F484263

General Info

Members Datasets Scaffolds Average Seq Length
873 275 1746 233

Family's Representative Sequence

Representative Sequence 3300042008|Ga0439450_006452|Ga0439450_006452_892_1722
Length 276
Sequence LPAARRRGRQKASFHVEWKSALDNPQDDVNNSVNEAHAGMNRMHITPHRLLWPLICAAFLFGVFAGVLDAHGVSGKDAVYLQGLQGRAIVPLMYLGAKHMVTGYDHLLFLVGVIFFLYRLKDVLLYVSLFTIGHSLTLLVGVLGGVRANPYLIDAIIGFSVVYKAFENMDGFKRFFGVQPNTRVAVLVFGLFHGFGLATKLQEFELSPNGLVANIVSFNVGVEIGQGLALTAILIALSYWRTRRGFLDHAFATNALVMASGFLLVGYQLSGYFLAA

Samples

Sample ID Description Type Environment
1 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
181 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
211 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
246 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
247 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
258 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
259 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
260 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
261 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
262 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
263 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.32
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 0.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439450_006452 3300042008 Bacteria 2113
2 JGI24746J21847_1002544 3300001977 Bacteria 2895
3 JGI24751J29686_10009957 3300002459 Bacteria 1958
4 JGI25406J46586_10000232 3300003203 Bacteria 24721
5 JGI25406J46586_10001315 3300003203 Bacteria 11685
6 Ga0065714_10085456 3300005288 Bacteria 2148
7 Ga0065714_10120188 3300005288 Bacteria 1357
8 Ga0065714_10149312 3300005288 Bacteria 1116
9 Ga0065704_10273334 3300005289 Bacteria 938
10 Ga0065704_10313460 3300005289 Bacteria 806
11 Ga0065712_10067948 3300005290 Bacteria 19699
12 Ga0065712_10124515 3300005290 Bacteria 1625
13 Ga0065712_10176768 3300005290 Bacteria 1214
14 Ga0065712_10189211 3300005290 Bacteria 1156
15 Ga0065712_10198719 3300005290 Bacteria 1109
16 Ga0065715_10021739 3300005293 Bacteria 2218
17 Ga0065715_10059175 3300005293 Bacteria 1050
18 Ga0065715_10093248 3300005293 Bacteria 4754
19 Ga0065715_10105587 3300005293 Bacteria 2883
20 Ga0065715_10123434 3300005293 Bacteria 2178
21 Ga0065715_10143077 3300005293 Bacteria 1825
22 Ga0065707_10000320 3300005295 Bacteria 3088
23 Ga0065707_10031132 3300005295 Bacteria 1244
24 Ga0065707_10031795 3300005295 Bacteria 1111
25 Ga0065707_10114725 3300005295 Bacteria 2289
26 Ga0065707_10119767 3300005295 Bacteria 2147
27 Ga0065707_10135363 3300005295 Bacteria 1851
28 Ga0065707_10140521 3300005295 Bacteria 1779
29 Ga0065707_10146296 3300005295 Bacteria 1710
30 Ga0065707_10218354 3300005295 Bacteria 1235
31 Ga0070676_10016023 3300005328 Bacteria 4139
32 Ga0070676_10122688 3300005328 Bacteria 1633
33 Ga0070676_10328022 3300005328 Bacteria 1046
34 Ga0070683_100004934 3300005329 Bacteria 11064
35 Ga0070683_100010580 3300005329 Bacteria 7931
36 Ga0070683_100175478 3300005329 Bacteria 2034
37 Ga0070683_100376439 3300005329 Bacteria 1353
38 Ga0070690_100077453 3300005330 Unclassified 2171
39 Ga0070690_100083444 3300005330 Bacteria 2093
40 Ga0070690_100094303 3300005330 Bacteria 1975
41 Ga0070670_100000414 3300005331 Bacteria 35226
42 Ga0070670_100004339 3300005331 Bacteria 11863
43 Ga0070670_100006900 3300005331 Bacteria 9625
44 Ga0070670_100123948 3300005331 Bacteria 2230
45 Ga0070670_100152999 3300005331 Bacteria 1997
46 Ga0070670_100192171 3300005331 Bacteria 1773
47 Ga0070670_100280375 3300005331 Bacteria 1455
48 Ga0070670_100453175 3300005331 Bacteria 1137
49 Ga0070677_10002777 3300005333 Bacteria 5607
50 Ga0070677_10008271 3300005333 Bacteria 3496
51 Ga0070677_10020655 3300005333 Bacteria 2403
52 Ga0068869_100041576 3300005334 Bacteria 3293
53 Ga0068869_100054125 3300005334 Bacteria 2920
54 Ga0068869_100139953 3300005334 Bacteria 1868
55 Ga0068869_100179378 3300005334 Bacteria 1660
56 Ga0068869_100322536 3300005334 Bacteria 1253
57 Ga0070666_10013799 3300005335 Bacteria 5133
58 Ga0070666_10063705 3300005335 Bacteria 2499
59 Ga0070666_10087770 3300005335 Bacteria 2132
60 Ga0070666_10109890 3300005335 Bacteria 1906
61 Ga0070666_10261934 3300005335 Bacteria 1226
62 Ga0070680_100206750 3300005336 Bacteria 1656
63 Ga0070680_100460250 3300005336 Bacteria 1087
64 Ga0068868_100026656 3300005338 Bacteria 4407
65 Ga0068868_100066560 3300005338 Bacteria 2864
66 Ga0068868_100800607 3300005338 Bacteria 850
67 Ga0070689_100023010 3300005340 Bacteria 4659
68 Ga0070689_100024009 3300005340 Bacteria 4571
69 Ga0070689_100071452 3300005340 Bacteria 2711
70 Ga0070689_100173571 3300005340 Bacteria 1748
71 Ga0070687_100025806 3300005343 Bacteria 2823
72 Ga0070687_100038442 3300005343 Bacteria 2399
73 Ga0070687_100060972 3300005343 Bacteria 1992
74 Ga0070687_100292908 3300005343 Bacteria 1029
75 Ga0070661_100031106 3300005344 Bacteria 3859
76 Ga0070661_100207102 3300005344 Bacteria 1500
77 Ga0070661_100289284 3300005344 Bacteria 1273
78 Ga0070661_100384489 3300005344 Bacteria 1107
79 Ga0070692_10062163 3300005345 Bacteria 1970
80 Ga0070668_100155103 3300005347 Bacteria 1854
81 Ga0070668_100235213 3300005347 Bacteria 1516
82 Ga0070668_100499108 3300005347 Bacteria 1053
83 Ga0070669_100000652 3300005353 Bacteria 25694
84 Ga0070669_100001685 3300005353 Bacteria 15999
85 Ga0070669_100018608 3300005353 Bacteria 4965
86 Ga0070669_100044984 3300005353 Bacteria 3216
87 Ga0070675_100000966 3300005354 Bacteria 20540
88 Ga0070675_100004748 3300005354 Bacteria 10371
89 Ga0070675_100011669 3300005354 Bacteria 6886
90 Ga0070675_100035627 3300005354 Bacteria 4045
91 Ga0070675_100062226 3300005354 Bacteria 3084
92 Ga0070675_100087964 3300005354 Bacteria 2599
93 Ga0070675_100097620 3300005354 Bacteria 2470
94 Ga0070675_100105270 3300005354 Bacteria 2380
95 Ga0070675_100128365 3300005354 Bacteria 2159
96 Ga0070675_100132785 3300005354 Bacteria 2123
97 Ga0070675_100308424 3300005354 Bacteria 1396
98 Ga0070675_100546728 3300005354 Bacteria 1047
99 Ga0070671_100003231 3300005355 Bacteria 12707
100 Ga0070674_100000307 3300005356 Bacteria 24081
101 Ga0070674_100118166 3300005356 Bacteria 1959
102 Ga0070674_100134388 3300005356 Bacteria 1848
103 Ga0070674_100141394 3300005356 Bacteria 1806
104 Ga0070673_100014586 3300005364 Bacteria 5481
105 Ga0070673_100052788 3300005364 Bacteria 3190
106 Ga0070673_100090130 3300005364 Bacteria 2505
107 Ga0070673_100095071 3300005364 Bacteria 2444
108 Ga0070673_100109016 3300005364 Bacteria 2293
109 Ga0070673_100156628 3300005364 Bacteria 1934
110 Ga0070673_100208151 3300005364 Bacteria 1688
111 Ga0070688_100014480 3300005365 Bacteria 4469
112 Ga0070688_100062506 3300005365 Bacteria 2357
113 Ga0070659_100302962 3300005366 Bacteria 1333
114 Ga0070667_100048751 3300005367 Bacteria 3565
115 Ga0070667_100634451 3300005367 Bacteria 986
116 Ga0070709_10071859 3300005434 Bacteria 2235
117 Ga0070713_100135375 3300005436 Bacteria 2176
118 Ga0070701_10006726 3300005438 Bacteria 4859
119 Ga0070701_10089961 3300005438 Bacteria 1680
120 Ga0070705_100037106 3300005440 Bacteria 2746
121 Ga0070705_100659738 3300005440 Bacteria 817
122 Ga0070700_100006461 3300005441 Bacteria 6275
123 Ga0070700_100061271 3300005441 Bacteria 2373
124 Ga0070700_100340081 3300005441 Bacteria 1109
125 Ga0070700_100461208 3300005441 Bacteria 969
126 Ga0070694_100003106 3300005444 Bacteria 9891
127 Ga0070694_100024966 3300005444 Bacteria 3862
128 Ga0070694_100067480 3300005444 Bacteria 2456
129 Ga0070694_100571264 3300005444 Bacteria 908
130 Ga0070708_100028747 3300005445 Bacteria 4786
131 Ga0070708_100661510 3300005445 Bacteria 984
132 Ga0070663_100022729 3300005455 Bacteria 4196
133 Ga0070663_100080233 3300005455 Bacteria 2396
134 Ga0070678_100037193 3300005456 Bacteria 3415
135 Ga0070678_100060124 3300005456 Bacteria 2795
136 Ga0070678_100092217 3300005456 Bacteria 2327
137 Ga0070678_100213444 3300005456 Bacteria 1600
138 Ga0070662_100011070 3300005457 Bacteria 5939
139 Ga0070662_100100615 3300005457 Bacteria 2187
140 Ga0070662_100144210 3300005457 Bacteria 1849
141 Ga0070662_100238698 3300005457 Bacteria 1457
142 Ga0070662_100377429 3300005457 Bacteria 1166
143 Ga0070681_10061423 3300005458 Bacteria 3732
144 Ga0068867_100035001 3300005459 Bacteria 3641
145 Ga0068867_100091452 3300005459 Bacteria 2310
146 Ga0068867_100613991 3300005459 Bacteria 950
147 Ga0070685_10011685 3300005466 Bacteria 4600
148 Ga0070706_100755140 3300005467 Bacteria 901
149 Ga0070707_100053252 3300005468 Bacteria 3879
150 Ga0070707_100055247 3300005468 Bacteria 3806
151 Ga0070707_100210726 3300005468 Bacteria 1894
152 Ga0070698_100022720 3300005471 Bacteria 6559
153 Ga0070698_100039572 3300005471 Bacteria 4852
154 Ga0070698_100092033 3300005471 Bacteria 3014
155 Ga0070698_100125320 3300005471 Bacteria 2526
156 Ga0070699_100000243 3300005518 Bacteria 53604
157 Ga0070699_100002821 3300005518 Bacteria 15506
158 Ga0070699_100012205 3300005518 Bacteria 7414
159 Ga0070699_100060536 3300005518 Bacteria 3281
160 Ga0070699_100271215 3300005518 Bacteria 1519
161 Ga0070699_100419245 3300005518 Bacteria 1211
162 Ga0070699_100578563 3300005518 Bacteria 1023
163 Ga0070679_100066523 3300005530 Bacteria 3592
164 Ga0070684_100000401 3300005535 Bacteria 29645
165 Ga0070684_100025484 3300005535 Bacteria 4973
166 Ga0070697_100057180 3300005536 Bacteria 3174
167 Ga0070697_100077948 3300005536 Unclassified 2726
168 Ga0070697_100124046 3300005536 Bacteria 2162
169 Ga0068853_100346268 3300005539 Bacteria 1381
170 Ga0070672_100004693 3300005543 Bacteria 8961
171 Ga0070672_100010350 3300005543 Bacteria 6468
172 Ga0070672_100014754 3300005543 Bacteria 5543
173 Ga0070672_100017965 3300005543 Bacteria 5102
174 Ga0070672_100039063 3300005543 Bacteria 3633
175 Ga0070672_100048391 3300005543 Bacteria 3304
176 Ga0070672_100065452 3300005543 Bacteria 2875
177 Ga0070672_100081162 3300005543 Bacteria 2599
178 Ga0070672_100087666 3300005543 Bacteria 2505
179 Ga0070672_100092793 3300005543 Bacteria 2438
180 Ga0070686_100004868 3300005544 Bacteria 7412
181 Ga0070695_100000809 3300005545 Bacteria 16826
182 Ga0070695_100035182 3300005545 Bacteria 3145
183 Ga0070695_100071285 3300005545 Bacteria 2275
184 Ga0070696_100001646 3300005546 Bacteria 14648
185 Ga0070665_100228061 3300005548 Bacteria 1862
186 Ga0070665_100293095 3300005548 Bacteria 1629
187 Ga0070665_100433653 3300005548 Bacteria 1323
188 Ga0070704_100000202 3300005549 Bacteria 24669
189 Ga0070704_100034498 3300005549 Bacteria 3432
190 Ga0070704_100044296 3300005549 Bacteria 3091
191 Ga0070704_100085710 3300005549 Bacteria 2332
192 Ga0070704_100163875 3300005549 Bacteria 1761
193 Ga0070704_100310179 3300005549 Bacteria 1318
194 Ga0070704_100470722 3300005549 Bacteria 1085
195 Ga0070664_100001354 3300005564 Bacteria 19543
196 Ga0070664_100090654 3300005564 Bacteria 2646
197 Ga0070664_100106894 3300005564 Bacteria 2439
198 Ga0070664_100168210 3300005564 Bacteria 1943
199 Ga0070664_100208249 3300005564 Bacteria 1747
200 Ga0068857_100026187 3300005577 Bacteria 5138
201 Ga0068857_100044746 3300005577 Bacteria 3928
202 Ga0068857_100098317 3300005577 Bacteria 2625
203 Ga0068857_100114474 3300005577 Bacteria 2426
204 Ga0068857_100136194 3300005577 Bacteria 2217
205 Ga0068857_100241491 3300005577 Bacteria 1654
206 Ga0068856_100152248 3300005614 Bacteria 2322
207 Ga0070702_100095553 3300005615 Bacteria 1812
208 Ga0070702_100260811 3300005615 Bacteria 1180
209 Ga0070702_100319290 3300005615 Bacteria 1082
210 Ga0070702_100463300 3300005615 Bacteria 922
211 Ga0068852_100089937 3300005616 Bacteria 2745
212 Ga0068852_100528964 3300005616 Unclassified 1177
213 Ga0068859_100001994 3300005617 Bacteria 20841
214 Ga0068859_100006375 3300005617 Bacteria 11966
215 Ga0068859_100044591 3300005617 Bacteria 4456
216 Ga0068859_100051106 3300005617 Bacteria 4154
217 Ga0068859_100141839 3300005617 Bacteria 2476
218 Ga0068859_100153849 3300005617 Bacteria 2376
219 Ga0068859_100737115 3300005617 Bacteria 1075
220 Ga0068864_100009146 3300005618 Bacteria 8167
221 Ga0068864_100015835 3300005618 Bacteria 6274
222 Ga0068864_100036824 3300005618 Bacteria 4172
223 Ga0068864_100184910 3300005618 Bacteria 1907
224 Ga0068864_100210760 3300005618 Bacteria 1789
225 Ga0068864_100479291 3300005618 Bacteria 1194
226 Ga0068866_10102626 3300005718 Bacteria 1581
227 Ga0068861_100003772 3300005719 Bacteria 10118
228 Ga0068861_100050960 3300005719 Bacteria 3141
229 Ga0068861_100437583 3300005719 Bacteria 1169
230 Ga0068870_10006190 3300005840 Bacteria 5264
231 Ga0068870_10011272 3300005840 Bacteria 4139
232 Ga0068870_10021711 3300005840 Bacteria 3145
233 Ga0068870_10036274 3300005840 Bacteria 2536
234 Ga0068863_100010431 3300005841 Bacteria 9030
235 Ga0068863_100051706 3300005841 Bacteria 3893
236 Ga0068863_100413488 3300005841 Bacteria 1321
237 Ga0068863_101000878 3300005841 Bacteria 838
238 Ga0068858_100006751 3300005842 Bacteria 11170
239 Ga0068858_100097672 3300005842 Bacteria 2738
240 Ga0068858_100195650 3300005842 Bacteria 1911
241 Ga0068858_100227941 3300005842 Bacteria 1766
242 Ga0068858_100335848 3300005842 Bacteria 1446
243 Ga0068858_100359084 3300005842 Bacteria 1396
244 Ga0068858_100690760 3300005842 Bacteria 993
245 Ga0068860_100007151 3300005843 Bacteria 11164
246 Ga0068860_100008315 3300005843 Bacteria 10329
247 Ga0068860_100085448 3300005843 Bacteria 3002
248 Ga0068860_100100940 3300005843 Bacteria 2753
249 Ga0068862_100000372 3300005844 Bacteria 48605
250 Ga0068862_100042156 3300005844 Bacteria 3887
251 Ga0068862_100075385 3300005844 Bacteria 2918
252 Ga0068862_100108737 3300005844 Bacteria 2432
253 Ga0068862_100878837 3300005844 Bacteria 880
254 Ga0081539_10000025 3300005985 Bacteria 340255
255 Ga0081539_10000096 3300005985 Bacteria 204059
256 Ga0081539_10002107 3300005985 Bacteria 29488
257 Ga0097621_100001571 3300006237 Bacteria 15608
258 Ga0097621_100032709 3300006237 Bacteria 4136
259 Ga0097621_100040163 3300006237 Bacteria 3761
260 Ga0097621_100071733 3300006237 Bacteria 2863
261 Ga0097621_100094493 3300006237 Bacteria 2507
262 Ga0097621_100149534 3300006237 Bacteria 2002
263 Ga0097621_100276576 3300006237 Bacteria 1477
264 Ga0097621_100303918 3300006237 Bacteria 1410
265 Ga0097621_100360048 3300006237 Bacteria 1296
266 Ga0068871_100001669 3300006358 Bacteria 14925
267 Ga0068871_100006603 3300006358 Bacteria 8225
268 Ga0068871_100008906 3300006358 Bacteria 7240
269 Ga0068871_100036150 3300006358 Bacteria 3931
270 Ga0068871_100045302 3300006358 Bacteria 3540
271 Ga0068871_100109445 3300006358 Bacteria 2323
272 Ga0068871_100184696 3300006358 Bacteria 1793
273 Ga0075428_100002383 3300006844 Bacteria 20400
274 Ga0075428_100014078 3300006844 Bacteria 8899
275 Ga0075428_100016371 3300006844 Bacteria 8192
276 Ga0075428_100098291 3300006844 Bacteria 3191
277 Ga0075430_100002972 3300006846 Bacteria 14196
278 Ga0075430_100011657 3300006846 Bacteria 7480
279 Ga0075430_100022340 3300006846 Bacteria 5382
280 Ga0075430_100156579 3300006846 Bacteria 1896
281 Ga0075431_100005304 3300006847 Bacteria 12709
282 Ga0075431_100052173 3300006847 Bacteria 4217
283 Ga0075431_100053572 3300006847 Bacteria 4159
284 Ga0075431_100078937 3300006847 Bacteria 3398
285 Ga0075431_100141935 3300006847 Bacteria 2476
286 Ga0075431_100148600 3300006847 Bacteria 2413
287 Ga0075431_100241302 3300006847 Bacteria 1838
288 Ga0075431_100316796 3300006847 Bacteria 1573
289 Ga0075431_100445442 3300006847 Bacteria 1291
290 Ga0075431_100490522 3300006847 Bacteria 1221
291 Ga0075433_10000087 3300006852 Bacteria 42396
292 Ga0075433_10075174 3300006852 Bacteria 2973
293 Ga0075433_10075749 3300006852 Bacteria 2961
294 Ga0075433_10096842 3300006852 Bacteria 2611
295 Ga0075433_10102333 3300006852 Bacteria 2537
296 Ga0075433_10120512 3300006852 Bacteria 2329
297 Ga0075433_10120940 3300006852 Bacteria 2325
298 Ga0075433_10230073 3300006852 Bacteria 1646
299 Ga0075434_100000626 3300006871 Bacteria 27295
300 Ga0075434_100004452 3300006871 Bacteria 12629
301 Ga0075434_100011095 3300006871 Bacteria 8479
302 Ga0075434_100022459 3300006871 Bacteria 6145
303 Ga0075434_100243382 3300006871 Bacteria 1819
304 Ga0075434_100665703 3300006871 Bacteria 1059
305 Ga0075429_100002180 3300006880 Bacteria 16360
306 Ga0075429_100019325 3300006880 Bacteria 5900
307 Ga0075429_100028111 3300006880 Bacteria 4882
308 Ga0075429_100039138 3300006880 Bacteria 4127
309 Ga0075429_100067598 3300006880 Bacteria 3110
310 Ga0075429_100092196 3300006880 Bacteria 2642
311 Ga0075429_100194851 3300006880 Bacteria 1775
312 Ga0075429_100454178 3300006880 Bacteria 1123
313 Ga0075429_100635001 3300006880 Bacteria 935
314 Ga0068865_100027284 3300006881 Bacteria 3771
315 Ga0068865_100080843 3300006881 Bacteria 2332
316 Ga0068865_100183224 3300006881 Bacteria 1614
317 Ga0068865_100198814 3300006881 Bacteria 1555
318 Ga0068865_100403823 3300006881 Bacteria 1120
319 Ga0075436_100318547 3300006914 Bacteria 1117
320 Ga0097620_100001994 3300006931 Bacteria 20841
321 Ga0097620_100006375 3300006931 Bacteria 11966
322 Ga0097620_100044588 3300006931 Bacteria 4456
323 Ga0097620_100051108 3300006931 Bacteria 4154
324 Ga0097620_100141837 3300006931 Bacteria 2476
325 Ga0097620_100153848 3300006931 Bacteria 2376
326 Ga0097620_100737076 3300006931 Bacteria 1075
327 Ga0075435_100014642 3300007076 Bacteria 5874
328 Ga0075435_100238678 3300007076 Bacteria 1545
329 Ga0075435_100306425 3300007076 Bacteria 1359
330 Ga0075435_100354717 3300007076 Bacteria 1257
331 Ga0099794_10205123 3300007265 Bacteria 1010
332 Ga0111539_10000567 3300009094 Bacteria 47359
333 Ga0111539_10001492 3300009094 Bacteria 31274
334 Ga0111539_10002728 3300009094 Bacteria 23437
335 Ga0111539_10004548 3300009094 Bacteria 18136
336 Ga0111539_10004635 3300009094 Bacteria 17956
337 Ga0111539_10073882 3300009094 Bacteria 4019
338 Ga0111539_10188589 3300009094 Bacteria 2407
339 Ga0111539_10217230 3300009094 Bacteria 2227
340 Ga0111539_10225491 3300009094 Bacteria 2183
341 Ga0111539_10290657 3300009094 Bacteria 1902
342 Ga0111539_10326115 3300009094 Bacteria 1787
343 Ga0111539_10346074 3300009094 Bacteria 1730
344 Ga0111539_10764019 3300009094 Bacteria 1125
345 Ga0105245_10013538 3300009098 Bacteria 7104
346 Ga0105245_10152842 3300009098 Bacteria 2184
347 Ga0105245_10381735 3300009098 Bacteria 1403
348 Ga0114129_10001344 3300009147 Bacteria 32950
349 Ga0114129_10002019 3300009147 Bacteria 27820
350 Ga0114129_10003522 3300009147 Bacteria 22030
351 Ga0114129_10022441 3300009147 Bacteria 8961
352 Ga0114129_10045375 3300009147 Bacteria 6179
353 Ga0114129_10053535 3300009147 Bacteria 5660
354 Ga0114129_10069562 3300009147 Bacteria 4907
355 Ga0114129_10118459 3300009147 Bacteria 3647
356 Ga0114129_10151200 3300009147 Bacteria 3177
357 Ga0114129_10355829 3300009147 Bacteria 1938
358 Ga0114129_10800374 3300009147 Bacteria 1202
359 Ga0114129_10953644 3300009147 Bacteria 1083
360 Ga0105243_10254062 3300009148 Bacteria 1571
361 Ga0105243_10255715 3300009148 Bacteria 1566
362 Ga0105243_10412752 3300009148 Bacteria 1257
363 Ga0105241_10042506 3300009174 Bacteria 3439
364 Ga0105242_10007343 3300009176 Bacteria 8483
365 Ga0105242_10036670 3300009176 Bacteria 3935
366 Ga0105242_10086885 3300009176 Bacteria 2625
367 Ga0105242_10124805 3300009176 Bacteria 2214
368 Ga0105242_10390770 3300009176 Bacteria 1295
369 Ga0105248_10013273 3300009177 Bacteria 9068
370 Ga0105248_10013724 3300009177 Bacteria 8918
371 Ga0105248_10029340 3300009177 Bacteria 6137
372 Ga0105248_10065510 3300009177 Bacteria 4079
373 Ga0105248_10111996 3300009177 Bacteria 3078
374 Ga0105248_10132982 3300009177 Bacteria 2807
375 Ga0105248_10207877 3300009177 Bacteria 2205
376 Ga0105248_10230898 3300009177 Bacteria 2083
377 Ga0105248_10248976 3300009177 Bacteria 2000
378 Ga0105248_10418786 3300009177 Bacteria 1508
379 Ga0105248_10669229 3300009177 Bacteria 1171
380 Ga0105248_10704934 3300009177 Bacteria 1139
381 Ga0105237_10321159 3300009545 Bacteria 1552
382 Ga0105238_10345054 3300009551 Bacteria 1477
383 Ga0105238_10350048 3300009551 Bacteria 1466
384 Ga0105249_10003191 3300009553 Bacteria 14190
385 Ga0105249_10012019 3300009553 Bacteria 7618
386 Ga0105249_10087577 3300009553 Bacteria 2906
387 Ga0105249_10169652 3300009553 Bacteria 2115
388 Ga0105249_10312096 3300009553 Bacteria 1581
389 Ga0105249_10355578 3300009553 Bacteria 1485
390 Ga0105249_10581507 3300009553 Bacteria 1173
391 Ga0105249_11468056 3300009553 Bacteria 754
392 Ga0105239_10038070 3300010375 Bacteria 5269
393 Ga0105239_10273167 3300010375 Bacteria 1901
394 Ga0105239_10760321 3300010375 Bacteria 1109
395 Ga0105246_10021238 3300011119 Bacteria 4175
396 Ga0105246_10149005 3300011119 Bacteria 1769
397 Ga0157369_10165658 3300013105 Bacteria 2331
398 Ga0157369_10180070 3300013105 Bacteria 2224
399 Ga0157374_10057694 3300013296 Bacteria 3627
400 Ga0157374_10079966 3300013296 Bacteria 3099
401 Ga0157374_10227175 3300013296 Bacteria 1833
402 Ga0157378_10013464 3300013297 Bacteria 7154
403 Ga0157378_10848357 3300013297 Bacteria 942
404 Ga0157378_10903955 3300013297 Bacteria 914
405 Ga0157378_10944986 3300013297 Bacteria 894
406 Ga0163162_10115623 3300013306 Bacteria 2783
407 Ga0163162_10196415 3300013306 Bacteria 2146
408 Ga0163162_10580298 3300013306 Bacteria 1248
409 Ga0157372_10205853 3300013307 Bacteria 2280
410 Ga0157375_10003556 3300013308 Bacteria 13527
411 Ga0157375_10016434 3300013308 Bacteria 6650
412 Ga0157375_10278898 3300013308 Bacteria 1834
413 Ga0157375_10420180 3300013308 Bacteria 1503
414 Ga0157375_10581958 3300013308 Bacteria 1280
415 Ga0163163_10016539 3300014325 Bacteria 6858
416 Ga0163163_10036932 3300014325 Bacteria 4749
417 Ga0163163_10062694 3300014325 Bacteria 3684
418 Ga0163163_10320475 3300014325 Bacteria 1604
419 Ga0157380_10008003 3300014326 Bacteria 7528
420 Ga0157380_10069384 3300014326 Bacteria 2844
421 Ga0157380_10098032 3300014326 Bacteria 2434
422 Ga0157380_10319549 3300014326 Bacteria 1439
423 Ga0157380_10569485 3300014326 Bacteria 1115
424 Ga0157380_10891041 3300014326 Bacteria 915
425 Ga0157380_11388679 3300014326 Bacteria 752
426 Ga0157377_10032915 3300014745 Bacteria 2826
427 Ga0157377_10038353 3300014745 Bacteria 2644
428 Ga0157377_10054032 3300014745 Bacteria 2273
429 Ga0157377_10134722 3300014745 Bacteria 1512
430 Ga0157377_10201698 3300014745 Bacteria 1263
431 Ga0157379_10013212 3300014968 Bacteria 7231
432 Ga0157379_10029073 3300014968 Bacteria 4915
433 Ga0157379_10110034 3300014968 Bacteria 2474
434 Ga0157379_10314944 3300014968 Bacteria 1428
435 Ga0157376_10016929 3300014969 Bacteria 5548
436 Ga0157376_10077185 3300014969 Bacteria 2849
437 Ga0157376_10087375 3300014969 Bacteria 2690
438 Ga0157376_10312576 3300014969 Bacteria 1491
439 Ga0157376_10381489 3300014969 Bacteria 1358
440 Ga0157376_10519855 3300014969 Bacteria 1173
441 Ga0163161_10484039 3300017792 Bacteria 1005
442 Ga0213873_10054547 3300021358 Bacteria 1067
443 Ga0207697_10001016 3300025315 Bacteria 15709
444 Ga0207697_10010483 3300025315 Bacteria 3959
445 Ga0207697_10043891 3300025315 Bacteria 1838
446 Ga0207682_10012235 3300025893 Bacteria 3350
447 Ga0207682_10021575 3300025893 Bacteria 2534
448 Ga0207682_10021826 3300025893 Bacteria 2519
449 Ga0207710_10017721 3300025900 Bacteria 3021
450 Ga0207688_10013888 3300025901 Bacteria 4377
451 Ga0207688_10059669 3300025901 Bacteria 2149
452 Ga0207680_10157119 3300025903 Bacteria 1522
453 Ga0207680_10547434 3300025903 Bacteria 826
454 Ga0207699_10216097 3300025906 Bacteria 1306
455 Ga0207699_10375210 3300025906 Bacteria 1008
456 Ga0207645_10002884 3300025907 Bacteria 13296
457 Ga0207645_10041434 3300025907 Bacteria 2947
458 Ga0207645_10088519 3300025907 Bacteria 1990
459 Ga0207643_10009275 3300025908 Bacteria 5287
460 Ga0207643_10011211 3300025908 Bacteria 4840
461 Ga0207643_10014580 3300025908 Bacteria 4272
462 Ga0207643_10016665 3300025908 Bacteria 4008
463 Ga0207643_10038637 3300025908 Bacteria 2682
464 Ga0207654_10060245 3300025911 Bacteria 2217
465 Ga0207654_10276757 3300025911 Bacteria 1134
466 Ga0207707_10012151 3300025912 Bacteria 7483
467 Ga0207707_10039879 3300025912 Bacteria 4103
468 Ga0207671_10101884 3300025914 Bacteria 2176
469 Ga0207660_10070102 3300025917 Bacteria 2548
470 Ga0207660_10430113 3300025917 Bacteria 1066
471 Ga0207662_10005253 3300025918 Bacteria 6877
472 Ga0207662_10012312 3300025918 Bacteria 4761
473 Ga0207662_10117024 3300025918 Bacteria 1667
474 Ga0207662_10250986 3300025918 Bacteria 1161
475 Ga0207649_10076881 3300025920 Bacteria 2149
476 Ga0207649_10177785 3300025920 Bacteria 1487
477 Ga0207649_10343518 3300025920 Bacteria 1103
478 Ga0207649_10368495 3300025920 Bacteria 1068
479 Ga0207646_10135116 3300025922 Bacteria 2220
480 Ga0207646_10441870 3300025922 Bacteria 1174
481 Ga0207681_10017882 3300025923 Bacteria 4457
482 Ga0207681_10030230 3300025923 Bacteria 3529
483 Ga0207681_10065236 3300025923 Bacteria 2516
484 Ga0207681_10070206 3300025923 Bacteria 2439
485 Ga0207681_10174645 3300025923 Bacteria 1631
486 Ga0207681_10199493 3300025923 Bacteria 1535
487 Ga0207694_10007427 3300025924 Bacteria 8305
488 Ga0207694_10050531 3300025924 Bacteria 3220
489 Ga0207694_10073693 3300025924 Bacteria 2671
490 Ga0207650_10001775 3300025925 Bacteria 15259
491 Ga0207650_10015425 3300025925 Bacteria 5321
492 Ga0207650_10129289 3300025925 Bacteria 1975
493 Ga0207650_10329591 3300025925 Bacteria 1252
494 Ga0207659_10001703 3300025926 Bacteria 13047
495 Ga0207659_10004418 3300025926 Bacteria 8501
496 Ga0207659_10015264 3300025926 Bacteria 4972
497 Ga0207659_10015923 3300025926 Bacteria 4885
498 Ga0207659_10031396 3300025926 Bacteria 3636
499 Ga0207659_10053891 3300025926 Bacteria 2870
500 Ga0207659_10081219 3300025926 Bacteria 2396
501 Ga0207659_10091115 3300025926 Bacteria 2277
502 Ga0207659_10266610 3300025926 Bacteria 1395
503 Ga0207659_10296280 3300025926 Bacteria 1327
504 Ga0207659_10386611 3300025926 Bacteria 1168
505 Ga0207687_10053934 3300025927 Bacteria 2811
506 Ga0207687_10066384 3300025927 Bacteria 2564
507 Ga0207644_10123951 3300025931 Bacteria 1970
508 Ga0207690_10207275 3300025932 Bacteria 1493
509 Ga0207690_10252684 3300025932 Bacteria 1362
510 Ga0207706_10008412 3300025933 Bacteria 9521
511 Ga0207706_10020366 3300025933 Bacteria 5962
512 Ga0207706_10043975 3300025933 Bacteria 3958
513 Ga0207706_10078600 3300025933 Bacteria 2902
514 Ga0207706_10122218 3300025933 Bacteria 2290
515 Ga0207706_10216198 3300025933 Bacteria 1679
516 Ga0207706_10249914 3300025933 Bacteria 1549
517 Ga0207706_10253432 3300025933 Bacteria 1537
518 Ga0207706_10333489 3300025933 Bacteria 1320
519 Ga0207686_10018781 3300025934 Bacteria 3919
520 Ga0207686_10021397 3300025934 Bacteria 3711
521 Ga0207686_10046496 3300025934 Bacteria 2677
522 Ga0207686_10087232 3300025934 Bacteria 2052
523 Ga0207709_10400014 3300025935 Bacteria 1050
524 Ga0207670_10005999 3300025936 Bacteria 6713
525 Ga0207670_10012229 3300025936 Bacteria 5014
526 Ga0207670_10027166 3300025936 Bacteria 3616
527 Ga0207670_10255680 3300025936 Bacteria 1355
528 Ga0207670_10481459 3300025936 Bacteria 1005
529 Ga0207669_10000231 3300025937 Bacteria 25543
530 Ga0207669_10005982 3300025937 Bacteria 5517
531 Ga0207669_10017555 3300025937 Bacteria 3675
532 Ga0207669_10273417 3300025937 Bacteria 1270
533 Ga0207704_10080081 3300025938 Bacteria 2107
534 Ga0207704_10156533 3300025938 Bacteria 1616
535 Ga0207691_10004416 3300025940 Bacteria 13631
536 Ga0207691_10007105 3300025940 Bacteria 10810
537 Ga0207691_10016220 3300025940 Bacteria 7072
538 Ga0207691_10017697 3300025940 Bacteria 6755
539 Ga0207691_10022802 3300025940 Bacteria 5901
540 Ga0207691_10025499 3300025940 Bacteria 5550
541 Ga0207691_10026882 3300025940 Bacteria 5399
542 Ga0207691_10035089 3300025940 Bacteria 4660
543 Ga0207691_10045862 3300025940 Bacteria 4018
544 Ga0207691_10125522 3300025940 Bacteria 2271
545 Ga0207711_10010779 3300025941 Bacteria 7599
546 Ga0207711_10020676 3300025941 Bacteria 5492
547 Ga0207711_10020678 3300025941 Bacteria 5492
548 Ga0207711_10031286 3300025941 Bacteria 4492
549 Ga0207711_10143180 3300025941 Bacteria 2152
550 Ga0207711_10183398 3300025941 Bacteria 1904
551 Ga0207711_10416943 3300025941 Bacteria 1248
552 Ga0207711_10426944 3300025941 Bacteria 1233
553 Ga0207711_10432616 3300025941 Bacteria 1224
554 Ga0207689_10007752 3300025942 Bacteria 9396
555 Ga0207689_10025874 3300025942 Bacteria 4915
556 Ga0207689_10049638 3300025942 Bacteria 3462
557 Ga0207689_10055891 3300025942 Bacteria 3247
558 Ga0207689_10214699 3300025942 Bacteria 1590
559 Ga0207661_10046911 3300025944 Bacteria 3427
560 Ga0207661_10122572 3300025944 Bacteria 2215
561 Ga0207661_10403624 3300025944 Bacteria 1240
562 Ga0207661_10523097 3300025944 Bacteria 1085
563 Ga0207679_10006852 3300025945 Bacteria 7221
564 Ga0207679_10028806 3300025945 Bacteria 3859
565 Ga0207679_10056396 3300025945 Bacteria 2900
566 Ga0207679_10071897 3300025945 Bacteria 2611
567 Ga0207679_10151199 3300025945 Bacteria 1889
568 Ga0207679_10320344 3300025945 Bacteria 1342
569 Ga0207667_10123893 3300025949 Plasmid 2663
570 Ga0207667_10292844 3300025949 Bacteria 1663
571 Ga0207651_10003849 3300025960 Bacteria 7446
572 Ga0207651_10007615 3300025960 Bacteria 5780
573 Ga0207651_10017816 3300025960 Bacteria 4207
574 Ga0207651_10032049 3300025960 Bacteria 3370
575 Ga0207651_10033541 3300025960 Bacteria 3312
576 Ga0207651_10116883 3300025960 Bacteria 2014
577 Ga0207651_10146444 3300025960 Bacteria 1832
578 Ga0207651_10546221 3300025960 Bacteria 1007
579 Ga0207712_10006952 3300025961 Bacteria 7139
580 Ga0207712_10012497 3300025961 Bacteria 5426
581 Ga0207712_10032917 3300025961 Bacteria 3501
582 Ga0207712_10050080 3300025961 Bacteria 2915
583 Ga0207712_10487528 3300025961 Bacteria 1051
584 Ga0207668_10076008 3300025972 Bacteria 2417
585 Ga0207668_10349938 3300025972 Bacteria 1235
586 Ga0207658_10433241 3300025986 Bacteria 1161
587 Ga0207658_10491270 3300025986 Bacteria 1092
588 Ga0207677_10050957 3300026023 Bacteria 2804
589 Ga0207677_10339873 3300026023 Bacteria 1254
590 Ga0207677_10703555 3300026023 Bacteria 897
591 Ga0207703_10005141 3300026035 Bacteria 10587
592 Ga0207703_10014387 3300026035 Bacteria 6169
593 Ga0207703_10139926 3300026035 Bacteria 2099
594 Ga0207639_10285328 3300026041 Bacteria 1453
595 Ga0207678_10037709 3300026067 Bacteria 4204
596 Ga0207708_10006005 3300026075 Bacteria 8998
597 Ga0207708_10012424 3300026075 Bacteria 6349
598 Ga0207708_10038269 3300026075 Bacteria 3654
599 Ga0207702_10015191 3300026078 Bacteria 6383
600 Ga0207641_10012575 3300026088 Bacteria 6938
601 Ga0207641_10033732 3300026088 Bacteria 4253
602 Ga0207641_10154987 3300026088 Bacteria 2078
603 Ga0207641_10173563 3300026088 Bacteria 1970
604 Ga0207648_10118490 3300026089 Bacteria 2327
605 Ga0207648_10139185 3300026089 Bacteria 2139
606 Ga0207648_10436657 3300026089 Bacteria 1190
607 Ga0207676_10014828 3300026095 Bacteria 5615
608 Ga0207676_10032474 3300026095 Bacteria 3934
609 Ga0207676_10034181 3300026095 Bacteria 3848
610 Ga0207676_10044621 3300026095 Bacteria 3421
611 Ga0207676_10178115 3300026095 Bacteria 1859
612 Ga0207674_10056626 3300026116 Bacteria 3980
613 Ga0207674_10061438 3300026116 Bacteria 3796
614 Ga0207674_10078319 3300026116 Bacteria 3310
615 Ga0207674_10112181 3300026116 Bacteria 2700
616 Ga0207674_10150906 3300026116 Bacteria 2281
617 Ga0207675_100001696 3300026118 Bacteria 22066
618 Ga0207675_100005425 3300026118 Bacteria 12217
619 Ga0207675_100217529 3300026118 Bacteria 1840
620 Ga0207675_100223099 3300026118 Bacteria 1816
621 Ga0207683_10008337 3300026121 Bacteria 8864
622 Ga0207683_10027651 3300026121 Bacteria 4901
623 Ga0207683_10031108 3300026121 Bacteria 4631
624 Ga0207683_10055495 3300026121 Bacteria 3474
625 Ga0207683_10091942 3300026121 Bacteria 2703
626 Ga0207683_10133201 3300026121 Bacteria 2236
627 Ga0207683_10147040 3300026121 Bacteria 2126
628 Ga0207683_10581970 3300026121 Bacteria 1035
629 Ga0207683_10605668 3300026121 Unclassified 1014
630 Ga0207428_10001082 3300027907 Bacteria 29692
631 Ga0207428_10002447 3300027907 Bacteria 18548
632 Ga0207428_10013264 3300027907 Bacteria 7204
633 Ga0207428_10017976 3300027907 Bacteria 6055
634 Ga0207428_10034986 3300027907 Bacteria 4110
635 Ga0207428_10076697 3300027907 Bacteria 2617
636 Ga0207428_10119685 3300027907 Bacteria 2020
637 Ga0207428_10421706 3300027907 Bacteria 975
638 Ga0268266_10182862 3300028379 Bacteria 1910
639 Ga0268266_10240860 3300028379 Bacteria 1669
640 Ga0268266_10400988 3300028379 Bacteria 1297
641 Ga0268265_10100004 3300028380 Bacteria 2339
642 Ga0268265_10788691 3300028380 Bacteria 925
643 Ga0268265_11072868 3300028380 Bacteria 798
644 Ga0268264_10009087 3300028381 Bacteria 8241
645 Ga0268264_10160139 3300028381 Bacteria 2027
646 Ga0268264_10173693 3300028381 Bacteria 1951
647 Ga0268264_10458092 3300028381 Bacteria 1237
648 Ga0265340_10025074 3300031247 Bacteria 3024
649 Ga0307408_100023087 3300031548 Bacteria 4234
650 Ga0265313_10003728 3300031595 Bacteria 12123
651 Ga0265314_10000525 3300031711 Bacteria 49392
652 Ga0307405_10072482 3300031731 Bacteria 2220
653 Ga0307413_10005418 3300031824 Bacteria 5695
654 Ga0307410_10004471 3300031852 Bacteria 7237
655 Ga0307406_10310640 3300031901 Bacteria 1215
656 Ga0307412_10022865 3300031911 Bacteria 3839
657 Ga0307412_10077025 3300031911 Bacteria 2293
658 Ga0307409_100031378 3300031995 Bacteria 3834
659 Ga0307409_100091512 3300031995 Bacteria 2493
660 Ga0307416_100112629 3300032002 Bacteria 2401
661 Ga0307414_10014578 3300032004 Bacteria 4718
662 Ga0307411_10003340 3300032005 Bacteria 7429
663 Ga0307411_10073445 3300032005 Bacteria 2327
664 Ga0307415_100052293 3300032126 Bacteria 2777
665 Ga0307415_100090251 3300032126 Bacteria 2216
666 Ga0307415_100155266 3300032126 Bacteria 1766
667 Ga0373958_0012712 3300034819 Bacteria 1445
668 Ga0373923_0081051 3300035111 Bacteria 1408
669 Ga0373932_0057857 3300035112 Bacteria 1170
670 Ga0373936_0082465 3300035113 Bacteria 1340
671 Ga0373941_0031601 3300035115 Bacteria 1579
672 Ga0373954_0220986 3300035118 Bacteria 932
673 Ga0373960_0040829 3300035121 Bacteria 1341
674 Ga0373955_0026585 3300035172 Bacteria 2983
675 Ga0373955_0082195 3300035172 Bacteria 1822
676 Ga0373955_0101852 3300035172 Bacteria 1649
677 Ga0373962_0030340 3300035242 Bacteria 1479
678 Ga0373931_0390526 3300035691 Bacteria 879
679 Ga0373935_0058311 3300035692 Bacteria 2466
680 Ga0373935_0631282 3300035692 Bacteria 785
681 Ga0373937_0072984 3300036401 Bacteria 3165
682 Ga0373937_0314041 3300036401 Bacteria 1483
683 Ga0373937_0398744 3300036401 Bacteria 1305
684 Ga0373937_0687738 3300036401 Bacteria 969
685 Ga0373925_0020488 3300037068 Bacteria 4814
686 Ga0436364_0054869 3300037853 Bacteria 4055
687 Ga0436364_0169125 3300037853 Bacteria 1941
688 Ga0436364_0378507 3300037853 Unclassified 4356
689 Ga0436365_1671986 3300039437 Bacteria 2063
690 Ga0436362_0328766 3300039453 Bacteria 1593
691 Ga0451853_1737950 3300041512 Bacteria 971
692 Ga0439444_0069949 3300042437 Bacteria 749
693 Ga0439460_0100628 3300042461 Bacteria 928
694 Ga0451576_0476348 3300045051 Bacteria 1311
695 Ga0495592_0026197 3300046454 Bacteria 4423
696 Ga0495592_0053413 3300046454 Bacteria 2997
697 Ga0495629_0013241 3300046459 Bacteria 5955
698 Ga0495651_0236533 3300046462 Bacteria 1255
699 Ga0495580_0080014 3300046472 Bacteria 2279
700 Ga0495662_0140184 3300046476 Bacteria 1190
701 Ga0495664_0259891 3300046477 Bacteria 1050
702 Ga0495594_0298993 3300046499 Bacteria 917
703 Ga0495608_0028538 3300046511 Bacteria 3792
704 Ga0495618_0110431 3300046514 Bacteria 1761
705 Ga0495630_0012421 3300046517 Bacteria 6183
706 Ga0495643_0001567 3300046522 Bacteria 20341
707 Ga0495663_0007325 3300046525 Bacteria 3047
708 Ga0495642_0072356 3300046528 Bacteria 1443
709 Ga0495642_0115461 3300046528 Bacteria 1150
710 Ga0495652_0221939 3300046529 Bacteria 1420
711 Ga0495587_0008146 3300046536 Bacteria 6755
712 Ga0495598_0057402 3300046537 Bacteria 1191
713 Ga0495598_0114664 3300046537 Bacteria 907
714 Ga0495621_0088445 3300046539 Bacteria 1165
715 Ga0495645_0198285 3300046543 Bacteria 1363
716 Ga0495622_0185869 3300046557 Bacteria 930
717 Ga0495667_0032770 3300046559 Bacteria 3479
718 Ga0495667_0432409 3300046559 Bacteria 828
719 Ga0495634_0127507 3300046642 Bacteria 1625
720 Ga0495634_0138620 3300046642 Bacteria 1546
721 Ga0495659_0008902 3300046664 Bacteria 3197
722 Ga0495659_0050700 3300046664 Bacteria 1510
723 Ga0495659_0138238 3300046664 Bacteria 970
724 Ga0495657_0005182 3300046675 Bacteria 10322
725 Ga0495658_0016418 3300046683 Bacteria 3812
726 Ga0495613_0007106 3300046689 Bacteria 8335
727 Ga0495613_0109420 3300046689 Bacteria 1992
728 Ga0495604_0046890 3300047317 Bacteria 3368
729 Ga0495636_0014307 3300047318 Bacteria 3153
730 Ga0495636_0034182 3300047318 Bacteria 2091
731 Ga0495674_0050525 3300047319 Bacteria 3669
732 Ga0495674_0092187 3300047319 Bacteria 2587
733 Ga0495674_0234944 3300047319 Bacteria 1512
734 Ga0495680_0497368 3300047322 Bacteria 828
735 Ga0495677_0055621 3300047445 Bacteria 1461
736 Ga0495685_088243 3300047447 Bacteria 1029
737 Ga0495684_0000113 3300047471 Bacteria 58380
738 Ga0495684_0101921 3300047471 Bacteria 2170
739 Ga0495684_0271315 3300047471 Bacteria 1227
740 Ga0495602_0084600 3300048088 Bacteria 2653
741 Ga0496100_0463803 3300048903 Bacteria 972
742 Ga0496101_0000937 3300048904 Bacteria 17236
743 Ga0496102_0074474 3300048905 Bacteria 3121
744 Ga0496102_0273033 3300048905 Bacteria 1594
745 Ga0496102_0448996 3300048905 Bacteria 1210
746 Ga0496104_0006654 3300048907 Bacteria 10172
747 Ga0496104_0165450 3300048907 Bacteria 2121
748 Ga0496105_0180125 3300048908 Bacteria 1731
749 Ga0496105_0211999 3300048908 Bacteria 1579
750 Ga0496105_0378918 3300048908 Bacteria 1126
751 Ga0496106_0247777 3300048909 Bacteria 1424
752 Ga0496106_0473788 3300048909 Bacteria 1006
753 Ga0496107_0038402 3300048910 Bacteria 3435
754 Ga0496108_0007766 3300048911 Bacteria 8690
755 Ga0496108_0155775 3300048911 Bacteria 1973
756 Ga0496108_0277548 3300048911 Bacteria 1459
757 Ga0496109_0000850 3300048912 Bacteria 25562
758 Ga0496109_0533859 3300048912 Bacteria 1107
759 Ga0496109_0597932 3300048912 Bacteria 1039
760 Ga0496110_0009128 3300048913 Bacteria 8005
761 Ga0496110_0039496 3300048913 Bacteria 4110
762 Ga0496110_0229068 3300048913 Bacteria 1690
763 Ga0496111_0002110 3300048914 Bacteria 11868
764 Ga0496112_0001752 3300048915 Bacteria 17013
765 Ga0496112_0116988 3300048915 Bacteria 2636
766 Ga0496112_0270414 3300048915 Bacteria 1648
767 Ga0496114_0000775 3300048917 Bacteria 23864
768 Ga0496115_0168357 3300048918 Bacteria 1812
769 Ga0496115_0275084 3300048918 Bacteria 1383
770 Ga0501038_0429890 3300049574 Bacteria 1018
771 Ga0501040_0013923 3300049576 Bacteria 5296
772 Ga0501041_0001187 3300049577 Bacteria 14194
773 Ga0501041_0241295 3300049577 Bacteria 1136
774 Ga0501042_0010256 3300049578 Bacteria 6272
775 Ga0501048_0213943 3300049582 Bacteria 1367
776 Ga0501048_0287096 3300049582 Bacteria 1170
777 Ga0501068_0027376 3300049584 Bacteria 3366
778 Ga0501071_0011783 3300049587 Bacteria 5899
779 Ga0501072_0380266 3300049588 Bacteria 1120
780 Ga0501075_0041243 3300049591 Bacteria 3458
781 Ga0501076_0002688 3300049592 Bacteria 12285
782 Ga0501223_044207 3300049663 Bacteria 864
783 Ga0501225_0072870 3300049705 Bacteria 978
784 Ga0501079_0006438 3300049741 Bacteria 8818
785 Ga0501080_0119851 3300049742 Bacteria 2439
786 Ga0501081_0002548 3300049743 Bacteria 11494
787 Ga0501283_014944 3300049779 Bacteria 1191
788 Ga0501045_0014031 3300049824 Bacteria 5671
789 Ga0501045_0418487 3300049824 Bacteria 997
790 nmdc:mga05p37_101137_c1 3300050507 Bacteria 3550
791 nmdc:mga05p37_111713_c1 3300050507 Bacteria 3361
792 nmdc:mga05p37_112248_c1 3300050507 Bacteria 3352
793 nmdc:mga05p37_13577_c1 3300050507 Bacteria 9763
794 nmdc:mga05p37_187811_c1 3300050507 Bacteria 2511
795 nmdc:mga05p37_19453_c1 3300050507 Bacteria 8214
796 nmdc:mga05p37_283521_c1 3300050507 Bacteria 1975
797 nmdc:mga05p37_300422_c1 3300050507 Bacteria 1908
798 nmdc:mga05p37_49815_c1 3300050507 Bacteria 5151
799 nmdc:mga05p37_624649_c1 3300050507 Bacteria 1212
800 nmdc:mga05p37_7128_c1 3300050507 Bacteria 13181
801 nmdc:mga05p37_73408_c1 3300050507 Plasmid 4211
802 nmdc:mga05p37_75484_c1 3300050507 Bacteria 4149
803 nmdc:mga05p37_839811_c1 3300050507 Bacteria 999
804 nmdc:mga05p37_84719_c1 3300050507 Bacteria 3905
805 nmdc:mga05p37_91164_c1 3300050507 Bacteria 3756
806 nmdc:mga09592_105425_c1 3300050508 Unclassified 2417
807 nmdc:mga09592_2353_c1 3300050508 Bacteria 15266
808 nmdc:mga09592_254023_c1 3300050508 Bacteria 1524
809 nmdc:mga09592_42997_c1 3300050508 Bacteria 3801
810 nmdc:mga09592_45650_c1 3300050508 Bacteria 3691
811 nmdc:mga09592_530600_c1 3300050508 Bacteria 1012
812 nmdc:mga09592_75233_c1 3300050508 Bacteria 2870
813 nmdc:mga0qj67_217601_c1 3300050509 Bacteria 1551
814 nmdc:mga0qj67_42798_c1 3300050509 Bacteria 3565
815 nmdc:mga0qj67_5613_c1 3300050509 Bacteria 9170
816 nmdc:mga0qj67_68827_c1 3300050509 Bacteria 2822
817 nmdc:mga0qj67_71481_c1 3300050509 Bacteria 2769
818 nmdc:mga0qj67_8197_c1 3300050509 Bacteria 7745
819 nmdc:mga06r32_134414_c1 3300050510 Bacteria 2448
820 nmdc:mga06r32_187898_c1 3300050510 Bacteria 2053
821 nmdc:mga06r32_191077_c1 3300050510 Bacteria 2035
822 nmdc:mga06r32_238565_c1 3300050510 Bacteria 1806
823 nmdc:mga06r32_41204_c1 3300050510 Bacteria 4386
824 nmdc:mga06r32_558144_c1 3300050510 Bacteria 1118
825 nmdc:mga06r32_671486_c1 3300050510 Bacteria 1003
826 nmdc:mga06r32_786093_c1 3300050510 Unclassified 913
827 nmdc:mga08y16_111156_c1 3300050511 Bacteria 2853
828 nmdc:mga08y16_138474_c1 3300050511 Bacteria 2530
829 nmdc:mga08y16_169031_c1 3300050511 Bacteria 2271
830 nmdc:mga08y16_177952_c1 3300050511 Bacteria 2209
831 nmdc:mga08y16_1910_c1 3300050511 Bacteria 21237
832 nmdc:mga08y16_25556_c1 3300050511 Bacteria 6230
833 nmdc:mga08y16_280343_c1 3300050511 Bacteria 1719
834 nmdc:mga08y16_30872_c1 3300050511 Bacteria 5635
835 nmdc:mga08y16_31341_c1 3300050511 Bacteria 5592
836 nmdc:mga08y16_32717_c1 3300050511 Bacteria 5467
837 nmdc:mga08y16_374100_c1 3300050511 Bacteria 1461
838 nmdc:mga08y16_4446_c1 3300050511 Bacteria 14653
839 nmdc:mga08y16_52356_c1 3300050511 Bacteria 4271
840 nmdc:mga08y16_678_c1 3300050511 Bacteria 32175
841 nmdc:mga0n895_10008_c1 3300050512 Bacteria 8347
842 nmdc:mga0n895_152613_c1 3300050512 Bacteria 2341
843 nmdc:mga0n895_19589_c1 3300050512 Bacteria 6291
844 nmdc:mga0n895_25120_c1 3300050512 Bacteria 5625
845 nmdc:mga0n895_46370_c1 3300050512 Bacteria 4246
846 nmdc:mga0n895_724923_c1 3300050512 Bacteria 989
847 nmdc:mga0n895_7614_c1 3300050512 Bacteria 9310
848 nmdc:mga0n895_836487_c1 3300050512 Bacteria 909
849 nmdc:mga0n895_899133_c1 3300050512 Bacteria 871
850 nmdc:mga0rr50_10558_c1 3300050513 Bacteria 5868
851 nmdc:mga0rr50_31204_c1 3300050513 Bacteria 3782
852 nmdc:mga0rr50_46550_c1 3300050513 Bacteria 3194
853 nmdc:mga0a205_11071_c1 3300050515 Bacteria 8299
854 nmdc:mga0a205_151_c1 3300050515 Bacteria 29511
855 nmdc:mga0a205_181594_c1 3300050515 Bacteria 1998
856 nmdc:mga0a205_221524_c1 3300050515 Bacteria 1777
857 nmdc:mga0a205_2445_c1 3300050515 Bacteria 16390
858 nmdc:mga0a205_259119_c1 3300050515 Bacteria 1617
859 nmdc:mga0a205_285830_c1 3300050515 Bacteria 1524
860 nmdc:mga0a205_311366_c1 3300050515 Bacteria 1446
861 nmdc:mga0a205_324532_c1 3300050515 Bacteria 1410
862 nmdc:mga0a205_403612_c1 3300050515 Bacteria 1230
863 nmdc:mga0a205_56664_c1 3300050515 Bacteria 3783
864 nmdc:mga0a205_6986_c1 3300050515 Bacteria 10203
865 nmdc:mga0a205_708089_c1 3300050515 Bacteria 857
866 nmdc:mga0a205_82541_c1 3300050515 Bacteria 3105
867 nmdc:mga0a205_9605_c1 3300050515 Bacteria 8854
868 Ga0495619_0035670 3300053085 Bacteria 3236
869 Ga0495619_0050415 3300053085 Bacteria 2747
870 Ga0501084_0006886 3300054114 Bacteria 9358
871 Ga0501082_0003187 3300060353 Bacteria 14312
872 Ga0501082_0627456 3300060353 Bacteria 940
873 Ga0530510_0139390 3300061734 Bacteria 1786
874 Ga0439450_006452
875 JGI24746J21847_1002544
876 JGI24751J29686_10009957
877 JGI25406J46586_10000232
878 JGI25406J46586_10001315
879 Ga0065714_10085456
880 Ga0065714_10120188
881 Ga0065714_10149312
882 Ga0065704_10273334
883 Ga0065704_10313460
884 Ga0065712_10067948
885 Ga0065712_10124515
886 Ga0065712_10176768
887 Ga0065712_10189211
888 Ga0065712_10198719
889 Ga0065715_10021739
890 Ga0065715_10059175
891 Ga0065715_10093248
892 Ga0065715_10105587
893 Ga0065715_10123434
894 Ga0065715_10143077
895 Ga0065707_10000320
896 Ga0065707_10031132
897 Ga0065707_10031795
898 Ga0065707_10114725
899 Ga0065707_10119767
900 Ga0065707_10135363
901 Ga0065707_10140521
902 Ga0065707_10146296
903 Ga0065707_10218354
904 Ga0070676_10016023
905 Ga0070676_10122688
906 Ga0070676_10328022
907 Ga0070683_100004934
908 Ga0070683_100010580
909 Ga0070683_100175478
910 Ga0070683_100376439
911 Ga0070690_100077453
912 Ga0070690_100083444
913 Ga0070690_100094303
914 Ga0070670_100000414
915 Ga0070670_100004339
916 Ga0070670_100006900
917 Ga0070670_100123948
918 Ga0070670_100152999
919 Ga0070670_100192171
920 Ga0070670_100280375
921 Ga0070670_100453175
922 Ga0070677_10002777
923 Ga0070677_10008271
924 Ga0070677_10020655
925 Ga0068869_100041576
926 Ga0068869_100054125
927 Ga0068869_100139953
928 Ga0068869_100179378
929 Ga0068869_100322536
930 Ga0070666_10013799
931 Ga0070666_10063705
932 Ga0070666_10087770
933 Ga0070666_10109890
934 Ga0070666_10261934
935 Ga0070680_100206750
936 Ga0070680_100460250
937 Ga0068868_100026656
938 Ga0068868_100066560
939 Ga0068868_100800607
940 Ga0070689_100023010
941 Ga0070689_100024009
942 Ga0070689_100071452
943 Ga0070689_100173571
944 Ga0070687_100025806
945 Ga0070687_100038442
946 Ga0070687_100060972
947 Ga0070687_100292908
948 Ga0070661_100031106
949 Ga0070661_100207102
950 Ga0070661_100289284
951 Ga0070661_100384489
952 Ga0070692_10062163
953 Ga0070668_100155103
954 Ga0070668_100235213
955 Ga0070668_100499108
956 Ga0070669_100000652
957 Ga0070669_100001685
958 Ga0070669_100018608
959 Ga0070669_100044984
960 Ga0070675_100000966
961 Ga0070675_100004748
962 Ga0070675_100011669
963 Ga0070675_100035627
964 Ga0070675_100062226
965 Ga0070675_100087964
966 Ga0070675_100097620
967 Ga0070675_100105270
968 Ga0070675_100128365
969 Ga0070675_100132785
970 Ga0070675_100308424
971 Ga0070675_100546728
972 Ga0070671_100003231
973 Ga0070674_100000307
974 Ga0070674_100118166
975 Ga0070674_100134388
976 Ga0070674_100141394
977 Ga0070673_100014586
978 Ga0070673_100052788
979 Ga0070673_100090130
980 Ga0070673_100095071
981 Ga0070673_100109016
982 Ga0070673_100156628
983 Ga0070673_100208151
984 Ga0070688_100014480
985 Ga0070688_100062506
986 Ga0070659_100302962
987 Ga0070667_100048751
988 Ga0070667_100634451
989 Ga0070709_10071859
990 Ga0070713_100135375
991 Ga0070701_10006726
992 Ga0070701_10089961
993 Ga0070705_100037106
994 Ga0070705_100659738
995 Ga0070700_100006461
996 Ga0070700_100061271
997 Ga0070700_100340081
998 Ga0070700_100461208
999 Ga0070694_100003106
1000 Ga0070694_100024966
1001 Ga0070694_100067480
1002 Ga0070694_100571264
1003 Ga0070708_100028747
1004 Ga0070708_100661510
1005 Ga0070663_100022729
1006 Ga0070663_100080233
1007 Ga0070678_100037193
1008 Ga0070678_100060124
1009 Ga0070678_100092217
1010 Ga0070678_100213444
1011 Ga0070662_100011070
1012 Ga0070662_100100615
1013 Ga0070662_100144210
1014 Ga0070662_100238698
1015 Ga0070662_100377429
1016 Ga0070681_10061423
1017 Ga0068867_100035001
1018 Ga0068867_100091452
1019 Ga0068867_100613991
1020 Ga0070685_10011685
1021 Ga0070706_100755140
1022 Ga0070707_100053252
1023 Ga0070707_100055247
1024 Ga0070707_100210726
1025 Ga0070698_100022720
1026 Ga0070698_100039572
1027 Ga0070698_100092033
1028 Ga0070698_100125320
1029 Ga0070699_100000243
1030 Ga0070699_100002821
1031 Ga0070699_100012205
1032 Ga0070699_100060536
1033 Ga0070699_100271215
1034 Ga0070699_100419245
1035 Ga0070699_100578563
1036 Ga0070679_100066523
1037 Ga0070684_100000401
1038 Ga0070684_100025484
1039 Ga0070697_100057180
1040 Ga0070697_100077948
1041 Ga0070697_100124046
1042 Ga0068853_100346268
1043 Ga0070672_100004693
1044 Ga0070672_100010350
1045 Ga0070672_100014754
1046 Ga0070672_100017965
1047 Ga0070672_100039063
1048 Ga0070672_100048391
1049 Ga0070672_100065452
1050 Ga0070672_100081162
1051 Ga0070672_100087666
1052 Ga0070672_100092793
1053 Ga0070686_100004868
1054 Ga0070695_100000809
1055 Ga0070695_100035182
1056 Ga0070695_100071285
1057 Ga0070696_100001646
1058 Ga0070665_100228061
1059 Ga0070665_100293095
1060 Ga0070665_100433653
1061 Ga0070704_100000202
1062 Ga0070704_100034498
1063 Ga0070704_100044296
1064 Ga0070704_100085710
1065 Ga0070704_100163875
1066 Ga0070704_100310179
1067 Ga0070704_100470722
1068 Ga0070664_100001354
1069 Ga0070664_100090654
1070 Ga0070664_100106894
1071 Ga0070664_100168210
1072 Ga0070664_100208249
1073 Ga0068857_100026187
1074 Ga0068857_100044746
1075 Ga0068857_100098317
1076 Ga0068857_100114474
1077 Ga0068857_100136194
1078 Ga0068857_100241491
1079 Ga0068856_100152248
1080 Ga0070702_100095553
1081 Ga0070702_100260811
1082 Ga0070702_100319290
1083 Ga0070702_100463300
1084 Ga0068852_100089937
1085 Ga0068852_100528964
1086 Ga0068859_100001994
1087 Ga0068859_100006375
1088 Ga0068859_100044591
1089 Ga0068859_100051106
1090 Ga0068859_100141839
1091 Ga0068859_100153849
1092 Ga0068859_100737115
1093 Ga0068864_100009146
1094 Ga0068864_100015835
1095 Ga0068864_100036824
1096 Ga0068864_100184910
1097 Ga0068864_100210760
1098 Ga0068864_100479291
1099 Ga0068866_10102626
1100 Ga0068861_100003772
1101 Ga0068861_100050960
1102 Ga0068861_100437583
1103 Ga0068870_10006190
1104 Ga0068870_10011272
1105 Ga0068870_10021711
1106 Ga0068870_10036274
1107 Ga0068863_100010431
1108 Ga0068863_100051706
1109 Ga0068863_100413488
1110 Ga0068863_101000878
1111 Ga0068858_100006751
1112 Ga0068858_100097672
1113 Ga0068858_100195650
1114 Ga0068858_100227941
1115 Ga0068858_100335848
1116 Ga0068858_100359084
1117 Ga0068858_100690760
1118 Ga0068860_100007151
1119 Ga0068860_100008315
1120 Ga0068860_100085448
1121 Ga0068860_100100940
1122 Ga0068862_100000372
1123 Ga0068862_100042156
1124 Ga0068862_100075385
1125 Ga0068862_100108737
1126 Ga0068862_100878837
1127 Ga0081539_10000025
1128 Ga0081539_10000096
1129 Ga0081539_10002107
1130 Ga0097621_100001571
1131 Ga0097621_100032709
1132 Ga0097621_100040163
1133 Ga0097621_100071733
1134 Ga0097621_100094493
1135 Ga0097621_100149534
1136 Ga0097621_100276576
1137 Ga0097621_100303918
1138 Ga0097621_100360048
1139 Ga0068871_100001669
1140 Ga0068871_100006603
1141 Ga0068871_100008906
1142 Ga0068871_100036150
1143 Ga0068871_100045302
1144 Ga0068871_100109445
1145 Ga0068871_100184696
1146 Ga0075428_100002383
1147 Ga0075428_100014078
1148 Ga0075428_100016371
1149 Ga0075428_100098291
1150 Ga0075430_100002972
1151 Ga0075430_100011657
1152 Ga0075430_100022340
1153 Ga0075430_100156579
1154 Ga0075431_100005304
1155 Ga0075431_100052173
1156 Ga0075431_100053572
1157 Ga0075431_100078937
1158 Ga0075431_100141935
1159 Ga0075431_100148600
1160 Ga0075431_100241302
1161 Ga0075431_100316796
1162 Ga0075431_100445442
1163 Ga0075431_100490522
1164 Ga0075433_10000087
1165 Ga0075433_10075174
1166 Ga0075433_10075749
1167 Ga0075433_10096842
1168 Ga0075433_10102333
1169 Ga0075433_10120512
1170 Ga0075433_10120940
1171 Ga0075433_10230073
1172 Ga0075434_100000626
1173 Ga0075434_100004452
1174 Ga0075434_100011095
1175 Ga0075434_100022459
1176 Ga0075434_100243382
1177 Ga0075434_100665703
1178 Ga0075429_100002180
1179 Ga0075429_100019325
1180 Ga0075429_100028111
1181 Ga0075429_100039138
1182 Ga0075429_100067598
1183 Ga0075429_100092196
1184 Ga0075429_100194851
1185 Ga0075429_100454178
1186 Ga0075429_100635001
1187 Ga0068865_100027284
1188 Ga0068865_100080843
1189 Ga0068865_100183224
1190 Ga0068865_100198814
1191 Ga0068865_100403823
1192 Ga0075436_100318547
1193 Ga0097620_100001994
1194 Ga0097620_100006375
1195 Ga0097620_100044588
1196 Ga0097620_100051108
1197 Ga0097620_100141837
1198 Ga0097620_100153848
1199 Ga0097620_100737076
1200 Ga0075435_100014642
1201 Ga0075435_100238678
1202 Ga0075435_100306425
1203 Ga0075435_100354717
1204 Ga0099794_10205123
1205 Ga0111539_10000567
1206 Ga0111539_10001492
1207 Ga0111539_10002728
1208 Ga0111539_10004548
1209 Ga0111539_10004635
1210 Ga0111539_10073882
1211 Ga0111539_10188589
1212 Ga0111539_10217230
1213 Ga0111539_10225491
1214 Ga0111539_10290657
1215 Ga0111539_10326115
1216 Ga0111539_10346074
1217 Ga0111539_10764019
1218 Ga0105245_10013538
1219 Ga0105245_10152842
1220 Ga0105245_10381735
1221 Ga0114129_10001344
1222 Ga0114129_10002019
1223 Ga0114129_10003522
1224 Ga0114129_10022441
1225 Ga0114129_10045375
1226 Ga0114129_10053535
1227 Ga0114129_10069562
1228 Ga0114129_10118459
1229 Ga0114129_10151200
1230 Ga0114129_10355829
1231 Ga0114129_10800374
1232 Ga0114129_10953644
1233 Ga0105243_10254062
1234 Ga0105243_10255715
1235 Ga0105243_10412752
1236 Ga0105241_10042506
1237 Ga0105242_10007343
1238 Ga0105242_10036670
1239 Ga0105242_10086885
1240 Ga0105242_10124805
1241 Ga0105242_10390770
1242 Ga0105248_10013273
1243 Ga0105248_10013724
1244 Ga0105248_10029340
1245 Ga0105248_10065510
1246 Ga0105248_10111996
1247 Ga0105248_10132982
1248 Ga0105248_10207877
1249 Ga0105248_10230898
1250 Ga0105248_10248976
1251 Ga0105248_10418786
1252 Ga0105248_10669229
1253 Ga0105248_10704934
1254 Ga0105237_10321159
1255 Ga0105238_10345054
1256 Ga0105238_10350048
1257 Ga0105249_10003191
1258 Ga0105249_10012019
1259 Ga0105249_10087577
1260 Ga0105249_10169652
1261 Ga0105249_10312096
1262 Ga0105249_10355578
1263 Ga0105249_10581507
1264 Ga0105249_11468056
1265 Ga0105239_10038070
1266 Ga0105239_10273167
1267 Ga0105239_10760321
1268 Ga0105246_10021238
1269 Ga0105246_10149005
1270 Ga0157369_10165658
1271 Ga0157369_10180070
1272 Ga0157374_10057694
1273 Ga0157374_10079966
1274 Ga0157374_10227175
1275 Ga0157378_10013464
1276 Ga0157378_10848357
1277 Ga0157378_10903955
1278 Ga0157378_10944986
1279 Ga0163162_10115623
1280 Ga0163162_10196415
1281 Ga0163162_10580298
1282 Ga0157372_10205853
1283 Ga0157375_10003556
1284 Ga0157375_10016434
1285 Ga0157375_10278898
1286 Ga0157375_10420180
1287 Ga0157375_10581958
1288 Ga0163163_10016539
1289 Ga0163163_10036932
1290 Ga0163163_10062694
1291 Ga0163163_10320475
1292 Ga0157380_10008003
1293 Ga0157380_10069384
1294 Ga0157380_10098032
1295 Ga0157380_10319549
1296 Ga0157380_10569485
1297 Ga0157380_10891041
1298 Ga0157380_11388679
1299 Ga0157377_10032915
1300 Ga0157377_10038353
1301 Ga0157377_10054032
1302 Ga0157377_10134722
1303 Ga0157377_10201698
1304 Ga0157379_10013212
1305 Ga0157379_10029073
1306 Ga0157379_10110034
1307 Ga0157379_10314944
1308 Ga0157376_10016929
1309 Ga0157376_10077185
1310 Ga0157376_10087375
1311 Ga0157376_10312576
1312 Ga0157376_10381489
1313 Ga0157376_10519855
1314 Ga0163161_10484039
1315 Ga0213873_10054547
1316 Ga0207697_10001016
1317 Ga0207697_10010483
1318 Ga0207697_10043891
1319 Ga0207682_10012235
1320 Ga0207682_10021575
1321 Ga0207682_10021826
1322 Ga0207710_10017721
1323 Ga0207688_10013888
1324 Ga0207688_10059669
1325 Ga0207680_10157119
1326 Ga0207680_10547434
1327 Ga0207699_10216097
1328 Ga0207699_10375210
1329 Ga0207645_10002884
1330 Ga0207645_10041434
1331 Ga0207645_10088519
1332 Ga0207643_10009275
1333 Ga0207643_10011211
1334 Ga0207643_10014580
1335 Ga0207643_10016665
1336 Ga0207643_10038637
1337 Ga0207654_10060245
1338 Ga0207654_10276757
1339 Ga0207707_10012151
1340 Ga0207707_10039879
1341 Ga0207671_10101884
1342 Ga0207660_10070102
1343 Ga0207660_10430113
1344 Ga0207662_10005253
1345 Ga0207662_10012312
1346 Ga0207662_10117024
1347 Ga0207662_10250986
1348 Ga0207649_10076881
1349 Ga0207649_10177785
1350 Ga0207649_10343518
1351 Ga0207649_10368495
1352 Ga0207646_10135116
1353 Ga0207646_10441870
1354 Ga0207681_10017882
1355 Ga0207681_10030230
1356 Ga0207681_10065236
1357 Ga0207681_10070206
1358 Ga0207681_10174645
1359 Ga0207681_10199493
1360 Ga0207694_10007427
1361 Ga0207694_10050531
1362 Ga0207694_10073693
1363 Ga0207650_10001775
1364 Ga0207650_10015425
1365 Ga0207650_10129289
1366 Ga0207650_10329591
1367 Ga0207659_10001703
1368 Ga0207659_10004418
1369 Ga0207659_10015264
1370 Ga0207659_10015923
1371 Ga0207659_10031396
1372 Ga0207659_10053891
1373 Ga0207659_10081219
1374 Ga0207659_10091115
1375 Ga0207659_10266610
1376 Ga0207659_10296280
1377 Ga0207659_10386611
1378 Ga0207687_10053934
1379 Ga0207687_10066384
1380 Ga0207644_10123951
1381 Ga0207690_10207275
1382 Ga0207690_10252684
1383 Ga0207706_10008412
1384 Ga0207706_10020366
1385 Ga0207706_10043975
1386 Ga0207706_10078600
1387 Ga0207706_10122218
1388 Ga0207706_10216198
1389 Ga0207706_10249914
1390 Ga0207706_10253432
1391 Ga0207706_10333489
1392 Ga0207686_10018781
1393 Ga0207686_10021397
1394 Ga0207686_10046496
1395 Ga0207686_10087232
1396 Ga0207709_10400014
1397 Ga0207670_10005999
1398 Ga0207670_10012229
1399 Ga0207670_10027166
1400 Ga0207670_10255680
1401 Ga0207670_10481459
1402 Ga0207669_10000231
1403 Ga0207669_10005982
1404 Ga0207669_10017555
1405 Ga0207669_10273417
1406 Ga0207704_10080081
1407 Ga0207704_10156533
1408 Ga0207691_10004416
1409 Ga0207691_10007105
1410 Ga0207691_10016220
1411 Ga0207691_10017697
1412 Ga0207691_10022802
1413 Ga0207691_10025499
1414 Ga0207691_10026882
1415 Ga0207691_10035089
1416 Ga0207691_10045862
1417 Ga0207691_10125522
1418 Ga0207711_10010779
1419 Ga0207711_10020676
1420 Ga0207711_10020678
1421 Ga0207711_10031286
1422 Ga0207711_10143180
1423 Ga0207711_10183398
1424 Ga0207711_10416943
1425 Ga0207711_10426944
1426 Ga0207711_10432616
1427 Ga0207689_10007752
1428 Ga0207689_10025874
1429 Ga0207689_10049638
1430 Ga0207689_10055891
1431 Ga0207689_10214699
1432 Ga0207661_10046911
1433 Ga0207661_10122572
1434 Ga0207661_10403624
1435 Ga0207661_10523097
1436 Ga0207679_10006852
1437 Ga0207679_10028806
1438 Ga0207679_10056396
1439 Ga0207679_10071897
1440 Ga0207679_10151199
1441 Ga0207679_10320344
1442 Ga0207667_10123893
1443 Ga0207667_10292844
1444 Ga0207651_10003849
1445 Ga0207651_10007615
1446 Ga0207651_10017816
1447 Ga0207651_10032049
1448 Ga0207651_10033541
1449 Ga0207651_10116883
1450 Ga0207651_10146444
1451 Ga0207651_10546221
1452 Ga0207712_10006952
1453 Ga0207712_10012497
1454 Ga0207712_10032917
1455 Ga0207712_10050080
1456 Ga0207712_10487528
1457 Ga0207668_10076008
1458 Ga0207668_10349938
1459 Ga0207658_10433241
1460 Ga0207658_10491270
1461 Ga0207677_10050957
1462 Ga0207677_10339873
1463 Ga0207677_10703555
1464 Ga0207703_10005141
1465 Ga0207703_10014387
1466 Ga0207703_10139926
1467 Ga0207639_10285328
1468 Ga0207678_10037709
1469 Ga0207708_10006005
1470 Ga0207708_10012424
1471 Ga0207708_10038269
1472 Ga0207702_10015191
1473 Ga0207641_10012575
1474 Ga0207641_10033732
1475 Ga0207641_10154987
1476 Ga0207641_10173563
1477 Ga0207648_10118490
1478 Ga0207648_10139185
1479 Ga0207648_10436657
1480 Ga0207676_10014828
1481 Ga0207676_10032474
1482 Ga0207676_10034181
1483 Ga0207676_10044621
1484 Ga0207676_10178115
1485 Ga0207674_10056626
1486 Ga0207674_10061438
1487 Ga0207674_10078319
1488 Ga0207674_10112181
1489 Ga0207674_10150906
1490 Ga0207675_100001696
1491 Ga0207675_100005425
1492 Ga0207675_100217529
1493 Ga0207675_100223099
1494 Ga0207683_10008337
1495 Ga0207683_10027651
1496 Ga0207683_10031108
1497 Ga0207683_10055495
1498 Ga0207683_10091942
1499 Ga0207683_10133201
1500 Ga0207683_10147040
1501 Ga0207683_10581970
1502 Ga0207683_10605668
1503 Ga0207428_10001082
1504 Ga0207428_10002447
1505 Ga0207428_10013264
1506 Ga0207428_10017976
1507 Ga0207428_10034986
1508 Ga0207428_10076697
1509 Ga0207428_10119685
1510 Ga0207428_10421706
1511 Ga0268266_10182862
1512 Ga0268266_10240860
1513 Ga0268266_10400988
1514 Ga0268265_10100004
1515 Ga0268265_10788691
1516 Ga0268265_11072868
1517 Ga0268264_10009087
1518 Ga0268264_10160139
1519 Ga0268264_10173693
1520 Ga0268264_10458092
1521 Ga0265340_10025074
1522 Ga0307408_100023087
1523 Ga0265313_10003728
1524 Ga0265314_10000525
1525 Ga0307405_10072482
1526 Ga0307413_10005418
1527 Ga0307410_10004471
1528 Ga0307406_10310640
1529 Ga0307412_10022865
1530 Ga0307412_10077025
1531 Ga0307409_100031378
1532 Ga0307409_100091512
1533 Ga0307416_100112629
1534 Ga0307414_10014578
1535 Ga0307411_10003340
1536 Ga0307411_10073445
1537 Ga0307415_100052293
1538 Ga0307415_100090251
1539 Ga0307415_100155266
1540 Ga0373958_0012712
1541 Ga0373923_0081051
1542 Ga0373932_0057857
1543 Ga0373936_0082465
1544 Ga0373941_0031601
1545 Ga0373954_0220986
1546 Ga0373960_0040829
1547 Ga0373955_0026585
1548 Ga0373955_0082195
1549 Ga0373955_0101852
1550 Ga0373962_0030340
1551 Ga0373931_0390526
1552 Ga0373935_0058311
1553 Ga0373935_0631282
1554 Ga0373937_0072984
1555 Ga0373937_0314041
1556 Ga0373937_0398744
1557 Ga0373937_0687738
1558 Ga0373925_0020488
1559 Ga0436364_0054869
1560 Ga0436364_0169125
1561 Ga0436364_0378507
1562 Ga0436365_1671986
1563 Ga0436362_0328766
1564 Ga0451853_1737950
1565 Ga0439444_0069949
1566 Ga0439460_0100628
1567 Ga0451576_0476348
1568 Ga0495592_0026197
1569 Ga0495592_0053413
1570 Ga0495629_0013241
1571 Ga0495651_0236533
1572 Ga0495580_0080014
1573 Ga0495662_0140184
1574 Ga0495664_0259891
1575 Ga0495594_0298993
1576 Ga0495608_0028538
1577 Ga0495618_0110431
1578 Ga0495630_0012421
1579 Ga0495643_0001567
1580 Ga0495663_0007325
1581 Ga0495642_0072356
1582 Ga0495642_0115461
1583 Ga0495652_0221939
1584 Ga0495587_0008146
1585 Ga0495598_0057402
1586 Ga0495598_0114664
1587 Ga0495621_0088445
1588 Ga0495645_0198285
1589 Ga0495622_0185869
1590 Ga0495667_0032770
1591 Ga0495667_0432409
1592 Ga0495634_0127507
1593 Ga0495634_0138620
1594 Ga0495659_0008902
1595 Ga0495659_0050700
1596 Ga0495659_0138238
1597 Ga0495657_0005182
1598 Ga0495658_0016418
1599 Ga0495613_0007106
1600 Ga0495613_0109420
1601 Ga0495604_0046890
1602 Ga0495636_0014307
1603 Ga0495636_0034182
1604 Ga0495674_0050525
1605 Ga0495674_0092187
1606 Ga0495674_0234944
1607 Ga0495680_0497368
1608 Ga0495677_0055621
1609 Ga0495685_088243
1610 Ga0495684_0000113
1611 Ga0495684_0101921
1612 Ga0495684_0271315
1613 Ga0495602_0084600
1614 Ga0496100_0463803
1615 Ga0496101_0000937
1616 Ga0496102_0074474
1617 Ga0496102_0273033
1618 Ga0496102_0448996
1619 Ga0496104_0006654
1620 Ga0496104_0165450
1621 Ga0496105_0180125
1622 Ga0496105_0211999
1623 Ga0496105_0378918
1624 Ga0496106_0247777
1625 Ga0496106_0473788
1626 Ga0496107_0038402
1627 Ga0496108_0007766
1628 Ga0496108_0155775
1629 Ga0496108_0277548
1630 Ga0496109_0000850
1631 Ga0496109_0533859
1632 Ga0496109_0597932
1633 Ga0496110_0009128
1634 Ga0496110_0039496
1635 Ga0496110_0229068
1636 Ga0496111_0002110
1637 Ga0496112_0001752
1638 Ga0496112_0116988
1639 Ga0496112_0270414
1640 Ga0496114_0000775
1641 Ga0496115_0168357
1642 Ga0496115_0275084
1643 Ga0501038_0429890
1644 Ga0501040_0013923
1645 Ga0501041_0001187
1646 Ga0501041_0241295
1647 Ga0501042_0010256
1648 Ga0501048_0213943
1649 Ga0501048_0287096
1650 Ga0501068_0027376
1651 Ga0501071_0011783
1652 Ga0501072_0380266
1653 Ga0501075_0041243
1654 Ga0501076_0002688
1655 Ga0501223_044207
1656 Ga0501225_0072870
1657 Ga0501079_0006438
1658 Ga0501080_0119851
1659 Ga0501081_0002548
1660 Ga0501283_014944
1661 Ga0501045_0014031
1662 Ga0501045_0418487
1663 nmdc:mga05p37_101137_c1
1664 nmdc:mga05p37_111713_c1
1665 nmdc:mga05p37_112248_c1
1666 nmdc:mga05p37_13577_c1
1667 nmdc:mga05p37_187811_c1
1668 nmdc:mga05p37_19453_c1
1669 nmdc:mga05p37_283521_c1
1670 nmdc:mga05p37_300422_c1
1671 nmdc:mga05p37_49815_c1
1672 nmdc:mga05p37_624649_c1
1673 nmdc:mga05p37_7128_c1
1674 nmdc:mga05p37_73408_c1
1675 nmdc:mga05p37_75484_c1
1676 nmdc:mga05p37_839811_c1
1677 nmdc:mga05p37_84719_c1
1678 nmdc:mga05p37_91164_c1
1679 nmdc:mga09592_105425_c1
1680 nmdc:mga09592_2353_c1
1681 nmdc:mga09592_254023_c1
1682 nmdc:mga09592_42997_c1
1683 nmdc:mga09592_45650_c1
1684 nmdc:mga09592_530600_c1
1685 nmdc:mga09592_75233_c1
1686 nmdc:mga0qj67_217601_c1
1687 nmdc:mga0qj67_42798_c1
1688 nmdc:mga0qj67_5613_c1
1689 nmdc:mga0qj67_68827_c1
1690 nmdc:mga0qj67_71481_c1
1691 nmdc:mga0qj67_8197_c1
1692 nmdc:mga06r32_134414_c1
1693 nmdc:mga06r32_187898_c1
1694 nmdc:mga06r32_191077_c1
1695 nmdc:mga06r32_238565_c1
1696 nmdc:mga06r32_41204_c1
1697 nmdc:mga06r32_558144_c1
1698 nmdc:mga06r32_671486_c1
1699 nmdc:mga06r32_786093_c1
1700 nmdc:mga08y16_111156_c1
1701 nmdc:mga08y16_138474_c1
1702 nmdc:mga08y16_169031_c1
1703 nmdc:mga08y16_177952_c1
1704 nmdc:mga08y16_1910_c1
1705 nmdc:mga08y16_25556_c1
1706 nmdc:mga08y16_280343_c1
1707 nmdc:mga08y16_30872_c1
1708 nmdc:mga08y16_31341_c1
1709 nmdc:mga08y16_32717_c1
1710 nmdc:mga08y16_374100_c1
1711 nmdc:mga08y16_4446_c1
1712 nmdc:mga08y16_52356_c1
1713 nmdc:mga08y16_678_c1
1714 nmdc:mga0n895_10008_c1
1715 nmdc:mga0n895_152613_c1
1716 nmdc:mga0n895_19589_c1
1717 nmdc:mga0n895_25120_c1
1718 nmdc:mga0n895_46370_c1
1719 nmdc:mga0n895_724923_c1
1720 nmdc:mga0n895_7614_c1
1721 nmdc:mga0n895_836487_c1
1722 nmdc:mga0n895_899133_c1
1723 nmdc:mga0rr50_10558_c1
1724 nmdc:mga0rr50_31204_c1
1725 nmdc:mga0rr50_46550_c1
1726 nmdc:mga0a205_11071_c1
1727 nmdc:mga0a205_151_c1
1728 nmdc:mga0a205_181594_c1
1729 nmdc:mga0a205_221524_c1
1730 nmdc:mga0a205_2445_c1
1731 nmdc:mga0a205_259119_c1
1732 nmdc:mga0a205_285830_c1
1733 nmdc:mga0a205_311366_c1
1734 nmdc:mga0a205_324532_c1
1735 nmdc:mga0a205_403612_c1
1736 nmdc:mga0a205_56664_c1
1737 nmdc:mga0a205_6986_c1
1738 nmdc:mga0a205_708089_c1
1739 nmdc:mga0a205_82541_c1
1740 nmdc:mga0a205_9605_c1
1741 Ga0495619_0035670
1742 Ga0495619_0050415
1743 Ga0501084_0006886
1744 Ga0501082_0003187
1745 Ga0501082_0627456
1746 Ga0530510_0139390

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13795

HupE_UreJ_2

HupE / UreJ protein

92

244

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dwi-assembly1.cif.gz_A molecular mechanism of sialic acid transport mediated by sialin 0.4786 50 227
6vbg-assembly1.cif.gz_A lactose permease complex with thiodigalactoside and nanobody 9043 0.4414 36 234
7wn1-assembly1.cif.gz_A structure of pfnt1(y190a) in complex with nanobody 48 and inosine 0.4323 63 227
8sbe-assembly1.cif.gz_A structure of the rat vesicular glutamate transporter 2 determined by single-particle cryo-em 0.4028 33 227
8k6l-assembly1.cif.gz_A cryo-em structure of human oatp1b1 in complex with dcf 0.3993 62 233
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5284 5 231 1.20.1250.20
af_P39709_129_329_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5224 50 231 1.20.1250.20
af_Q9V7S5_35_265_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.522 74 228 1.20.1250.20
af_Q9DC37_260_445_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5207 50 233 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5158 5 231 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A1Q7JN62-F1-model_v4 HupE / UreJ protein 0.9867 32 203 GO:0016020
AF-A0A2E6JAF7-F1-model_v4 HupE/UreJ family protein 0.9847 31 232 GO:0016020
AF-A0A6F8Q0C3-F1-model_v4 deleted 0.9836 47 231
AF-A0A1N7KVS6-F1-model_v4 HupE / UreJ protein 0.9833 30 234 GO:0016020
AF-A0A520XNE9-F1-model_v4 deleted 0.9825 31 193

Map