F484397

General Info

Members Datasets Scaffolds Average Seq Length
877 357 1754 88

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0143288|Ga0395901_0143288_1780_2103
Length 107
Sequence MSVRRLLLPSPGPRCGRFYVMPNIKQQKKRVRIAAEERLENLRYSSAVKTFTRRLRAAVADGDRDRISAEHRELVRQIDKAVAKGSLHRNAAARKKAQAAKLVSGSS

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
4 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
188 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
189 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
190 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
197 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
209 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
210 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
211 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
212 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
215 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
225 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
253 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
254 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
260 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
261 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
262 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
263 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
264 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
265 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
266 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
267 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
268 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
269 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
270 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
275 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
276 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
282 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
283 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
284 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
285 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
286 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
287 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
288 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
289 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
290 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
291 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
292 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
295 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
296 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
297 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
301 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
302 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
303 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
304 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
305 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
306 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
307 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
323 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
324 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
325 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
326 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
327 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
328 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
329 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
330 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
354 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.86
Metatranscriptomes 1.14
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.03
Nodule 0
Rhizoplane 3.76
Rhizosphere 94.64
Stem 0
Stem Tuber 0
Unclassified 24.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0143288 3300038443 Bacteria 2512
2 2214844107 2209111006 Unclassified 626
3 ARCol0yngRDRAFT_1001207 3300000652 Unclassified 2186
4 JGI24747J21853_1052053 3300001978 Bacteria 501
5 JGI24737J22298_10086399 3300001990 Unclassified 932
6 JGI24750J21931_1056447 3300002070 Unclassified 621
7 JGI24751J29686_10086328 3300002459 Bacteria 651
8 Ga0070658_10973777 3300005327 Bacteria 738
9 Ga0070658_11031398 3300005327 Unclassified 715
10 Ga0070676_10262441 3300005328 Unclassified 1157
11 Ga0070683_100029646 3300005329 Bacteria 4958
12 Ga0070683_100113027 3300005329 Bacteria 2563
13 Ga0070683_100155888 3300005329 Bacteria 2165
14 Ga0070683_100731772 3300005329 Bacteria 948
15 Ga0070670_100004293 3300005331 Bacteria 11932
16 Ga0070670_101284636 3300005331 Bacteria 670
17 Ga0068869_100765152 3300005334 Unclassified 828
18 Ga0070680_100017076 3300005336 Bacteria 5716
19 Ga0070680_100047883 3300005336 Bacteria 3482
20 Ga0070680_100184404 3300005336 Bacteria 1758
21 Ga0070682_100027482 3300005337 Bacteria 3414
22 Ga0070682_100039472 3300005337 Bacteria 2901
23 Ga0070682_100069359 3300005337 Unclassified 2251
24 Ga0070682_100207939 3300005337 Unclassified 1385
25 Ga0070682_100422299 3300005337 Bacteria 1014
26 Ga0070682_100538241 3300005337 Bacteria 912
27 Ga0068868_100052357 3300005338 Bacteria 3214
28 Ga0068868_100076443 3300005338 Bacteria 2677
29 Ga0068868_100274197 3300005338 Unclassified 1426
30 Ga0070660_100004020 3300005339 Bacteria 10151
31 Ga0070660_100051687 3300005339 Bacteria 3166
32 Ga0070660_100054676 3300005339 Bacteria 3083
33 Ga0070660_100069690 3300005339 Unclassified 2743
34 Ga0070660_100741137 3300005339 Bacteria 825
35 Ga0070689_100003774 3300005340 Bacteria 10146
36 Ga0070691_10007080 3300005341 Bacteria 5142
37 Ga0070691_10034986 3300005341 Bacteria 2365
38 Ga0070691_10067369 3300005341 Bacteria 1732
39 Ga0070691_10100715 3300005341 Bacteria 1435
40 Ga0070691_10201465 3300005341 Bacteria 1046
41 Ga0070691_10277784 3300005341 Unclassified 907
42 Ga0070687_100175273 3300005343 Unclassified 1280
43 Ga0070661_100032624 3300005344 Bacteria 3769
44 Ga0070661_100040181 3300005344 Bacteria 3411
45 Ga0070661_100051438 3300005344 Bacteria 3015
46 Ga0070661_100061220 3300005344 Bacteria 2762
47 Ga0070661_100211329 3300005344 Unclassified 1485
48 Ga0070661_100327878 3300005344 Bacteria 1197
49 Ga0070692_10263196 3300005345 Bacteria 1038
50 Ga0070692_10313588 3300005345 Unclassified 962
51 Ga0070692_10877169 3300005345 Bacteria 619
52 Ga0070668_100012799 3300005347 Bacteria 6246
53 Ga0070668_100106381 3300005347 Unclassified 2229
54 Ga0070669_100220227 3300005353 Bacteria 1500
55 Ga0070669_101617951 3300005353 Unclassified 564
56 Ga0070675_100022753 3300005354 Bacteria 5008
57 Ga0070675_100088535 3300005354 Unclassified 2591
58 Ga0070671_100050170 3300005355 Bacteria 3471
59 Ga0070674_100048016 3300005356 Bacteria 2928
60 Ga0070673_100125318 3300005364 Bacteria 2148
61 Ga0070673_100643777 3300005364 Unclassified 970
62 Ga0070688_100013097 3300005365 Bacteria 4668
63 Ga0070659_100004191 3300005366 Bacteria 10288
64 Ga0070659_100139846 3300005366 Unclassified 1971
65 Ga0070659_100191809 3300005366 Bacteria 1680
66 Ga0070659_100248844 3300005366 Bacteria 1473
67 Ga0070659_100455386 3300005366 Unclassified 1086
68 Ga0070659_100781266 3300005366 Bacteria 830
69 Ga0070709_10065998 3300005434 Unclassified 2319
70 Ga0070709_10602433 3300005434 Bacteria 846
71 Ga0070701_10036135 3300005438 Bacteria 2487
72 Ga0070705_100124794 3300005440 Bacteria 1669
73 Ga0070705_101454682 3300005440 Bacteria 573
74 Ga0070700_100022475 3300005441 Bacteria 3678
75 Ga0070700_100183854 3300005441 Bacteria 1457
76 Ga0070694_100204639 3300005444 Unclassified 1473
77 Ga0070694_100378890 3300005444 Bacteria 1103
78 Ga0070694_100510143 3300005444 Bacteria 958
79 Ga0070708_100026347 3300005445 Bacteria 4975
80 Ga0070708_100543202 3300005445 Bacteria 1096
81 Ga0070663_100018125 3300005455 Bacteria 4610
82 Ga0070663_100377550 3300005455 Unclassified 1154
83 Ga0070663_100745347 3300005455 Unclassified 836
84 Ga0070663_100851697 3300005455 Bacteria 785
85 Ga0070663_101461948 3300005455 Unclassified 607
86 Ga0070678_100093151 3300005456 Bacteria 2316
87 Ga0070678_100113926 3300005456 Bacteria 2121
88 Ga0070678_101752876 3300005456 Unclassified 585
89 Ga0070662_100026481 3300005457 Bacteria 4017
90 Ga0070681_10004205 3300005458 Bacteria 13637
91 Ga0070681_10026421 3300005458 Bacteria 5833
92 Ga0070681_10029317 3300005458 Bacteria 5526
93 Ga0070681_10039157 3300005458 Unclassified 4752
94 Ga0070681_10120245 3300005458 Bacteria 2562
95 Ga0070681_10133318 3300005458 Bacteria 2415
96 Ga0070681_10712138 3300005458 Bacteria 920
97 Ga0068867_100223726 3300005459 Bacteria 1518
98 Ga0068867_100344255 3300005459 Unclassified 1242
99 Ga0068867_100356219 3300005459 Bacteria 1222
100 Ga0068867_101451400 3300005459 Bacteria 638
101 Ga0068867_101923455 3300005459 Bacteria 558
102 Ga0070685_10002617 3300005466 Bacteria 9220
103 Ga0070685_10214238 3300005466 Bacteria 1259
104 Ga0070706_100100250 3300005467 Bacteria 2691
105 Ga0070698_100012820 3300005471 Bacteria 8876
106 Ga0070699_100725371 3300005518 Bacteria 908
107 Ga0070679_100016489 3300005530 Bacteria 7129
108 Ga0070679_100051786 3300005530 Unclassified 4089
109 Ga0070679_100053802 3300005530 Bacteria 4007
110 Ga0070679_100171922 3300005530 Unclassified 2139
111 Ga0070679_100370840 3300005530 Bacteria 1378
112 Ga0070679_100398849 3300005530 Bacteria 1321
113 Ga0070684_100026963 3300005535 Bacteria 4844
114 Ga0070684_100059030 3300005535 Bacteria 3353
115 Ga0070684_100083164 3300005535 Unclassified 2836
116 Ga0070684_101123807 3300005535 Bacteria 738
117 Ga0070697_100588795 3300005536 Unclassified 977
118 Ga0068853_100061202 3300005539 Bacteria 3255
119 Ga0068853_100204397 3300005539 Unclassified 1798
120 Ga0068853_100534876 3300005539 Unclassified 1109
121 Ga0068853_100554622 3300005539 Bacteria 1089
122 Ga0070672_100340813 3300005543 Bacteria 1276
123 Ga0070686_100012297 3300005544 Bacteria 4870
124 Ga0070686_100061669 3300005544 Bacteria 2424
125 Ga0070686_101124669 3300005544 Bacteria 650
126 Ga0070695_100325320 3300005545 Unclassified 1144
127 Ga0070695_101449799 3300005545 Unclassified 570
128 Ga0070696_100046066 3300005546 Bacteria 3023
129 Ga0070696_100090361 3300005546 Unclassified 2179
130 Ga0070696_100486377 3300005546 Bacteria 979
131 Ga0070696_100619929 3300005546 Bacteria 874
132 Ga0070693_100002576 3300005547 Bacteria 8347
133 Ga0070693_100028915 3300005547 Unclassified 3018
134 Ga0070693_100523434 3300005547 Bacteria 845
135 Ga0070665_100003372 3300005548 Bacteria 17091
136 Ga0070665_100004675 3300005548 Bacteria 14290
137 Ga0070704_100161901 3300005549 Unclassified 1770
138 Ga0070704_100268357 3300005549 Unclassified 1409
139 Ga0070704_100462325 3300005549 Bacteria 1095
140 Ga0070704_102123821 3300005549 Bacteria 522
141 Ga0068855_100026901 3300005563 Bacteria 6883
142 Ga0068855_100056594 3300005563 Bacteria 4600
143 Ga0068855_100085283 3300005563 Bacteria 3655
144 Ga0068855_100087106 3300005563 Bacteria 3610
145 Ga0068855_100099792 3300005563 Bacteria 3343
146 Ga0068855_100145330 3300005563 Bacteria 2700
147 Ga0068855_100383957 3300005563 Bacteria 1542
148 Ga0070664_100056774 3300005564 Bacteria 3326
149 Ga0070664_100569298 3300005564 Unclassified 1049
150 Ga0070664_100632732 3300005564 Bacteria 994
151 Ga0068857_100052743 3300005577 Bacteria 3607
152 Ga0068857_100081880 3300005577 Bacteria 2882
153 Ga0068857_100274491 3300005577 Unclassified 1550
154 Ga0068857_101073422 3300005577 Bacteria 777
155 Ga0068854_100057292 3300005578 Bacteria 2810
156 Ga0068854_100069149 3300005578 Unclassified 2577
157 Ga0068854_100182523 3300005578 Unclassified 1640
158 Ga0068854_100616682 3300005578 Bacteria 928
159 Ga0068854_101361307 3300005578 Unclassified 640
160 Ga0068856_100030809 3300005614 Bacteria 5245
161 Ga0068856_100208424 3300005614 Bacteria 1969
162 Ga0068856_100491018 3300005614 Unclassified 1249
163 Ga0068856_101498064 3300005614 Bacteria 688
164 Ga0068856_101982363 3300005614 Unclassified 593
165 Ga0070702_100030952 3300005615 Unclassified 2923
166 Ga0070702_100185144 3300005615 Unclassified 1366
167 Ga0070702_101256906 3300005615 Unclassified 599
168 Ga0068852_100052926 3300005616 Bacteria 3492
169 Ga0068852_100404257 3300005616 Unclassified 1344
170 Ga0068852_100958545 3300005616 Unclassified 874
171 Ga0068852_101491142 3300005616 Bacteria 699
172 Ga0068859_100742505 3300005617 Bacteria 1071
173 Ga0068866_10067979 3300005718 Bacteria 1872
174 Ga0068866_10616268 3300005718 Bacteria 735
175 Ga0068861_100004039 3300005719 Bacteria 9829
176 Ga0068861_100453555 3300005719 Bacteria 1149
177 Ga0068851_10228045 3300005834 Bacteria 1049
178 Ga0068870_10041791 3300005840 Unclassified 2384
179 Ga0068870_10434679 3300005840 Bacteria 862
180 Ga0068870_10470001 3300005840 Bacteria 832
181 Ga0068870_10714179 3300005840 Unclassified 693
182 Ga0068870_10818601 3300005840 Unclassified 652
183 Ga0068870_11222205 3300005840 Bacteria 545
184 Ga0068863_100896296 3300005841 Bacteria 887
185 Ga0068858_100883428 3300005842 Unclassified 874
186 Ga0068860_102257699 3300005843 Unclassified 565
187 Ga0068860_102427781 3300005843 Unclassified 544
188 Ga0068862_100087547 3300005844 Unclassified 2709
189 Ga0081455_10006006 3300005937 Bacteria 13168
190 Ga0081455_10140085 3300005937 Unclassified 1880
191 Ga0081540_1002188 3300005983 Bacteria 16164
192 Ga0081540_1030610 3300005983 Bacteria 2977
193 Ga0075365_10194479 3300006038 Unclassified 1420
194 Ga0075363_100229734 3300006048 Unclassified 1065
195 Ga0075432_10000461 3300006058 Bacteria 12043
196 Ga0075432_10018005 3300006058 Unclassified 2409
197 Ga0070716_101119217 3300006173 Unclassified 629
198 Ga0075367_10027362 3300006178 Bacteria 3244
199 Ga0097621_100038619 3300006237 Bacteria 3831
200 Ga0075428_100002927 3300006844 Bacteria 18606
201 Ga0075428_100056461 3300006844 Unclassified 4300
202 Ga0075428_100116177 3300006844 Bacteria 2914
203 Ga0075428_100216755 3300006844 Bacteria 2068
204 Ga0075431_100108803 3300006847 Unclassified 2860
205 Ga0075431_100295335 3300006847 Unclassified 1638
206 Ga0075433_10035247 3300006852 Bacteria 4302
207 Ga0075433_10224985 3300006852 Bacteria 1666
208 Ga0075433_11465387 3300006852 Unclassified 590
209 Ga0075434_100057148 3300006871 Bacteria 3878
210 Ga0075434_100083197 3300006871 Bacteria 3198
211 Ga0075434_100417130 3300006871 Bacteria 1363
212 Ga0075434_101199660 3300006871 Bacteria 771
213 Ga0075429_100054406 3300006880 Bacteria 3481
214 Ga0075429_100641003 3300006880 Bacteria 931
215 Ga0068865_100039816 3300006881 Bacteria 3190
216 Ga0068865_100083672 3300006881 Unclassified 2297
217 Ga0068865_100159037 3300006881 Unclassified 1721
218 Ga0068865_100818612 3300006881 Bacteria 804
219 Ga0068865_101348879 3300006881 Bacteria 635
220 Ga0075436_100122633 3300006914 Bacteria 1819
221 Ga0075436_100779747 3300006914 Bacteria 711
222 Ga0097620_100742438 3300006931 Bacteria 1071
223 Ga0075435_100011630 3300007076 Bacteria 6487
224 Ga0075435_100083320 3300007076 Unclassified 2629
225 Ga0075435_100246405 3300007076 Bacteria 1520
226 Ga0075435_101050587 3300007076 Bacteria 712
227 Ga0105244_10555514 3300009036 Unclassified 528
228 Ga0105240_10071711 3300009093 Bacteria 4283
229 Ga0105240_10268400 3300009093 Unclassified 1966
230 Ga0105240_10424666 3300009093 Bacteria 1492
231 Ga0105240_11454002 3300009093 Bacteria 719
232 Ga0111539_10000483 3300009094 Bacteria 50415
233 Ga0111539_10004184 3300009094 Bacteria 18936
234 Ga0111539_10164031 3300009094 Bacteria 2599
235 Ga0111539_10273113 3300009094 Unclassified 1968
236 Ga0105245_10001379 3300009098 Bacteria 21999
237 Ga0105245_10020869 3300009098 Bacteria 5742
238 Ga0105245_10059662 3300009098 Bacteria 3435
239 Ga0105245_10108014 3300009098 Bacteria 2584
240 Ga0105245_10275884 3300009098 Bacteria 1641
241 Ga0105245_12025969 3300009098 Unclassified 629
242 Ga0114129_10026232 3300009147 Bacteria 8253
243 Ga0114129_10517947 3300009147 Bacteria 1555
244 Ga0114129_11111957 3300009147 Unclassified 989
245 Ga0114129_12824929 3300009147 Unclassified 576
246 Ga0105243_10034919 3300009148 Bacteria 3897
247 Ga0105243_10075909 3300009148 Bacteria 2729
248 Ga0105241_10043669 3300009174 Bacteria 3395
249 Ga0105241_10279762 3300009174 Bacteria 1424
250 Ga0105241_10872022 3300009174 Bacteria 834
251 Ga0105242_10220483 3300009176 Bacteria 1695
252 Ga0105242_10343508 3300009176 Bacteria 1376
253 Ga0105248_10085552 3300009177 Bacteria 3548
254 Ga0105237_10022728 3300009545 Bacteria 6434
255 Ga0105237_10150488 3300009545 Unclassified 2324
256 Ga0105237_12424549 3300009545 Unclassified 535
257 Ga0105238_10028446 3300009551 Bacteria 5694
258 Ga0105238_10057436 3300009551 Bacteria 3901
259 Ga0105238_10719059 3300009551 Bacteria 1011
260 Ga0105238_10942751 3300009551 Unclassified 883
261 Ga0105249_10022281 3300009553 Bacteria 5675
262 Ga0105249_10136595 3300009553 Unclassified 2347
263 Ga0105249_10665554 3300009553 Unclassified 1099
264 Ga0105249_12325366 3300009553 Bacteria 609
265 Ga0105249_12774164 3300009553 Bacteria 562
266 Ga0105239_10151122 3300010375 Unclassified 2591
267 Ga0105239_10180465 3300010375 Bacteria 2362
268 Ga0105239_10273783 3300010375 Unclassified 1899
269 Ga0105239_10292632 3300010375 Bacteria 1834
270 Ga0105239_10882106 3300010375 Bacteria 1026
271 Ga0105239_13214856 3300010375 Bacteria 532
272 Ga0105246_10015407 3300011119 Bacteria 4829
273 Ga0105246_10102170 3300011119 Unclassified 2090
274 Ga0105246_10731582 3300011119 Bacteria 870
275 Ga0105246_11710392 3300011119 Unclassified 598
276 Ga0157316_1003391 3300012510 Unclassified 1147
277 Ga0157373_10010162 3300013100 Bacteria 6933
278 Ga0157373_10178559 3300013100 Bacteria 1495
279 Ga0157373_10309800 3300013100 Unclassified 1122
280 Ga0157373_10448377 3300013100 Bacteria 928
281 Ga0157373_11293122 3300013100 Unclassified 552
282 Ga0157371_10251315 3300013102 Bacteria 1273
283 Ga0157371_10568442 3300013102 Bacteria 841
284 Ga0157370_10020350 3300013104 Bacteria 6628
285 Ga0157370_10020774 3300013104 Bacteria 6552
286 Ga0157370_10148352 3300013104 Bacteria 2183
287 Ga0157370_10353642 3300013104 Bacteria 1354
288 Ga0157369_10015314 3300013105 Bacteria 8647
289 Ga0157369_10051364 3300013105 Bacteria 4461
290 Ga0157369_10192440 3300013105 Unclassified 2143
291 Ga0157369_10778406 3300013105 Bacteria 984
292 Ga0157369_11614538 3300013105 Bacteria 659
293 Ga0157374_10262783 3300013296 Bacteria 1700
294 Ga0157374_11099496 3300013296 Bacteria 815
295 Ga0157374_11705925 3300013296 Bacteria 655
296 Ga0157378_11120696 3300013297 Bacteria 824
297 Ga0163162_10122856 3300013306 Bacteria 2701
298 Ga0163162_10173123 3300013306 Unclassified 2283
299 Ga0163162_10530942 3300013306 Unclassified 1306
300 Ga0157372_10007863 3300013307 Bacteria 11332
301 Ga0157372_10119843 3300013307 Bacteria 3021
302 Ga0157372_10437467 3300013307 Bacteria 1524
303 Ga0157372_11594983 3300013307 Bacteria 751
304 Ga0157372_12148938 3300013307 Unclassified 641
305 Ga0157372_13043469 3300013307 Bacteria 536
306 Ga0157375_10050701 3300013308 Bacteria 4072
307 Ga0157375_11561608 3300013308 Unclassified 780
308 Ga0157375_12222052 3300013308 Unclassified 654
309 Ga0163163_10061159 3300014325 Bacteria 3731
310 Ga0163163_10190410 3300014325 Bacteria 2100
311 Ga0163163_10240064 3300014325 Bacteria 1862
312 Ga0163163_10664589 3300014325 Bacteria 1105
313 Ga0163163_13284084 3300014325 Bacteria 504
314 Ga0157380_11052040 3300014326 Bacteria 850
315 Ga0157380_12369182 3300014326 Bacteria 596
316 Ga0182008_10378925 3300014497 Unclassified 756
317 Ga0182008_10573538 3300014497 Bacteria 630
318 Ga0157377_10052985 3300014745 Bacteria 2292
319 Ga0157377_10068182 3300014745 Unclassified 2050
320 Ga0157377_10165281 3300014745 Bacteria 1379
321 Ga0157377_11197990 3300014745 Unclassified 588
322 Ga0157376_10051798 3300014969 Bacteria 3411
323 Ga0157376_10703166 3300014969 Bacteria 1016
324 Ga0157376_11033325 3300014969 Bacteria 845
325 Ga0163161_10020642 3300017792 Bacteria 4626
326 Ga0163161_10101804 3300017792 Bacteria 2139
327 Ga0197907_10381642 3300020069 Bacteria 1311
328 Ga0206356_10893813 3300020070 Unclassified 2868
329 Ga0206356_11691718 3300020070 Bacteria 620
330 Ga0206354_10655524 3300020081 Bacteria 2648
331 Ga0206354_11064529 3300020081 Unclassified 1835
332 Ga0206353_10019772 3300020082 Bacteria 649
333 Ga0206353_10184386 3300020082 Unclassified 1193
334 Ga0206353_10588121 3300020082 Bacteria 1732
335 Ga0206353_11289376 3300020082 Bacteria 747
336 Ga0224712_10285904 3300022467 Unclassified 769
337 Ga0207692_10571233 3300025898 Bacteria 724
338 Ga0207692_10798034 3300025898 Unclassified 617
339 Ga0207642_10106239 3300025899 Bacteria 1420
340 Ga0207688_10029329 3300025901 Bacteria 3028
341 Ga0207688_10088948 3300025901 Bacteria 1771
342 Ga0207699_10237408 3300025906 Bacteria 1251
343 Ga0207645_10034937 3300025907 Bacteria 3228
344 Ga0207643_10001826 3300025908 Bacteria 11805
345 Ga0207643_10046142 3300025908 Bacteria 2463
346 Ga0207705_10027534 3300025909 Bacteria 4053
347 Ga0207705_10129551 3300025909 Bacteria 1877
348 Ga0207684_10062371 3300025910 Bacteria 3165
349 Ga0207684_10190423 3300025910 Unclassified 1769
350 Ga0207654_10051699 3300025911 Bacteria 2366
351 Ga0207654_10154676 3300025911 Bacteria 1476
352 Ga0207654_10566411 3300025911 Bacteria 808
353 Ga0207707_10054970 3300025912 Bacteria 3464
354 Ga0207707_10071510 3300025912 Bacteria 3023
355 Ga0207707_10072380 3300025912 Bacteria 3005
356 Ga0207707_10105283 3300025912 Bacteria 2466
357 Ga0207707_10251253 3300025912 Unclassified 1536
358 Ga0207707_11604343 3300025912 Bacteria 512
359 Ga0207695_10192103 3300025913 Unclassified 1959
360 Ga0207695_11129340 3300025913 Bacteria 664
361 Ga0207671_10151354 3300025914 Bacteria 1792
362 Ga0207671_10153650 3300025914 Unclassified 1779
363 Ga0207671_11082927 3300025914 Unclassified 630
364 Ga0207693_10061795 3300025915 Bacteria 2934
365 Ga0207693_10814431 3300025915 Bacteria 719
366 Ga0207663_10019136 3300025916 Bacteria 3850
367 Ga0207660_10032133 3300025917 Bacteria 3621
368 Ga0207660_10035433 3300025917 Bacteria 3466
369 Ga0207660_10184149 3300025917 Bacteria 1623
370 Ga0207660_10195234 3300025917 Unclassified 1578
371 Ga0207662_10036660 3300025918 Bacteria 2867
372 Ga0207657_10000467 3300025919 Bacteria 42840
373 Ga0207657_10000731 3300025919 Bacteria 34878
374 Ga0207657_10033593 3300025919 Unclassified 4623
375 Ga0207657_10072051 3300025919 Bacteria 2924
376 Ga0207657_10170245 3300025919 Unclassified 1765
377 Ga0207657_10184231 3300025919 Bacteria 1687
378 Ga0207657_10500669 3300025919 Unclassified 952
379 Ga0207649_10014002 3300025920 Bacteria 4489
380 Ga0207649_10067545 3300025920 Bacteria 2270
381 Ga0207649_10201225 3300025920 Bacteria 1407
382 Ga0207649_10291502 3300025920 Bacteria 1190
383 Ga0207652_10029820 3300025921 Bacteria 4565
384 Ga0207652_10047514 3300025921 Bacteria 3666
385 Ga0207652_10069746 3300025921 Bacteria 3052
386 Ga0207652_10071978 3300025921 Bacteria 3005
387 Ga0207652_10113398 3300025921 Bacteria 2406
388 Ga0207652_10191399 3300025921 Bacteria 1840
389 Ga0207652_10200392 3300025921 Bacteria 1796
390 Ga0207652_10360937 3300025921 Unclassified 1311
391 Ga0207646_10475425 3300025922 Bacteria 1127
392 Ga0207681_10427786 3300025923 Bacteria 1074
393 Ga0207694_10046466 3300025924 Bacteria 3356
394 Ga0207694_10143163 3300025924 Bacteria 1923
395 Ga0207694_10819375 3300025924 Unclassified 786
396 Ga0207650_10475642 3300025925 Bacteria 1042
397 Ga0207659_10077356 3300025926 Unclassified 2449
398 Ga0207687_10039162 3300025927 Unclassified 3244
399 Ga0207687_10499823 3300025927 Bacteria 1015
400 Ga0207687_11117551 3300025927 Bacteria 677
401 Ga0207664_11462055 3300025929 Bacteria 605
402 Ga0207644_10151842 3300025931 Bacteria 1793
403 Ga0207690_10026602 3300025932 Bacteria 3644
404 Ga0207690_10264722 3300025932 Unclassified 1333
405 Ga0207690_11583860 3300025932 Bacteria 547
406 Ga0207706_10006904 3300025933 Bacteria 10500
407 Ga0207686_10257160 3300025934 Bacteria 1278
408 Ga0207709_10048106 3300025935 Unclassified 2597
409 Ga0207709_10570505 3300025935 Bacteria 892
410 Ga0207669_10005301 3300025937 Bacteria 5769
411 Ga0207669_10099012 3300025937 Unclassified 1922
412 Ga0207704_10007727 3300025938 Bacteria 5099
413 Ga0207704_10335049 3300025938 Bacteria 1172
414 Ga0207704_10468823 3300025938 Bacteria 1009
415 Ga0207665_10001983 3300025939 Bacteria 13791
416 Ga0207665_10395148 3300025939 Unclassified 1052
417 Ga0207665_10600325 3300025939 Bacteria 859
418 Ga0207711_10485872 3300025941 Bacteria 1151
419 Ga0207689_10027077 3300025942 Bacteria 4799
420 Ga0207689_10131692 3300025942 Bacteria 2058
421 Ga0207689_10302189 3300025942 Unclassified 1326
422 Ga0207689_10339157 3300025942 Unclassified 1248
423 Ga0207661_10219589 3300025944 Bacteria 1679
424 Ga0207661_10237678 3300025944 Bacteria 1615
425 Ga0207661_10450548 3300025944 Bacteria 1172
426 Ga0207661_11184357 3300025944 Unclassified 703
427 Ga0207661_11360667 3300025944 Unclassified 652
428 Ga0207661_11381924 3300025944 Unclassified 646
429 Ga0207661_11748784 3300025944 Bacteria 567
430 Ga0207661_11921883 3300025944 Bacteria 537
431 Ga0207679_10181219 3300025945 Unclassified 1743
432 Ga0207679_10228018 3300025945 Bacteria 1571
433 Ga0207679_10702118 3300025945 Bacteria 918
434 Ga0207679_11234490 3300025945 Bacteria 686
435 Ga0207667_10047992 3300025949 Bacteria 4516
436 Ga0207667_10055691 3300025949 Bacteria 4157
437 Ga0207667_10076403 3300025949 Bacteria 3476
438 Ga0207667_10138219 3300025949 Bacteria 2509
439 Ga0207667_10166210 3300025949 Bacteria 2268
440 Ga0207667_10334528 3300025949 Bacteria 1546
441 Ga0207667_12145574 3300025949 Unclassified 517
442 Ga0207651_10100351 3300025960 Bacteria 2146
443 Ga0207651_11981131 3300025960 Unclassified 523
444 Ga0207712_10024008 3300025961 Bacteria 4032
445 Ga0207712_10033899 3300025961 Bacteria 3455
446 Ga0207668_10098019 3300025972 Unclassified 2171
447 Ga0207668_10118821 3300025972 Bacteria 1998
448 Ga0207668_10322373 3300025972 Unclassified 1282
449 Ga0207640_10075865 3300025981 Unclassified 2280
450 Ga0207640_10082353 3300025981 Bacteria 2203
451 Ga0207640_10259968 3300025981 Unclassified 1352
452 Ga0207639_10083877 3300026041 Unclassified 2530
453 Ga0207678_10080492 3300026067 Unclassified 2789
454 Ga0207678_11013350 3300026067 Bacteria 735
455 Ga0207708_10011473 3300026075 Bacteria 6602
456 Ga0207708_10037886 3300026075 Unclassified 3673
457 Ga0207708_10209939 3300026075 Bacteria 1556
458 Ga0207708_10275707 3300026075 Bacteria 1361
459 Ga0207702_10256927 3300026078 Bacteria 1643
460 Ga0207702_10804426 3300026078 Bacteria 929
461 Ga0207641_10803993 3300026088 Bacteria 930
462 Ga0207648_10067794 3300026089 Bacteria 3110
463 Ga0207648_10314967 3300026089 Bacteria 1405
464 Ga0207648_10631573 3300026089 Unclassified 989
465 Ga0207648_10981468 3300026089 Bacteria 791
466 Ga0207676_10477075 3300026095 Bacteria 1181
467 Ga0207674_10017840 3300026116 Bacteria 7737
468 Ga0207674_10224371 3300026116 Unclassified 1827
469 Ga0207674_10669002 3300026116 Bacteria 1002
470 Ga0207675_100000792 3300026118 Bacteria 31451
471 Ga0207675_100142480 3300026118 Unclassified 2277
472 Ga0207683_10017553 3300026121 Bacteria 6101
473 Ga0207683_10026950 3300026121 Bacteria 4966
474 Ga0207698_10031836 3300026142 Bacteria 3813
475 Ga0207698_10054316 3300026142 Unclassified 3082
476 Ga0207698_10221785 3300026142 Bacteria 1709
477 Ga0207698_11262251 3300026142 Bacteria 753
478 Ga0209966_1109360 3300027695 Unclassified 629
479 Ga0207428_10000196 3300027907 Bacteria 84609
480 Ga0207428_10023492 3300027907 Bacteria 5186
481 Ga0207428_10038882 3300027907 Bacteria 3865
482 Ga0207428_10123914 3300027907 Bacteria 1980
483 Ga0207428_10352850 3300027907 Unclassified 1082
484 Ga0207428_10436726 3300027907 Bacteria 955
485 Ga0268266_10134451 3300028379 Bacteria 2214
486 Ga0268266_10693120 3300028379 Bacteria 981
487 Ga0268265_10113510 3300028380 Unclassified 2217
488 Ga0268265_10380175 3300028380 Unclassified 1299
489 Ga0268264_10898715 3300028381 Bacteria 889
490 Ga0268264_11594476 3300028381 Unclassified 663
491 Ga0307405_10043409 3300031731 Unclassified 2743
492 Ga0307413_10779240 3300031824 Bacteria 802
493 Ga0307406_11723478 3300031901 Bacteria 556
494 Ga0307412_10669810 3300031911 Bacteria 887
495 Ga0307409_100861911 3300031995 Bacteria 917
496 Ga0307416_100130815 3300032002 Unclassified 2259
497 Ga0307416_100158582 3300032002 Bacteria 2087
498 Ga0373930_0154200 3300034816 Bacteria 578
499 Ga0373938_0020233 3300034957 Unclassified 1339
500 Ga0373949_0120091 3300035090 Unclassified 737
501 Ga0373949_0233749 3300035090 Bacteria 563
502 Ga0373952_0210989 3300035092 Bacteria 573
503 Ga0373932_0235368 3300035112 Unclassified 663
504 Ga0373936_0069926 3300035113 Bacteria 1445
505 Ga0373939_0013189 3300035114 Bacteria 2122
506 Ga0373945_0009560 3300035116 Bacteria 3180
507 Ga0373945_0177961 3300035116 Bacteria 874
508 Ga0373960_0021450 3300035121 Bacteria 1718
509 Ga0373943_0010858 3300035170 Bacteria 4089
510 Ga0373943_0092909 3300035170 Bacteria 1565
511 Ga0373946_0763483 3300035171 Unclassified 508
512 Ga0373931_0375379 3300035691 Bacteria 895
513 Ga0373935_0054335 3300035692 Bacteria 2550
514 Ga0373935_0075407 3300035692 Bacteria 2182
515 Ga0373947_0000533 3300035725 Bacteria 22256
516 Ga0373947_0007052 3300035725 Bacteria 6513
517 Ga0373925_0004302 3300037068 Bacteria 10786
518 Ga0373925_0005142 3300037068 Bacteria 9804
519 Ga0395899_0019101 3300037312 Bacteria 5209
520 Ga0395899_0103369 3300037312 Bacteria 2055
521 Ga0395899_0342688 3300037312 Bacteria 1002
522 Ga0395899_0664437 3300037312 Bacteria 657
523 Ga0395900_0002857 3300037418 Bacteria 18833
524 Ga0395900_0007033 3300037418 Bacteria 11651
525 Ga0395900_0024664 3300037418 Bacteria 6154
526 Ga0395900_0132501 3300037418 Bacteria 2554
527 Ga0395900_0223612 3300037418 Bacteria 1896
528 Ga0395900_0496441 3300037418 Unclassified 1171
529 Ga0395900_0505405 3300037418 Unclassified 1158
530 Ga0395900_0585983 3300037418 Bacteria 1057
531 Ga0395900_1794388 3300037418 Unclassified 524
532 Ga0395898_0005912 3300037466 Bacteria 13149
533 Ga0395898_0049255 3300037466 Bacteria 4128
534 Ga0395898_0119559 3300037466 Unclassified 2524
535 Ga0395898_0127401 3300037466 Unclassified 2439
536 Ga0395898_0139447 3300037466 Bacteria 2321
537 Ga0395898_0199860 3300037466 Bacteria 1909
538 Ga0395898_0210539 3300037466 Bacteria 1854
539 Ga0395898_0244486 3300037466 Bacteria 1711
540 Ga0395898_0751481 3300037466 Unclassified 916
541 Ga0395898_1018596 3300037466 Unclassified 763
542 Ga0395898_1399223 3300037466 Bacteria 627
543 Ga0395898_1444569 3300037466 Bacteria 615
544 Ga0395905_0000568 3300037471 Bacteria 50013
545 Ga0395905_0074777 3300037471 Bacteria 3175
546 Ga0395905_0155309 3300037471 Bacteria 2152
547 Ga0395905_0196194 3300037471 Unclassified 1893
548 Ga0395905_0272235 3300037471 Unclassified 1579
549 Ga0395905_0799707 3300037471 Bacteria 846
550 Ga0395905_0857099 3300037471 Unclassified 811
551 Ga0436364_0135606 3300037853 Bacteria 1088
552 Ga0395901_0001508 3300038443 Bacteria 24209
553 Ga0395901_0001844 3300038443 Bacteria 21899
554 Ga0395901_0020113 3300038443 Bacteria 6831
555 Ga0395901_0022801 3300038443 Bacteria 6419
556 Ga0395901_0099773 3300038443 Unclassified 3045
557 Ga0395901_0154003 3300038443 Bacteria 2414
558 Ga0395901_0166266 3300038443 Unclassified 2316
559 Ga0395901_0273538 3300038443 Bacteria 1756
560 Ga0395901_0434011 3300038443 Unclassified 1345
561 Ga0395901_1552502 3300038443 Bacteria 617
562 Ga0395901_1718000 3300038443 Bacteria 578
563 Ga0436365_1360505 3300039437 Bacteria 5265
564 Ga0436363_1283513 3300039450 Bacteria 1365
565 Ga0451800_1206920 3300041459 Bacteria 914
566 Ga0451841_0962610 3300041498 Bacteria 850
567 Ga0451853_3046892 3300041512 Unclassified 974
568 Ga0439448_0036216 3300042005 Unclassified 1582
569 Ga0439448_0050431 3300042005 Bacteria 1362
570 Ga0439450_191670 3300042008 Unclassified 545
571 Ga0439450_214576 3300042008 Unclassified 517
572 Ga0439458_0024941 3300042157 Unclassified 1400
573 Ga0439459_0008300 3300042438 Unclassified 1772
574 Ga0439460_0302318 3300042461 Bacteria 559
575 Ga0466965_0213282 3300044683 Bacteria 1027
576 Ga0466965_0556251 3300044683 Bacteria 648
577 Ga0466966_0012700 3300044684 Bacteria 5582
578 Ga0466961_0062856 3300044693 Bacteria 2359
579 Ga0466961_0222985 3300044693 Bacteria 1162
580 Ga0466963_0000743 3300044694 Bacteria 16069
581 Ga0466963_0003907 3300044694 Bacteria 8612
582 Ga0466963_0011801 3300044694 Bacteria 5330
583 Ga0466963_0016083 3300044694 Bacteria 4647
584 Ga0466963_0702603 3300044694 Bacteria 713
585 Ga0466964_0057077 3300044706 Unclassified 1615
586 Ga0466964_0288249 3300044706 Bacteria 823
587 Ga0466964_0371995 3300044706 Bacteria 739
588 Ga0466971_0253830 3300044719 Bacteria 838
589 Ga0466968_0102500 3300044735 Bacteria 1279
590 Ga0466957_0035500 3300044842 Bacteria 2991
591 Ga0466957_0037750 3300044842 Bacteria 2909
592 Ga0466957_1166679 3300044842 Bacteria 557
593 Ga0466957_1365385 3300044842 Bacteria 515
594 Ga0466960_0059143 3300044901 Bacteria 1874
595 Ga0466960_0199030 3300044901 Bacteria 1094
596 Ga0466960_0404126 3300044901 Bacteria 787
597 Ga0466959_0116832 3300045049 Unclassified 1899
598 Ga0466959_0117305 3300045049 Bacteria 1895
599 Ga0466959_0414820 3300045049 Bacteria 914
600 Ga0466959_0470427 3300045049 Bacteria 851
601 Ga0451576_0076759 3300045051 Unclassified 3477
602 Ga0451576_0799670 3300045051 Bacteria 990
603 Ga0451576_1672917 3300045051 Unclassified 659
604 Ga0466958_0188522 3300045836 Unclassified 1310
605 Ga0466958_0215460 3300045836 Bacteria 1224
606 Ga0466958_0735974 3300045836 Bacteria 643
607 Ga0466967_0017646 3300045976 Bacteria 5676
608 Ga0466967_0025753 3300045976 Bacteria 4854
609 Ga0466967_0086552 3300045976 Bacteria 2839
610 Ga0466967_0150849 3300045976 Bacteria 2172
611 Ga0466967_0252259 3300045976 Bacteria 1686
612 Ga0466967_0323005 3300045976 Bacteria 1489
613 Ga0466967_0466491 3300045976 Unclassified 1236
614 Ga0466967_0563334 3300045976 Bacteria 1122
615 Ga0466967_1419134 3300045976 Bacteria 691
616 Ga0466967_1680503 3300045976 Bacteria 632
617 Ga0495617_196152 3300046452 Unclassified 632
618 Ga0495627_209246 3300046453 Unclassified 537
619 Ga0495592_0358570 3300046454 Bacteria 933
620 Ga0495603_0001442 3300046455 Bacteria 13834
621 Ga0495590_0161515 3300046457 Unclassified 815
622 Ga0495591_093021 3300046458 Bacteria 755
623 Ga0495629_0281263 3300046459 Bacteria 1141
624 Ga0495638_0220396 3300046460 Bacteria 1061
625 Ga0495641_0001137 3300046461 Bacteria 22903
626 Ga0495651_0540941 3300046462 Bacteria 741
627 Ga0495653_0319535 3300046463 Bacteria 1007
628 Ga0495580_0024689 3300046472 Bacteria 4398
629 Ga0495582_0508520 3300046473 Bacteria 696
630 Ga0495605_0152583 3300046474 Bacteria 1030
631 Ga0495605_0229594 3300046474 Bacteria 800
632 Ga0495639_0092991 3300046475 Bacteria 1417
633 Ga0495664_0871479 3300046477 Bacteria 527
634 Ga0495584_0031556 3300046491 Bacteria 2682
635 Ga0495584_0102989 3300046491 Bacteria 1443
636 Ga0495584_0113837 3300046491 Bacteria 1369
637 Ga0495584_0147462 3300046491 Bacteria 1195
638 Ga0495585_0073866 3300046492 Bacteria 1856
639 Ga0495596_0148636 3300046500 Bacteria 910
640 Ga0495607_0099665 3300046501 Bacteria 1558
641 Ga0495607_0116113 3300046501 Bacteria 1412
642 Ga0495608_0118464 3300046511 Unclassified 1699
643 Ga0495616_0062508 3300046513 Bacteria 1823
644 Ga0495618_0576325 3300046514 Bacteria 672
645 Ga0495628_0089479 3300046516 Bacteria 2384
646 Ga0495630_0241726 3300046517 Bacteria 1379
647 Ga0495630_0329553 3300046517 Bacteria 1167
648 Ga0495637_0072954 3300046520 Unclassified 1381
649 Ga0495643_0115895 3300046522 Bacteria 1358
650 Ga0495644_0040461 3300046523 Bacteria 1757
651 Ga0495644_0361866 3300046523 Unclassified 572
652 Ga0495663_0039737 3300046525 Bacteria 1426
653 Ga0495666_0030512 3300046526 Bacteria 2645
654 Ga0495652_0060460 3300046529 Bacteria 3202
655 Ga0495654_0054023 3300046530 Bacteria 1950
656 Ga0495640_0365558 3300046533 Bacteria 889
657 Ga0495586_0011957 3300046535 Bacteria 4611
658 Ga0495598_0002624 3300046537 Bacteria 3722
659 Ga0495609_0029943 3300046538 Bacteria 2477
660 Ga0495609_0070700 3300046538 Bacteria 1534
661 Ga0495621_0091796 3300046539 Unclassified 1145
662 Ga0495621_0307785 3300046539 Bacteria 658
663 Ga0495622_0178440 3300046557 Unclassified 953
664 Ga0495633_0367589 3300046558 Bacteria 651
665 Ga0495633_0490530 3300046558 Unclassified 554
666 Ga0495667_0607962 3300046559 Unclassified 681
667 Ga0495656_0020197 3300046615 Bacteria 2581
668 Ga0495656_0468026 3300046615 Bacteria 665
669 Ga0495668_0115958 3300046616 Bacteria 1465
670 Ga0495668_0842471 3300046616 Unclassified 508
671 Ga0495634_0270683 3300046642 Bacteria 1034
672 Ga0495611_0165473 3300046648 Unclassified 1034
673 Ga0495659_0034272 3300046664 Bacteria 1785
674 Ga0495659_0054242 3300046664 Bacteria 1466
675 Ga0495657_0391294 3300046675 Unclassified 819
676 Ga0495599_0418419 3300046678 Bacteria 796
677 Ga0495658_0090430 3300046683 Bacteria 1812
678 Ga0495658_0236207 3300046683 Bacteria 1147
679 Ga0495613_0029948 3300046689 Bacteria 4044
680 Ga0495670_0076392 3300046691 Bacteria 1702
681 Ga0495670_0182764 3300046691 Bacteria 1107
682 Ga0495671_0023230 3300046692 Unclassified 3241
683 Ga0495671_0240615 3300046692 Bacteria 874
684 Ga0495589_0091290 3300046794 Bacteria 1479
685 Ga0495660_0052786 3300046810 Bacteria 2208
686 Ga0495581_0449843 3300047315 Unclassified 750
687 Ga0495636_0309298 3300047318 Bacteria 740
688 Ga0495636_0350394 3300047318 Unclassified 697
689 Ga0495674_0037327 3300047319 Bacteria 4366
690 Ga0495674_0057423 3300047319 Bacteria 3406
691 Ga0495676_0004439 3300047321 Bacteria 12831
692 Ga0495676_0152464 3300047321 Bacteria 1643
693 Ga0495683_0134032 3300047323 Unclassified 1166
694 Ga0495677_0102244 3300047445 Bacteria 1086
695 Ga0495679_077589 3300047446 Bacteria 948
696 Ga0495685_060001 3300047447 Bacteria 1283
697 Ga0495684_0239030 3300047471 Bacteria 1326
698 Ga0495614_0185542 3300048089 Bacteria 937
699 Ga0495615_0040955 3300048090 Bacteria 1156
700 Ga0495615_0158045 3300048090 Unclassified 679
701 Ga0495626_0406239 3300048091 Unclassified 526
702 Ga0496100_0107149 3300048903 Unclassified 1935
703 Ga0496100_0546977 3300048903 Unclassified 895
704 Ga0496102_0069469 3300048905 Bacteria 3233
705 Ga0496102_0332158 3300048905 Unclassified 1432
706 Ga0496102_1118018 3300048905 Bacteria 708
707 Ga0496103_0001272 3300048906 Bacteria 17185
708 Ga0496104_0068050 3300048907 Bacteria 3383
709 Ga0496104_0145904 3300048907 Bacteria 2272
710 Ga0496105_0040024 3300048908 Bacteria 3864
711 Ga0496105_0087274 3300048908 Bacteria 2577
712 Ga0496108_0030725 3300048911 Bacteria 4451
713 Ga0496108_0031161 3300048911 Bacteria 4422
714 Ga0496108_0080685 3300048911 Bacteria 2756
715 Ga0496109_0017493 3300048912 Bacteria 6285
716 Ga0496109_0045948 3300048912 Bacteria 3965
717 Ga0496109_0391846 3300048912 Bacteria 1312
718 Ga0496109_0658730 3300048912 Archaea 984
719 Ga0496109_0697472 3300048912 Bacteria 952
720 Ga0496109_0759751 3300048912 Bacteria 907
721 Ga0496110_0027599 3300048913 Bacteria 4867
722 Ga0496110_0040053 3300048913 Bacteria 4082
723 Ga0496110_0343280 3300048913 Bacteria 1360
724 Ga0496110_0621323 3300048913 Bacteria 979
725 Ga0496111_0028098 3300048914 Bacteria 3984
726 Ga0496111_0974635 3300048914 Bacteria 608
727 Ga0496112_0140642 3300048915 Bacteria 2383
728 Ga0496112_0154778 3300048915 Bacteria 2260
729 Ga0496113_0049910 3300048916 Bacteria 3117
730 Ga0496113_0285579 3300048916 Bacteria 1320
731 Ga0496113_0476688 3300048916 Unclassified 1002
732 Ga0496113_1308342 3300048916 Bacteria 563
733 Ga0496115_0301259 3300048918 Unclassified 1313
734 Ga0501031_0791810 3300049568 Bacteria 608
735 Ga0501032_0086020 3300049569 Bacteria 2090
736 Ga0501032_0207989 3300049569 Bacteria 1276
737 Ga0501033_0152133 3300049570 Unclassified 1669
738 Ga0501036_0008255 3300049572 Bacteria 8536
739 Ga0501036_0054381 3300049572 Bacteria 3391
740 Ga0501036_0182990 3300049572 Bacteria 1764
741 Ga0501036_1503353 3300049572 Bacteria 545
742 Ga0501037_0177334 3300049573 Bacteria 1513
743 Ga0501037_0191611 3300049573 Bacteria 1447
744 Ga0501038_0102375 3300049574 Bacteria 2383
745 Ga0501038_0135942 3300049574 Unclassified 2014
746 Ga0501038_1087868 3300049574 Bacteria 584
747 Ga0501039_0005748 3300049575 Bacteria 9390
748 Ga0501039_0040396 3300049575 Bacteria 3601
749 Ga0501039_0288171 3300049575 Bacteria 1291
750 Ga0501040_0014913 3300049576 Bacteria 5131
751 Ga0501040_0122600 3300049576 Unclassified 1824
752 Ga0501040_0434922 3300049576 Bacteria 944
753 Ga0501040_0543641 3300049576 Bacteria 838
754 Ga0501040_0869225 3300049576 Bacteria 653
755 Ga0501041_0013301 3300049577 Bacteria 4876
756 Ga0501041_0193853 3300049577 Bacteria 1273
757 Ga0501041_0355648 3300049577 Bacteria 926
758 Ga0501041_0724316 3300049577 Bacteria 637
759 Ga0501042_0012634 3300049578 Bacteria 5728
760 Ga0501043_0134523 3300049579 Bacteria 1937
761 Ga0501043_0216468 3300049579 Unclassified 1483
762 Ga0501046_0015766 3300049580 Bacteria 6344
763 Ga0501046_0073305 3300049580 Bacteria 2657
764 Ga0501048_0016652 3300049582 Bacteria 5420
765 Ga0501048_0110789 3300049582 Unclassified 1938
766 Ga0501067_0007929 3300049583 Bacteria 5898
767 Ga0501067_0008781 3300049583 Bacteria 5598
768 Ga0501067_0163793 3300049583 Bacteria 1238
769 Ga0501067_0591902 3300049583 Bacteria 622
770 Ga0501067_0759140 3300049583 Bacteria 546
771 Ga0501068_0028112 3300049584 Bacteria 3323
772 Ga0501068_0317711 3300049584 Bacteria 998
773 Ga0501068_0461380 3300049584 Bacteria 822
774 Ga0501068_0797315 3300049584 Bacteria 619
775 Ga0501068_1027469 3300049584 Bacteria 544
776 Ga0501069_0006739 3300049585 Bacteria 6012
777 Ga0501069_0040999 3300049585 Bacteria 2558
778 Ga0501069_0089266 3300049585 Bacteria 1742
779 Ga0501070_0098290 3300049586 Unclassified 2421
780 Ga0501070_0174680 3300049586 Bacteria 1769
781 Ga0501070_0282188 3300049586 Bacteria 1355
782 Ga0501071_0003446 3300049587 Bacteria 9881
783 Ga0501071_0017284 3300049587 Bacteria 4972
784 Ga0501071_0047094 3300049587 Bacteria 3097
785 Ga0501071_0426790 3300049587 Bacteria 1013
786 Ga0501072_0002483 3300049588 Bacteria 13814
787 Ga0501072_0004929 3300049588 Bacteria 10151
788 Ga0501072_0073843 3300049588 Bacteria 2696
789 Ga0501072_0255406 3300049588 Bacteria 1395
790 Ga0501073_0090545 3300049589 Bacteria 2126
791 Ga0501074_0025245 3300049590 Bacteria 4317
792 Ga0501074_0261882 3300049590 Bacteria 1229
793 Ga0501075_0016749 3300049591 Bacteria 5286
794 Ga0501075_0059032 3300049591 Bacteria 2889
795 Ga0501075_0060058 3300049591 Bacteria 2865
796 Ga0501075_0265228 3300049591 Bacteria 1309
797 Ga0501076_0004215 3300049592 Bacteria 10176
798 Ga0501076_0007588 3300049592 Bacteria 7897
799 Ga0501077_0005911 3300049593 Bacteria 7464
800 Ga0501077_0023566 3300049593 Bacteria 3903
801 Ga0501079_0001382 3300049741 Bacteria 17096
802 Ga0501079_0005016 3300049741 Bacteria 9819
803 Ga0501079_0015422 3300049741 Bacteria 5831
804 Ga0501079_0244225 3300049741 Bacteria 1403
805 Ga0501080_0002032 3300049742 Bacteria 17493
806 Ga0501080_0162035 3300049742 Bacteria 2065
807 Ga0501081_0006195 3300049743 Bacteria 7748
808 Ga0501081_0012524 3300049743 Bacteria 5577
809 Ga0501081_0055419 3300049743 Bacteria 2740
810 Ga0501081_0476230 3300049743 Unclassified 929
811 Ga0501083_0111851 3300049744 Bacteria 1795
812 Ga0501035_0019017 3300049822 Bacteria 6323
813 Ga0501035_1279037 3300049822 Bacteria 566
814 Ga0501044_0237734 3300049823 Bacteria 1767
815 Ga0501045_0026787 3300049824 Bacteria 4149
816 Ga0501045_0044759 3300049824 Bacteria 3224
817 Ga0501045_0078100 3300049824 Bacteria 2440
818 Ga0501045_0341451 3300049824 Bacteria 1115
819 Ga0501045_0661007 3300049824 Bacteria 772
820 nmdc:mga03n38_236587_c1 3300050490 Unclassified 959
821 nmdc:mga00v17_24047_c1 3300050491 Bacteria 3530
822 nmdc:mga0yw44_195849_c1 3300050492 Bacteria 1333
823 nmdc:mga0yw44_243554_c1 3300050492 Unclassified 1196
824 nmdc:mga0yw44_369402_c1 3300050492 Bacteria 968
825 nmdc:mga06z11_7552_c1 3300050494 Bacteria 4482
826 nmdc:mga05p37_159332_c1 3300050507 Bacteria 2757
827 nmdc:mga05p37_4691_c2 3300050507 Bacteria 8253
828 nmdc:mga09592_4692_c1 3300050508 Bacteria 11062
829 nmdc:mga06r32_282208_c1 3300050510 Bacteria 1648
830 nmdc:mga08y16_100664_c1 3300050511 Bacteria 3009
831 nmdc:mga08y16_2176447_c1 3300050511 Bacteria 501
832 nmdc:mga08y16_334025_c1 3300050511 Bacteria 1559
833 nmdc:mga08y16_458110_c1 3300050511 Bacteria 1300
834 nmdc:mga08y16_56074_c1 3300050511 Bacteria 4119
835 nmdc:mga08y16_716998_c1 3300050511 Bacteria 999
836 nmdc:mga08y16_759948_c1 3300050511 Unclassified 965
837 nmdc:mga08y16_8793_c1 3300050511 Bacteria 10600
838 nmdc:mga0n895_1130384_c1 3300050512 Bacteria 760
839 nmdc:mga0n895_1581838_c1 3300050512 Unclassified 620
840 nmdc:mga0n895_46478_c1 3300050512 Bacteria 4241
841 nmdc:mga0n895_565935_c1 3300050512 Bacteria 1141
842 nmdc:mga0n895_608643_c1 3300050512 Unclassified 1094
843 nmdc:mga0n895_72506_c1 3300050512 Bacteria 3416
844 nmdc:mga0n895_929025_c1 3300050512 Unclassified 854
845 nmdc:mga0rr50_13665_c1 3300050513 Bacteria 5296
846 nmdc:mga0rr50_1633915_c1 3300050513 Bacteria 544
847 nmdc:mga0rr50_54017_c1 3300050513 Unclassified 2991
848 nmdc:mga0rr50_640727_c1 3300050513 Bacteria 907
849 nmdc:mga08x19_28639_c1 3300050514 Bacteria 3490
850 nmdc:mga0a205_1165110_c1 3300050515 Bacteria 618
851 nmdc:mga0a205_29555_c1 3300050515 Bacteria 5245
852 nmdc:mga0a205_491719_c1 3300050515 Unclassified 1084
853 nmdc:mga0a205_60942_c1 3300050515 Bacteria 3644
854 nmdc:mga0a205_65347_c1 3300050515 Bacteria 3515
855 Ga0495612_0474198 3300053078 Bacteria 573
856 Ga0495619_0914415 3300053085 Bacteria 590
857 Ga0501084_0001654 3300054114 Bacteria 17736
858 Ga0501084_0003270 3300054114 Bacteria 13109
859 Ga0501084_0083263 3300054114 Bacteria 2685
860 Ga0501084_0263187 3300054114 Unclassified 1456
861 Ga0501082_0047898 3300060353 Bacteria 3683
862 Ga0501082_0378196 3300060353 Bacteria 1236
863 Ga0501082_0462488 3300060353 Bacteria 1109
864 Ga0501082_0897358 3300060353 Bacteria 775
865 Ga0466962_0052428 3300061719 Bacteria 1950
866 Ga0466962_0363666 3300061719 Unclassified 721
867 Ga0466962_0476138 3300061719 Bacteria 630
868 Ga0530510_0004090 3300061734 Bacteria 10065
869 Ga0530510_0024164 3300061734 Bacteria 4335
870 Ga0530510_0049813 3300061734 Unclassified 3025
871 Ga0530510_0058423 3300061734 Bacteria 2789
872 Ga0530510_0166606 3300061734 Bacteria 1631
873 Ga0530510_0201631 3300061734 Bacteria 1478
874 Ga0530510_0362616 3300061734 Bacteria 1089
875 Ga0530510_0482666 3300061734 Bacteria 939
876 Ga0530510_0665806 3300061734 Bacteria 793
877 Ga0530510_0711399 3300061734 Bacteria 766
878 Ga0395901_0143288
879 2214844107
880 ARCol0yngRDRAFT_1001207
881 JGI24747J21853_1052053
882 JGI24737J22298_10086399
883 JGI24750J21931_1056447
884 JGI24751J29686_10086328
885 Ga0070658_10973777
886 Ga0070658_11031398
887 Ga0070676_10262441
888 Ga0070683_100029646
889 Ga0070683_100113027
890 Ga0070683_100155888
891 Ga0070683_100731772
892 Ga0070670_100004293
893 Ga0070670_101284636
894 Ga0068869_100765152
895 Ga0070680_100017076
896 Ga0070680_100047883
897 Ga0070680_100184404
898 Ga0070682_100027482
899 Ga0070682_100039472
900 Ga0070682_100069359
901 Ga0070682_100207939
902 Ga0070682_100422299
903 Ga0070682_100538241
904 Ga0068868_100052357
905 Ga0068868_100076443
906 Ga0068868_100274197
907 Ga0070660_100004020
908 Ga0070660_100051687
909 Ga0070660_100054676
910 Ga0070660_100069690
911 Ga0070660_100741137
912 Ga0070689_100003774
913 Ga0070691_10007080
914 Ga0070691_10034986
915 Ga0070691_10067369
916 Ga0070691_10100715
917 Ga0070691_10201465
918 Ga0070691_10277784
919 Ga0070687_100175273
920 Ga0070661_100032624
921 Ga0070661_100040181
922 Ga0070661_100051438
923 Ga0070661_100061220
924 Ga0070661_100211329
925 Ga0070661_100327878
926 Ga0070692_10263196
927 Ga0070692_10313588
928 Ga0070692_10877169
929 Ga0070668_100012799
930 Ga0070668_100106381
931 Ga0070669_100220227
932 Ga0070669_101617951
933 Ga0070675_100022753
934 Ga0070675_100088535
935 Ga0070671_100050170
936 Ga0070674_100048016
937 Ga0070673_100125318
938 Ga0070673_100643777
939 Ga0070688_100013097
940 Ga0070659_100004191
941 Ga0070659_100139846
942 Ga0070659_100191809
943 Ga0070659_100248844
944 Ga0070659_100455386
945 Ga0070659_100781266
946 Ga0070709_10065998
947 Ga0070709_10602433
948 Ga0070701_10036135
949 Ga0070705_100124794
950 Ga0070705_101454682
951 Ga0070700_100022475
952 Ga0070700_100183854
953 Ga0070694_100204639
954 Ga0070694_100378890
955 Ga0070694_100510143
956 Ga0070708_100026347
957 Ga0070708_100543202
958 Ga0070663_100018125
959 Ga0070663_100377550
960 Ga0070663_100745347
961 Ga0070663_100851697
962 Ga0070663_101461948
963 Ga0070678_100093151
964 Ga0070678_100113926
965 Ga0070678_101752876
966 Ga0070662_100026481
967 Ga0070681_10004205
968 Ga0070681_10026421
969 Ga0070681_10029317
970 Ga0070681_10039157
971 Ga0070681_10120245
972 Ga0070681_10133318
973 Ga0070681_10712138
974 Ga0068867_100223726
975 Ga0068867_100344255
976 Ga0068867_100356219
977 Ga0068867_101451400
978 Ga0068867_101923455
979 Ga0070685_10002617
980 Ga0070685_10214238
981 Ga0070706_100100250
982 Ga0070698_100012820
983 Ga0070699_100725371
984 Ga0070679_100016489
985 Ga0070679_100051786
986 Ga0070679_100053802
987 Ga0070679_100171922
988 Ga0070679_100370840
989 Ga0070679_100398849
990 Ga0070684_100026963
991 Ga0070684_100059030
992 Ga0070684_100083164
993 Ga0070684_101123807
994 Ga0070697_100588795
995 Ga0068853_100061202
996 Ga0068853_100204397
997 Ga0068853_100534876
998 Ga0068853_100554622
999 Ga0070672_100340813
1000 Ga0070686_100012297
1001 Ga0070686_100061669
1002 Ga0070686_101124669
1003 Ga0070695_100325320
1004 Ga0070695_101449799
1005 Ga0070696_100046066
1006 Ga0070696_100090361
1007 Ga0070696_100486377
1008 Ga0070696_100619929
1009 Ga0070693_100002576
1010 Ga0070693_100028915
1011 Ga0070693_100523434
1012 Ga0070665_100003372
1013 Ga0070665_100004675
1014 Ga0070704_100161901
1015 Ga0070704_100268357
1016 Ga0070704_100462325
1017 Ga0070704_102123821
1018 Ga0068855_100026901
1019 Ga0068855_100056594
1020 Ga0068855_100085283
1021 Ga0068855_100087106
1022 Ga0068855_100099792
1023 Ga0068855_100145330
1024 Ga0068855_100383957
1025 Ga0070664_100056774
1026 Ga0070664_100569298
1027 Ga0070664_100632732
1028 Ga0068857_100052743
1029 Ga0068857_100081880
1030 Ga0068857_100274491
1031 Ga0068857_101073422
1032 Ga0068854_100057292
1033 Ga0068854_100069149
1034 Ga0068854_100182523
1035 Ga0068854_100616682
1036 Ga0068854_101361307
1037 Ga0068856_100030809
1038 Ga0068856_100208424
1039 Ga0068856_100491018
1040 Ga0068856_101498064
1041 Ga0068856_101982363
1042 Ga0070702_100030952
1043 Ga0070702_100185144
1044 Ga0070702_101256906
1045 Ga0068852_100052926
1046 Ga0068852_100404257
1047 Ga0068852_100958545
1048 Ga0068852_101491142
1049 Ga0068859_100742505
1050 Ga0068866_10067979
1051 Ga0068866_10616268
1052 Ga0068861_100004039
1053 Ga0068861_100453555
1054 Ga0068851_10228045
1055 Ga0068870_10041791
1056 Ga0068870_10434679
1057 Ga0068870_10470001
1058 Ga0068870_10714179
1059 Ga0068870_10818601
1060 Ga0068870_11222205
1061 Ga0068863_100896296
1062 Ga0068858_100883428
1063 Ga0068860_102257699
1064 Ga0068860_102427781
1065 Ga0068862_100087547
1066 Ga0081455_10006006
1067 Ga0081455_10140085
1068 Ga0081540_1002188
1069 Ga0081540_1030610
1070 Ga0075365_10194479
1071 Ga0075363_100229734
1072 Ga0075432_10000461
1073 Ga0075432_10018005
1074 Ga0070716_101119217
1075 Ga0075367_10027362
1076 Ga0097621_100038619
1077 Ga0075428_100002927
1078 Ga0075428_100056461
1079 Ga0075428_100116177
1080 Ga0075428_100216755
1081 Ga0075431_100108803
1082 Ga0075431_100295335
1083 Ga0075433_10035247
1084 Ga0075433_10224985
1085 Ga0075433_11465387
1086 Ga0075434_100057148
1087 Ga0075434_100083197
1088 Ga0075434_100417130
1089 Ga0075434_101199660
1090 Ga0075429_100054406
1091 Ga0075429_100641003
1092 Ga0068865_100039816
1093 Ga0068865_100083672
1094 Ga0068865_100159037
1095 Ga0068865_100818612
1096 Ga0068865_101348879
1097 Ga0075436_100122633
1098 Ga0075436_100779747
1099 Ga0097620_100742438
1100 Ga0075435_100011630
1101 Ga0075435_100083320
1102 Ga0075435_100246405
1103 Ga0075435_101050587
1104 Ga0105244_10555514
1105 Ga0105240_10071711
1106 Ga0105240_10268400
1107 Ga0105240_10424666
1108 Ga0105240_11454002
1109 Ga0111539_10000483
1110 Ga0111539_10004184
1111 Ga0111539_10164031
1112 Ga0111539_10273113
1113 Ga0105245_10001379
1114 Ga0105245_10020869
1115 Ga0105245_10059662
1116 Ga0105245_10108014
1117 Ga0105245_10275884
1118 Ga0105245_12025969
1119 Ga0114129_10026232
1120 Ga0114129_10517947
1121 Ga0114129_11111957
1122 Ga0114129_12824929
1123 Ga0105243_10034919
1124 Ga0105243_10075909
1125 Ga0105241_10043669
1126 Ga0105241_10279762
1127 Ga0105241_10872022
1128 Ga0105242_10220483
1129 Ga0105242_10343508
1130 Ga0105248_10085552
1131 Ga0105237_10022728
1132 Ga0105237_10150488
1133 Ga0105237_12424549
1134 Ga0105238_10028446
1135 Ga0105238_10057436
1136 Ga0105238_10719059
1137 Ga0105238_10942751
1138 Ga0105249_10022281
1139 Ga0105249_10136595
1140 Ga0105249_10665554
1141 Ga0105249_12325366
1142 Ga0105249_12774164
1143 Ga0105239_10151122
1144 Ga0105239_10180465
1145 Ga0105239_10273783
1146 Ga0105239_10292632
1147 Ga0105239_10882106
1148 Ga0105239_13214856
1149 Ga0105246_10015407
1150 Ga0105246_10102170
1151 Ga0105246_10731582
1152 Ga0105246_11710392
1153 Ga0157316_1003391
1154 Ga0157373_10010162
1155 Ga0157373_10178559
1156 Ga0157373_10309800
1157 Ga0157373_10448377
1158 Ga0157373_11293122
1159 Ga0157371_10251315
1160 Ga0157371_10568442
1161 Ga0157370_10020350
1162 Ga0157370_10020774
1163 Ga0157370_10148352
1164 Ga0157370_10353642
1165 Ga0157369_10015314
1166 Ga0157369_10051364
1167 Ga0157369_10192440
1168 Ga0157369_10778406
1169 Ga0157369_11614538
1170 Ga0157374_10262783
1171 Ga0157374_11099496
1172 Ga0157374_11705925
1173 Ga0157378_11120696
1174 Ga0163162_10122856
1175 Ga0163162_10173123
1176 Ga0163162_10530942
1177 Ga0157372_10007863
1178 Ga0157372_10119843
1179 Ga0157372_10437467
1180 Ga0157372_11594983
1181 Ga0157372_12148938
1182 Ga0157372_13043469
1183 Ga0157375_10050701
1184 Ga0157375_11561608
1185 Ga0157375_12222052
1186 Ga0163163_10061159
1187 Ga0163163_10190410
1188 Ga0163163_10240064
1189 Ga0163163_10664589
1190 Ga0163163_13284084
1191 Ga0157380_11052040
1192 Ga0157380_12369182
1193 Ga0182008_10378925
1194 Ga0182008_10573538
1195 Ga0157377_10052985
1196 Ga0157377_10068182
1197 Ga0157377_10165281
1198 Ga0157377_11197990
1199 Ga0157376_10051798
1200 Ga0157376_10703166
1201 Ga0157376_11033325
1202 Ga0163161_10020642
1203 Ga0163161_10101804
1204 Ga0197907_10381642
1205 Ga0206356_10893813
1206 Ga0206356_11691718
1207 Ga0206354_10655524
1208 Ga0206354_11064529
1209 Ga0206353_10019772
1210 Ga0206353_10184386
1211 Ga0206353_10588121
1212 Ga0206353_11289376
1213 Ga0224712_10285904
1214 Ga0207692_10571233
1215 Ga0207692_10798034
1216 Ga0207642_10106239
1217 Ga0207688_10029329
1218 Ga0207688_10088948
1219 Ga0207699_10237408
1220 Ga0207645_10034937
1221 Ga0207643_10001826
1222 Ga0207643_10046142
1223 Ga0207705_10027534
1224 Ga0207705_10129551
1225 Ga0207684_10062371
1226 Ga0207684_10190423
1227 Ga0207654_10051699
1228 Ga0207654_10154676
1229 Ga0207654_10566411
1230 Ga0207707_10054970
1231 Ga0207707_10071510
1232 Ga0207707_10072380
1233 Ga0207707_10105283
1234 Ga0207707_10251253
1235 Ga0207707_11604343
1236 Ga0207695_10192103
1237 Ga0207695_11129340
1238 Ga0207671_10151354
1239 Ga0207671_10153650
1240 Ga0207671_11082927
1241 Ga0207693_10061795
1242 Ga0207693_10814431
1243 Ga0207663_10019136
1244 Ga0207660_10032133
1245 Ga0207660_10035433
1246 Ga0207660_10184149
1247 Ga0207660_10195234
1248 Ga0207662_10036660
1249 Ga0207657_10000467
1250 Ga0207657_10000731
1251 Ga0207657_10033593
1252 Ga0207657_10072051
1253 Ga0207657_10170245
1254 Ga0207657_10184231
1255 Ga0207657_10500669
1256 Ga0207649_10014002
1257 Ga0207649_10067545
1258 Ga0207649_10201225
1259 Ga0207649_10291502
1260 Ga0207652_10029820
1261 Ga0207652_10047514
1262 Ga0207652_10069746
1263 Ga0207652_10071978
1264 Ga0207652_10113398
1265 Ga0207652_10191399
1266 Ga0207652_10200392
1267 Ga0207652_10360937
1268 Ga0207646_10475425
1269 Ga0207681_10427786
1270 Ga0207694_10046466
1271 Ga0207694_10143163
1272 Ga0207694_10819375
1273 Ga0207650_10475642
1274 Ga0207659_10077356
1275 Ga0207687_10039162
1276 Ga0207687_10499823
1277 Ga0207687_11117551
1278 Ga0207664_11462055
1279 Ga0207644_10151842
1280 Ga0207690_10026602
1281 Ga0207690_10264722
1282 Ga0207690_11583860
1283 Ga0207706_10006904
1284 Ga0207686_10257160
1285 Ga0207709_10048106
1286 Ga0207709_10570505
1287 Ga0207669_10005301
1288 Ga0207669_10099012
1289 Ga0207704_10007727
1290 Ga0207704_10335049
1291 Ga0207704_10468823
1292 Ga0207665_10001983
1293 Ga0207665_10395148
1294 Ga0207665_10600325
1295 Ga0207711_10485872
1296 Ga0207689_10027077
1297 Ga0207689_10131692
1298 Ga0207689_10302189
1299 Ga0207689_10339157
1300 Ga0207661_10219589
1301 Ga0207661_10237678
1302 Ga0207661_10450548
1303 Ga0207661_11184357
1304 Ga0207661_11360667
1305 Ga0207661_11381924
1306 Ga0207661_11748784
1307 Ga0207661_11921883
1308 Ga0207679_10181219
1309 Ga0207679_10228018
1310 Ga0207679_10702118
1311 Ga0207679_11234490
1312 Ga0207667_10047992
1313 Ga0207667_10055691
1314 Ga0207667_10076403
1315 Ga0207667_10138219
1316 Ga0207667_10166210
1317 Ga0207667_10334528
1318 Ga0207667_12145574
1319 Ga0207651_10100351
1320 Ga0207651_11981131
1321 Ga0207712_10024008
1322 Ga0207712_10033899
1323 Ga0207668_10098019
1324 Ga0207668_10118821
1325 Ga0207668_10322373
1326 Ga0207640_10075865
1327 Ga0207640_10082353
1328 Ga0207640_10259968
1329 Ga0207639_10083877
1330 Ga0207678_10080492
1331 Ga0207678_11013350
1332 Ga0207708_10011473
1333 Ga0207708_10037886
1334 Ga0207708_10209939
1335 Ga0207708_10275707
1336 Ga0207702_10256927
1337 Ga0207702_10804426
1338 Ga0207641_10803993
1339 Ga0207648_10067794
1340 Ga0207648_10314967
1341 Ga0207648_10631573
1342 Ga0207648_10981468
1343 Ga0207676_10477075
1344 Ga0207674_10017840
1345 Ga0207674_10224371
1346 Ga0207674_10669002
1347 Ga0207675_100000792
1348 Ga0207675_100142480
1349 Ga0207683_10017553
1350 Ga0207683_10026950
1351 Ga0207698_10031836
1352 Ga0207698_10054316
1353 Ga0207698_10221785
1354 Ga0207698_11262251
1355 Ga0209966_1109360
1356 Ga0207428_10000196
1357 Ga0207428_10023492
1358 Ga0207428_10038882
1359 Ga0207428_10123914
1360 Ga0207428_10352850
1361 Ga0207428_10436726
1362 Ga0268266_10134451
1363 Ga0268266_10693120
1364 Ga0268265_10113510
1365 Ga0268265_10380175
1366 Ga0268264_10898715
1367 Ga0268264_11594476
1368 Ga0307405_10043409
1369 Ga0307413_10779240
1370 Ga0307406_11723478
1371 Ga0307412_10669810
1372 Ga0307409_100861911
1373 Ga0307416_100130815
1374 Ga0307416_100158582
1375 Ga0373930_0154200
1376 Ga0373938_0020233
1377 Ga0373949_0120091
1378 Ga0373949_0233749
1379 Ga0373952_0210989
1380 Ga0373932_0235368
1381 Ga0373936_0069926
1382 Ga0373939_0013189
1383 Ga0373945_0009560
1384 Ga0373945_0177961
1385 Ga0373960_0021450
1386 Ga0373943_0010858
1387 Ga0373943_0092909
1388 Ga0373946_0763483
1389 Ga0373931_0375379
1390 Ga0373935_0054335
1391 Ga0373935_0075407
1392 Ga0373947_0000533
1393 Ga0373947_0007052
1394 Ga0373925_0004302
1395 Ga0373925_0005142
1396 Ga0395899_0019101
1397 Ga0395899_0103369
1398 Ga0395899_0342688
1399 Ga0395899_0664437
1400 Ga0395900_0002857
1401 Ga0395900_0007033
1402 Ga0395900_0024664
1403 Ga0395900_0132501
1404 Ga0395900_0223612
1405 Ga0395900_0496441
1406 Ga0395900_0505405
1407 Ga0395900_0585983
1408 Ga0395900_1794388
1409 Ga0395898_0005912
1410 Ga0395898_0049255
1411 Ga0395898_0119559
1412 Ga0395898_0127401
1413 Ga0395898_0139447
1414 Ga0395898_0199860
1415 Ga0395898_0210539
1416 Ga0395898_0244486
1417 Ga0395898_0751481
1418 Ga0395898_1018596
1419 Ga0395898_1399223
1420 Ga0395898_1444569
1421 Ga0395905_0000568
1422 Ga0395905_0074777
1423 Ga0395905_0155309
1424 Ga0395905_0196194
1425 Ga0395905_0272235
1426 Ga0395905_0799707
1427 Ga0395905_0857099
1428 Ga0436364_0135606
1429 Ga0395901_0001508
1430 Ga0395901_0001844
1431 Ga0395901_0020113
1432 Ga0395901_0022801
1433 Ga0395901_0099773
1434 Ga0395901_0154003
1435 Ga0395901_0166266
1436 Ga0395901_0273538
1437 Ga0395901_0434011
1438 Ga0395901_1552502
1439 Ga0395901_1718000
1440 Ga0436365_1360505
1441 Ga0436363_1283513
1442 Ga0451800_1206920
1443 Ga0451841_0962610
1444 Ga0451853_3046892
1445 Ga0439448_0036216
1446 Ga0439448_0050431
1447 Ga0439450_191670
1448 Ga0439450_214576
1449 Ga0439458_0024941
1450 Ga0439459_0008300
1451 Ga0439460_0302318
1452 Ga0466965_0213282
1453 Ga0466965_0556251
1454 Ga0466966_0012700
1455 Ga0466961_0062856
1456 Ga0466961_0222985
1457 Ga0466963_0000743
1458 Ga0466963_0003907
1459 Ga0466963_0011801
1460 Ga0466963_0016083
1461 Ga0466963_0702603
1462 Ga0466964_0057077
1463 Ga0466964_0288249
1464 Ga0466964_0371995
1465 Ga0466971_0253830
1466 Ga0466968_0102500
1467 Ga0466957_0035500
1468 Ga0466957_0037750
1469 Ga0466957_1166679
1470 Ga0466957_1365385
1471 Ga0466960_0059143
1472 Ga0466960_0199030
1473 Ga0466960_0404126
1474 Ga0466959_0116832
1475 Ga0466959_0117305
1476 Ga0466959_0414820
1477 Ga0466959_0470427
1478 Ga0451576_0076759
1479 Ga0451576_0799670
1480 Ga0451576_1672917
1481 Ga0466958_0188522
1482 Ga0466958_0215460
1483 Ga0466958_0735974
1484 Ga0466967_0017646
1485 Ga0466967_0025753
1486 Ga0466967_0086552
1487 Ga0466967_0150849
1488 Ga0466967_0252259
1489 Ga0466967_0323005
1490 Ga0466967_0466491
1491 Ga0466967_0563334
1492 Ga0466967_1419134
1493 Ga0466967_1680503
1494 Ga0495617_196152
1495 Ga0495627_209246
1496 Ga0495592_0358570
1497 Ga0495603_0001442
1498 Ga0495590_0161515
1499 Ga0495591_093021
1500 Ga0495629_0281263
1501 Ga0495638_0220396
1502 Ga0495641_0001137
1503 Ga0495651_0540941
1504 Ga0495653_0319535
1505 Ga0495580_0024689
1506 Ga0495582_0508520
1507 Ga0495605_0152583
1508 Ga0495605_0229594
1509 Ga0495639_0092991
1510 Ga0495664_0871479
1511 Ga0495584_0031556
1512 Ga0495584_0102989
1513 Ga0495584_0113837
1514 Ga0495584_0147462
1515 Ga0495585_0073866
1516 Ga0495596_0148636
1517 Ga0495607_0099665
1518 Ga0495607_0116113
1519 Ga0495608_0118464
1520 Ga0495616_0062508
1521 Ga0495618_0576325
1522 Ga0495628_0089479
1523 Ga0495630_0241726
1524 Ga0495630_0329553
1525 Ga0495637_0072954
1526 Ga0495643_0115895
1527 Ga0495644_0040461
1528 Ga0495644_0361866
1529 Ga0495663_0039737
1530 Ga0495666_0030512
1531 Ga0495652_0060460
1532 Ga0495654_0054023
1533 Ga0495640_0365558
1534 Ga0495586_0011957
1535 Ga0495598_0002624
1536 Ga0495609_0029943
1537 Ga0495609_0070700
1538 Ga0495621_0091796
1539 Ga0495621_0307785
1540 Ga0495622_0178440
1541 Ga0495633_0367589
1542 Ga0495633_0490530
1543 Ga0495667_0607962
1544 Ga0495656_0020197
1545 Ga0495656_0468026
1546 Ga0495668_0115958
1547 Ga0495668_0842471
1548 Ga0495634_0270683
1549 Ga0495611_0165473
1550 Ga0495659_0034272
1551 Ga0495659_0054242
1552 Ga0495657_0391294
1553 Ga0495599_0418419
1554 Ga0495658_0090430
1555 Ga0495658_0236207
1556 Ga0495613_0029948
1557 Ga0495670_0076392
1558 Ga0495670_0182764
1559 Ga0495671_0023230
1560 Ga0495671_0240615
1561 Ga0495589_0091290
1562 Ga0495660_0052786
1563 Ga0495581_0449843
1564 Ga0495636_0309298
1565 Ga0495636_0350394
1566 Ga0495674_0037327
1567 Ga0495674_0057423
1568 Ga0495676_0004439
1569 Ga0495676_0152464
1570 Ga0495683_0134032
1571 Ga0495677_0102244
1572 Ga0495679_077589
1573 Ga0495685_060001
1574 Ga0495684_0239030
1575 Ga0495614_0185542
1576 Ga0495615_0040955
1577 Ga0495615_0158045
1578 Ga0495626_0406239
1579 Ga0496100_0107149
1580 Ga0496100_0546977
1581 Ga0496102_0069469
1582 Ga0496102_0332158
1583 Ga0496102_1118018
1584 Ga0496103_0001272
1585 Ga0496104_0068050
1586 Ga0496104_0145904
1587 Ga0496105_0040024
1588 Ga0496105_0087274
1589 Ga0496108_0030725
1590 Ga0496108_0031161
1591 Ga0496108_0080685
1592 Ga0496109_0017493
1593 Ga0496109_0045948
1594 Ga0496109_0391846
1595 Ga0496109_0658730
1596 Ga0496109_0697472
1597 Ga0496109_0759751
1598 Ga0496110_0027599
1599 Ga0496110_0040053
1600 Ga0496110_0343280
1601 Ga0496110_0621323
1602 Ga0496111_0028098
1603 Ga0496111_0974635
1604 Ga0496112_0140642
1605 Ga0496112_0154778
1606 Ga0496113_0049910
1607 Ga0496113_0285579
1608 Ga0496113_0476688
1609 Ga0496113_1308342
1610 Ga0496115_0301259
1611 Ga0501031_0791810
1612 Ga0501032_0086020
1613 Ga0501032_0207989
1614 Ga0501033_0152133
1615 Ga0501036_0008255
1616 Ga0501036_0054381
1617 Ga0501036_0182990
1618 Ga0501036_1503353
1619 Ga0501037_0177334
1620 Ga0501037_0191611
1621 Ga0501038_0102375
1622 Ga0501038_0135942
1623 Ga0501038_1087868
1624 Ga0501039_0005748
1625 Ga0501039_0040396
1626 Ga0501039_0288171
1627 Ga0501040_0014913
1628 Ga0501040_0122600
1629 Ga0501040_0434922
1630 Ga0501040_0543641
1631 Ga0501040_0869225
1632 Ga0501041_0013301
1633 Ga0501041_0193853
1634 Ga0501041_0355648
1635 Ga0501041_0724316
1636 Ga0501042_0012634
1637 Ga0501043_0134523
1638 Ga0501043_0216468
1639 Ga0501046_0015766
1640 Ga0501046_0073305
1641 Ga0501048_0016652
1642 Ga0501048_0110789
1643 Ga0501067_0007929
1644 Ga0501067_0008781
1645 Ga0501067_0163793
1646 Ga0501067_0591902
1647 Ga0501067_0759140
1648 Ga0501068_0028112
1649 Ga0501068_0317711
1650 Ga0501068_0461380
1651 Ga0501068_0797315
1652 Ga0501068_1027469
1653 Ga0501069_0006739
1654 Ga0501069_0040999
1655 Ga0501069_0089266
1656 Ga0501070_0098290
1657 Ga0501070_0174680
1658 Ga0501070_0282188
1659 Ga0501071_0003446
1660 Ga0501071_0017284
1661 Ga0501071_0047094
1662 Ga0501071_0426790
1663 Ga0501072_0002483
1664 Ga0501072_0004929
1665 Ga0501072_0073843
1666 Ga0501072_0255406
1667 Ga0501073_0090545
1668 Ga0501074_0025245
1669 Ga0501074_0261882
1670 Ga0501075_0016749
1671 Ga0501075_0059032
1672 Ga0501075_0060058
1673 Ga0501075_0265228
1674 Ga0501076_0004215
1675 Ga0501076_0007588
1676 Ga0501077_0005911
1677 Ga0501077_0023566
1678 Ga0501079_0001382
1679 Ga0501079_0005016
1680 Ga0501079_0015422
1681 Ga0501079_0244225
1682 Ga0501080_0002032
1683 Ga0501080_0162035
1684 Ga0501081_0006195
1685 Ga0501081_0012524
1686 Ga0501081_0055419
1687 Ga0501081_0476230
1688 Ga0501083_0111851
1689 Ga0501035_0019017
1690 Ga0501035_1279037
1691 Ga0501044_0237734
1692 Ga0501045_0026787
1693 Ga0501045_0044759
1694 Ga0501045_0078100
1695 Ga0501045_0341451
1696 Ga0501045_0661007
1697 nmdc:mga03n38_236587_c1
1698 nmdc:mga00v17_24047_c1
1699 nmdc:mga0yw44_195849_c1
1700 nmdc:mga0yw44_243554_c1
1701 nmdc:mga0yw44_369402_c1
1702 nmdc:mga06z11_7552_c1
1703 nmdc:mga05p37_159332_c1
1704 nmdc:mga05p37_4691_c2
1705 nmdc:mga09592_4692_c1
1706 nmdc:mga06r32_282208_c1
1707 nmdc:mga08y16_100664_c1
1708 nmdc:mga08y16_2176447_c1
1709 nmdc:mga08y16_334025_c1
1710 nmdc:mga08y16_458110_c1
1711 nmdc:mga08y16_56074_c1
1712 nmdc:mga08y16_716998_c1
1713 nmdc:mga08y16_759948_c1
1714 nmdc:mga08y16_8793_c1
1715 nmdc:mga0n895_1130384_c1
1716 nmdc:mga0n895_1581838_c1
1717 nmdc:mga0n895_46478_c1
1718 nmdc:mga0n895_565935_c1
1719 nmdc:mga0n895_608643_c1
1720 nmdc:mga0n895_72506_c1
1721 nmdc:mga0n895_929025_c1
1722 nmdc:mga0rr50_13665_c1
1723 nmdc:mga0rr50_1633915_c1
1724 nmdc:mga0rr50_54017_c1
1725 nmdc:mga0rr50_640727_c1
1726 nmdc:mga08x19_28639_c1
1727 nmdc:mga0a205_1165110_c1
1728 nmdc:mga0a205_29555_c1
1729 nmdc:mga0a205_491719_c1
1730 nmdc:mga0a205_60942_c1
1731 nmdc:mga0a205_65347_c1
1732 Ga0495612_0474198
1733 Ga0495619_0914415
1734 Ga0501084_0001654
1735 Ga0501084_0003270
1736 Ga0501084_0083263
1737 Ga0501084_0263187
1738 Ga0501082_0047898
1739 Ga0501082_0378196
1740 Ga0501082_0462488
1741 Ga0501082_0897358
1742 Ga0466962_0052428
1743 Ga0466962_0363666
1744 Ga0466962_0476138
1745 Ga0530510_0004090
1746 Ga0530510_0024164
1747 Ga0530510_0049813
1748 Ga0530510_0058423
1749 Ga0530510_0166606
1750 Ga0530510_0201631
1751 Ga0530510_0362616
1752 Ga0530510_0482666
1753 Ga0530510_0665806
1754 Ga0530510_0711399

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

22

104

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mfk-assembly1.cif.gz_A structure of the clostridium perfringens gh89 in complex with alpha-hnjnac 0.9868 24 59
4b6x-assembly2.cif.gz_B crystal structure of in planta processed avrrps4 0.9385 17 65
7o3e-assembly1.cif.gz_c murine supercomplex ciii2civ in the intermediate locked conformation 0.9368 19 58
4v47-assembly1.cif.gz_BT real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the ef-g.gtp state of e. coli 70s ribosome 0.9346 8 86
4v4w-assembly1.cif.gz_AT structure of a secm-stalled e. coli ribosome complex obtained by fitting atomic models for rna and protein components into cryo-em map emd-1143 0.9338 8 86
ID Description Score Start End Superfamily
af_Q9BPX3_363_558_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9751 12 64 1.25.10.10
af_Q54DW5_515_797_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9613 24 59 1.20.120.670
af_Q9UI47_502_632_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.9596 21 60 1.20.120.230
af_A5A8R3_1_166_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.9533 16 64 1.20.1270.60
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9439 17 65 1.20.120.80
ID Description Score Start End GO Terms
AF-X1J7I0-F1-model_v4 30S ribosomal protein S20 0.9671 12 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1Q509-F1-model_v4 30S ribosomal protein S20 0.967 16 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X1FE40-F1-model_v4 30S ribosomal protein S20 0.9655 10 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A419FMU6-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9561 19 86 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-A0A6L6B8C7-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9539 19 87 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181

Map