | 12956 |
| 693 | Ga0495635_0006936 | 3300046663 | Bacteria | 7912 |
| 694 | Ga0495635_0008400 | 3300046663 | Bacteria | 7206 |
| 695 | Ga0495635_0009246 | 3300046663 | Bacteria | 6884 |
| 696 | Ga0495635_0032241 | 3300046663 | Bacteria | 3636 |
| 697 | Ga0495635_0066633 | 3300046663 | Bacteria | 2469 |
| 698 | Ga0495635_0147565 | 3300046663 | Bacteria | 1601 |
| 699 | Ga0495635_0154822 | 3300046663 | Bacteria | 1560 |
| 700 | Ga0495635_0272836 | 3300046663 | Bacteria | 1137 |
| 701 | Ga0495588_0231176 | 3300046674 | Bacteria | 976 |
| 702 | Ga0495657_0014019 | 3300046675 | Bacteria | 5888 |
| 703 | Ga0495657_0030095 | 3300046675 | Bacteria | 3804 |
| 704 | Ga0495657_0044343 | 3300046675 | Bacteria | 3025 |
| 705 | Ga0495657_0090525 | 3300046675 | Bacteria | 1964 |
| 706 | Ga0495599_0000791 | 3300046678 | Bacteria | 17762 |
| 707 | Ga0495599_0009836 | 3300046678 | Bacteria | 5853 |
| 708 | Ga0495599_0014028 | 3300046678 | Bacteria | 4960 |
| 709 | Ga0495599_0151762 | 3300046678 | Bacteria | 1434 |
| 710 | Ga0495623_0010893 | 3300046679 | Bacteria | 5888 |
| 711 | Ga0495623_0183828 | 3300046679 | Bacteria | 1212 |
| 712 | Ga0495646_0018847 | 3300046680 | Bacteria | 4370 |
| 713 | Ga0495646_0078089 | 3300046680 | Bacteria | 1935 |
| 714 | Ga0495646_0091802 | 3300046680 | Bacteria | 1752 |
| 715 | Ga0495646_0115284 | 3300046680 | Bacteria | 1526 |
| 716 | Ga0495646_0141086 | 3300046680 | Bacteria | 1347 |
| 717 | Ga0495647_0059593 | 3300046681 | Bacteria | 1503 |
| 718 | Ga0495658_0002567 | 3300046683 | Bacteria | 9131 |
| 719 | Ga0495658_0032373 | 3300046683 | Bacteria | 2854 |
| 720 | Ga0495613_0028709 | 3300046689 | Bacteria | 4138 |
| 721 | Ga0495613_0073481 | 3300046689 | Bacteria | 2491 |
| 722 | Ga0495613_0149811 | 3300046689 | Bacteria | 1664 |
| 723 | Ga0495613_0179889 | 3300046689 | Bacteria | 1498 |
| 724 | Ga0495624_0020406 | 3300046690 | Bacteria | 4411 |
| 725 | Ga0495624_0115982 | 3300046690 | Bacteria | 1646 |
| 726 | Ga0495624_0199326 | 3300046690 | Bacteria | 1216 |
| 727 | Ga0495600_0007449 | 3300046809 | Bacteria | 6697 |
| 728 | Ga0495600_0010608 | 3300046809 | Bacteria | 5723 |
| 729 | Ga0495600_0045771 | 3300046809 | Bacteria | 2855 |
| 730 | Ga0495600_0214310 | 3300046809 | Bacteria | 1233 |
| 731 | Ga0495581_0005138 | 3300047315 | Bacteria | 7572 |
| 732 | Ga0495581_0006345 | 3300047315 | Bacteria | 6857 |
| 733 | Ga0495581_0130303 | 3300047315 | Bacteria | 1465 |
| 734 | Ga0495581_0509242 | 3300047315 | Bacteria | 700 |
| 735 | Ga0495604_0048972 | 3300047317 | Bacteria | 3285 |
| 736 | Ga0495604_0064605 | 3300047317 | Bacteria | 2788 |
| 737 | Ga0495604_0227644 | 3300047317 | Bacteria | 1280 |
| 738 | Ga0495604_0235189 | 3300047317 | Bacteria | 1255 |
| 739 | Ga0495604_0250961 | 3300047317 | Unclassified | 1206 |
| 740 | Ga0495636_0209240 | 3300047318 | Bacteria | 893 |
| 741 | Ga0495674_0002797 | 3300047319 | Bacteria | 16935 |
| 742 | Ga0495674_0003374 | 3300047319 | Bacteria | 15512 |
| 743 | Ga0495674_0006923 | 3300047319 | Bacteria | 10846 |
| 744 | Ga0495674_0015365 | 3300047319 | Bacteria | 7160 |
| 745 | Ga0495674_0031023 | 3300047319 | Bacteria | 4857 |
| 746 | Ga0495674_0052872 | 3300047319 | Bacteria | 3572 |
| 747 | Ga0495674_0115619 | 3300047319 | Bacteria | 2270 |
| 748 | Ga0495674_0255937 | 3300047319 | Bacteria | 1439 |
| 749 | Ga0495674_0309676 | 3300047319 | Bacteria | 1288 |
| 750 | Ga0495676_0024595 | 3300047321 | Bacteria | 5210 |
| 751 | Ga0495676_0233709 | 3300047321 | Bacteria | 1262 |
| 752 | Ga0495676_0265900 | 3300047321 | Bacteria | 1165 |
| 753 | Ga0495680_0002943 | 3300047322 | Bacteria | 17050 |
| 754 | Ga0495680_0003020 | 3300047322 | Bacteria | 16779 |
| 755 | Ga0495680_0005552 | 3300047322 | Bacteria | 11839 |
| 756 | Ga0495680_0006380 | 3300047322 | Bacteria | 10972 |
| 757 | Ga0495680_0010108 | 3300047322 | Bacteria | 8437 |
| 758 | Ga0495680_0087118 | 3300047322 | Bacteria | 2349 |
| 759 | Ga0495680_0130376 | 3300047322 | Bacteria | 1848 |
| 760 | Ga0495680_0206618 | 3300047322 | Bacteria | 1407 |
| 761 | Ga0495680_0313277 | 3300047322 | Bacteria | 1099 |
| 762 | Ga0495684_0000915 | 3300047471 | Bacteria | 23961 |
| 763 | Ga0495684_0006939 | 3300047471 | Bacteria | 8793 |
| 764 | Ga0495684_0015447 | 3300047471 | Bacteria | 5875 |
| 765 | Ga0495684_0040989 | 3300047471 | Bacteria | 3548 |
| 766 | Ga0495684_0044331 | 3300047471 | Bacteria | 3405 |
| 767 | Ga0495684_0055030 | 3300047471 | Bacteria | 3034 |
| 768 | Ga0495684_0124541 | 3300047471 | Bacteria | 1939 |
| 769 | Ga0495684_0195894 | 3300047471 | Bacteria | 1491 |
| 770 | Ga0495684_0407111 | 3300047471 | Bacteria | 954 |
| 771 | Ga0495593_0008349 | 3300047673 | Bacteria | 6026 |
| 772 | Ga0495593_0014023 | 3300047673 | Bacteria | 4563 |
| 773 | Ga0495593_0090993 | 3300047673 | Bacteria | 1571 |
| 774 | Ga0495602_0008635 | 3300048088 | Bacteria | 10641 |
| 775 | Ga0495602_0056120 | 3300048088 | Bacteria | 3465 |
| 776 | Ga0495602_0079124 | 3300048088 | Bacteria | 2774 |
| 777 | Ga0495602_0235246 | 3300048088 | Bacteria | 1373 |
| 778 | Ga0495602_0331085 | 3300048088 | Bacteria | 1104 |
| 779 | Ga0495602_0413555 | 3300048088 | Bacteria | 959 |
| 780 | Ga0495614_0030347 | 3300048089 | Bacteria | 2326 |
| 781 | Ga0496100_0103906 | 3300048903 | Bacteria | 1962 |
| 782 | Ga0496100_0304393 | 3300048903 | Bacteria | 1194 |
| 783 | Ga0496101_0112744 | 3300048904 | Bacteria | 2049 |
| 784 | Ga0496101_0247835 | 3300048904 | Bacteria | 1387 |
| 785 | Ga0496102_0160930 | 3300048905 | Bacteria | 2112 |
| 786 | Ga0496102_0182781 | 3300048905 | Bacteria | 1975 |
| 787 | Ga0496102_0223224 | 3300048905 | Bacteria | 1776 |
| 788 | Ga0496102_0393851 | 3300048905 | Bacteria | 1303 |
| 789 | Ga0496103_0123608 | 3300048906 | Bacteria | 1649 |
| 790 | Ga0496103_0371394 | 3300048906 | Bacteria | 919 |
| 791 | Ga0496103_0574263 | 3300048906 | Bacteria | 719 |
| 792 | Ga0496104_0025698 | 3300048907 | Bacteria | 5431 |
| 793 | Ga0496104_0079398 | 3300048907 | Bacteria | 3127 |
| 794 | Ga0496104_0085966 | 3300048907 | Bacteria | 3002 |
| 795 | Ga0496104_0168196 | 3300048907 | Bacteria | 2102 |
| 796 | Ga0496105_0041197 | 3300048908 | Bacteria | 3806 |
| 797 | Ga0496105_0047238 | 3300048908 | Bacteria | 3552 |
| 798 | Ga0496105_0111512 | 3300048908 | Bacteria | 2257 |
| 799 | Ga0496105_0159954 | 3300048908 | Bacteria | 1849 |
| 800 | Ga0496106_0031933 | 3300048909 | Bacteria | 3924 |
| 801 | Ga0496106_0032857 | 3300048909 | Bacteria | 3869 |
| 802 | Ga0496107_0051184 | 3300048910 | Bacteria | 2978 |
| 803 | Ga0496107_0250083 | 3300048910 | Bacteria | 1319 |
| 804 | Ga0496107_0277263 | 3300048910 | Bacteria | 1248 |
| 805 | Ga0496107_0760732 | 3300048910 | Bacteria | 711 |
| 806 | Ga0496108_0033292 | 3300048911 | Bacteria | 4282 |
| 807 | Ga0496108_0048955 | 3300048911 | Bacteria | 3534 |
| 808 | Ga0496108_0057877 | 3300048911 | Bacteria | 3257 |
| 809 | Ga0496108_0110283 | 3300048911 | Bacteria | 2352 |
| 810 | Ga0496108_0223298 | 3300048911 | Bacteria | 1637 |
| 811 | Ga0496108_0264927 | 3300048911 | Bacteria | 1495 |
| 812 | Ga0496109_0024758 | 3300048912 | Bacteria | 5339 |
| 813 | Ga0496109_0083299 | 3300048912 | Bacteria | 2949 |
| 814 | Ga0496109_0332079 | 3300048912 | Bacteria | 1435 |
| 815 | Ga0496109_1194369 | 3300048912 | Bacteria | 697 |
| 816 | Ga0496110_0162245 | 3300048913 | Bacteria | 2026 |
| 817 | Ga0496110_0772134 | 3300048913 | Bacteria | 865 |
| 818 | Ga0496110_0778538 | 3300048913 | Bacteria | 861 |
| 819 | Ga0496111_0064002 | 3300048914 | Bacteria | 2667 |
| 820 | Ga0496111_0167767 | 3300048914 | Bacteria | 1631 |
| 821 | Ga0496111_0263970 | 3300048914 | Unclassified | 1277 |
| 822 | Ga0496112_0000328 | 3300048915 | Bacteria | 30672 |
| 823 | Ga0496112_0021304 | 3300048915 | Bacteria | 6162 |
| 824 | Ga0496112_0089774 | 3300048915 | Bacteria | 3041 |
| 825 | Ga0496112_0116673 | 3300048915 | Bacteria | 2640 |
| 826 | Ga0496112_0120883 | 3300048915 | Bacteria | 2589 |
| 827 | Ga0496112_0123159 | 3300048915 | Bacteria | 2563 |
| 828 | Ga0496112_0516203 | 3300048915 | Bacteria | 1130 |
| 829 | Ga0496112_0683724 | 3300048915 | Bacteria | 954 |
| 830 | Ga0496113_0064473 | 3300048916 | Bacteria | 2770 |
| 831 | Ga0496113_0093846 | 3300048916 | Bacteria | 2317 |
| 832 | Ga0496113_0151681 | 3300048916 | Bacteria | 1828 |
| 833 | Ga0496113_0162772 | 3300048916 | Bacteria | 1764 |
| 834 | Ga0496113_0182816 | 3300048916 | Bacteria | 1662 |
| 835 | Ga0496114_0072777 | 3300048917 | Bacteria | 2891 |
| 836 | Ga0496114_0207471 | 3300048917 | Bacteria | 1718 |
| 837 | Ga0496114_0238602 | 3300048917 | Bacteria | 1598 |
| 838 | Ga0496114_0315461 | 3300048917 | Bacteria | 1381 |
| 839 | Ga0496114_0558019 | 3300048917 | Bacteria | 1012 |
| 840 | Ga0496115_0021773 | 3300048918 | Bacteria | 4955 |
| 841 | Ga0496115_0174141 | 3300048918 | Bacteria | 1779 |
| 842 | Ga0496115_0319389 | 3300048918 | Bacteria | 1270 |
| 843 | nmdc:mga05p37_1281728_c1 | 3300050507 | Bacteria | 749 |
| 844 | nmdc:mga05p37_42625_c1 | 3300050507 | Bacteria | 5578 |
| 845 | nmdc:mga09592_26309_c1 | 3300050508 | Bacteria | 4819 |
| 846 | nmdc:mga06r32_1030367_c1 | 3300050510 | Bacteria | 774 |
| 847 | nmdc:mga06r32_415213_c1 | 3300050510 | Bacteria | 1327 |
| 848 | nmdc:mga08y16_26715_c1 | 3300050511 | Bacteria | 6083 |
| 849 | nmdc:mga08y16_509699_c1 | 3300050511 | Bacteria | 1221 |
| 850 | nmdc:mga0n895_140388_c1 | 3300050512 | Unclassified | 2444 |
| 851 | nmdc:mga0n895_180761_c1 | 3300050512 | Bacteria | 2141 |
| 852 | nmdc:mga0n895_213402_c1 | 3300050512 | Bacteria | 1960 |
| 853 | nmdc:mga0n895_213880_c1 | 3300050512 | Bacteria | 1958 |
| 854 | nmdc:mga0n895_24667_c1 | 3300050512 | Bacteria | 5670 |
| 855 | nmdc:mga0n895_366558_c1 | 3300050512 | Bacteria | 1459 |
| 856 | nmdc:mga0n895_705600_c1 | 3300050512 | Bacteria | 1005 |
| 857 | nmdc:mga0n895_790197_c1 | 3300050512 | Bacteria | 940 |
| 858 | nmdc:mga0rr50_17860_c1 | 3300050513 | Bacteria | 4750 |
| 859 | nmdc:mga0rr50_478945_c1 | 3300050513 | Bacteria | 1057 |
| 860 | nmdc:mga0rr50_545042_c1 | 3300050513 | Bacteria | 988 |
| 861 | nmdc:mga0rr50_59115_c1 | 3300050513 | Bacteria | 2877 |
| 862 | nmdc:mga08x19_224595_c2 | 3300050514 | Bacteria | 898 |
| 863 | nmdc:mga08x19_310175_c1 | 3300050514 | Bacteria | 1097 |
| 864 | nmdc:mga08x19_520372_c1 | 3300050514 | Bacteria | 841 |
| 865 | nmdc:mga08x19_54446_c1 | 3300050514 | Bacteria | 2576 |
| 866 | nmdc:mga08x19_75135_c1 | 3300050514 | Bacteria | 2209 |
| 867 | nmdc:mga0a205_137506_c1 | 3300050515 | Bacteria | 2344 |
| 868 | nmdc:mga0a205_274415_c1 | 3300050515 | Bacteria | 1562 |
| 869 | nmdc:mga0a205_310257_c1 | 3300050515 | Bacteria | 1450 |
| 870 | nmdc:mga0a205_6050_c1 | 3300050515 | Bacteria | 10918 |
| 871 | Ga0495601_0017677 | 3300053077 | Bacteria | 4331 |
| 872 | Ga0495601_0023343 | 3300053077 | Bacteria | 3800 |
| 873 | Ga0495601_0099190 | 3300053077 | Bacteria | 1880 |
| 874 | Ga0495601_0331464 | 3300053077 | Bacteria | 990 |
| 875 | Ga0495601_0461011 | 3300053077 | Bacteria | 821 |
| 876 | Ga0495612_0025789 | 3300053078 | Bacteria | 2361 |
| 877 | Ga0495612_0030294 | 3300053078 | Bacteria | 2179 |
| 878 | Ga0495612_0062116 | 3300053078 | Bacteria | 1548 |
| 879 | Ga0495612_0066462 | 3300053078 | Bacteria | 1499 |
| 880 | Ga0495612_0102042 | 3300053078 | Bacteria | 1222 |
| 881 | Ga0495655_0129306 | 3300053083 | Bacteria | 776 |
| 882 | Ga0495619_0008575 | 3300053085 | Bacteria | 6470 |
| 883 | Ga0495619_0027404 | 3300053085 | Bacteria | 3669 |
| 884 | Ga0495619_0227145 | 3300053085 | Bacteria | 1293 |
| 885 | 2676483792 | 2675903059 | Bacteria | 8644972 |
| 886 | Ga0495628_0185266 | |||
| 887 | Ga0070683_100470163 | |||
| 888 | Ga0070683_100697053 | |||
| 889 | Ga0070683_101033962 | |||
| 890 | Ga0068869_100128947 | |||
| 891 | Ga0068869_100517962 | |||
| 892 | Ga0070666_10121134 | |||
| 893 | Ga0070682_100132888 | |||
| 894 | Ga0070682_100263680 | |||
| 895 | Ga0068868_100767527 | |||
| 896 | Ga0070689_100126115 | |||
| 897 | Ga0070689_100524436 | |||
| 898 | Ga0070691_10049380 | |||
| 899 | Ga0070691_10054462 | |||
| 900 | Ga0070691_10145639 | |||
| 901 | Ga0070687_100189372 | |||
| 902 | Ga0070661_100105366 | |||
| 903 | Ga0070668_100102965 | |||
| 904 | Ga0070668_100137264 | |||
| 905 | Ga0070669_100521678 | |||
| 906 | Ga0070675_100047009 | |||
| 907 | Ga0070671_100540407 | |||
| 908 | Ga0070674_100203670 | |||
| 909 | Ga0070674_100644649 | |||
| 910 | Ga0070673_100179117 | |||
| 911 | Ga0070659_100046748 | |||
| 912 | Ga0070667_100558410 | |||
| 913 | Ga0070709_10008029 | |||
| 914 | Ga0070709_10008777 | |||
| 915 | Ga0070709_10011509 | |||
| 916 | Ga0070709_10014405 | |||
| 917 | Ga0070709_10027499 | |||
| 918 | Ga0070709_10034447 | |||
| 919 | Ga0070709_10304737 | |||
| 920 | Ga0070714_100003083 | |||
| 921 | Ga0070714_100021540 | |||
| 922 | Ga0070714_100043012 | |||
| 923 | Ga0070714_100046236 | |||
| 924 | Ga0070714_100052272 | |||
| 925 | Ga0070714_100075615 | |||
| 926 | Ga0070714_100108446 | |||
| 927 | Ga0070714_100178353 | |||
| 928 | Ga0070714_100228782 | |||
| 929 | Ga0070714_100418706 | |||
| 930 | Ga0070713_100002609 | |||
| 931 | Ga0070713_100007436 | |||
| 932 | Ga0070713_100018746 | |||
| 933 | Ga0070713_100020870 | |||
| 934 | Ga0070713_100031705 | |||
| 935 | Ga0070713_100051518 | |||
| 936 | Ga0070713_100062450 | |||
| 937 | Ga0070713_100126109 | |||
| 938 | Ga0070713_100234417 | |||
| 939 | Ga0070713_100261248 | |||
| 940 | Ga0070713_100451311 | |||
| 941 | Ga0070713_100555425 | |||
| 942 | Ga0070713_100718724 | |||
| 943 | Ga0070710_10003502 | |||
| 944 | Ga0070710_10008426 | |||
| 945 | Ga0070710_10009481 | |||
| 946 | Ga0070710_10024791 | |||
| 947 | Ga0070710_10033622 | |||
| 948 | Ga0070710_10034216 | |||
| 949 | Ga0070710_10072514 | |||
| 950 | Ga0070710_10295536 | |||
| 951 | Ga0070701_10027455 | |||
| 952 | Ga0070711_100026642 | |||
| 953 | Ga0070711_100104178 | |||
| 954 | Ga0070711_100158726 | |||
| 955 | Ga0070711_100273574 | |||
| 956 | Ga0070711_100337855 | |||
| 957 | Ga0070711_100378062 | |||
| 958 | Ga0070711_100405542 | |||
| 959 | Ga0070705_100122468 | |||
| 960 | Ga0070700_100220101 | |||
| 961 | Ga0070708_100008385 | |||
| 962 | Ga0070708_100018479 | |||
| 963 | Ga0070708_100171003 | |||
| 964 | Ga0070708_100219325 | |||
| 965 | Ga0070708_100231612 | |||
| 966 | Ga0070708_100233389 | |||
| 967 | Ga0070708_100248225 | |||
| 968 | Ga0070708_100251958 | |||
| 969 | Ga0070708_100663275 | |||
| 970 | Ga0070663_100049224 | |||
| 971 | Ga0070663_100503000 | |||
| 972 | Ga0070678_100214364 | |||
| 973 | Ga0070662_100235214 | |||
| 974 | Ga0070681_10653298 | |||
| 975 | Ga0068867_100561817 | |||
| 976 | Ga0068867_100654753 | |||
| 977 | Ga0070706_100017573 | |||
| 978 | Ga0070706_100039392 | |||
| 979 | Ga0070706_100067237 | |||
| 980 | Ga0070706_100073297 | |||
| 981 | Ga0070706_100175508 | |||
| 982 | Ga0070706_100176671 | |||
| 983 | Ga0070706_100234414 | |||
| 984 | Ga0070706_100276702 | |||
| 985 | Ga0070706_100850077 | |||
| 986 | Ga0070707_100016241 | |||
| 987 | Ga0070707_100042695 | |||
| 988 | Ga0070707_100050684 | |||
| 989 | Ga0070707_100061845 | |||
| 990 | Ga0070707_100088248 | |||
| 991 | Ga0070707_100208364 | |||
| 992 | Ga0070707_100248875 | |||
| 993 | Ga0070707_100345801 | |||
| 994 | Ga0070707_100751547 | |||
| 995 | Ga0070707_101044228 | |||
| 996 | Ga0070698_100001890 | |||
| 997 | Ga0070698_100006119 | |||
| 998 | Ga0070698_100014708 | |||
| 999 | Ga0070698_100028270 | |||
| 1000 | Ga0070698_100030483 | |||
| 1001 | Ga0070698_100063335 | |||
| 1002 | Ga0070698_100105827 | |||
| 1003 | Ga0070698_100223031 | |||
| 1004 | Ga0070699_100001763 | |||
| 1005 | Ga0070699_100003475 | |||
| 1006 | Ga0070699_100430746 | |||
| 1007 | Ga0070684_100128257 | |||
| 1008 | Ga0070697_100066124 | |||
| 1009 | Ga0070697_100506722 | |||
| 1010 | Ga0068853_100053867 | |||
| 1011 | Ga0068853_100385449 | |||
| 1012 | Ga0070695_100295527 | |||
| 1013 | Ga0070696_100099772 | |||
| 1014 | Ga0070696_100256389 | |||
| 1015 | Ga0070693_100039155 | |||
| 1016 | Ga0070693_100119147 | |||
| 1017 | Ga0070665_100126835 | |||
| 1018 | Ga0070665_100436314 | |||
| 1019 | Ga0070664_100258230 | |||
| 1020 | Ga0068857_100074415 | |||
| 1021 | Ga0068857_100231504 | |||
| 1022 | Ga0068854_100080604 | |||
| 1023 | Ga0068856_100052789 | |||
| 1024 | Ga0068856_100200111 | |||
| 1025 | Ga0068856_100295042 | |||
| 1026 | Ga0070702_100107689 | |||
| 1027 | Ga0070702_100152852 | |||
| 1028 | Ga0068852_100044513 | |||
| 1029 | Ga0068852_100531049 | |||
| 1030 | Ga0068852_101381296 | |||
| 1031 | Ga0068864_100174972 | |||
| 1032 | Ga0068864_100263022 | |||
| 1033 | Ga0068866_10244454 | |||
| 1034 | Ga0068861_100964021 | |||
| 1035 | Ga0068851_10061795 | |||
| 1036 | Ga0068870_10084314 | |||
| 1037 | Ga0068870_10144085 | |||
| 1038 | Ga0068863_100026311 | |||
| 1039 | Ga0068863_100169350 | |||
| 1040 | Ga0068858_100193158 | |||
| 1041 | Ga0068858_100196924 | |||
| 1042 | Ga0068860_100155519 | |||
| 1043 | Ga0068860_100186351 | |||
| 1044 | Ga0081455_10325194 | |||
| 1045 | Ga0081540_1000505 | |||
| 1046 | Ga0081540_1012672 | |||
| 1047 | Ga0070717_10019547 | |||
| 1048 | Ga0070717_10020149 | |||
| 1049 | Ga0070717_10046450 | |||
| 1050 | Ga0070717_10049745 | |||
| 1051 | Ga0070717_10063693 | |||
| 1052 | Ga0070717_10064646 | |||
| 1053 | Ga0070717_10068574 | |||
| 1054 | Ga0070717_10071140 | |||
| 1055 | Ga0070717_10089149 | |||
| 1056 | Ga0070717_10097940 | |||
| 1057 | Ga0070717_10205869 | |||
| 1058 | Ga0070717_10279156 | |||
| 1059 | Ga0070717_10302248 | |||
| 1060 | Ga0070717_10325192 | |||
| 1061 | Ga0070717_10425047 | |||
| 1062 | Ga0070717_10436157 | |||
| 1063 | Ga0070717_10438339 | |||
| 1064 | Ga0070717_10930218 | |||
| 1065 | Ga0070715_10006872 | |||
| 1066 | Ga0070715_10012291 | |||
| 1067 | Ga0070715_10039413 | |||
| 1068 | Ga0070715_10044545 | |||
| 1069 | Ga0070715_10066280 | |||
| 1070 | Ga0070715_10118074 | |||
| 1071 | Ga0070716_100000882 | |||
| 1072 | Ga0070716_100001013 | |||
| 1073 | Ga0070716_100002488 | |||
| 1074 | Ga0070716_100003491 | |||
| 1075 | Ga0070716_100014786 | |||
| 1076 | Ga0070716_100014836 | |||
| 1077 | Ga0070716_100057607 | |||
| 1078 | Ga0070716_100453236 | |||
| 1079 | Ga0070712_100013422 | |||
| 1080 | Ga0070712_100018865 | |||
| 1081 | Ga0070712_100023270 | |||
| 1082 | Ga0070712_100049351 | |||
| 1083 | Ga0070712_100055946 | |||
| 1084 | Ga0070712_100106512 | |||
| 1085 | Ga0070712_100154806 | |||
| 1086 | Ga0070712_100345284 | |||
| 1087 | Ga0070712_100359043 | |||
| 1088 | Ga0070712_100435039 | |||
| 1089 | Ga0070712_100582546 | |||
| 1090 | Ga0097621_100086681 | |||
| 1091 | Ga0097621_100709667 | |||
| 1092 | Ga0068871_100130107 | |||
| 1093 | Ga0068871_100194480 | |||
| 1094 | Ga0075428_100090402 | |||
| 1095 | Ga0075428_100120812 | |||
| 1096 | Ga0075428_101005337 | |||
| 1097 | Ga0075430_100149748 | |||
| 1098 | Ga0075433_10205380 | |||
| 1099 | Ga0075433_10332457 | |||
| 1100 | Ga0075433_10507917 | |||
| 1101 | Ga0075434_100036497 | |||
| 1102 | Ga0075434_100181054 | |||
| 1103 | Ga0075434_100212462 | |||
| 1104 | Ga0075434_100259593 | |||
| 1105 | Ga0075434_101024076 | |||
| 1106 | Ga0075429_100039673 | |||
| 1107 | Ga0068865_100017084 | |||
| 1108 | Ga0068865_100056870 | |||
| 1109 | Ga0068865_100465856 | |||
| 1110 | Ga0075436_100064578 | |||
| 1111 | Ga0075436_100085027 | |||
| 1112 | Ga0075436_100228875 | |||
| 1113 | Ga0075436_100392494 | |||
| 1114 | Ga0075435_100016758 | |||
| 1115 | Ga0075435_100151716 | |||
| 1116 | Ga0075435_100200333 | |||
| 1117 | Ga0075435_100313894 | |||
| 1118 | Ga0075435_100566294 | |||
| 1119 | Ga0099794_10056594 | |||
| 1120 | Ga0099794_10108679 | |||
| 1121 | Ga0099794_10169926 | |||
| 1122 | Ga0099795_10056610 | |||
| 1123 | Ga0099795_10076428 | |||
| 1124 | Ga0099795_10154581 | |||
| 1125 | Ga0105240_10755236 | |||
| 1126 | Ga0111539_10022628 | |||
| 1127 | Ga0111539_11055609 | |||
| 1128 | Ga0105245_10045218 | |||
| 1129 | Ga0105245_10098182 | |||
| 1130 | Ga0105245_10164325 | |||
| 1131 | Ga0105247_10036308 | |||
| 1132 | Ga0105247_10132660 | |||
| 1133 | Ga0114129_10060899 | |||
| 1134 | Ga0114129_11032827 | |||
| 1135 | Ga0105243_10206118 | |||
| 1136 | Ga0105243_10412722 | |||
| 1137 | Ga0105243_10506568 | |||
| 1138 | Ga0105243_10606530 | |||
| 1139 | Ga0105243_10883354 | |||
| 1140 | Ga0105242_10047464 | |||
| 1141 | Ga0105242_10549764 | |||
| 1142 | Ga0105248_10083883 | |||
| 1143 | Ga0105238_10137555 | |||
| 1144 | Ga0105238_10267849 | |||
| 1145 | Ga0105249_10143980 | |||
| 1146 | Ga0105249_10277377 | |||
| 1147 | Ga0099796_10143973 | |||
| 1148 | Ga0105239_10318926 | |||
| 1149 | Ga0105239_10450388 | |||
| 1150 | Ga0105246_10038639 | |||
| 1151 | Ga0157335_1006038 | |||
| 1152 | Ga0157342_1000926 | |||
| 1153 | Ga0157373_10471300 | |||
| 1154 | Ga0157371_10053784 | |||
| 1155 | Ga0157371_10184620 | |||
| 1156 | Ga0157370_10207940 | |||
| 1157 | Ga0157370_10600087 | |||
| 1158 | Ga0157369_10073701 | |||
| 1159 | Ga0157374_10085339 | |||
| 1160 | Ga0157378_10046010 | |||
| 1161 | Ga0157378_10400567 | |||
| 1162 | Ga0163162_10005222 | |||
| 1163 | Ga0163162_10113568 | |||
| 1164 | Ga0163162_10477744 | |||
| 1165 | Ga0163162_10709206 | |||
| 1166 | Ga0163162_11204273 | |||
| 1167 | Ga0157372_10197550 | |||
| 1168 | Ga0157372_10693819 | |||
| 1169 | Ga0157372_10766473 | |||
| 1170 | Ga0157375_10097979 | |||
| 1171 | Ga0157375_10286718 | |||
| 1172 | Ga0163163_10039709 | |||
| 1173 | Ga0163163_10104363 | |||
| 1174 | Ga0157380_10048663 | |||
| 1175 | Ga0157380_10084123 | |||
| 1176 | Ga0157380_10562600 | |||
| 1177 | Ga0157377_10024600 | |||
| 1178 | Ga0157379_10113597 | |||
| 1179 | Ga0157376_10087923 | |||
| 1180 | Ga0157376_10157878 | |||
| 1181 | Ga0163161_10125812 | |||
| 1182 | Ga0206353_11196411 | |||
| 1183 | Ga0224572_1018809 | |||
| 1184 | Ga0224572_1027730 | |||
| 1185 | Ga0207713_1130527 | |||
| 1186 | Ga0207692_10000906 | |||
| 1187 | Ga0207692_10001229 | |||
| 1188 | Ga0207692_10009869 | |||
| 1189 | Ga0207692_10012375 | |||
| 1190 | Ga0207692_10014285 | |||
| 1191 | Ga0207692_10020061 | |||
| 1192 | Ga0207692_10021348 | |||
| 1193 | Ga0207692_10030514 | |||
| 1194 | Ga0207692_10055175 | |||
| 1195 | Ga0207692_10058124 | |||
| 1196 | Ga0207692_10084215 | |||
| 1197 | Ga0207692_10129609 | |||
| 1198 | Ga0207692_10136137 | |||
| 1199 | Ga0207692_10168364 | |||
| 1200 | Ga0207692_10191899 | |||
| 1201 | Ga0207692_10443253 | |||
| 1202 | Ga0207642_10627568 | |||
| 1203 | Ga0207710_10150784 | |||
| 1204 | Ga0207688_10039836 | |||
| 1205 | Ga0207688_10141118 | |||
| 1206 | Ga0207688_10184421 | |||
| 1207 | Ga0207680_10102656 | |||
| 1208 | Ga0207680_10201114 | |||
| 1209 | Ga0207647_10073955 | |||
| 1210 | Ga0207647_10275545 | |||
| 1211 | Ga0207685_10007944 | |||
| 1212 | Ga0207685_10008898 | |||
| 1213 | Ga0207685_10009317 | |||
| 1214 | Ga0207685_10011073 | |||
| 1215 | Ga0207685_10128313 | |||
| 1216 | Ga0207685_10151700 | |||
| 1217 | Ga0207685_10188580 | |||
| 1218 | Ga0207699_10002045 | |||
| 1219 | Ga0207699_10005425 | |||
| 1220 | Ga0207699_10007542 | |||
| 1221 | Ga0207699_10009906 | |||
| 1222 | Ga0207699_10011204 | |||
| 1223 | Ga0207699_10016300 | |||
| 1224 | Ga0207699_10048664 | |||
| 1225 | Ga0207699_10063946 | |||
| 1226 | Ga0207699_10138007 | |||
| 1227 | Ga0207699_10292017 | |||
| 1228 | Ga0207699_10566103 | |||
| 1229 | Ga0207645_10289867 | |||
| 1230 | Ga0207643_10167932 | |||
| 1231 | Ga0207684_10011456 | |||
| 1232 | Ga0207684_10013316 | |||
| 1233 | Ga0207684_10028604 | |||
| 1234 | Ga0207684_10090406 | |||
| 1235 | Ga0207684_10094476 | |||
| 1236 | Ga0207684_10138934 | |||
| 1237 | Ga0207684_10155682 | |||
| 1238 | Ga0207684_10219183 | |||
| 1239 | Ga0207684_10489379 | |||
| 1240 | Ga0207684_10503151 | |||
| 1241 | Ga0207695_10572523 | |||
| 1242 | Ga0207693_10003537 | |||
| 1243 | Ga0207693_10007818 | |||
| 1244 | Ga0207693_10013772 | |||
| 1245 | Ga0207693_10015281 | |||
| 1246 | Ga0207693_10021090 | |||
| 1247 | Ga0207693_10023129 | |||
| 1248 | Ga0207693_10027720 | |||
| 1249 | Ga0207693_10032382 | |||
| 1250 | Ga0207693_10056236 | |||
| 1251 | Ga0207693_10062161 | |||
| 1252 | Ga0207693_10078373 | |||
| 1253 | Ga0207693_10203591 | |||
| 1254 | Ga0207693_10223458 | |||
| 1255 | Ga0207663_10013212 | |||
| 1256 | Ga0207663_10019008 | |||
| 1257 | Ga0207663_10033650 | |||
| 1258 | Ga0207663_10033718 | |||
| 1259 | Ga0207663_10039015 | |||
| 1260 | Ga0207663_10099809 | |||
| 1261 | Ga0207663_10147484 | |||
| 1262 | Ga0207663_10841570 | |||
| 1263 | Ga0207660_10597045 | |||
| 1264 | Ga0207662_10048216 | |||
| 1265 | Ga0207662_10051446 | |||
| 1266 | Ga0207657_10026270 | |||
| 1267 | Ga0207646_10016723 | |||
| 1268 | Ga0207646_10018380 | |||
| 1269 | Ga0207646_10034733 | |||
| 1270 | Ga0207646_10035529 | |||
| 1271 | Ga0207646_10039619 | |||
| 1272 | Ga0207646_10073950 | |||
| 1273 | Ga0207646_10425805 | |||
| 1274 | Ga0207646_10565642 | |||
| 1275 | Ga0207694_10287125 | |||
| 1276 | Ga0207687_10243171 | |||
| 1277 | Ga0207700_10001538 | |||
| 1278 | Ga0207700_10003380 | |||
| 1279 | Ga0207700_10004555 | |||
| 1280 | Ga0207700_10012251 | |||
| 1281 | Ga0207700_10020694 | |||
| 1282 | Ga0207700_10021528 | |||
| 1283 | Ga0207700_10027226 | |||
| 1284 | Ga0207700_10040769 | |||
| 1285 | Ga0207700_10114687 | |||
| 1286 | Ga0207700_10129052 | |||
| 1287 | Ga0207700_10245148 | |||
| 1288 | Ga0207700_10262553 | |||
| 1289 | Ga0207700_10292906 | |||
| 1290 | Ga0207700_10337846 | |||
| 1291 | Ga0207700_10380544 | |||
| 1292 | Ga0207700_10692432 | |||
| 1293 | Ga0207700_10761650 | |||
| 1294 | Ga0207664_10000393 | |||
| 1295 | Ga0207664_10018595 | |||
| 1296 | Ga0207664_10021419 | |||
| 1297 | Ga0207664_10033058 | |||
| 1298 | Ga0207664_10044684 | |||
| 1299 | Ga0207664_10049339 | |||
| 1300 | Ga0207664_10059063 | |||
| 1301 | Ga0207664_10059833 | |||
| 1302 | Ga0207664_10082031 | |||
| 1303 | Ga0207664_10085296 | |||
| 1304 | Ga0207664_10089227 | |||
| 1305 | Ga0207664_10130313 | |||
| 1306 | Ga0207664_10130768 | |||
| 1307 | Ga0207664_10187675 | |||
| 1308 | Ga0207664_10207890 | |||
| 1309 | Ga0207664_10296691 | |||
| 1310 | Ga0207664_10337101 | |||
| 1311 | Ga0207690_10371067 | |||
| 1312 | Ga0207690_10838471 | |||
| 1313 | Ga0207706_10293370 | |||
| 1314 | Ga0207686_10216826 | |||
| 1315 | Ga0207709_10795039 | |||
| 1316 | Ga0207669_10537552 | |||
| 1317 | Ga0207704_10332289 | |||
| 1318 | Ga0207665_10000212 | |||
| 1319 | Ga0207665_10003975 | |||
| 1320 | Ga0207665_10005779 | |||
| 1321 | Ga0207665_10012784 | |||
| 1322 | Ga0207665_10021946 | |||
| 1323 | Ga0207665_10046918 | |||
| 1324 | Ga0207665_10058062 | |||
| 1325 | Ga0207665_10074084 | |||
| 1326 | Ga0207665_10085645 | |||
| 1327 | Ga0207665_10159080 | |||
| 1328 | Ga0207691_10043240 | |||
| 1329 | Ga0207711_10107740 | |||
| 1330 | Ga0207711_10770738 | |||
| 1331 | Ga0207689_10066097 | |||
| 1332 | Ga0207689_10251395 | |||
| 1333 | Ga0207661_11328956 | |||
| 1334 | Ga0207679_10328572 | |||
| 1335 | Ga0207667_10444355 | |||
| 1336 | Ga0207651_10505224 | |||
| 1337 | Ga0207712_10258534 | |||
| 1338 | Ga0207668_10930432 | |||
| 1339 | Ga0207640_10363213 | |||
| 1340 | Ga0207640_11164169 | |||
| 1341 | Ga0207677_10374190 | |||
| 1342 | Ga0207677_10443671 | |||
| 1343 | Ga0207703_10284011 | |||
| 1344 | Ga0207639_10424620 | |||
| 1345 | Ga0207678_10020838 | |||
| 1346 | Ga0207678_10195174 | |||
| 1347 | Ga0207702_10054308 | |||
| 1348 | Ga0207702_10190432 | |||
| 1349 | Ga0207641_10341915 | |||
| 1350 | Ga0207676_10107532 | |||
| 1351 | Ga0207674_10002102 | |||
| 1352 | Ga0207674_10013776 | |||
| 1353 | Ga0207675_100674903 | |||
| 1354 | Ga0207675_100972094 | |||
| 1355 | Ga0207683_10011291 | |||
| 1356 | Ga0207683_10445579 | |||
| 1357 | Ga0209588_1093951 | |||
| 1358 | Ga0207428_10075309 | |||
| 1359 | Ga0268265_10390704 | |||
| 1360 | Ga0268265_10851951 | |||
| 1361 | Ga0265773_1005577 | |||
| 1362 | Ga0307513_10564039 | |||
| 1363 | Ga0307415_100251223 | |||
| 1364 | Ga0373948_0050200 | |||
| 1365 | Ga0373948_0050201 | |||
| 1366 | Ga0373959_0010133 | |||
| 1367 | Ga0373926_0000351 | |||
| 1368 | Ga0373926_0028302 | |||
| 1369 | Ga0373926_0050410 | |||
| 1370 | Ga0373928_0070872 | |||
| 1371 | Ga0373934_0013934 | |||
| 1372 | Ga0373934_0078797 | |||
| 1373 | Ga0373934_0106340 | |||
| 1374 | Ga0373944_0002690 | |||
| 1375 | Ga0373949_0075902 | |||
| 1376 | Ga0373952_0102275 | |||
| 1377 | Ga0373923_0004043 | |||
| 1378 | Ga0373923_0008726 | |||
| 1379 | Ga0373923_0038852 | |||
| 1380 | Ga0373923_0051196 | |||
| 1381 | Ga0373923_0208300 | |||
| 1382 | Ga0373932_0030949 | |||
| 1383 | Ga0373932_0093099 | |||
| 1384 | Ga0373932_0125877 | |||
| 1385 | Ga0373936_0000106 | |||
| 1386 | Ga0373936_0009435 | |||
| 1387 | Ga0373936_0125146 | |||
| 1388 | Ga0373939_0023728 | |||
| 1389 | Ga0373945_0000011 | |||
| 1390 | Ga0373945_0022868 | |||
| 1391 | Ga0373945_0077436 | |||
| 1392 | Ga0373945_0245426 | |||
| 1393 | Ga0373953_0003747 | |||
| 1394 | Ga0373953_0111658 | |||
| 1395 | Ga0373954_0025478 | |||
| 1396 | Ga0373954_0087169 | |||
| 1397 | Ga0373956_0003134 | |||
| 1398 | Ga0373956_0357638 | |||
| 1399 | Ga0373957_0009002 | |||
| 1400 | Ga0373957_0107107 | |||
| 1401 | Ga0373960_0006879 | |||
| 1402 | Ga0373960_0097514 | |||
| 1403 | Ga0373943_0000223 | |||
| 1404 | Ga0373943_0036307 | |||
| 1405 | Ga0373943_0038679 | |||
| 1406 | Ga0373943_0139455 | |||
| 1407 | Ga0373946_0000509 | |||
| 1408 | Ga0373946_0053685 | |||
| 1409 | Ga0373946_0098707 | |||
| 1410 | Ga0373946_0118000 | |||
| 1411 | Ga0373946_0183065 | |||
| 1412 | Ga0373955_0015063 | |||
| 1413 | Ga0373955_0026838 | |||
| 1414 | Ga0373955_0059828 | |||
| 1415 | Ga0373955_0172298 | |||
| 1416 | Ga0373955_0301979 | |||
| 1417 | Ga0373942_0031668 | |||
| 1418 | Ga0373942_0126597 | |||
| 1419 | Ga0373962_0060052 | |||
| 1420 | Ga0373924_0009356 | |||
| 1421 | Ga0373924_0010065 | |||
| 1422 | Ga0373924_0054277 | |||
| 1423 | Ga0373924_0062092 | |||
| 1424 | Ga0373924_0129829 | |||
| 1425 | Ga0373931_0024103 | |||
| 1426 | Ga0373931_0045564 | |||
| 1427 | Ga0373931_0106831 | |||
| 1428 | Ga0373931_0337339 | |||
| 1429 | Ga0373935_0001332 | |||
| 1430 | Ga0373935_0028504 | |||
| 1431 | Ga0373935_0211866 | |||
| 1432 | Ga0373935_0296506 | |||
| 1433 | Ga0373935_0303838 | |||
| 1434 | Ga0373935_0304426 | |||
| 1435 | Ga0373935_0445923 | |||
| 1436 | Ga0373935_0466600 | |||
| 1437 | Ga0373927_0001232 | |||
| 1438 | Ga0373927_0350937 | |||
| 1439 | Ga0373933_0001230 | |||
| 1440 | Ga0373933_0170058 | |||
| 1441 | Ga0373933_0255271 | |||
| 1442 | Ga0373947_0000678 | |||
| 1443 | Ga0373947_0015730 | |||
| 1444 | Ga0373947_0148468 | |||
| 1445 | Ga0373947_0284746 | |||
| 1446 | Ga0373947_0304993 | |||
| 1447 | Ga0373947_0394498 | |||
| 1448 | Ga0373947_0487262 | |||
| 1449 | Ga0373947_0554131 | |||
| 1450 | Ga0373937_0004426 | |||
| 1451 | Ga0373937_0021560 | |||
| 1452 | Ga0373937_0055133 | |||
| 1453 | Ga0373937_0261126 | |||
| 1454 | Ga0373937_0577499 | |||
| 1455 | Ga0373925_0003810 | |||
| 1456 | Ga0373925_0004138 | |||
| 1457 | Ga0373925_0005610 | |||
| 1458 | Ga0373925_0012071 | |||
| 1459 | Ga0373925_0047159 | |||
| 1460 | Ga0373925_0258966 | |||
| 1461 | Ga0373925_0284185 | |||
| 1462 | Ga0395905_0189469 | |||
| 1463 | Ga0495592_0025646 | |||
| 1464 | Ga0495592_0134164 | |||
| 1465 | Ga0495592_0157158 | |||
| 1466 | Ga0495603_0407159 | |||
| 1467 | Ga0495629_0002045 | |||
| 1468 | Ga0495629_0006311 | |||
| 1469 | Ga0495629_0017493 | |||
| 1470 | Ga0495629_0126371 | |||
| 1471 | Ga0495629_0214141 | |||
| 1472 | Ga0495641_0005509 | |||
| 1473 | Ga0495641_0015509 | |||
| 1474 | Ga0495641_0028379 | |||
| 1475 | Ga0495651_0006919 | |||
| 1476 | Ga0495651_0014526 | |||
| 1477 | Ga0495651_0064772 | |||
| 1478 | Ga0495651_0145248 | |||
| 1479 | Ga0495651_0160763 | |||
| 1480 | Ga0495651_0211441 | |||
| 1481 | Ga0495651_0247723 | |||
| 1482 | Ga0495653_0002243 | |||
| 1483 | Ga0495653_0003585 | |||
| 1484 | Ga0495653_0012057 | |||
| 1485 | Ga0495653_0020891 | |||
| 1486 | Ga0495653_0021628 | |||
| 1487 | Ga0495653_0044512 | |||
| 1488 | Ga0495653_0049360 | |||
| 1489 | Ga0495653_0323717 | |||
| 1490 | Ga0495580_0318242 | |||
| 1491 | Ga0495582_0005139 | |||
| 1492 | Ga0495582_0009104 | |||
| 1493 | Ga0495582_0016403 | |||
| 1494 | Ga0495582_0286067 | |||
| 1495 | Ga0495639_0159100 | |||
| 1496 | Ga0495662_0006434 | |||
| 1497 | Ga0495662_0074406 | |||
| 1498 | Ga0495662_0301281 | |||
| 1499 | Ga0495664_0000074 | |||
| 1500 | Ga0495664_0014019 | |||
| 1501 | Ga0495664_0021632 | |||
| 1502 | Ga0495664_0032010 | |||
| 1503 | Ga0495664_0048865 | |||
| 1504 | Ga0495664_0087583 | |||
| 1505 | Ga0495664_0120286 | |||
| 1506 | Ga0495664_0129079 | |||
| 1507 | Ga0495664_0147325 | |||
| 1508 | Ga0495594_0233837 | |||
| 1509 | Ga0495608_0010301 | |||
| 1510 | Ga0495608_0019775 | |||
| 1511 | Ga0495608_0047514 | |||
| 1512 | Ga0495608_0060395 | |||
| 1513 | Ga0495608_0157466 | |||
| 1514 | Ga0495608_0162758 | |||
| 1515 | Ga0495618_0027274 | |||
| 1516 | Ga0495618_0054180 | |||
| 1517 | Ga0495618_0058143 | |||
| 1518 | Ga0495618_0105379 | |||
| 1519 | Ga0495618_0115631 | |||
| 1520 | Ga0495618_0191587 | |||
| 1521 | Ga0495628_0006999 | |||
| 1522 | Ga0495628_0041315 | |||
| 1523 | Ga0495628_0042336 | |||
| 1524 | Ga0495628_0326244 | |||
| 1525 | Ga0495630_0003300 | |||
| 1526 | Ga0495630_0003467 | |||
| 1527 | Ga0495630_0019477 | |||
| 1528 | Ga0495630_0075816 | |||
| 1529 | Ga0495630_0151772 | |||
| 1530 | Ga0495630_0315868 | |||
| 1531 | Ga0495630_0325567 | |||
| 1532 | Ga0495630_0446198 | |||
| 1533 | Ga0495663_0020642 | |||
| 1534 | Ga0495652_0003774 | |||
| 1535 | Ga0495652_0026003 | |||
| 1536 | Ga0495652_0053023 | |||
| 1537 | Ga0495652_0364330 | |||
| 1538 | Ga0495665_0006968 | |||
| 1539 | Ga0495665_0015753 | |||
| 1540 | Ga0495665_0024358 | |||
| 1541 | Ga0495665_0029169 | |||
| 1542 | Ga0495640_0019455 | |||
| 1543 | Ga0495640_0085276 | |||
| 1544 | Ga0495640_0088225 | |||
| 1545 | Ga0495640_0090684 | |||
| 1546 | Ga0495640_0134951 | |||
| 1547 | Ga0495640_0165211 | |||
| 1548 | Ga0495640_0256950 | |||
| 1549 | Ga0495587_0004663 | |||
| 1550 | Ga0495587_0008354 | |||
| 1551 | Ga0495587_0038641 | |||
| 1552 | Ga0495587_0060530 | |||
| 1553 | Ga0495587_0121095 | |||
| 1554 | Ga0495587_0192718 | |||
| 1555 | Ga0495587_0255209 | |||
| 1556 | Ga0495645_0027793 | |||
| 1557 | Ga0495645_0054285 | |||
| 1558 | Ga0495645_0061359 | |||
| 1559 | Ga0495645_0062247 | |||
| 1560 | Ga0495645_0126322 | |||
| 1561 | Ga0495645_0140348 | |||
| 1562 | Ga0495645_0150853 | |||
| 1563 | Ga0495645_0196207 | |||
| 1564 | Ga0495667_0004794 | |||
| 1565 | Ga0495667_0009182 | |||
| 1566 | Ga0495667_0009944 | |||
| 1567 | Ga0495667_0032929 | |||
| 1568 | Ga0495667_0052635 | |||
| 1569 | Ga0495667_0054015 | |||
| 1570 | Ga0495667_0096710 | |||
| 1571 | Ga0495634_0003827 | |||
| 1572 | Ga0495634_0006194 | |||
| 1573 | Ga0495634_0021922 | |||
| 1574 | Ga0495634_0027823 | |||
| 1575 | Ga0495634_0044194 | |||
| 1576 | Ga0495634_0217226 | |||
| 1577 | Ga0495635_0002312 | |||
| 1578 | Ga0495635_0006936 | |||
| 1579 | Ga0495635_0008400 | |||
| 1580 | Ga0495635_0009246 | |||
| 1581 | Ga0495635_0032241 | |||
| 1582 | Ga0495635_0066633 | |||
| 1583 | Ga0495635_0147565 | |||
| 1584 | Ga0495635_0154822 | |||
| 1585 | Ga0495635_0272836 | |||
| 1586 | Ga0495588_0231176 | |||
| 1587 | Ga0495657_0014019 | |||
| 1588 | Ga0495657_0030095 | |||
| 1589 | Ga0495657_0044343 | |||
| 1590 | Ga0495657_0090525 | |||
| 1591 | Ga0495599_0000791 | |||
| 1592 | Ga0495599_0009836 | |||
| 1593 | Ga0495599_0014028 | |||
| 1594 | Ga0495599_0151762 | |||
| 1595 | Ga0495623_0010893 | |||
| 1596 | Ga0495623_0183828 | |||
| 1597 | Ga0495646_0018847 | |||
| 1598 | Ga0495646_0078089 | |||
| 1599 | Ga0495646_0091802 | |||
| 1600 | Ga0495646_0115284 | |||
| 1601 | Ga0495646_0141086 | |||
| 1602 | Ga0495647_0059593 | |||
| 1603 | Ga0495658_0002567 | |||
| 1604 | Ga0495658_0032373 | |||
| 1605 | Ga0495613_0028709 | |||
| 1606 | Ga0495613_0073481 | |||
| 1607 | Ga0495613_0149811 | |||
| 1608 | Ga0495613_0179889 | |||
| 1609 | Ga0495624_0020406 | |||
| 1610 | Ga0495624_0115982 | |||
| 1611 | Ga0495624_0199326 | |||
| 1612 | Ga0495600_0007449 | |||
| 1613 | Ga0495600_0010608 | |||
| 1614 | Ga0495600_0045771 | |||
| 1615 | Ga0495600_0214310 | |||
| 1616 | Ga0495581_0005138 | |||
| 1617 | Ga0495581_0006345 | |||
| 1618 | Ga0495581_0130303 | |||
| 1619 | Ga0495581_0509242 | |||
| 1620 | Ga0495604_0048972 | |||
| 1621 | Ga0495604_0064605 | |||
| 1622 | Ga0495604_0227644 | |||
| 1623 | Ga0495604_0235189 | |||
| 1624 | Ga0495604_0250961 | |||
| 1625 | Ga0495636_0209240 | |||
| 1626 | Ga0495674_0002797 | |||
| 1627 | Ga0495674_0003374 | |||
| 1628 | Ga0495674_0006923 | |||
| 1629 | Ga0495674_0015365 | |||
| 1630 | Ga0495674_0031023 | |||
| 1631 | Ga0495674_0052872 | |||
| 1632 | Ga0495674_0115619 | |||
| 1633 | Ga0495674_0255937 | |||
| 1634 | Ga0495674_0309676 | |||
| 1635 | Ga0495676_0024595 | |||
| 1636 | Ga0495676_0233709 | |||
| 1637 | Ga0495676_0265900 | |||
| 1638 | Ga0495680_0002943 | |||
| 1639 | Ga0495680_0003020 | |||
| 1640 | Ga0495680_0005552 | |||
| 1641 | Ga0495680_0006380 | |||
| 1642 | Ga0495680_0010108 | |||
| 1643 | Ga0495680_0087118 | |||
| 1644 | Ga0495680_0130376 | |||
| 1645 | Ga0495680_0206618 | |||
| 1646 | Ga0495680_0313277 | |||
| 1647 | Ga0495684_0000915 | |||
| 1648 | Ga0495684_0006939 | |||
| 1649 | Ga0495684_0015447 | |||
| 1650 | Ga0495684_0040989 | |||
| 1651 | Ga0495684_0044331 | |||
| 1652 | Ga0495684_0055030 | |||
| 1653 | Ga0495684_0124541 | |||
| 1654 | Ga0495684_0195894 | |||
| 1655 | Ga0495684_0407111 | |||
| 1656 | Ga0495593_0008349 | |||
| 1657 | Ga0495593_0014023 | |||
| 1658 | Ga0495593_0090993 | |||
| 1659 | Ga0495602_0008635 | |||
| 1660 | Ga0495602_0056120 | |||
| 1661 | Ga0495602_0079124 | |||
| 1662 | Ga0495602_0235246 | |||
| 1663 | Ga0495602_0331085 | |||
| 1664 | Ga0495602_0413555 | |||
| 1665 | Ga0495614_0030347 | |||
| 1666 | Ga0496100_0103906 | |||
| 1667 | Ga0496100_0304393 | |||
| 1668 | Ga0496101_0112744 | |||
| 1669 | Ga0496101_0247835 | |||
| 1670 | Ga0496102_0160930 | |||
| 1671 | Ga0496102_0182781 | |||
| 1672 | Ga0496102_0223224 | |||
| 1673 | Ga0496102_0393851 | |||
| 1674 | Ga0496103_0123608 | |||
| 1675 | Ga0496103_0371394 | |||
| 1676 | Ga0496103_0574263 | |||
| 1677 | Ga0496104_0025698 | |||
| 1678 | Ga0496104_0079398 | |||
| 1679 | Ga0496104_0085966 | |||
| 1680 | Ga0496104_0168196 | |||
| 1681 | Ga0496105_0041197 | |||
| 1682 | Ga0496105_0047238 | |||
| 1683 | Ga0496105_0111512 | |||
| 1684 | Ga0496105_0159954 | |||
| 1685 | Ga0496106_0031933 | |||
| 1686 | Ga0496106_0032857 | |||
| 1687 | Ga0496107_0051184 | |||
| 1688 | Ga0496107_0250083 | |||
| 1689 | Ga0496107_0277263 | |||
| 1690 | Ga0496107_0760732 | |||
| 1691 | Ga0496108_0033292 | |||
| 1692 | Ga0496108_0048955 | |||
| 1693 | Ga0496108_0057877 | |||
| 1694 | Ga0496108_0110283 | |||
| 1695 | Ga0496108_0223298 | |||
| 1696 | Ga0496108_0264927 | |||
| 1697 | Ga0496109_0024758 | |||
| 1698 | Ga0496109_0083299 | |||
| 1699 | Ga0496109_0332079 | |||
| 1700 | Ga0496109_1194369 | |||
| 1701 | Ga0496110_0162245 | |||
| 1702 | Ga0496110_0772134 | |||
| 1703 | Ga0496110_0778538 | |||
| 1704 | Ga0496111_0064002 | |||
| 1705 | Ga0496111_0167767 | |||
| 1706 | Ga0496111_0263970 | |||
| 1707 | Ga0496112_0000328 | |||
| 1708 | Ga0496112_0021304 | |||
| 1709 | Ga0496112_0089774 | |||
| 1710 | Ga0496112_0116673 | |||
| 1711 | Ga0496112_0120883 | |||
| 1712 | Ga0496112_0123159 | |||
| 1713 | Ga0496112_0516203 | |||
| 1714 | Ga0496112_0683724 | |||
| 1715 | Ga0496113_0064473 | |||
| 1716 | Ga0496113_0093846 | |||
| 1717 | Ga0496113_0151681 | |||
| 1718 | Ga0496113_0162772 | |||
| 1719 | Ga0496113_0182816 | |||
| 1720 | Ga0496114_0072777 | |||
| 1721 | Ga0496114_0207471 | |||
| 1722 | Ga0496114_0238602 | |||
| 1723 | Ga0496114_0315461 | |||
| 1724 | Ga0496114_0558019 | |||
| 1725 | Ga0496115_0021773 | |||
| 1726 | Ga0496115_0174141 | |||
| 1727 | Ga0496115_0319389 | |||
| 1728 | nmdc:mga05p37_1281728_c1 | |||
| 1729 | nmdc:mga05p37_42625_c1 | |||
| 1730 | nmdc:mga09592_26309_c1 | |||
| 1731 | nmdc:mga06r32_1030367_c1 | |||
| 1732 | nmdc:mga06r32_415213_c1 | |||
| 1733 | nmdc:mga08y16_26715_c1 | |||
| 1734 | nmdc:mga08y16_509699_c1 | |||
| 1735 | nmdc:mga0n895_140388_c1 | |||
| 1736 | nmdc:mga0n895_180761_c1 | |||
| 1737 | nmdc:mga0n895_213402_c1 | |||
| 1738 | nmdc:mga0n895_213880_c1 | |||
| 1739 | nmdc:mga0n895_24667_c1 | |||
| 1740 | nmdc:mga0n895_366558_c1 | |||
| 1741 | nmdc:mga0n895_705600_c1 | |||
| 1742 | nmdc:mga0n895_790197_c1 | |||
| 1743 | nmdc:mga0rr50_17860_c1 | |||
| 1744 | nmdc:mga0rr50_478945_c1 | |||
| 1745 | nmdc:mga0rr50_545042_c1 | |||
| 1746 | nmdc:mga0rr50_59115_c1 | |||
| 1747 | nmdc:mga08x19_224595_c2 | |||
| 1748 | nmdc:mga08x19_310175_c1 | |||
| 1749 | nmdc:mga08x19_520372_c1 | |||
| 1750 | nmdc:mga08x19_54446_c1 | |||
| 1751 | nmdc:mga08x19_75135_c1 | |||
| 1752 | nmdc:mga0a205_137506_c1 | |||
| 1753 | nmdc:mga0a205_274415_c1 | |||
| 1754 | nmdc:mga0a205_310257_c1 | |||
| 1755 | nmdc:mga0a205_6050_c1 | |||
| 1756 | Ga0495601_0017677 | |||
| 1757 | Ga0495601_0023343 | |||
| 1758 | Ga0495601_0099190 | |||
| 1759 | Ga0495601_0331464 | |||
| 1760 | Ga0495601_0461011 | |||
| 1761 | Ga0495612_0025789 | |||
| 1762 | Ga0495612_0030294 | |||
| 1763 | Ga0495612_0062116 | |||
| 1764 | Ga0495612_0066462 | |||
| 1765 | Ga0495612_0102042 | |||
| 1766 | Ga0495655_0129306 | |||
| 1767 | Ga0495619_0008575 | |||
| 1768 | Ga0495619_0027404 | |||
| 1769 | Ga0495619_0227145 | |||
| 1770 | 2676483792 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2g40-assembly1.cif.gz_A-2 | crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution | 0.6891 | 12 | 202 |
| 2g40-assembly1.cif.gz_A-2 | crystal structure of a duf162 family protein (dr_1909) from deinococcus radiodurans at 1.70 a resolution | 0.6814 | 12 | 202 |
| 5yfj-assembly1.cif.gz_A | crystal structure of ribose-1,5-bisphosphate isomerase from pyrococcus horikoshii ot3 in complex with ribulose-1,5-bisphosphate | 0.6402 | 39 | 152 |
| 6j1k-assembly1.cif.gz_B | crystal structure of ribose-5-phosphate isomerase a from ochrobactrum sp. csl1 | 0.6373 | 39 | 154 |
| 5b04-assembly1.cif.gz_H | crystal structure of the eukaryotic translation initiation factor 2b from schizosaccharomyces pombe | 0.6282 | 42 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9BI24_30_213_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9372 | 20 | 202 | 3.40.50.10420 |
| af_Q9BI24_30_213_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.9275 | 20 | 202 | 3.40.50.10420 |
| 2g40A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.6891 | 12 | 202 | 3.40.50.10420 |
| 2g40A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.6814 | 12 | 202 | 3.40.50.10420 |
| af_P0AC28_1_181_3.40.50.10420 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like | 0.6621 | 107 | 154 | 3.40.50.10420 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H3UG36-F1-model_v4 | Uncharacterized ACR, YkgG family COG1556 | 0.9817 | 12 | 208 |
|
| AF-A0A1H3UG36-F1-model_v4 | Uncharacterized ACR, YkgG family COG1556 | 0.9768 | 12 | 208 |
|
| AF-A0A536LJK3-F1-model_v4 | LUD domain-containing protein | 0.9753 | 9 | 208 |
|
| AF-A0A536APJ8-F1-model_v4 | LUD domain-containing protein | 0.9751 | 5 | 208 |
|
| AF-A0A536MI73-F1-model_v4 | LUD domain-containing protein | 0.9743 | 24 | 208 |
|