F484528

General Info

Members Datasets Scaffolds Average Seq Length
881 306 1762 179

Family's Representative Sequence

Representative Sequence 3300025912|Ga0207707_10383398|Ga0207707_103833982
Length 214
Sequence MNGKHGTNAEMKRPGIIERVTRETTVRVELTRGTGTASVSTGLPFLDHMLTTFARYAALDLSVSAQGDLRHHIIEDVAITVGAALAEIVPACAARYGERVIPMDDALVQVALDLGGRPYYRGPLPSSLYEHWMRSFSDNAKATLHVRVLRGRDRHHVVEAAFKALGLAVRQALVEGDAVFSTKGAVRGSGLGTRXXXTPRAVPESRAPSPEDPC

Samples

Sample ID Description Type Environment
1 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
104 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
119 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
195 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
196 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
217 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
218 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
219 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
220 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
221 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
222 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
223 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
224 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
236 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
237 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
238 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
247 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
248 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
253 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
262 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
263 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
264 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
283 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
284 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
287 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
288 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
303 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
304 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
305 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.11
Nodule 0
Rhizoplane 2.27
Rhizosphere 97.39
Stem 0
Stem Tuber 0
Unclassified 8.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207707_10383398 3300025912 Bacteria 1208
2 Ga0065712_10088664 3300005290 Bacteria 2508
3 Ga0065715_10144245 3300005293 Bacteria 1810
4 Ga0065707_10092615 3300005295 Bacteria 3744
5 Ga0070658_10011734 3300005327 Bacteria 7029
6 Ga0070658_10016236 3300005327 Bacteria 5958
7 Ga0070658_10017610 3300005327 Bacteria 5714
8 Ga0070658_10072200 3300005327 Bacteria 2828
9 Ga0070658_10181125 3300005327 Bacteria 1773
10 Ga0070658_10311687 3300005327 Bacteria 1343
11 Ga0070676_10000196 3300005328 Bacteria 25358
12 Ga0070676_10135933 3300005328 Bacteria 1560
13 Ga0070683_100001031 3300005329 Bacteria 20906
14 Ga0070683_100002551 3300005329 Bacteria 14543
15 Ga0070683_100008332 3300005329 Bacteria 8808
16 Ga0070683_100010700 3300005329 Bacteria 7888
17 Ga0070683_100011398 3300005329 Bacteria 7685
18 Ga0070683_100033293 3300005329 Bacteria 4699
19 Ga0070683_100037429 3300005329 Bacteria 4441
20 Ga0070683_100058098 3300005329 Bacteria 3594
21 Ga0070683_100268721 3300005329 Archaea 1622
22 Ga0070690_100024197 3300005330 Bacteria 3733
23 Ga0070690_100043358 3300005330 Bacteria 2853
24 Ga0070690_100122519 3300005330 Bacteria 1747
25 Ga0070670_100014831 3300005331 Bacteria 6682
26 Ga0070670_100043812 3300005331 Unclassified 3846
27 Ga0070670_100108277 3300005331 Bacteria 2394
28 Ga0070670_100337479 3300005331 Bacteria 1322
29 Ga0070670_101004109 3300005331 Bacteria 759
30 Ga0070677_10014232 3300005333 Bacteria 2797
31 Ga0068869_100002544 3300005334 Bacteria 11008
32 Ga0070666_10052076 3300005335 Bacteria 2758
33 Ga0070666_10090382 3300005335 Unclassified 2103
34 Ga0070666_10149691 3300005335 Bacteria 1628
35 Ga0070666_10157663 3300005335 Bacteria 1585
36 Ga0070666_10311078 3300005335 Unclassified 1123
37 Ga0070680_100003258 3300005336 Bacteria 12092
38 Ga0070680_100008374 3300005336 Bacteria 7919
39 Ga0070680_100010093 3300005336 Bacteria 7277
40 Ga0070680_100066800 3300005336 Bacteria 2949
41 Ga0070680_100183829 3300005336 Bacteria 1761
42 Ga0070680_100197398 3300005336 Bacteria 1696
43 Ga0070680_100655875 3300005336 Bacteria 902
44 Ga0070682_100146049 3300005337 Bacteria 1618
45 Ga0070682_100249847 3300005337 Bacteria 1278
46 Ga0070682_100284134 3300005337 Bacteria 1207
47 Ga0070682_100329911 3300005337 Bacteria 1130
48 Ga0070682_100464870 3300005337 Bacteria 972
49 Ga0070682_100679847 3300005337 Bacteria 823
50 Ga0068868_100003976 3300005338 Bacteria 10318
51 Ga0068868_100654132 3300005338 Unclassified 936
52 Ga0070660_100006178 3300005339 Bacteria 8287
53 Ga0070660_100011888 3300005339 Bacteria 6207
54 Ga0070660_100018959 3300005339 Bacteria 5037
55 Ga0070660_100098347 3300005339 Bacteria 2316
56 Ga0070660_100099186 3300005339 Bacteria 2306
57 Ga0070660_100127772 3300005339 Bacteria 2032
58 Ga0070660_100153072 3300005339 Bacteria 1855
59 Ga0070660_100193885 3300005339 Bacteria 1646
60 Ga0070660_100227738 3300005339 Bacteria 1516
61 Ga0070660_100259991 3300005339 Bacteria 1417
62 Ga0070660_100777609 3300005339 Bacteria 805
63 Ga0070689_100007718 3300005340 Bacteria 7538
64 Ga0070689_100025701 3300005340 Bacteria 4426
65 Ga0070687_100002491 3300005343 Bacteria 6932
66 Ga0070687_100285518 3300005343 Bacteria 1041
67 Ga0070661_100008461 3300005344 Bacteria 7117
68 Ga0070661_100015259 3300005344 Bacteria 5421
69 Ga0070661_100020255 3300005344 Bacteria 4741
70 Ga0070661_100031819 3300005344 Bacteria 3816
71 Ga0070661_100044122 3300005344 Bacteria 3257
72 Ga0070661_100077508 3300005344 Bacteria 2450
73 Ga0070661_100265522 3300005344 Bacteria 1328
74 Ga0070661_100319504 3300005344 Bacteria 1212
75 Ga0070661_101141322 3300005344 Unclassified 650
76 Ga0070692_10014444 3300005345 Bacteria 3710
77 Ga0070692_10137356 3300005345 Bacteria 1380
78 Ga0070692_10239573 3300005345 Bacteria 1081
79 Ga0070668_100000199 3300005347 Bacteria 39363
80 Ga0070668_100002845 3300005347 Bacteria 12748
81 Ga0070668_100006132 3300005347 Bacteria 8915
82 Ga0070668_100043340 3300005347 Bacteria 3451
83 Ga0070669_100000234 3300005353 Bacteria 46372
84 Ga0070669_100001776 3300005353 Bacteria 15532
85 Ga0070669_100005249 3300005353 Bacteria 9352
86 Ga0070669_100122948 3300005353 Bacteria 1983
87 Ga0070669_100304886 3300005353 Bacteria 1282
88 Ga0070675_100000355 3300005354 Bacteria 30985
89 Ga0070675_100000950 3300005354 Bacteria 20666
90 Ga0070671_100141698 3300005355 Bacteria 2029
91 Ga0070671_100192071 3300005355 Bacteria 1730
92 Ga0070671_100290821 3300005355 Bacteria 1390
93 Ga0070671_100308817 3300005355 Bacteria 1347
94 Ga0070674_100120721 3300005356 Bacteria 1940
95 Ga0070674_100216492 3300005356 Unclassified 1488
96 Ga0070673_100047740 3300005364 Bacteria 3333
97 Ga0070673_100096523 3300005364 Bacteria 2426
98 Ga0070673_100578335 3300005364 Bacteria 1023
99 Ga0070688_100001683 3300005365 Bacteria 11041
100 Ga0070688_100037996 3300005365 Bacteria 2937
101 Ga0070688_100711657 3300005365 Bacteria 779
102 Ga0070659_100002708 3300005366 Bacteria 12595
103 Ga0070659_100005359 3300005366 Bacteria 9205
104 Ga0070659_100009737 3300005366 Bacteria 7060
105 Ga0070659_100011752 3300005366 Bacteria 6481
106 Ga0070659_100013241 3300005366 Bacteria 6134
107 Ga0070659_100053227 3300005366 Bacteria 3185
108 Ga0070659_100053634 3300005366 Bacteria 3174
109 Ga0070659_100278885 3300005366 Bacteria 1390
110 Ga0070659_100701713 3300005366 Bacteria 875
111 Ga0070659_100802512 3300005366 Bacteria 819
112 Ga0070667_100100974 3300005367 Bacteria 2492
113 Ga0070667_100163514 3300005367 Bacteria 1962
114 Ga0070667_100245585 3300005367 Bacteria 1599
115 Ga0070703_10297661 3300005406 Unclassified 671
116 Ga0070709_10005765 3300005434 Bacteria 6718
117 Ga0070709_10226254 3300005434 Unclassified 1336
118 Ga0070714_100000513 3300005435 Bacteria 28062
119 Ga0070714_100005882 3300005435 Bacteria 9412
120 Ga0070714_100037225 3300005435 Bacteria 4087
121 Ga0070713_100004887 3300005436 Bacteria 9096
122 Ga0070713_100216025 3300005436 Unclassified 1738
123 Ga0070713_100603245 3300005436 Bacteria 1043
124 Ga0070701_10001150 3300005438 Bacteria 9663
125 Ga0070701_10019866 3300005438 Bacteria 3179
126 Ga0070701_10068539 3300005438 Bacteria 1890
127 Ga0070701_10177610 3300005438 Bacteria 1244
128 Ga0070700_100093954 3300005441 Bacteria 1963
129 Ga0070694_100167646 3300005444 Bacteria 1616
130 Ga0070694_100180321 3300005444 Bacteria 1562
131 Ga0070708_100195390 3300005445 Bacteria 1893
132 Ga0070663_100007679 3300005455 Bacteria 6584
133 Ga0070663_100010389 3300005455 Bacteria 5802
134 Ga0070663_100117919 3300005455 Bacteria 2002
135 Ga0070663_100192403 3300005455 Bacteria 1588
136 Ga0070663_100435254 3300005455 Bacteria 1078
137 Ga0070662_100006287 3300005457 Bacteria 7649
138 Ga0070662_100213350 3300005457 Archaea 1537
139 Ga0070662_100470089 3300005457 Bacteria 1046
140 Ga0070662_100810864 3300005457 Unclassified 796
141 Ga0070681_10000126 3300005458 Bacteria 57455
142 Ga0070681_10010495 3300005458 Bacteria 9147
143 Ga0070681_10012859 3300005458 Bacteria 8311
144 Ga0070681_10028013 3300005458 Bacteria 5664
145 Ga0070681_10029537 3300005458 Bacteria 5505
146 Ga0070681_10033622 3300005458 Bacteria 5147
147 Ga0070681_10120090 3300005458 Bacteria 2564
148 Ga0070681_10122911 3300005458 Bacteria 2528
149 Ga0070681_10154465 3300005458 Bacteria 2221
150 Ga0070681_10156034 3300005458 Bacteria 2207
151 Ga0070681_10294884 3300005458 Unclassified 1531
152 Ga0070681_10543911 3300005458 Bacteria 1075
153 Ga0070681_11028266 3300005458 Bacteria 744
154 Ga0068867_100007866 3300005459 Bacteria 7534
155 Ga0068867_100093562 3300005459 Bacteria 2285
156 Ga0068867_100559432 3300005459 Bacteria 992
157 Ga0070685_10012542 3300005466 Bacteria 4456
158 Ga0070685_10016174 3300005466 Bacteria 3971
159 Ga0070706_100000192 3300005467 Bacteria 76632
160 Ga0070706_100030140 3300005467 Bacteria 4997
161 Ga0070706_100460979 3300005467 Bacteria 1183
162 Ga0070707_100003482 3300005468 Bacteria 14854
163 Ga0070707_100171654 3300005468 Bacteria 2113
164 Ga0070707_100607279 3300005468 Bacteria 1056
165 Ga0070698_100006912 3300005471 Bacteria 12300
166 Ga0070698_100025012 3300005471 Bacteria 6224
167 Ga0070698_100240954 3300005471 Bacteria 1742
168 Ga0070698_100255770 3300005471 Bacteria 1684
169 Ga0070698_100616812 3300005471 Bacteria 1025
170 Ga0070699_100003327 3300005518 Bacteria 14214
171 Ga0070699_100103221 3300005518 Bacteria 2500
172 Ga0070699_100302638 3300005518 Bacteria 1435
173 Ga0070699_100442131 3300005518 Bacteria 1178
174 Ga0070679_100003236 3300005530 Bacteria 14879
175 Ga0070679_100003664 3300005530 Bacteria 14065
176 Ga0070679_100010605 3300005530 Bacteria 8746
177 Ga0070679_100011246 3300005530 Bacteria 8531
178 Ga0070679_100036982 3300005530 Bacteria 4847
179 Ga0070679_100169093 3300005530 Bacteria 2159
180 Ga0070679_100230184 3300005530 Bacteria 1813
181 Ga0070679_100299288 3300005530 Bacteria 1559
182 Ga0070679_100359879 3300005530 Bacteria 1402
183 Ga0070679_100962859 3300005530 Unclassified 797
184 Ga0070684_100003014 3300005535 Bacteria 12541
185 Ga0070684_100004678 3300005535 Bacteria 10450
186 Ga0070684_100005365 3300005535 Bacteria 9827
187 Ga0070684_100008147 3300005535 Bacteria 8181
188 Ga0070684_100054008 3300005535 Bacteria 3500
189 Ga0070684_100082255 3300005535 Bacteria 2851
190 Ga0070684_100102117 3300005535 Bacteria 2563
191 Ga0070684_100110487 3300005535 Bacteria 2465
192 Ga0070684_100300628 3300005535 Bacteria 1473
193 Ga0070697_100005208 3300005536 Bacteria 9992
194 Ga0070697_100284447 3300005536 Bacteria 1419
195 Ga0068853_100003265 3300005539 Bacteria 12398
196 Ga0068853_100010911 3300005539 Bacteria 7363
197 Ga0068853_100030870 3300005539 Bacteria 4528
198 Ga0068853_100341231 3300005539 Bacteria 1392
199 Ga0068853_100359844 3300005539 Bacteria 1355
200 Ga0068853_100438828 3300005539 Bacteria 1227
201 Ga0068853_100756666 3300005539 Bacteria 929
202 Ga0070672_100007834 3300005543 Bacteria 7287
203 Ga0070672_100007861 3300005543 Bacteria 7278
204 Ga0070672_100009780 3300005543 Bacteria 6624
205 Ga0070672_100101228 3300005543 Bacteria 2337
206 Ga0070672_100135368 3300005543 Bacteria 2029
207 Ga0070686_100163330 3300005544 Unclassified 1570
208 Ga0070686_100667792 3300005544 Bacteria 826
209 Ga0070696_100037138 3300005546 Bacteria 3359
210 Ga0070696_100623590 3300005546 Bacteria 872
211 Ga0070693_100012798 3300005547 Bacteria 4256
212 Ga0070693_100028246 3300005547 Bacteria 3049
213 Ga0070665_100105848 3300005548 Bacteria 2815
214 Ga0070704_100081134 3300005549 Bacteria 2388
215 Ga0068855_100000968 3300005563 Bacteria 35743
216 Ga0068855_100016696 3300005563 Bacteria 8829
217 Ga0068855_100017646 3300005563 Bacteria 8582
218 Ga0068855_100045629 3300005563 Bacteria 5183
219 Ga0068855_100054223 3300005563 Bacteria 4712
220 Ga0068855_100146358 3300005563 Bacteria 2689
221 Ga0068855_100280646 3300005563 Bacteria 1850
222 Ga0068855_100383600 3300005563 Bacteria 1542
223 Ga0070664_100001429 3300005564 Bacteria 19051
224 Ga0070664_100001585 3300005564 Bacteria 18174
225 Ga0070664_100007954 3300005564 Bacteria 8566
226 Ga0070664_100008295 3300005564 Bacteria 8403
227 Ga0070664_100013259 3300005564 Bacteria 6714
228 Ga0070664_100048593 3300005564 Bacteria 3585
229 Ga0070664_100122007 3300005564 Bacteria 2283
230 Ga0070664_100157424 3300005564 Unclassified 2008
231 Ga0070664_100310860 3300005564 Bacteria 1426
232 Ga0068857_100001670 3300005577 Bacteria 17822
233 Ga0068857_100003207 3300005577 Bacteria 13565
234 Ga0068857_100011217 3300005577 Bacteria 7794
235 Ga0068857_100076009 3300005577 Bacteria 2994
236 Ga0068857_101679818 3300005577 Bacteria 621
237 Ga0068854_100008058 3300005578 Bacteria 6752
238 Ga0068854_100093710 3300005578 Bacteria 2239
239 Ga0068854_100137552 3300005578 Bacteria 1871
240 Ga0068854_100139620 3300005578 Bacteria 1858
241 Ga0068856_100013189 3300005614 Bacteria 8004
242 Ga0070702_100126332 3300005615 Unclassified 1609
243 Ga0068852_100001587 3300005616 Bacteria 15455
244 Ga0068852_100029920 3300005616 Bacteria 4478
245 Ga0068852_100112922 3300005616 Bacteria 2473
246 Ga0068852_100377114 3300005616 Bacteria 1391
247 Ga0068852_100873570 3300005616 Bacteria 916
248 Ga0068859_100009934 3300005617 Bacteria 9603
249 Ga0068859_100061485 3300005617 Bacteria 3784
250 Ga0068864_100101919 3300005618 Bacteria 2547
251 Ga0068864_100195495 3300005618 Bacteria 1856
252 Ga0068864_100293664 3300005618 Unclassified 1520
253 Ga0068866_10021412 3300005718 Unclassified 2978
254 Ga0068866_10118322 3300005718 Bacteria 1489
255 Ga0068861_100000050 3300005719 Bacteria 54921
256 Ga0068861_100620264 3300005719 Bacteria 995
257 Ga0068861_100623804 3300005719 Bacteria 992
258 Ga0068861_100637942 3300005719 Bacteria 982
259 Ga0068851_10005441 3300005834 Bacteria 5775
260 Ga0068851_10038973 3300005834 Bacteria 2386
261 Ga0068851_10172903 3300005834 Bacteria 1193
262 Ga0068870_10008419 3300005840 Bacteria 4639
263 Ga0068870_10008513 3300005840 Bacteria 4619
264 Ga0068870_10194466 3300005840 Unclassified 1226
265 Ga0068863_100011897 3300005841 Bacteria 8409
266 Ga0068863_100141181 3300005841 Bacteria 2302
267 Ga0068863_101688565 3300005841 Bacteria 643
268 Ga0068858_100020400 3300005842 Bacteria 6197
269 Ga0068858_100059849 3300005842 Bacteria 3521
270 Ga0068860_100041629 3300005843 Bacteria 4388
271 Ga0068860_100070525 3300005843 Bacteria 3322
272 Ga0068860_100339752 3300005843 Bacteria 1476
273 Ga0068860_101207434 3300005843 Unclassified 776
274 Ga0068862_100001155 3300005844 Bacteria 24966
275 Ga0068862_100002486 3300005844 Bacteria 16308
276 Ga0068862_100032965 3300005844 Bacteria 4375
277 Ga0068862_100141831 3300005844 Bacteria 2133
278 Ga0081539_10013920 3300005985 Bacteria 6007
279 Ga0070717_10003484 3300006028 Bacteria 11272
280 Ga0070717_10067254 3300006028 Unclassified 2981
281 Ga0070717_10111900 3300006028 Bacteria 2330
282 Ga0070717_10144984 3300006028 Bacteria 2050
283 Ga0070717_10166785 3300006028 Bacteria 1913
284 Ga0070712_100003320 3300006175 Bacteria 9894
285 Ga0097621_100240512 3300006237 Unclassified 1582
286 Ga0097621_100576779 3300006237 Bacteria 1026
287 Ga0068871_100898443 3300006358 Unclassified 821
288 Ga0068871_101056278 3300006358 Bacteria 758
289 Ga0075428_100230234 3300006844 Bacteria 2000
290 Ga0075428_100607302 3300006844 Bacteria 1168
291 Ga0075430_100001111 3300006846 Bacteria 21393
292 Ga0075430_100002336 3300006846 Bacteria 15762
293 Ga0075430_100044799 3300006846 Bacteria 3739
294 Ga0075430_100075700 3300006846 Bacteria 2822
295 Ga0075430_100342744 3300006846 Bacteria 1234
296 Ga0075430_100714316 3300006846 Bacteria 826
297 Ga0075430_101066714 3300006846 Bacteria 665
298 Ga0075430_101066715 3300006846 Bacteria 665
299 Ga0075431_100013223 3300006847 Bacteria 8337
300 Ga0075431_100067930 3300006847 Bacteria 3679
301 Ga0075431_100134149 3300006847 Unclassified 2552
302 Ga0075431_100151138 3300006847 Bacteria 2391
303 Ga0075431_100399224 3300006847 Bacteria 1376
304 Ga0075431_100490362 3300006847 Bacteria 1221
305 Ga0075433_10000919 3300006852 Bacteria 20725
306 Ga0075433_10090074 3300006852 Bacteria 2711
307 Ga0075433_10481104 3300006852 Unclassified 1094
308 Ga0075433_10905655 3300006852 Bacteria 769
309 Ga0075434_100002429 3300006871 Bacteria 16375
310 Ga0075434_100004446 3300006871 Bacteria 12639
311 Ga0075434_100051562 3300006871 Bacteria 4089
312 Ga0075434_100070883 3300006871 Bacteria 3476
313 Ga0075429_100059129 3300006880 Bacteria 3339
314 Ga0075429_100451496 3300006880 Bacteria 1126
315 Ga0075429_100914278 3300006880 Unclassified 768
316 Ga0068865_100001898 3300006881 Bacteria 12287
317 Ga0068865_100136086 3300006881 Bacteria 1847
318 Ga0068865_100264875 3300006881 Bacteria 1362
319 Ga0075436_100014406 3300006914 Bacteria 5414
320 Ga0075436_100074417 3300006914 Bacteria 2351
321 Ga0075436_100300673 3300006914 Bacteria 1150
322 Ga0075436_100679414 3300006914 Unclassified 762
323 Ga0097620_100009934 3300006931 Bacteria 9603
324 Ga0097620_100061485 3300006931 Bacteria 3784
325 Ga0105240_10000835 3300009093 Bacteria 55504
326 Ga0105240_10026045 3300009093 Bacteria 7679
327 Ga0105240_10032108 3300009093 Bacteria 6800
328 Ga0105240_10041242 3300009093 Bacteria 5893
329 Ga0105240_10044704 3300009093 Bacteria 5625
330 Ga0105240_10072856 3300009093 Bacteria 4244
331 Ga0105240_10132109 3300009093 Bacteria 2994
332 Ga0105240_10552684 3300009093 Bacteria 1274
333 Ga0105240_10802187 3300009093 Bacteria 1020
334 Ga0111539_10102993 3300009094 Bacteria 3350
335 Ga0111539_10347525 3300009094 Bacteria 1726
336 Ga0111539_10398986 3300009094 Bacteria 1602
337 Ga0105245_10059902 3300009098 Unclassified 3429
338 Ga0114129_10184713 3300009147 Bacteria 2835
339 Ga0105243_10372617 3300009148 Bacteria 1318
340 Ga0105243_10389156 3300009148 Bacteria 1292
341 Ga0105241_10161237 3300009174 Bacteria 1843
342 Ga0105241_10483062 3300009174 Bacteria 1101
343 Ga0105241_10812266 3300009174 Bacteria 862
344 Ga0105242_10001625 3300009176 Bacteria 17717
345 Ga0105242_10004199 3300009176 Bacteria 11227
346 Ga0105242_10025244 3300009176 Bacteria 4701
347 Ga0105248_10116199 3300009177 Bacteria 3017
348 Ga0105248_10163534 3300009177 Bacteria 2509
349 Ga0105248_10281417 3300009177 Bacteria 1873
350 Ga0105248_10412475 3300009177 Bacteria 1521
351 Ga0105237_10091117 3300009545 Bacteria 3038
352 Ga0105237_10213160 3300009545 Bacteria 1931
353 Ga0105237_10330639 3300009545 Bacteria 1528
354 Ga0105237_10950908 3300009545 Unclassified 866
355 Ga0105238_10013842 3300009551 Bacteria 8154
356 Ga0105238_10016877 3300009551 Bacteria 7406
357 Ga0105238_10395378 3300009551 Bacteria 1375
358 Ga0105238_10715187 3300009551 Unclassified 1014
359 Ga0105249_10000009 3300009553 Bacteria 313866
360 Ga0105249_10000188 3300009553 Bacteria 71137
361 Ga0105249_10071346 3300009553 Bacteria 3208
362 Ga0105239_10021125 3300010375 Bacteria 7182
363 Ga0105246_10638305 3300011119 Unclassified 925
364 Ga0157373_10004057 3300013100 Bacteria 11034
365 Ga0157373_10004069 3300013100 Bacteria 11019
366 Ga0157373_10215824 3300013100 Bacteria 1353
367 Ga0157371_10010420 3300013102 Bacteria 7242
368 Ga0157371_10030880 3300013102 Bacteria 3861
369 Ga0157371_10085854 3300013102 Bacteria 2229
370 Ga0157371_10383734 3300013102 Bacteria 1026
371 Ga0157371_10841503 3300013102 Bacteria 693
372 Ga0157370_10004376 3300013104 Bacteria 16218
373 Ga0157370_10006346 3300013104 Bacteria 13060
374 Ga0157370_10007271 3300013104 Bacteria 12086
375 Ga0157370_10092744 3300013104 Bacteria 2834
376 Ga0157370_10111636 3300013104 Bacteria 2555
377 Ga0157370_10141866 3300013104 Bacteria 2238
378 Ga0157370_10370871 3300013104 Bacteria 1319
379 Ga0157369_10005215 3300013105 Bacteria 15176
380 Ga0157369_10007252 3300013105 Bacteria 12762
381 Ga0157369_10020702 3300013105 Bacteria 7354
382 Ga0157369_10079621 3300013105 Bacteria 3509
383 Ga0157369_10084026 3300013105 Bacteria 3404
384 Ga0157369_10706913 3300013105 Bacteria 1038
385 Ga0157369_10875466 3300013105 Bacteria 922
386 Ga0157369_11319176 3300013105 Bacteria 735
387 Ga0157374_10302123 3300013296 Bacteria 1583
388 Ga0157378_10005279 3300013297 Bacteria 11345
389 Ga0157378_10037287 3300013297 Bacteria 4305
390 Ga0157378_10259628 3300013297 Bacteria 1666
391 Ga0157378_10341616 3300013297 Bacteria 1460
392 Ga0163162_10006838 3300013306 Bacteria 11066
393 Ga0163162_10027705 3300013306 Bacteria 5604
394 Ga0163162_11221113 3300013306 Bacteria 853
395 Ga0163162_11909209 3300013306 Unclassified 680
396 Ga0157372_10003316 3300013307 Bacteria 17392
397 Ga0157372_10010118 3300013307 Bacteria 10020
398 Ga0157372_10013215 3300013307 Bacteria 8810
399 Ga0157372_10015746 3300013307 Bacteria 8109
400 Ga0157372_10021601 3300013307 Bacteria 6955
401 Ga0157372_10023983 3300013307 Bacteria 6619
402 Ga0157372_10046904 3300013307 Bacteria 4798
403 Ga0157372_10077175 3300013307 Bacteria 3762
404 Ga0157372_10130090 3300013307 Bacteria 2896
405 Ga0157372_10173622 3300013307 Bacteria 2494
406 Ga0157372_10176904 3300013307 Bacteria 2470
407 Ga0157372_10229368 3300013307 Bacteria 2153
408 Ga0157372_10242159 3300013307 Bacteria 2093
409 Ga0157372_10321487 3300013307 Bacteria 1802
410 Ga0157372_11605070 3300013307 Bacteria 749
411 Ga0157375_10009807 3300013308 Bacteria 8419
412 Ga0157375_10016080 3300013308 Bacteria 6712
413 Ga0157375_10040269 3300013308 Bacteria 4503
414 Ga0157375_10046290 3300013308 Bacteria 4239
415 Ga0157375_10113476 3300013308 Bacteria 2811
416 Ga0157375_10239409 3300013308 Unclassified 1974
417 Ga0157375_11592208 3300013308 Unclassified 772
418 Ga0157380_10002402 3300014326 Bacteria 12592
419 Ga0157380_10005780 3300014326 Bacteria 8657
420 Ga0157380_10616273 3300014326 Bacteria 1076
421 Ga0182008_10001362 3300014497 Bacteria 16573
422 Ga0157377_10028374 3300014745 Bacteria 3012
423 Ga0157379_10176582 3300014968 Bacteria 1929
424 Ga0157379_10180275 3300014968 Bacteria 1908
425 Ga0157376_10401295 3300014969 Bacteria 1326
426 Ga0157376_10552089 3300014969 Bacteria 1140
427 Ga0182007_10080279 3300015262 Bacteria 1070
428 Ga0163161_10001550 3300017792 Bacteria 16975
429 Ga0163161_10020486 3300017792 Bacteria 4640
430 Ga0163161_10793631 3300017792 Unclassified 795
431 Ga0213876_10170600 3300021384 Bacteria 1157
432 Ga0207673_1010368 3300025290 Bacteria 1198
433 Ga0207697_10098149 3300025315 Bacteria 1247
434 Ga0207656_10010003 3300025321 Bacteria 3535
435 Ga0207656_10013133 3300025321 Bacteria 3160
436 Ga0207656_10059134 3300025321 Bacteria 1676
437 Ga0207656_10268202 3300025321 Bacteria 840
438 Ga0207692_10059154 3300025898 Bacteria 1978
439 Ga0207642_10242558 3300025899 Bacteria 1018
440 Ga0207688_10005659 3300025901 Bacteria 6796
441 Ga0207680_10040232 3300025903 Bacteria 2719
442 Ga0207680_10389134 3300025903 Bacteria 984
443 Ga0207680_10401293 3300025903 Bacteria 969
444 Ga0207680_10548477 3300025903 Unclassified 825
445 Ga0207647_10009723 3300025904 Bacteria 6822
446 Ga0207699_10009388 3300025906 Bacteria 4869
447 Ga0207699_10365276 3300025906 Unclassified 1022
448 Ga0207699_10620256 3300025906 Bacteria 788
449 Ga0207645_10000120 3300025907 Bacteria 59056
450 Ga0207645_10010380 3300025907 Bacteria 6393
451 Ga0207645_10106585 3300025907 Unclassified 1812
452 Ga0207645_10127464 3300025907 Bacteria 1655
453 Ga0207645_10246639 3300025907 Unclassified 1181
454 Ga0207645_10256122 3300025907 Bacteria 1159
455 Ga0207643_10004281 3300025908 Bacteria 7679
456 Ga0207643_10004529 3300025908 Bacteria 7473
457 Ga0207643_10171435 3300025908 Unclassified 1310
458 Ga0207705_10006991 3300025909 Bacteria 8330
459 Ga0207705_10009053 3300025909 Bacteria 7256
460 Ga0207705_10050165 3300025909 Bacteria 3004
461 Ga0207705_10062144 3300025909 Bacteria 2698
462 Ga0207684_10000021 3300025910 Bacteria 340887
463 Ga0207684_10025396 3300025910 Bacteria 5048
464 Ga0207654_10092556 3300025911 Bacteria 1846
465 Ga0207654_10502908 3300025911 Bacteria 856
466 Ga0207654_10677118 3300025911 Bacteria 740
467 Ga0207707_10000145 3300025912 Bacteria 73692
468 Ga0207707_10006698 3300025912 Bacteria 10055
469 Ga0207707_10007559 3300025912 Bacteria 9468
470 Ga0207707_10009051 3300025912 Bacteria 8651
471 Ga0207707_10100467 3300025912 Bacteria 2528
472 Ga0207707_10157365 3300025912 Bacteria 1987
473 Ga0207707_10162673 3300025912 Bacteria 1951
474 Ga0207707_10185846 3300025912 Unclassified 1814
475 Ga0207707_10215902 3300025912 Unclassified 1670
476 Ga0207707_10223392 3300025912 Bacteria 1639
477 Ga0207707_10309760 3300025912 Bacteria 1364
478 Ga0207707_10379887 3300025912 Bacteria 1214
479 Ga0207707_10764779 3300025912 Bacteria 807
480 Ga0207695_10001488 3300025913 Bacteria 39157
481 Ga0207695_10004282 3300025913 Bacteria 19576
482 Ga0207695_10005837 3300025913 Bacteria 16189
483 Ga0207695_10036507 3300025913 Bacteria 5313
484 Ga0207695_10044277 3300025913 Bacteria 4735
485 Ga0207695_10091688 3300025913 Bacteria 3052
486 Ga0207695_10094958 3300025913 Bacteria 2988
487 Ga0207695_10438675 3300025913 Unclassified 1189
488 Ga0207671_10401811 3300025914 Bacteria 1090
489 Ga0207671_10556972 3300025914 Bacteria 914
490 Ga0207693_10007116 3300025915 Bacteria 9227
491 Ga0207660_10001279 3300025917 Bacteria 16886
492 Ga0207660_10001980 3300025917 Bacteria 13654
493 Ga0207660_10010084 3300025917 Bacteria 6120
494 Ga0207660_10058886 3300025917 Bacteria 2756
495 Ga0207660_10113378 3300025917 Bacteria 2043
496 Ga0207660_10314488 3300025917 Bacteria 1249
497 Ga0207660_10593434 3300025917 Bacteria 902
498 Ga0207662_10002650 3300025918 Bacteria 9026
499 Ga0207662_10010448 3300025918 Bacteria 5126
500 Ga0207657_10000322 3300025919 Bacteria 50910
501 Ga0207657_10006793 3300025919 Bacteria 11809
502 Ga0207657_10008298 3300025919 Bacteria 10567
503 Ga0207657_10082106 3300025919 Bacteria 2706
504 Ga0207657_10098580 3300025919 Bacteria 2428
505 Ga0207657_10103967 3300025919 Bacteria 2353
506 Ga0207657_10131201 3300025919 Bacteria 2053
507 Ga0207657_10151689 3300025919 Bacteria 1887
508 Ga0207657_10253355 3300025919 Bacteria 1402
509 Ga0207657_10552491 3300025919 Bacteria 900
510 Ga0207649_10002362 3300025920 Bacteria 10577
511 Ga0207649_10028278 3300025920 Bacteria 3300
512 Ga0207649_10054678 3300025920 Bacteria 2485
513 Ga0207649_10147452 3300025920 Bacteria 1617
514 Ga0207649_10189016 3300025920 Unclassified 1447
515 Ga0207652_10000247 3300025921 Bacteria 56128
516 Ga0207652_10001931 3300025921 Bacteria 17921
517 Ga0207652_10011717 3300025921 Bacteria 7076
518 Ga0207652_10015366 3300025921 Bacteria 6217
519 Ga0207652_10025880 3300025921 Bacteria 4882
520 Ga0207652_10049230 3300025921 Bacteria 3607
521 Ga0207652_10055092 3300025921 Bacteria 3419
522 Ga0207652_10075384 3300025921 Bacteria 2940
523 Ga0207652_10111092 3300025921 Bacteria 2431
524 Ga0207652_10265150 3300025921 Bacteria 1549
525 Ga0207646_10000449 3300025922 Bacteria 54972
526 Ga0207646_10217751 3300025922 Bacteria 1725
527 Ga0207646_10440516 3300025922 Bacteria 1176
528 Ga0207681_10000721 3300025923 Bacteria 21712
529 Ga0207681_10000724 3300025923 Bacteria 21669
530 Ga0207681_10001868 3300025923 Bacteria 13493
531 Ga0207681_10047425 3300025923 Bacteria 2895
532 Ga0207694_10007636 3300025924 Bacteria 8196
533 Ga0207694_10023119 3300025924 Bacteria 4719
534 Ga0207694_10346552 3300025924 Bacteria 1229
535 Ga0207650_10096147 3300025925 Unclassified 2272
536 Ga0207650_10185245 3300025925 Bacteria 1661
537 Ga0207650_10440379 3300025925 Bacteria 1083
538 Ga0207650_10533463 3300025925 Bacteria 983
539 Ga0207659_10002414 3300025926 Bacteria 11126
540 Ga0207659_10054612 3300025926 Unclassified 2853
541 Ga0207659_10511740 3300025926 Bacteria 1017
542 Ga0207687_10053478 3300025927 Unclassified 2821
543 Ga0207700_10080662 3300025928 Unclassified 2538
544 Ga0207700_10352018 3300025928 Unclassified 1283
545 Ga0207664_10000468 3300025929 Bacteria 28547
546 Ga0207664_10032411 3300025929 Bacteria 4004
547 Ga0207664_10034450 3300025929 Bacteria 3900
548 Ga0207644_10109679 3300025931 Bacteria 2085
549 Ga0207644_10123806 3300025931 Bacteria 1971
550 Ga0207644_10404526 3300025931 Bacteria 1116
551 Ga0207690_10009263 3300025932 Bacteria 5849
552 Ga0207690_10010348 3300025932 Bacteria 5539
553 Ga0207690_10120194 3300025932 Bacteria 1907
554 Ga0207690_10169579 3300025932 Bacteria 1634
555 Ga0207690_10243419 3300025932 Bacteria 1386
556 Ga0207706_10000083 3300025933 Bacteria 98149
557 Ga0207706_10060209 3300025933 Bacteria 3344
558 Ga0207706_10150632 3300025933 Bacteria 2046
559 Ga0207706_10343660 3300025933 Archaea 1298
560 Ga0207706_10390879 3300025933 Bacteria 1206
561 Ga0207706_10548577 3300025933 Bacteria 995
562 Ga0207706_10693158 3300025933 Bacteria 871
563 Ga0207686_10023672 3300025934 Bacteria 3549
564 Ga0207686_10049029 3300025934 Bacteria 2619
565 Ga0207686_10130787 3300025934 Bacteria 1721
566 Ga0207670_10010343 3300025936 Bacteria 5368
567 Ga0207670_10206959 3300025936 Unclassified 1494
568 Ga0207670_10292329 3300025936 Bacteria 1273
569 Ga0207669_10192189 3300025937 Bacteria 1473
570 Ga0207669_10215692 3300025937 Unclassified 1404
571 Ga0207704_10445304 3300025938 Bacteria 1032
572 Ga0207704_10749536 3300025938 Unclassified 812
573 Ga0207691_10001331 3300025940 Bacteria 24658
574 Ga0207691_10002943 3300025940 Bacteria 16623
575 Ga0207691_10006157 3300025940 Bacteria 11603
576 Ga0207691_10009298 3300025940 Bacteria 9432
577 Ga0207691_10048118 3300025940 Bacteria 3910
578 Ga0207691_10053350 3300025940 Bacteria 3691
579 Ga0207691_10053548 3300025940 Bacteria 3684
580 Ga0207711_10016956 3300025941 Bacteria 6050
581 Ga0207711_10019528 3300025941 Bacteria 5641
582 Ga0207711_10183233 3300025941 Bacteria 1905
583 Ga0207711_10772589 3300025941 Bacteria 895
584 Ga0207689_10008882 3300025942 Bacteria 8718
585 Ga0207689_10197038 3300025942 Bacteria 1662
586 Ga0207689_10788281 3300025942 Bacteria 802
587 Ga0207661_10000719 3300025944 Bacteria 21519
588 Ga0207661_10009291 3300025944 Bacteria 7047
589 Ga0207661_10010122 3300025944 Bacteria 6776
590 Ga0207661_10017720 3300025944 Bacteria 5277
591 Ga0207661_10051316 3300025944 Bacteria 3290
592 Ga0207661_10063180 3300025944 Bacteria 2998
593 Ga0207661_10105604 3300025944 Bacteria 2373
594 Ga0207661_10106977 3300025944 Bacteria 2358
595 Ga0207661_10110777 3300025944 Bacteria 2321
596 Ga0207661_10543197 3300025944 Archaea 1064
597 Ga0207661_10934754 3300025944 Unclassified 799
598 Ga0207679_10004313 3300025945 Bacteria 8845
599 Ga0207679_10015942 3300025945 Bacteria 4982
600 Ga0207679_10036011 3300025945 Bacteria 3506
601 Ga0207679_10069438 3300025945 Bacteria 2651
602 Ga0207679_10389995 3300025945 Bacteria 1223
603 Ga0207679_10531736 3300025945 Bacteria 1053
604 Ga0207679_10664156 3300025945 Bacteria 944
605 Ga0207667_10015803 3300025949 Bacteria 8554
606 Ga0207667_10038313 3300025949 Bacteria 5121
607 Ga0207667_10059592 3300025949 Bacteria 3997
608 Ga0207667_10062902 3300025949 Bacteria 3879
609 Ga0207667_10323515 3300025949 Bacteria 1575
610 Ga0207667_10398014 3300025949 Bacteria 1402
611 Ga0207667_10844915 3300025949 Unclassified 910
612 Ga0207651_10086413 3300025960 Bacteria 2279
613 Ga0207651_11001880 3300025960 Bacteria 747
614 Ga0207712_10000080 3300025961 Bacteria 114486
615 Ga0207712_10000604 3300025961 Bacteria 28470
616 Ga0207712_10000986 3300025961 Bacteria 20382
617 Ga0207712_10198277 3300025961 Bacteria 1590
618 Ga0207668_10001000 3300025972 Bacteria 16933
619 Ga0207668_10013652 3300025972 Bacteria 5010
620 Ga0207668_10029957 3300025972 Bacteria 3572
621 Ga0207668_10152729 3300025972 Bacteria 1789
622 Ga0207668_10655991 3300025972 Unclassified 919
623 Ga0207640_10000130 3300025981 Bacteria 56556
624 Ga0207640_10030546 3300025981 Bacteria 3319
625 Ga0207640_10137452 3300025981 Bacteria 1776
626 Ga0207640_10211675 3300025981 Bacteria 1477
627 Ga0207640_10491189 3300025981 Bacteria 1020
628 Ga0207658_10014699 3300025986 Bacteria 5365
629 Ga0207658_10037666 3300025986 Bacteria 3477
630 Ga0207677_10009604 3300026023 Bacteria 5445
631 Ga0207677_10052341 3300026023 Unclassified 2773
632 Ga0207677_10224239 3300026023 Bacteria 1509
633 Ga0207677_10542190 3300026023 Bacteria 1012
634 Ga0207703_10080123 3300026035 Unclassified 2719
635 Ga0207703_10326319 3300026035 Bacteria 1407
636 Ga0207639_10276440 3300026041 Bacteria 1475
637 Ga0207639_10461215 3300026041 Bacteria 1155
638 Ga0207639_11064500 3300026041 Bacteria 758
639 Ga0207678_10007170 3300026067 Bacteria 9885
640 Ga0207678_10016631 3300026067 Bacteria 6462
641 Ga0207678_10135081 3300026067 Bacteria 2105
642 Ga0207678_10318134 3300026067 Bacteria 1339
643 Ga0207708_10022613 3300026075 Bacteria 4748
644 Ga0207708_10124577 3300026075 Bacteria 2010
645 Ga0207708_10667591 3300026075 Bacteria 886
646 Ga0207702_10016111 3300026078 Bacteria 6188
647 Ga0207702_10101690 3300026078 Bacteria 2538
648 Ga0207702_10255808 3300026078 Bacteria 1647
649 Ga0207641_10060929 3300026088 Bacteria 3217
650 Ga0207641_10164537 3300026088 Bacteria 2019
651 Ga0207641_10515159 3300026088 Bacteria 1163
652 Ga0207641_10578763 3300026088 Unclassified 1097
653 Ga0207641_11119183 3300026088 Bacteria 786
654 Ga0207648_10011850 3300026089 Bacteria 8196
655 Ga0207648_10013688 3300026089 Bacteria 7532
656 Ga0207648_10020224 3300026089 Bacteria 5999
657 Ga0207676_10024301 3300026095 Bacteria 4482
658 Ga0207676_10087603 3300026095 Bacteria 2547
659 Ga0207676_10381711 3300026095 Bacteria 1312
660 Ga0207676_10596475 3300026095 Bacteria 1060
661 Ga0207674_10000044 3300026116 Bacteria 123506
662 Ga0207674_10000889 3300026116 Bacteria 39068
663 Ga0207674_10003432 3300026116 Bacteria 19400
664 Ga0207674_10005482 3300026116 Bacteria 15071
665 Ga0207674_10024910 3300026116 Bacteria 6386
666 Ga0207674_10206005 3300026116 Bacteria 1916
667 Ga0207675_100000132 3300026118 Bacteria 62776
668 Ga0207675_100017109 3300026118 Bacteria 6771
669 Ga0207675_100270797 3300026118 Bacteria 1648
670 Ga0207698_10014597 3300026142 Bacteria 5229
671 Ga0207698_10018480 3300026142 Bacteria 4751
672 Ga0207698_10029193 3300026142 Bacteria 3945
673 Ga0207698_10082178 3300026142 Bacteria 2603
674 Ga0207698_10105081 3300026142 Bacteria 2352
675 Ga0207698_10115015 3300026142 Bacteria 2264
676 Ga0207698_10431293 3300026142 Bacteria 1267
677 Ga0207698_10443273 3300026142 Bacteria 1251
678 Ga0207428_10056151 3300027907 Bacteria 3128
679 Ga0268266_10214868 3300028379 Bacteria 1765
680 Ga0268266_10671673 3300028379 Bacteria 998
681 Ga0268265_10000860 3300028380 Bacteria 28381
682 Ga0268265_10003196 3300028380 Bacteria 11901
683 Ga0268265_10020525 3300028380 Bacteria 4611
684 Ga0268265_10629347 3300028380 Bacteria 1029
685 Ga0268264_10005798 3300028381 Bacteria 10474
686 Ga0268264_10304264 3300028381 Bacteria 1502
687 Ga0307408_100135809 3300031548 Bacteria 1924
688 Ga0307408_100444062 3300031548 Bacteria 1124
689 Ga0316578_10351658 3300031728 Unclassified 877
690 Ga0307405_10175642 3300031731 Bacteria 1532
691 Ga0307413_10058004 3300031824 Bacteria 2370
692 Ga0307413_10081508 3300031824 Bacteria 2075
693 Ga0307413_10283961 3300031824 Bacteria 1246
694 Ga0307413_10444354 3300031824 Bacteria 1027
695 Ga0307413_10950826 3300031824 Bacteria 733
696 Ga0307410_10087061 3300031852 Bacteria 2208
697 Ga0307410_10510968 3300031852 Bacteria 990
698 Ga0307406_10063134 3300031901 Bacteria 2398
699 Ga0307406_10233631 3300031901 Bacteria 1375
700 Ga0307406_10925519 3300031901 Bacteria 744
701 Ga0307407_10032346 3300031903 Bacteria 2843
702 Ga0307407_10107117 3300031903 Bacteria 1747
703 Ga0307412_10030823 3300031911 Bacteria 3381
704 Ga0307412_10091038 3300031911 Bacteria 2134
705 Ga0307412_10133025 3300031911 Bacteria 1810
706 Ga0307412_10286416 3300031911 Unclassified 1296
707 Ga0307412_10790432 3300031911 Bacteria 823
708 Ga0307409_100137672 3300031995 Bacteria 2098
709 Ga0307409_100167703 3300031995 Bacteria 1929
710 Ga0307409_100182448 3300031995 Bacteria 1859
711 Ga0307409_100236257 3300031995 Bacteria 1660
712 Ga0307409_101413342 3300031995 Bacteria 722
713 Ga0307416_100002459 3300032002 Bacteria 10646
714 Ga0307416_100107255 3300032002 Bacteria 2451
715 Ga0307416_100120353 3300032002 Bacteria 2338
716 Ga0307416_100248134 3300032002 Bacteria 1730
717 Ga0307416_101265981 3300032002 Bacteria 843
718 Ga0307416_101275452 3300032002 Bacteria 840
719 Ga0307416_101297634 3300032002 Bacteria 834
720 Ga0307414_10381575 3300032004 Bacteria 1219
721 Ga0307414_11819906 3300032004 Bacteria 568
722 Ga0307411_10018518 3300032005 Bacteria 3996
723 Ga0307411_10490805 3300032005 Bacteria 1036
724 Ga0316583_10075900 3300032133 Bacteria 1175
725 Ga0373934_0003557 3300035086 Bacteria 5729
726 Ga0373923_0023071 3300035111 Bacteria 2445
727 Ga0373956_0002381 3300035119 Bacteria 7681
728 Ga0373943_0170282 3300035170 Bacteria 1191
729 Ga0373955_0003595 3300035172 Bacteria 6821
730 Ga0373931_0051565 3300035691 Bacteria 2192
731 Ga0373931_0073655 3300035691 Bacteria 1869
732 Ga0373931_0336779 3300035691 Unclassified 941
733 Ga0373933_0011444 3300035724 Unclassified 4890
734 Ga0373937_0007060 3300036401 Bacteria 9699
735 Ga0373937_0103978 3300036401 Bacteria 2638
736 Ga0373937_1103140 3300036401 Bacteria 742
737 Ga0395900_0635843 3300037418 Bacteria 1005
738 Ga0436365_0612340 3300039437 Bacteria 5746
739 Ga0439448_0094939 3300042005 Bacteria 1010
740 Ga0439455_0012521 3300042012 Bacteria 1907
741 Ga0450896_029929 3300042133 Bacteria 822
742 Ga0451577_0000001 3300042876 Bacteria 2461803
743 Ga0466966_0495422 3300044684 Bacteria 735
744 Ga0466961_0529932 3300044693 Bacteria 710
745 Ga0453684_0000455 3300044712 Bacteria 165080
746 Ga0466971_0158785 3300044719 Bacteria 1058
747 Ga0466959_0030778 3300045049 Bacteria 3974
748 Ga0451576_0167311 3300045051 Bacteria 2294
749 Ga0451576_0522253 3300045051 Bacteria 1247
750 Ga0451576_0584651 3300045051 Unclassified 1173
751 Ga0495629_0028400 3300046459 Bacteria 3972
752 Ga0495651_0221622 3300046462 Bacteria 1308
753 Ga0495653_0000580 3300046463 Bacteria 28086
754 Ga0495639_0252729 3300046475 Unclassified 872
755 Ga0495596_0014941 3300046500 Bacteria 3263
756 Ga0495608_0123091 3300046511 Bacteria 1662
757 Ga0495618_0064895 3300046514 Bacteria 2320
758 Ga0495618_0140536 3300046514 Bacteria 1545
759 Ga0495620_0271730 3300046515 Bacteria 645
760 Ga0495628_0029198 3300046516 Unclassified 4474
761 Ga0495630_0109799 3300046517 Bacteria 2089
762 Ga0495663_0034026 3300046525 Bacteria 1524
763 Ga0495663_0076711 3300046525 Bacteria 1071
764 Ga0495652_0006802 3300046529 Bacteria 10599
765 Ga0495587_0028317 3300046536 Unclassified 3407
766 Ga0495598_0108931 3300046537 Bacteria 926
767 Ga0495598_0127629 3300046537 Bacteria 869
768 Ga0495621_0019862 3300046539 Bacteria 2198
769 Ga0495621_0032372 3300046539 Bacteria 1797
770 Ga0495645_0053561 3300046543 Bacteria 2932
771 Ga0495667_0008019 3300046559 Bacteria 7162
772 Ga0495656_0030414 3300046615 Bacteria 2183
773 Ga0495635_0002881 3300046663 Bacteria 11813
774 Ga0495657_0004404 3300046675 Bacteria 11240
775 Ga0495599_0026465 3300046678 Unclassified 3635
776 Ga0495623_0016384 3300046679 Bacteria 4788
777 Ga0495623_0082510 3300046679 Bacteria 1986
778 Ga0495646_0100700 3300046680 Bacteria 1657
779 Ga0495669_0003360 3300046684 Bacteria 6588
780 Ga0495613_0043672 3300046689 Unclassified 3316
781 Ga0495600_0005235 3300046809 Bacteria 7806
782 Ga0495581_0046544 3300047315 Bacteria 2507
783 Ga0495604_0079956 3300047317 Bacteria 2450
784 Ga0495604_0116017 3300047317 Bacteria 1945
785 Ga0495636_0293046 3300047318 Bacteria 760
786 Ga0495674_0009593 3300047319 Bacteria 9194
787 Ga0495672_0003008 3300047320 Bacteria 14823
788 Ga0495680_0002216 3300047322 Bacteria 20058
789 Ga0495675_0030331 3300047444 Unclassified 3450
790 Ga0495677_0047095 3300047445 Bacteria 1583
791 Ga0495677_0155177 3300047445 Unclassified 882
792 Ga0495684_0004469 3300047471 Bacteria 10930
793 Ga0495684_0285634 3300047471 Bacteria 1189
794 Ga0495593_0166650 3300047673 Bacteria 1111
795 Ga0495602_0006493 3300048088 Bacteria 12270
796 Ga0495615_0067215 3300048090 Bacteria 959
797 Ga0496101_0080602 3300048904 Bacteria 2405
798 Ga0496104_0137639 3300048907 Bacteria 2346
799 Ga0496105_0090078 3300048908 Bacteria 2534
800 Ga0496106_0257812 3300048909 Bacteria 1395
801 Ga0496106_0275012 3300048909 Bacteria 1349
802 Ga0496107_0177992 3300048910 Bacteria 1579
803 Ga0496108_0019904 3300048911 Bacteria 5513
804 Ga0496109_0094765 3300048912 Bacteria 2763
805 Ga0496109_0266047 3300048912 Bacteria 1615
806 Ga0496109_0757883 3300048912 Bacteria 908
807 Ga0496110_0049853 3300048913 Bacteria 3675
808 Ga0496112_0051827 3300048915 Bacteria 4026
809 Ga0496112_0129446 3300048915 Bacteria 2495
810 Ga0496112_0681220 3300048915 Bacteria 957
811 Ga0496112_0979842 3300048915 Unclassified 766
812 Ga0496113_0001384 3300048916 Bacteria 13462
813 Ga0496113_0752498 3300048916 Bacteria 776
814 Ga0496114_0696600 3300048917 Bacteria 891
815 Ga0496115_0195560 3300048918 Bacteria 1671
816 Ga0496115_0520521 3300048918 Archaea 954
817 Ga0501031_0132161 3300049568 Bacteria 1630
818 Ga0501032_0040725 3300049569 Bacteria 3157
819 Ga0501034_0231377 3300049571 Bacteria 1797
820 Ga0501036_0598310 3300049572 Bacteria 915
821 Ga0501038_0022177 3300049574 Bacteria 5691
822 Ga0501039_0315420 3300049575 Bacteria 1229
823 Ga0501039_0556350 3300049575 Bacteria 900
824 Ga0501040_0003853 3300049576 Bacteria 9731
825 Ga0501043_0010344 3300049579 Bacteria 7313
826 Ga0501046_0193310 3300049580 Bacteria 1517
827 Ga0501046_0281616 3300049580 Bacteria 1218
828 Ga0501047_0004204 3300049581 Bacteria 13561
829 Ga0501047_0367491 3300049581 Bacteria 1274
830 Ga0501047_0954923 3300049581 Bacteria 670
831 Ga0501048_0033644 3300049582 Bacteria 3702
832 Ga0501070_0001202 3300049586 Bacteria 23186
833 Ga0501070_0297831 3300049586 Bacteria 1314
834 Ga0501072_0452796 3300049588 Bacteria 1016
835 Ga0501074_0009944 3300049590 Bacteria 6912
836 Ga0501074_0098314 3300049590 Bacteria 2095
837 Ga0501075_0054402 3300049591 Bacteria 3011
838 Ga0501076_0019229 3300049592 Bacteria 5218
839 Ga0501077_0403248 3300049593 Bacteria 874
840 Ga0501224_031026 3300049664 Unclassified 801
841 Ga0501233_134837 3300049668 Bacteria 678
842 Ga0501249_044778 3300049679 Bacteria 1009
843 Ga0501225_0149620 3300049705 Bacteria 711
844 Ga0501079_0123714 3300049741 Bacteria 2012
845 Ga0501080_0346655 3300049742 Bacteria 1342
846 Ga0501080_0598060 3300049742 Bacteria 979
847 Ga0501081_0051843 3300049743 Bacteria 2830
848 Ga0501035_0022903 3300049822 Bacteria 5736
849 Ga0501044_0658037 3300049823 Bacteria 936
850 Ga0501045_0126311 3300049824 Bacteria 1900
851 nmdc:mga05p37_316967_c1 3300050507 Bacteria 1847
852 nmdc:mga05p37_672596_c1 3300050507 Bacteria 1155
853 nmdc:mga09592_382830_c1 3300050508 Bacteria 1216
854 nmdc:mga0qj67_1000875_c1 3300050509 Bacteria 656
855 nmdc:mga0qj67_1019_c1 3300050509 Bacteria 19352
856 nmdc:mga0qj67_1117075_c1 3300050509 Bacteria 615
857 nmdc:mga0qj67_211125_c1 3300050509 Bacteria 1577
858 nmdc:mga0qj67_23157_c1 3300050509 Bacteria 4775
859 nmdc:mga0qj67_274067_c1 3300050509 Bacteria 1368
860 nmdc:mga06r32_11463_c1 3300050510 Bacteria 7983
861 nmdc:mga06r32_121600_c1 3300050510 Bacteria 2576
862 nmdc:mga06r32_1274929_c1 3300050510 Bacteria 679
863 nmdc:mga06r32_526577_c1 3300050510 Bacteria 1157
864 nmdc:mga08y16_280848_c1 3300050511 Bacteria 1717
865 nmdc:mga08y16_30706_c1 3300050511 Bacteria 5651
866 nmdc:mga0n895_1236_c1 3300050512 Bacteria 18851
867 nmdc:mga0n895_1358_c1 3300050512 Bacteria 18186
868 nmdc:mga0n895_465883_c1 3300050512 Bacteria 1275
869 nmdc:mga0rr50_142054_c1 3300050513 Bacteria 1932
870 nmdc:mga08x19_10849_c1 3300050514 Bacteria 5479
871 nmdc:mga08x19_43268_c1 3300050514 Bacteria 2873
872 nmdc:mga0a205_118478_c1 3300050515 Bacteria 2546
873 nmdc:mga0a205_60244_c1 3300050515 Bacteria 3666
874 nmdc:mga0a205_9685_c1 3300050515 Bacteria 8823
875 Ga0495601_0075375 3300053077 Bacteria 2159
876 Ga0495612_0022110 3300053078 Bacteria 2549
877 Ga0495595_0024736 3300053084 Bacteria 2654
878 Ga0495619_0013352 3300053085 Bacteria 5175
879 Ga0500583_0382792 3300053092 Unclassified 677
880 Ga0501082_0012531 3300060353 Bacteria 7285
881 Ga0501082_0072357 3300060353 Bacteria 2970
882 Ga0207707_10383398
883 Ga0065712_10088664
884 Ga0065715_10144245
885 Ga0065707_10092615
886 Ga0070658_10011734
887 Ga0070658_10016236
888 Ga0070658_10017610
889 Ga0070658_10072200
890 Ga0070658_10181125
891 Ga0070658_10311687
892 Ga0070676_10000196
893 Ga0070676_10135933
894 Ga0070683_100001031
895 Ga0070683_100002551
896 Ga0070683_100008332
897 Ga0070683_100010700
898 Ga0070683_100011398
899 Ga0070683_100033293
900 Ga0070683_100037429
901 Ga0070683_100058098
902 Ga0070683_100268721
903 Ga0070690_100024197
904 Ga0070690_100043358
905 Ga0070690_100122519
906 Ga0070670_100014831
907 Ga0070670_100043812
908 Ga0070670_100108277
909 Ga0070670_100337479
910 Ga0070670_101004109
911 Ga0070677_10014232
912 Ga0068869_100002544
913 Ga0070666_10052076
914 Ga0070666_10090382
915 Ga0070666_10149691
916 Ga0070666_10157663
917 Ga0070666_10311078
918 Ga0070680_100003258
919 Ga0070680_100008374
920 Ga0070680_100010093
921 Ga0070680_100066800
922 Ga0070680_100183829
923 Ga0070680_100197398
924 Ga0070680_100655875
925 Ga0070682_100146049
926 Ga0070682_100249847
927 Ga0070682_100284134
928 Ga0070682_100329911
929 Ga0070682_100464870
930 Ga0070682_100679847
931 Ga0068868_100003976
932 Ga0068868_100654132
933 Ga0070660_100006178
934 Ga0070660_100011888
935 Ga0070660_100018959
936 Ga0070660_100098347
937 Ga0070660_100099186
938 Ga0070660_100127772
939 Ga0070660_100153072
940 Ga0070660_100193885
941 Ga0070660_100227738
942 Ga0070660_100259991
943 Ga0070660_100777609
944 Ga0070689_100007718
945 Ga0070689_100025701
946 Ga0070687_100002491
947 Ga0070687_100285518
948 Ga0070661_100008461
949 Ga0070661_100015259
950 Ga0070661_100020255
951 Ga0070661_100031819
952 Ga0070661_100044122
953 Ga0070661_100077508
954 Ga0070661_100265522
955 Ga0070661_100319504
956 Ga0070661_101141322
957 Ga0070692_10014444
958 Ga0070692_10137356
959 Ga0070692_10239573
960 Ga0070668_100000199
961 Ga0070668_100002845
962 Ga0070668_100006132
963 Ga0070668_100043340
964 Ga0070669_100000234
965 Ga0070669_100001776
966 Ga0070669_100005249
967 Ga0070669_100122948
968 Ga0070669_100304886
969 Ga0070675_100000355
970 Ga0070675_100000950
971 Ga0070671_100141698
972 Ga0070671_100192071
973 Ga0070671_100290821
974 Ga0070671_100308817
975 Ga0070674_100120721
976 Ga0070674_100216492
977 Ga0070673_100047740
978 Ga0070673_100096523
979 Ga0070673_100578335
980 Ga0070688_100001683
981 Ga0070688_100037996
982 Ga0070688_100711657
983 Ga0070659_100002708
984 Ga0070659_100005359
985 Ga0070659_100009737
986 Ga0070659_100011752
987 Ga0070659_100013241
988 Ga0070659_100053227
989 Ga0070659_100053634
990 Ga0070659_100278885
991 Ga0070659_100701713
992 Ga0070659_100802512
993 Ga0070667_100100974
994 Ga0070667_100163514
995 Ga0070667_100245585
996 Ga0070703_10297661
997 Ga0070709_10005765
998 Ga0070709_10226254
999 Ga0070714_100000513
1000 Ga0070714_100005882
1001 Ga0070714_100037225
1002 Ga0070713_100004887
1003 Ga0070713_100216025
1004 Ga0070713_100603245
1005 Ga0070701_10001150
1006 Ga0070701_10019866
1007 Ga0070701_10068539
1008 Ga0070701_10177610
1009 Ga0070700_100093954
1010 Ga0070694_100167646
1011 Ga0070694_100180321
1012 Ga0070708_100195390
1013 Ga0070663_100007679
1014 Ga0070663_100010389
1015 Ga0070663_100117919
1016 Ga0070663_100192403
1017 Ga0070663_100435254
1018 Ga0070662_100006287
1019 Ga0070662_100213350
1020 Ga0070662_100470089
1021 Ga0070662_100810864
1022 Ga0070681_10000126
1023 Ga0070681_10010495
1024 Ga0070681_10012859
1025 Ga0070681_10028013
1026 Ga0070681_10029537
1027 Ga0070681_10033622
1028 Ga0070681_10120090
1029 Ga0070681_10122911
1030 Ga0070681_10154465
1031 Ga0070681_10156034
1032 Ga0070681_10294884
1033 Ga0070681_10543911
1034 Ga0070681_11028266
1035 Ga0068867_100007866
1036 Ga0068867_100093562
1037 Ga0068867_100559432
1038 Ga0070685_10012542
1039 Ga0070685_10016174
1040 Ga0070706_100000192
1041 Ga0070706_100030140
1042 Ga0070706_100460979
1043 Ga0070707_100003482
1044 Ga0070707_100171654
1045 Ga0070707_100607279
1046 Ga0070698_100006912
1047 Ga0070698_100025012
1048 Ga0070698_100240954
1049 Ga0070698_100255770
1050 Ga0070698_100616812
1051 Ga0070699_100003327
1052 Ga0070699_100103221
1053 Ga0070699_100302638
1054 Ga0070699_100442131
1055 Ga0070679_100003236
1056 Ga0070679_100003664
1057 Ga0070679_100010605
1058 Ga0070679_100011246
1059 Ga0070679_100036982
1060 Ga0070679_100169093
1061 Ga0070679_100230184
1062 Ga0070679_100299288
1063 Ga0070679_100359879
1064 Ga0070679_100962859
1065 Ga0070684_100003014
1066 Ga0070684_100004678
1067 Ga0070684_100005365
1068 Ga0070684_100008147
1069 Ga0070684_100054008
1070 Ga0070684_100082255
1071 Ga0070684_100102117
1072 Ga0070684_100110487
1073 Ga0070684_100300628
1074 Ga0070697_100005208
1075 Ga0070697_100284447
1076 Ga0068853_100003265
1077 Ga0068853_100010911
1078 Ga0068853_100030870
1079 Ga0068853_100341231
1080 Ga0068853_100359844
1081 Ga0068853_100438828
1082 Ga0068853_100756666
1083 Ga0070672_100007834
1084 Ga0070672_100007861
1085 Ga0070672_100009780
1086 Ga0070672_100101228
1087 Ga0070672_100135368
1088 Ga0070686_100163330
1089 Ga0070686_100667792
1090 Ga0070696_100037138
1091 Ga0070696_100623590
1092 Ga0070693_100012798
1093 Ga0070693_100028246
1094 Ga0070665_100105848
1095 Ga0070704_100081134
1096 Ga0068855_100000968
1097 Ga0068855_100016696
1098 Ga0068855_100017646
1099 Ga0068855_100045629
1100 Ga0068855_100054223
1101 Ga0068855_100146358
1102 Ga0068855_100280646
1103 Ga0068855_100383600
1104 Ga0070664_100001429
1105 Ga0070664_100001585
1106 Ga0070664_100007954
1107 Ga0070664_100008295
1108 Ga0070664_100013259
1109 Ga0070664_100048593
1110 Ga0070664_100122007
1111 Ga0070664_100157424
1112 Ga0070664_100310860
1113 Ga0068857_100001670
1114 Ga0068857_100003207
1115 Ga0068857_100011217
1116 Ga0068857_100076009
1117 Ga0068857_101679818
1118 Ga0068854_100008058
1119 Ga0068854_100093710
1120 Ga0068854_100137552
1121 Ga0068854_100139620
1122 Ga0068856_100013189
1123 Ga0070702_100126332
1124 Ga0068852_100001587
1125 Ga0068852_100029920
1126 Ga0068852_100112922
1127 Ga0068852_100377114
1128 Ga0068852_100873570
1129 Ga0068859_100009934
1130 Ga0068859_100061485
1131 Ga0068864_100101919
1132 Ga0068864_100195495
1133 Ga0068864_100293664
1134 Ga0068866_10021412
1135 Ga0068866_10118322
1136 Ga0068861_100000050
1137 Ga0068861_100620264
1138 Ga0068861_100623804
1139 Ga0068861_100637942
1140 Ga0068851_10005441
1141 Ga0068851_10038973
1142 Ga0068851_10172903
1143 Ga0068870_10008419
1144 Ga0068870_10008513
1145 Ga0068870_10194466
1146 Ga0068863_100011897
1147 Ga0068863_100141181
1148 Ga0068863_101688565
1149 Ga0068858_100020400
1150 Ga0068858_100059849
1151 Ga0068860_100041629
1152 Ga0068860_100070525
1153 Ga0068860_100339752
1154 Ga0068860_101207434
1155 Ga0068862_100001155
1156 Ga0068862_100002486
1157 Ga0068862_100032965
1158 Ga0068862_100141831
1159 Ga0081539_10013920
1160 Ga0070717_10003484
1161 Ga0070717_10067254
1162 Ga0070717_10111900
1163 Ga0070717_10144984
1164 Ga0070717_10166785
1165 Ga0070712_100003320
1166 Ga0097621_100240512
1167 Ga0097621_100576779
1168 Ga0068871_100898443
1169 Ga0068871_101056278
1170 Ga0075428_100230234
1171 Ga0075428_100607302
1172 Ga0075430_100001111
1173 Ga0075430_100002336
1174 Ga0075430_100044799
1175 Ga0075430_100075700
1176 Ga0075430_100342744
1177 Ga0075430_100714316
1178 Ga0075430_101066714
1179 Ga0075430_101066715
1180 Ga0075431_100013223
1181 Ga0075431_100067930
1182 Ga0075431_100134149
1183 Ga0075431_100151138
1184 Ga0075431_100399224
1185 Ga0075431_100490362
1186 Ga0075433_10000919
1187 Ga0075433_10090074
1188 Ga0075433_10481104
1189 Ga0075433_10905655
1190 Ga0075434_100002429
1191 Ga0075434_100004446
1192 Ga0075434_100051562
1193 Ga0075434_100070883
1194 Ga0075429_100059129
1195 Ga0075429_100451496
1196 Ga0075429_100914278
1197 Ga0068865_100001898
1198 Ga0068865_100136086
1199 Ga0068865_100264875
1200 Ga0075436_100014406
1201 Ga0075436_100074417
1202 Ga0075436_100300673
1203 Ga0075436_100679414
1204 Ga0097620_100009934
1205 Ga0097620_100061485
1206 Ga0105240_10000835
1207 Ga0105240_10026045
1208 Ga0105240_10032108
1209 Ga0105240_10041242
1210 Ga0105240_10044704
1211 Ga0105240_10072856
1212 Ga0105240_10132109
1213 Ga0105240_10552684
1214 Ga0105240_10802187
1215 Ga0111539_10102993
1216 Ga0111539_10347525
1217 Ga0111539_10398986
1218 Ga0105245_10059902
1219 Ga0114129_10184713
1220 Ga0105243_10372617
1221 Ga0105243_10389156
1222 Ga0105241_10161237
1223 Ga0105241_10483062
1224 Ga0105241_10812266
1225 Ga0105242_10001625
1226 Ga0105242_10004199
1227 Ga0105242_10025244
1228 Ga0105248_10116199
1229 Ga0105248_10163534
1230 Ga0105248_10281417
1231 Ga0105248_10412475
1232 Ga0105237_10091117
1233 Ga0105237_10213160
1234 Ga0105237_10330639
1235 Ga0105237_10950908
1236 Ga0105238_10013842
1237 Ga0105238_10016877
1238 Ga0105238_10395378
1239 Ga0105238_10715187
1240 Ga0105249_10000009
1241 Ga0105249_10000188
1242 Ga0105249_10071346
1243 Ga0105239_10021125
1244 Ga0105246_10638305
1245 Ga0157373_10004057
1246 Ga0157373_10004069
1247 Ga0157373_10215824
1248 Ga0157371_10010420
1249 Ga0157371_10030880
1250 Ga0157371_10085854
1251 Ga0157371_10383734
1252 Ga0157371_10841503
1253 Ga0157370_10004376
1254 Ga0157370_10006346
1255 Ga0157370_10007271
1256 Ga0157370_10092744
1257 Ga0157370_10111636
1258 Ga0157370_10141866
1259 Ga0157370_10370871
1260 Ga0157369_10005215
1261 Ga0157369_10007252
1262 Ga0157369_10020702
1263 Ga0157369_10079621
1264 Ga0157369_10084026
1265 Ga0157369_10706913
1266 Ga0157369_10875466
1267 Ga0157369_11319176
1268 Ga0157374_10302123
1269 Ga0157378_10005279
1270 Ga0157378_10037287
1271 Ga0157378_10259628
1272 Ga0157378_10341616
1273 Ga0163162_10006838
1274 Ga0163162_10027705
1275 Ga0163162_11221113
1276 Ga0163162_11909209
1277 Ga0157372_10003316
1278 Ga0157372_10010118
1279 Ga0157372_10013215
1280 Ga0157372_10015746
1281 Ga0157372_10021601
1282 Ga0157372_10023983
1283 Ga0157372_10046904
1284 Ga0157372_10077175
1285 Ga0157372_10130090
1286 Ga0157372_10173622
1287 Ga0157372_10176904
1288 Ga0157372_10229368
1289 Ga0157372_10242159
1290 Ga0157372_10321487
1291 Ga0157372_11605070
1292 Ga0157375_10009807
1293 Ga0157375_10016080
1294 Ga0157375_10040269
1295 Ga0157375_10046290
1296 Ga0157375_10113476
1297 Ga0157375_10239409
1298 Ga0157375_11592208
1299 Ga0157380_10002402
1300 Ga0157380_10005780
1301 Ga0157380_10616273
1302 Ga0182008_10001362
1303 Ga0157377_10028374
1304 Ga0157379_10176582
1305 Ga0157379_10180275
1306 Ga0157376_10401295
1307 Ga0157376_10552089
1308 Ga0182007_10080279
1309 Ga0163161_10001550
1310 Ga0163161_10020486
1311 Ga0163161_10793631
1312 Ga0213876_10170600
1313 Ga0207673_1010368
1314 Ga0207697_10098149
1315 Ga0207656_10010003
1316 Ga0207656_10013133
1317 Ga0207656_10059134
1318 Ga0207656_10268202
1319 Ga0207692_10059154
1320 Ga0207642_10242558
1321 Ga0207688_10005659
1322 Ga0207680_10040232
1323 Ga0207680_10389134
1324 Ga0207680_10401293
1325 Ga0207680_10548477
1326 Ga0207647_10009723
1327 Ga0207699_10009388
1328 Ga0207699_10365276
1329 Ga0207699_10620256
1330 Ga0207645_10000120
1331 Ga0207645_10010380
1332 Ga0207645_10106585
1333 Ga0207645_10127464
1334 Ga0207645_10246639
1335 Ga0207645_10256122
1336 Ga0207643_10004281
1337 Ga0207643_10004529
1338 Ga0207643_10171435
1339 Ga0207705_10006991
1340 Ga0207705_10009053
1341 Ga0207705_10050165
1342 Ga0207705_10062144
1343 Ga0207684_10000021
1344 Ga0207684_10025396
1345 Ga0207654_10092556
1346 Ga0207654_10502908
1347 Ga0207654_10677118
1348 Ga0207707_10000145
1349 Ga0207707_10006698
1350 Ga0207707_10007559
1351 Ga0207707_10009051
1352 Ga0207707_10100467
1353 Ga0207707_10157365
1354 Ga0207707_10162673
1355 Ga0207707_10185846
1356 Ga0207707_10215902
1357 Ga0207707_10223392
1358 Ga0207707_10309760
1359 Ga0207707_10379887
1360 Ga0207707_10764779
1361 Ga0207695_10001488
1362 Ga0207695_10004282
1363 Ga0207695_10005837
1364 Ga0207695_10036507
1365 Ga0207695_10044277
1366 Ga0207695_10091688
1367 Ga0207695_10094958
1368 Ga0207695_10438675
1369 Ga0207671_10401811
1370 Ga0207671_10556972
1371 Ga0207693_10007116
1372 Ga0207660_10001279
1373 Ga0207660_10001980
1374 Ga0207660_10010084
1375 Ga0207660_10058886
1376 Ga0207660_10113378
1377 Ga0207660_10314488
1378 Ga0207660_10593434
1379 Ga0207662_10002650
1380 Ga0207662_10010448
1381 Ga0207657_10000322
1382 Ga0207657_10006793
1383 Ga0207657_10008298
1384 Ga0207657_10082106
1385 Ga0207657_10098580
1386 Ga0207657_10103967
1387 Ga0207657_10131201
1388 Ga0207657_10151689
1389 Ga0207657_10253355
1390 Ga0207657_10552491
1391 Ga0207649_10002362
1392 Ga0207649_10028278
1393 Ga0207649_10054678
1394 Ga0207649_10147452
1395 Ga0207649_10189016
1396 Ga0207652_10000247
1397 Ga0207652_10001931
1398 Ga0207652_10011717
1399 Ga0207652_10015366
1400 Ga0207652_10025880
1401 Ga0207652_10049230
1402 Ga0207652_10055092
1403 Ga0207652_10075384
1404 Ga0207652_10111092
1405 Ga0207652_10265150
1406 Ga0207646_10000449
1407 Ga0207646_10217751
1408 Ga0207646_10440516
1409 Ga0207681_10000721
1410 Ga0207681_10000724
1411 Ga0207681_10001868
1412 Ga0207681_10047425
1413 Ga0207694_10007636
1414 Ga0207694_10023119
1415 Ga0207694_10346552
1416 Ga0207650_10096147
1417 Ga0207650_10185245
1418 Ga0207650_10440379
1419 Ga0207650_10533463
1420 Ga0207659_10002414
1421 Ga0207659_10054612
1422 Ga0207659_10511740
1423 Ga0207687_10053478
1424 Ga0207700_10080662
1425 Ga0207700_10352018
1426 Ga0207664_10000468
1427 Ga0207664_10032411
1428 Ga0207664_10034450
1429 Ga0207644_10109679
1430 Ga0207644_10123806
1431 Ga0207644_10404526
1432 Ga0207690_10009263
1433 Ga0207690_10010348
1434 Ga0207690_10120194
1435 Ga0207690_10169579
1436 Ga0207690_10243419
1437 Ga0207706_10000083
1438 Ga0207706_10060209
1439 Ga0207706_10150632
1440 Ga0207706_10343660
1441 Ga0207706_10390879
1442 Ga0207706_10548577
1443 Ga0207706_10693158
1444 Ga0207686_10023672
1445 Ga0207686_10049029
1446 Ga0207686_10130787
1447 Ga0207670_10010343
1448 Ga0207670_10206959
1449 Ga0207670_10292329
1450 Ga0207669_10192189
1451 Ga0207669_10215692
1452 Ga0207704_10445304
1453 Ga0207704_10749536
1454 Ga0207691_10001331
1455 Ga0207691_10002943
1456 Ga0207691_10006157
1457 Ga0207691_10009298
1458 Ga0207691_10048118
1459 Ga0207691_10053350
1460 Ga0207691_10053548
1461 Ga0207711_10016956
1462 Ga0207711_10019528
1463 Ga0207711_10183233
1464 Ga0207711_10772589
1465 Ga0207689_10008882
1466 Ga0207689_10197038
1467 Ga0207689_10788281
1468 Ga0207661_10000719
1469 Ga0207661_10009291
1470 Ga0207661_10010122
1471 Ga0207661_10017720
1472 Ga0207661_10051316
1473 Ga0207661_10063180
1474 Ga0207661_10105604
1475 Ga0207661_10106977
1476 Ga0207661_10110777
1477 Ga0207661_10543197
1478 Ga0207661_10934754
1479 Ga0207679_10004313
1480 Ga0207679_10015942
1481 Ga0207679_10036011
1482 Ga0207679_10069438
1483 Ga0207679_10389995
1484 Ga0207679_10531736
1485 Ga0207679_10664156
1486 Ga0207667_10015803
1487 Ga0207667_10038313
1488 Ga0207667_10059592
1489 Ga0207667_10062902
1490 Ga0207667_10323515
1491 Ga0207667_10398014
1492 Ga0207667_10844915
1493 Ga0207651_10086413
1494 Ga0207651_11001880
1495 Ga0207712_10000080
1496 Ga0207712_10000604
1497 Ga0207712_10000986
1498 Ga0207712_10198277
1499 Ga0207668_10001000
1500 Ga0207668_10013652
1501 Ga0207668_10029957
1502 Ga0207668_10152729
1503 Ga0207668_10655991
1504 Ga0207640_10000130
1505 Ga0207640_10030546
1506 Ga0207640_10137452
1507 Ga0207640_10211675
1508 Ga0207640_10491189
1509 Ga0207658_10014699
1510 Ga0207658_10037666
1511 Ga0207677_10009604
1512 Ga0207677_10052341
1513 Ga0207677_10224239
1514 Ga0207677_10542190
1515 Ga0207703_10080123
1516 Ga0207703_10326319
1517 Ga0207639_10276440
1518 Ga0207639_10461215
1519 Ga0207639_11064500
1520 Ga0207678_10007170
1521 Ga0207678_10016631
1522 Ga0207678_10135081
1523 Ga0207678_10318134
1524 Ga0207708_10022613
1525 Ga0207708_10124577
1526 Ga0207708_10667591
1527 Ga0207702_10016111
1528 Ga0207702_10101690
1529 Ga0207702_10255808
1530 Ga0207641_10060929
1531 Ga0207641_10164537
1532 Ga0207641_10515159
1533 Ga0207641_10578763
1534 Ga0207641_11119183
1535 Ga0207648_10011850
1536 Ga0207648_10013688
1537 Ga0207648_10020224
1538 Ga0207676_10024301
1539 Ga0207676_10087603
1540 Ga0207676_10381711
1541 Ga0207676_10596475
1542 Ga0207674_10000044
1543 Ga0207674_10000889
1544 Ga0207674_10003432
1545 Ga0207674_10005482
1546 Ga0207674_10024910
1547 Ga0207674_10206005
1548 Ga0207675_100000132
1549 Ga0207675_100017109
1550 Ga0207675_100270797
1551 Ga0207698_10014597
1552 Ga0207698_10018480
1553 Ga0207698_10029193
1554 Ga0207698_10082178
1555 Ga0207698_10105081
1556 Ga0207698_10115015
1557 Ga0207698_10431293
1558 Ga0207698_10443273
1559 Ga0207428_10056151
1560 Ga0268266_10214868
1561 Ga0268266_10671673
1562 Ga0268265_10000860
1563 Ga0268265_10003196
1564 Ga0268265_10020525
1565 Ga0268265_10629347
1566 Ga0268264_10005798
1567 Ga0268264_10304264
1568 Ga0307408_100135809
1569 Ga0307408_100444062
1570 Ga0316578_10351658
1571 Ga0307405_10175642
1572 Ga0307413_10058004
1573 Ga0307413_10081508
1574 Ga0307413_10283961
1575 Ga0307413_10444354
1576 Ga0307413_10950826
1577 Ga0307410_10087061
1578 Ga0307410_10510968
1579 Ga0307406_10063134
1580 Ga0307406_10233631
1581 Ga0307406_10925519
1582 Ga0307407_10032346
1583 Ga0307407_10107117
1584 Ga0307412_10030823
1585 Ga0307412_10091038
1586 Ga0307412_10133025
1587 Ga0307412_10286416
1588 Ga0307412_10790432
1589 Ga0307409_100137672
1590 Ga0307409_100167703
1591 Ga0307409_100182448
1592 Ga0307409_100236257
1593 Ga0307409_101413342
1594 Ga0307416_100002459
1595 Ga0307416_100107255
1596 Ga0307416_100120353
1597 Ga0307416_100248134
1598 Ga0307416_101265981
1599 Ga0307416_101275452
1600 Ga0307416_101297634
1601 Ga0307414_10381575
1602 Ga0307414_11819906
1603 Ga0307411_10018518
1604 Ga0307411_10490805
1605 Ga0316583_10075900
1606 Ga0373934_0003557
1607 Ga0373923_0023071
1608 Ga0373956_0002381
1609 Ga0373943_0170282
1610 Ga0373955_0003595
1611 Ga0373931_0051565
1612 Ga0373931_0073655
1613 Ga0373931_0336779
1614 Ga0373933_0011444
1615 Ga0373937_0007060
1616 Ga0373937_0103978
1617 Ga0373937_1103140
1618 Ga0395900_0635843
1619 Ga0436365_0612340
1620 Ga0439448_0094939
1621 Ga0439455_0012521
1622 Ga0450896_029929
1623 Ga0451577_0000001
1624 Ga0466966_0495422
1625 Ga0466961_0529932
1626 Ga0453684_0000455
1627 Ga0466971_0158785
1628 Ga0466959_0030778
1629 Ga0451576_0167311
1630 Ga0451576_0522253
1631 Ga0451576_0584651
1632 Ga0495629_0028400
1633 Ga0495651_0221622
1634 Ga0495653_0000580
1635 Ga0495639_0252729
1636 Ga0495596_0014941
1637 Ga0495608_0123091
1638 Ga0495618_0064895
1639 Ga0495618_0140536
1640 Ga0495620_0271730
1641 Ga0495628_0029198
1642 Ga0495630_0109799
1643 Ga0495663_0034026
1644 Ga0495663_0076711
1645 Ga0495652_0006802
1646 Ga0495587_0028317
1647 Ga0495598_0108931
1648 Ga0495598_0127629
1649 Ga0495621_0019862
1650 Ga0495621_0032372
1651 Ga0495645_0053561
1652 Ga0495667_0008019
1653 Ga0495656_0030414
1654 Ga0495635_0002881
1655 Ga0495657_0004404
1656 Ga0495599_0026465
1657 Ga0495623_0016384
1658 Ga0495623_0082510
1659 Ga0495646_0100700
1660 Ga0495669_0003360
1661 Ga0495613_0043672
1662 Ga0495600_0005235
1663 Ga0495581_0046544
1664 Ga0495604_0079956
1665 Ga0495604_0116017
1666 Ga0495636_0293046
1667 Ga0495674_0009593
1668 Ga0495672_0003008
1669 Ga0495680_0002216
1670 Ga0495675_0030331
1671 Ga0495677_0047095
1672 Ga0495677_0155177
1673 Ga0495684_0004469
1674 Ga0495684_0285634
1675 Ga0495593_0166650
1676 Ga0495602_0006493
1677 Ga0495615_0067215
1678 Ga0496101_0080602
1679 Ga0496104_0137639
1680 Ga0496105_0090078
1681 Ga0496106_0257812
1682 Ga0496106_0275012
1683 Ga0496107_0177992
1684 Ga0496108_0019904
1685 Ga0496109_0094765
1686 Ga0496109_0266047
1687 Ga0496109_0757883
1688 Ga0496110_0049853
1689 Ga0496112_0051827
1690 Ga0496112_0129446
1691 Ga0496112_0681220
1692 Ga0496112_0979842
1693 Ga0496113_0001384
1694 Ga0496113_0752498
1695 Ga0496114_0696600
1696 Ga0496115_0195560
1697 Ga0496115_0520521
1698 Ga0501031_0132161
1699 Ga0501032_0040725
1700 Ga0501034_0231377
1701 Ga0501036_0598310
1702 Ga0501038_0022177
1703 Ga0501039_0315420
1704 Ga0501039_0556350
1705 Ga0501040_0003853
1706 Ga0501043_0010344
1707 Ga0501046_0193310
1708 Ga0501046_0281616
1709 Ga0501047_0004204
1710 Ga0501047_0367491
1711 Ga0501047_0954923
1712 Ga0501048_0033644
1713 Ga0501070_0001202
1714 Ga0501070_0297831
1715 Ga0501072_0452796
1716 Ga0501074_0009944
1717 Ga0501074_0098314
1718 Ga0501075_0054402
1719 Ga0501076_0019229
1720 Ga0501077_0403248
1721 Ga0501224_031026
1722 Ga0501233_134837
1723 Ga0501249_044778
1724 Ga0501225_0149620
1725 Ga0501079_0123714
1726 Ga0501080_0346655
1727 Ga0501080_0598060
1728 Ga0501081_0051843
1729 Ga0501035_0022903
1730 Ga0501044_0658037
1731 Ga0501045_0126311
1732 nmdc:mga05p37_316967_c1
1733 nmdc:mga05p37_672596_c1
1734 nmdc:mga09592_382830_c1
1735 nmdc:mga0qj67_1000875_c1
1736 nmdc:mga0qj67_1019_c1
1737 nmdc:mga0qj67_1117075_c1
1738 nmdc:mga0qj67_211125_c1
1739 nmdc:mga0qj67_23157_c1
1740 nmdc:mga0qj67_274067_c1
1741 nmdc:mga06r32_11463_c1
1742 nmdc:mga06r32_121600_c1
1743 nmdc:mga06r32_1274929_c1
1744 nmdc:mga06r32_526577_c1
1745 nmdc:mga08y16_280848_c1
1746 nmdc:mga08y16_30706_c1
1747 nmdc:mga0n895_1236_c1
1748 nmdc:mga0n895_1358_c1
1749 nmdc:mga0n895_465883_c1
1750 nmdc:mga0rr50_142054_c1
1751 nmdc:mga08x19_10849_c1
1752 nmdc:mga08x19_43268_c1
1753 nmdc:mga0a205_118478_c1
1754 nmdc:mga0a205_60244_c1
1755 nmdc:mga0a205_9685_c1
1756 Ga0495601_0075375
1757 Ga0495612_0022110
1758 Ga0495595_0024736
1759 Ga0495619_0013352
1760 Ga0500583_0382792
1761 Ga0501082_0012531
1762 Ga0501082_0072357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

41

169

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9578 2 162
6fwh-assembly1.cif.gz_A acanthamoeba igpd in complex with r-c348 to 1.7a resolution 0.9541 3 171
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9528 2 165
5el9-assembly1.cif.gz_A a. thaliana igpd2 in complex with the triazole-phosphonate inhibitor, (s)-c348, to 1.1a resolution 0.9512 2 171
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.947 2 171
ID Description Score Start End Superfamily
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9789 2 72 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9705 2 72 3.30.230.40
af_Q2FUU0_1_87_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9641 2 72 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.952 82 161 3.30.230.40
5dnlA01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9412 4 77 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A7V9H8P3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 1 1 163 GO:0000105
GO:0004424
AF-X1G476-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9988 2 71 GO:0000105
GO:0004424
AF-X1JQP4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9956 2 71 GO:0000105
GO:0004424
AF-A0A7W1PIH3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.995 1 137 GO:0000105
GO:0004424
AF-A0A7V9H8P3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9943 1 163 GO:0000105
GO:0004424

Map