F484250

General Info

Members Datasets Scaffolds Average Seq Length
873 333 1746 204

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100239660|Ga0070664_1002396601
Length 230
Sequence MGTAETQRIQRTQRIEEHVMRKILIGTAAMAVMLAGPSAQEREYQPTCNMCPGTYIPNSEIEAYAKRGKANQLIDQQVRQVDIGKANVGVAVVYRGKVDNPAAVVAEHDLVSEVYHVIDGSGTLVLGPDLVGKQRRPSTETTVRLLNGPGNNSQAIRNGVAHELKPGDVVVIPAGTGHQFTKIDDHITYLMIRVDPDKVTPHKTEADSRADLLTDGRNSAGGTGRGRDGR

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
78 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
84 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
85 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
101 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
102 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
103 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
104 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
105 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
200 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
201 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
202 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
203 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
204 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
205 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
206 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
229 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
230 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
231 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
232 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
235 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
236 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
237 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
238 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
239 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
249 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
252 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
255 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
259 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
260 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
261 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
262 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
265 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
266 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
267 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
268 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
269 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
278 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
279 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
285 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
286 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
287 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
308 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
309 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
310 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
311 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
312 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
313 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
318 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
319 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
320 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
326 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
327 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
328 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
329 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
330 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
331 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
332 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 3.09
Rhizosphere 96.33
Stem 0
Stem Tuber 0
Unclassified 16.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100239660 3300005564 Unclassified 1628
2 JGI24746J21847_1026205 3300001977 Bacteria 806
3 JGI24748J21848_1010998 3300002074 Bacteria 1065
4 JGI24751J29686_10023444 3300002459 Bacteria 1280
5 Ga0065704_10275541 3300005289 Bacteria 934
6 Ga0065704_10311845 3300005289 Unclassified 866
7 Ga0065712_10014941 3300005290 Bacteria 2523
8 Ga0065712_10102617 3300005290 Bacteria 2004
9 Ga0065715_10184517 3300005293 Bacteria 1454
10 Ga0065715_10204796 3300005293 Bacteria 1339
11 Ga0065707_10354510 3300005295 Bacteria 913
12 Ga0070676_10025976 3300005328 Bacteria 3314
13 Ga0070676_10067510 3300005328 Bacteria 2138
14 Ga0070676_10073525 3300005328 Unclassified 2056
15 Ga0070690_100011281 3300005330 Bacteria 5224
16 Ga0070690_100032368 3300005330 Bacteria 3265
17 Ga0070690_100069202 3300005330 Bacteria 2290
18 Ga0070690_100442021 3300005330 Unclassified 962
19 Ga0070670_100013341 3300005331 Bacteria 7038
20 Ga0070670_100040768 3300005331 Unclassified 3991
21 Ga0070670_100170678 3300005331 Bacteria 1886
22 Ga0070670_100984204 3300005331 Bacteria 767
23 Ga0070677_10062739 3300005333 Unclassified 1538
24 Ga0068869_100021553 3300005334 Bacteria 4435
25 Ga0068869_100085807 3300005334 Bacteria 2358
26 Ga0068869_100112338 3300005334 Bacteria 2074
27 Ga0068869_101234037 3300005334 Bacteria 658
28 Ga0070666_10007215 3300005335 Bacteria 6853
29 Ga0070666_10019396 3300005335 Bacteria 4389
30 Ga0070666_10115967 3300005335 Bacteria 1855
31 Ga0070680_100169596 3300005336 Bacteria 1836
32 Ga0070680_100466577 3300005336 Unclassified 1079
33 Ga0070682_100294643 3300005337 Bacteria 1188
34 Ga0068868_100042257 3300005338 Bacteria 3556
35 Ga0068868_100135786 3300005338 Bacteria 2016
36 Ga0068868_100190636 3300005338 Bacteria 1705
37 Ga0068868_100546620 3300005338 Bacteria 1020
38 Ga0070660_100021434 3300005339 Bacteria 4766
39 Ga0070689_100015106 3300005340 Bacteria 5623
40 Ga0070689_100051576 3300005340 Bacteria 3180
41 Ga0070689_100052814 3300005340 Bacteria 3144
42 Ga0070689_100142120 3300005340 Bacteria 1930
43 Ga0070689_100194088 3300005340 Bacteria 1654
44 Ga0070689_100322798 3300005340 Unclassified 1290
45 Ga0070689_100569427 3300005340 Bacteria 978
46 Ga0070689_101116513 3300005340 Bacteria 705
47 Ga0070691_10005742 3300005341 Bacteria 5658
48 Ga0070687_100005955 3300005343 Bacteria 4962
49 Ga0070687_100026862 3300005343 Bacteria 2775
50 Ga0070687_100079638 3300005343 Bacteria 1784
51 Ga0070661_100378313 3300005344 Bacteria 1116
52 Ga0070661_100695830 3300005344 Unclassified 828
53 Ga0070692_10010926 3300005345 Bacteria 4154
54 Ga0070692_10223350 3300005345 Bacteria 1114
55 Ga0070668_100015041 3300005347 Bacteria 5779
56 Ga0070668_100185668 3300005347 Bacteria 1700
57 Ga0070668_100579906 3300005347 Bacteria 979
58 Ga0070668_100921815 3300005347 Bacteria 782
59 Ga0070669_100000856 3300005353 Bacteria 22099
60 Ga0070669_100087679 3300005353 Bacteria 2327
61 Ga0070669_100097156 3300005353 Unclassified 2217
62 Ga0070669_100546736 3300005353 Unclassified 965
63 Ga0070669_100626914 3300005353 Bacteria 903
64 Ga0070669_100788505 3300005353 Bacteria 807
65 Ga0070675_100001217 3300005354 Bacteria 18706
66 Ga0070675_100005111 3300005354 Bacteria 10006
67 Ga0070675_100011088 3300005354 Bacteria 7055
68 Ga0070675_100050220 3300005354 Bacteria 3425
69 Ga0070675_100080591 3300005354 Bacteria 2713
70 Ga0070675_100138371 3300005354 Bacteria 2080
71 Ga0070671_100003433 3300005355 Bacteria 12366
72 Ga0070671_100015469 3300005355 Bacteria 6165
73 Ga0070671_100039414 3300005355 Bacteria 3922
74 Ga0070671_100087178 3300005355 Bacteria 2612
75 Ga0070671_100095129 3300005355 Unclassified 2497
76 Ga0070671_100383015 3300005355 Bacteria 1202
77 Ga0070674_100030246 3300005356 Bacteria 3576
78 Ga0070674_100055670 3300005356 Unclassified 2740
79 Ga0070674_100060937 3300005356 Bacteria 2632
80 Ga0070674_100520243 3300005356 Bacteria 994
81 Ga0070674_100742240 3300005356 Unclassified 843
82 Ga0070673_100062197 3300005364 Unclassified 2965
83 Ga0070673_100358343 3300005364 Bacteria 1296
84 Ga0070688_100039501 3300005365 Bacteria 2888
85 Ga0070659_100300678 3300005366 Bacteria 1338
86 Ga0070659_100326917 3300005366 Bacteria 1283
87 Ga0070709_10375115 3300005434 Bacteria 1056
88 Ga0070714_100446842 3300005435 Unclassified 1228
89 Ga0070713_100014105 3300005436 Bacteria 5920
90 Ga0070713_100068591 3300005436 Bacteria 2988
91 Ga0070710_10570633 3300005437 Unclassified 784
92 Ga0070701_10010578 3300005438 Bacteria 4086
93 Ga0070701_10010826 3300005438 Bacteria 4049
94 Ga0070701_10015466 3300005438 Bacteria 3526
95 Ga0070701_10033486 3300005438 Bacteria 2568
96 Ga0070711_100021119 3300005439 Bacteria 4206
97 Ga0070705_100001559 3300005440 Bacteria 12013
98 Ga0070705_100001998 3300005440 Bacteria 10423
99 Ga0070705_100063789 3300005440 Bacteria 2199
100 Ga0070700_100003262 3300005441 Bacteria 8356
101 Ga0070700_100010932 3300005441 Bacteria 5019
102 Ga0070700_100036580 3300005441 Bacteria 2978
103 Ga0070700_100155043 3300005441 Unclassified 1571
104 Ga0070700_100271699 3300005441 Unclassified 1225
105 Ga0070694_100003745 3300005444 Bacteria 9064
106 Ga0070694_100019023 3300005444 Unclassified 4365
107 Ga0070694_100075195 3300005444 Unclassified 2336
108 Ga0070694_100141004 3300005444 Bacteria 1751
109 Ga0070694_100228269 3300005444 Bacteria 1399
110 Ga0070663_100014490 3300005455 Bacteria 5062
111 Ga0070662_100287871 3300005457 Unclassified 1331
112 Ga0070662_100458683 3300005457 Bacteria 1059
113 Ga0070681_10035019 3300005458 Bacteria 5042
114 Ga0070681_10086097 3300005458 Unclassified 3095
115 Ga0068867_100002732 3300005459 Bacteria 12443
116 Ga0068867_100020598 3300005459 Unclassified 4699
117 Ga0068867_100295625 3300005459 Bacteria 1333
118 Ga0070685_10031388 3300005466 Bacteria 2968
119 Ga0070706_100761543 3300005467 Bacteria 897
120 Ga0070707_100008538 3300005468 Bacteria 9519
121 Ga0070707_100041902 3300005468 Bacteria 4383
122 Ga0070707_100172310 3300005468 Bacteria 2109
123 Ga0070707_100189746 3300005468 Bacteria 2004
124 Ga0070698_100031616 3300005471 Bacteria 5487
125 Ga0070698_100051201 3300005471 Bacteria 4207
126 Ga0070698_100651066 3300005471 Bacteria 995
127 Ga0070698_100718348 3300005471 Bacteria 942
128 Ga0070699_100000249 3300005518 Bacteria 52979
129 Ga0070699_100001648 3300005518 Bacteria 20384
130 Ga0070699_100010580 3300005518 Bacteria 7988
131 Ga0070699_100113104 3300005518 Bacteria 2385
132 Ga0070699_100465861 3300005518 Bacteria 1146
133 Ga0070679_100059901 3300005530 Unclassified 3794
134 Ga0070684_100857679 3300005535 Bacteria 850
135 Ga0070697_100084321 3300005536 Archaea 2620
136 Ga0070672_100001866 3300005543 Bacteria 13163
137 Ga0070672_100028041 3300005543 Bacteria 4208
138 Ga0070672_100144645 3300005543 Bacteria 1964
139 Ga0070672_100177101 3300005543 Unclassified 1776
140 Ga0070672_100252852 3300005543 Bacteria 1484
141 Ga0070672_100297018 3300005543 Bacteria 1368
142 Ga0070672_100363454 3300005543 Bacteria 1236
143 Ga0070672_100688685 3300005543 Unclassified 894
144 Ga0070686_100115242 3300005544 Unclassified 1837
145 Ga0070686_100115881 3300005544 Bacteria 1833
146 Ga0070686_100203186 3300005544 Bacteria 1422
147 Ga0070686_100508614 3300005544 Unclassified 936
148 Ga0070695_100000104 3300005545 Bacteria 37120
149 Ga0070695_100004676 3300005545 Bacteria 8051
150 Ga0070695_100011495 3300005545 Bacteria 5296
151 Ga0070695_100029929 3300005545 Bacteria 3387
152 Ga0070695_100121151 3300005545 Bacteria 1790
153 Ga0070695_100289472 3300005545 Unclassified 1207
154 Ga0070665_100005360 3300005548 Bacteria 13242
155 Ga0070665_100191324 3300005548 Unclassified 2047
156 Ga0070665_100630209 3300005548 Bacteria 1085
157 Ga0070704_100004129 3300005549 Bacteria 8382
158 Ga0070704_100013232 3300005549 Bacteria 5116
159 Ga0070704_100057360 3300005549 Bacteria 2769
160 Ga0070704_100070873 3300005549 Bacteria 2530
161 Ga0070704_100101456 3300005549 Bacteria 2169
162 Ga0070704_100106360 3300005549 Bacteria 2126
163 Ga0068855_100081680 3300005563 Bacteria 3746
164 Ga0070664_100041399 3300005564 Bacteria 3887
165 Ga0070664_100045055 3300005564 Bacteria 3725
166 Ga0070664_100232201 3300005564 Bacteria 1654
167 Ga0070664_101270953 3300005564 Unclassified 695
168 Ga0068857_100091062 3300005577 Bacteria 2729
169 Ga0068857_100228254 3300005577 Bacteria 1702
170 Ga0068857_100823628 3300005577 Bacteria 887
171 Ga0068857_100892738 3300005577 Bacteria 852
172 Ga0068854_100015722 3300005578 Bacteria 5024
173 Ga0068854_100105683 3300005578 Bacteria 2117
174 Ga0068854_100164800 3300005578 Unclassified 1720
175 Ga0068856_100194394 3300005614 Unclassified 2043
176 Ga0070702_100000807 3300005615 Bacteria 11981
177 Ga0070702_100005855 3300005615 Bacteria 5766
178 Ga0070702_100007812 3300005615 Bacteria 5143
179 Ga0070702_100049288 3300005615 Unclassified 2401
180 Ga0070702_100111008 3300005615 Bacteria 1700
181 Ga0068852_100029026 3300005616 Bacteria 4537
182 Ga0068859_100080795 3300005617 Unclassified 3292
183 Ga0068859_100205460 3300005617 Bacteria 2055
184 Ga0068859_100525002 3300005617 Bacteria 1279
185 Ga0068859_100581168 3300005617 Bacteria 1214
186 Ga0068859_100978008 3300005617 Bacteria 929
187 Ga0068859_101108659 3300005617 Bacteria 871
188 Ga0068864_100003281 3300005618 Bacteria 13359
189 Ga0068864_100011422 3300005618 Bacteria 7335
190 Ga0068864_100092499 3300005618 Bacteria 2670
191 Ga0068864_100246948 3300005618 Bacteria 1655
192 Ga0068866_10023167 3300005718 Bacteria 2884
193 Ga0068866_10185785 3300005718 Bacteria 1231
194 Ga0068861_100004493 3300005719 Bacteria 9364
195 Ga0068861_100018740 3300005719 Bacteria 4933
196 Ga0068861_100118009 3300005719 Bacteria 2136
197 Ga0068861_100147559 3300005719 Bacteria 1926
198 Ga0068861_100191611 3300005719 Bacteria 1709
199 Ga0068861_100691059 3300005719 Bacteria 947
200 Ga0068851_10048684 3300005834 Bacteria 2148
201 Ga0068870_10029962 3300005840 Bacteria 2747
202 Ga0068870_10099905 3300005840 Bacteria 1638
203 Ga0068863_100003785 3300005841 Bacteria 14967
204 Ga0068863_100048812 3300005841 Bacteria 4013
205 Ga0068863_100120016 3300005841 Bacteria 2506
206 Ga0068863_100495581 3300005841 Bacteria 1203
207 Ga0068858_100012279 3300005842 Bacteria 8078
208 Ga0068858_100014277 3300005842 Bacteria 7489
209 Ga0068858_100026929 3300005842 Bacteria 5340
210 Ga0068858_100045110 3300005842 Bacteria 4085
211 Ga0068858_100065238 3300005842 Bacteria 3369
212 Ga0068858_100115553 3300005842 Bacteria 2507
213 Ga0068858_100127016 3300005842 Bacteria 2389
214 Ga0068858_100230524 3300005842 Unclassified 1756
215 Ga0068858_100281689 3300005842 Bacteria 1583
216 Ga0068858_101190625 3300005842 Unclassified 749
217 Ga0068860_100084891 3300005843 Bacteria 3011
218 Ga0068860_100174147 3300005843 Bacteria 2079
219 Ga0068860_100220240 3300005843 Bacteria 1843
220 Ga0068860_100235739 3300005843 Bacteria 1779
221 Ga0068860_100311181 3300005843 Bacteria 1544
222 Ga0068860_100398614 3300005843 Bacteria 1361
223 Ga0068860_100606205 3300005843 Unclassified 1101
224 Ga0068862_100003116 3300005844 Bacteria 14450
225 Ga0068862_100032149 3300005844 Bacteria 4433
226 Ga0068862_100037798 3300005844 Bacteria 4092
227 Ga0068862_100149034 3300005844 Bacteria 2081
228 Ga0068862_100311477 3300005844 Bacteria 1451
229 Ga0068862_100340995 3300005844 Unclassified 1388
230 Ga0068862_100698836 3300005844 Bacteria 982
231 Ga0081455_10022337 3300005937 Bacteria 5915
232 Ga0081455_10029354 3300005937 Bacteria 5014
233 Ga0081455_10062734 3300005937 Bacteria 3122
234 Ga0081540_1008840 3300005983 Bacteria 6994
235 Ga0081540_1179098 3300005983 Bacteria 796
236 Ga0081539_10000071 3300005985 Bacteria 233094
237 Ga0070717_10305737 3300006028 Bacteria 1414
238 Ga0075432_10069108 3300006058 Unclassified 1267
239 Ga0070712_100110700 3300006175 Bacteria 2049
240 Ga0075367_10356237 3300006178 Bacteria 924
241 Ga0097621_100093875 3300006237 Bacteria 2515
242 Ga0097621_100116168 3300006237 Bacteria 2265
243 Ga0097621_100156954 3300006237 Bacteria 1953
244 Ga0097621_100228239 3300006237 Bacteria 1625
245 Ga0097621_100288626 3300006237 Bacteria 1446
246 Ga0068871_100030815 3300006358 Bacteria 4227
247 Ga0068871_100129796 3300006358 Bacteria 2136
248 Ga0068871_100137187 3300006358 Bacteria 2078
249 Ga0068871_100366292 3300006358 Bacteria 1277
250 Ga0068871_100398874 3300006358 Unclassified 1225
251 Ga0075428_100001190 3300006844 Bacteria 27834
252 Ga0075428_100017466 3300006844 Bacteria 7928
253 Ga0075428_100174386 3300006844 Bacteria 2329
254 Ga0075428_100226858 3300006844 Bacteria 2016
255 Ga0075428_100405642 3300006844 Bacteria 1460
256 Ga0075428_100665367 3300006844 Bacteria 1110
257 Ga0075430_100006519 3300006846 Bacteria 9840
258 Ga0075430_100061587 3300006846 Unclassified 3153
259 Ga0075430_100289434 3300006846 Bacteria 1355
260 Ga0075431_100006480 3300006847 Bacteria 11622
261 Ga0075431_100198507 3300006847 Bacteria 2053
262 Ga0075431_100267355 3300006847 Bacteria 1734
263 Ga0075433_10058363 3300006852 Bacteria 3375
264 Ga0075433_10064477 3300006852 Bacteria 3212
265 Ga0075433_10107778 3300006852 Bacteria 2470
266 Ga0075433_10163589 3300006852 Bacteria 1980
267 Ga0075433_10190603 3300006852 Bacteria 1824
268 Ga0075433_10197340 3300006852 Bacteria 1790
269 Ga0075434_100002827 3300006871 Bacteria 15376
270 Ga0075434_100003678 3300006871 Bacteria 13702
271 Ga0075434_100006134 3300006871 Bacteria 11006
272 Ga0075434_100019263 3300006871 Bacteria 6602
273 Ga0075434_101334402 3300006871 Bacteria 728
274 Ga0075429_100005103 3300006880 Bacteria 11291
275 Ga0075429_100015846 3300006880 Bacteria 6526
276 Ga0075429_100023751 3300006880 Bacteria 5320
277 Ga0075429_100043961 3300006880 Bacteria 3886
278 Ga0075429_100161397 3300006880 Bacteria 1963
279 Ga0068865_100466448 3300006881 Bacteria 1047
280 Ga0075436_100000928 3300006914 Bacteria 19542
281 Ga0075436_100010457 3300006914 Bacteria 6360
282 Ga0075436_100377451 3300006914 Bacteria 1025
283 Ga0097620_100080793 3300006931 Unclassified 3292
284 Ga0097620_100205445 3300006931 Bacteria 2055
285 Ga0097620_100525018 3300006931 Bacteria 1279
286 Ga0097620_100581141 3300006931 Bacteria 1214
287 Ga0097620_100977817 3300006931 Bacteria 929
288 Ga0097620_101108522 3300006931 Bacteria 871
289 Ga0075435_100000216 3300007076 Bacteria 35336
290 Ga0075435_100005332 3300007076 Bacteria 8959
291 Ga0075435_100111207 3300007076 Bacteria 2279
292 Ga0075435_100363509 3300007076 Bacteria 1242
293 Ga0075435_100422667 3300007076 Unclassified 1148
294 Ga0099794_10036009 3300007265 Bacteria 2337
295 Ga0105240_10104703 3300009093 Bacteria 3436
296 Ga0111539_10060071 3300009094 Bacteria 4506
297 Ga0111539_10225134 3300009094 Bacteria 2185
298 Ga0111539_10297469 3300009094 Bacteria 1878
299 Ga0111539_10446280 3300009094 Bacteria 1506
300 Ga0111539_10585824 3300009094 Unclassified 1299
301 Ga0111539_10671908 3300009094 Bacteria 1206
302 Ga0105245_10047030 3300009098 Unclassified 3857
303 Ga0105245_10181082 3300009098 Bacteria 2013
304 Ga0105245_10247468 3300009098 Unclassified 1731
305 Ga0105245_10311754 3300009098 Bacteria 1547
306 Ga0105247_10006773 3300009101 Bacteria 7065
307 Ga0105247_10213017 3300009101 Bacteria 1304
308 Ga0114129_10000872 3300009147 Bacteria 39245
309 Ga0114129_10001463 3300009147 Bacteria 31911
310 Ga0114129_10025064 3300009147 Bacteria 8453
311 Ga0114129_10026499 3300009147 Bacteria 8208
312 Ga0114129_10041163 3300009147 Bacteria 6512
313 Ga0114129_10043466 3300009147 Bacteria 6321
314 Ga0114129_10067783 3300009147 Bacteria 4976
315 Ga0114129_10080175 3300009147 Bacteria 4537
316 Ga0114129_10150354 3300009147 Bacteria 3187
317 Ga0114129_10213923 3300009147 Bacteria 2604
318 Ga0114129_10238725 3300009147 Bacteria 2444
319 Ga0114129_10313671 3300009147 Bacteria 2087
320 Ga0114129_10457408 3300009147 Unclassified 1673
321 Ga0114129_10586584 3300009147 Bacteria 1446
322 Ga0114129_11798185 3300009147 Unclassified 745
323 Ga0105243_10018229 3300009148 Bacteria 5315
324 Ga0105243_10081530 3300009148 Unclassified 2642
325 Ga0105243_10558232 3300009148 Bacteria 1095
326 Ga0105243_10574784 3300009148 Bacteria 1081
327 Ga0105243_10675709 3300009148 Unclassified 1004
328 Ga0105243_10685850 3300009148 Bacteria 997
329 Ga0105242_10004388 3300009176 Bacteria 10975
330 Ga0105242_10005798 3300009176 Bacteria 9514
331 Ga0105242_10008281 3300009176 Bacteria 7989
332 Ga0105242_10136797 3300009176 Bacteria 2121
333 Ga0105242_10162706 3300009176 Bacteria 1955
334 Ga0105242_10321345 3300009176 Bacteria 1420
335 Ga0105242_10602395 3300009176 Unclassified 1061
336 Ga0105248_10001321 3300009177 Bacteria 27614
337 Ga0105248_10001837 3300009177 Bacteria 23524
338 Ga0105248_10071474 3300009177 Bacteria 3898
339 Ga0105248_10085301 3300009177 Bacteria 3554
340 Ga0105248_10390296 3300009177 Bacteria 1567
341 Ga0105248_10553377 3300009177 Bacteria 1298
342 Ga0105248_10644767 3300009177 Bacteria 1195
343 Ga0105248_10755820 3300009177 Bacteria 1097
344 Ga0105237_10431143 3300009545 Bacteria 1324
345 Ga0105237_10650493 3300009545 Unclassified 1061
346 Ga0105238_10007997 3300009551 Bacteria 10582
347 Ga0105238_10195118 3300009551 Bacteria 2001
348 Ga0105249_10138430 3300009553 Bacteria 2332
349 Ga0105249_10161273 3300009553 Bacteria 2167
350 Ga0105249_10304537 3300009553 Bacteria 1600
351 Ga0105249_10893912 3300009553 Bacteria 955
352 Ga0105249_10974194 3300009553 Bacteria 916
353 Ga0105249_11115192 3300009553 Bacteria 859
354 Ga0099796_10010804 3300010159 Unclassified 2524
355 Ga0099796_10051386 3300010159 Bacteria 1432
356 Ga0099796_10271784 3300010159 Bacteria 710
357 Ga0105239_10156926 3300010375 Bacteria 2541
358 Ga0105246_10174880 3300011119 Bacteria 1648
359 Ga0157315_1019904 3300012508 Bacteria 700
360 Ga0157370_10073559 3300013104 Bacteria 3225
361 Ga0157369_10046603 3300013105 Unclassified 4711
362 Ga0157374_10029002 3300013296 Bacteria 5004
363 Ga0157374_10159856 3300013296 Bacteria 2194
364 Ga0157378_10350703 3300013297 Bacteria 1441
365 Ga0157378_10362924 3300013297 Bacteria 1418
366 Ga0163162_10035155 3300013306 Bacteria 4990
367 Ga0157372_10039247 3300013307 Bacteria 5226
368 Ga0157375_10258524 3300013308 Bacteria 1903
369 Ga0157375_11117366 3300013308 Bacteria 923
370 Ga0163163_10004060 3300014325 Bacteria 12487
371 Ga0163163_10025213 3300014325 Bacteria 5668
372 Ga0163163_10039618 3300014325 Bacteria 4600
373 Ga0163163_10042434 3300014325 Bacteria 4455
374 Ga0163163_10157612 3300014325 Unclassified 2315
375 Ga0163163_10473343 3300014325 Bacteria 1313
376 Ga0157380_10057651 3300014326 Bacteria 3094
377 Ga0157380_10059149 3300014326 Bacteria 3057
378 Ga0157380_10135030 3300014326 Bacteria 2111
379 Ga0157380_10212897 3300014326 Bacteria 1723
380 Ga0157380_10283903 3300014326 Bacteria 1516
381 Ga0157380_10315452 3300014326 Bacteria 1447
382 Ga0157380_10472081 3300014326 Bacteria 1211
383 Ga0157380_10539726 3300014326 Bacteria 1142
384 Ga0157380_10736737 3300014326 Unclassified 995
385 Ga0157380_10835451 3300014326 Bacteria 941
386 Ga0157380_11355236 3300014326 Unclassified 760
387 Ga0157377_10023095 3300014745 Bacteria 3293
388 Ga0157377_10040793 3300014745 Bacteria 2572
389 Ga0157377_10172055 3300014745 Unclassified 1355
390 Ga0157379_10037484 3300014968 Bacteria 4323
391 Ga0157379_10057329 3300014968 Bacteria 3481
392 Ga0157379_10117003 3300014968 Unclassified 2398
393 Ga0157379_10433503 3300014968 Bacteria 1211
394 Ga0157376_10035998 3300014969 Bacteria 4007
395 Ga0157376_10097819 3300014969 Bacteria 2557
396 Ga0157376_10147431 3300014969 Bacteria 2118
397 Ga0157376_10147946 3300014969 Bacteria 2115
398 Ga0157376_10181794 3300014969 Bacteria 1923
399 Ga0157376_10746005 3300014969 Unclassified 988
400 Ga0207697_10004503 3300025315 Bacteria 6646
401 Ga0207697_10213180 3300025315 Bacteria 851
402 Ga0207697_10302372 3300025315 Bacteria 710
403 Ga0207656_10025111 3300025321 Bacteria 2417
404 Ga0207653_10165295 3300025885 Bacteria 821
405 Ga0207682_10001994 3300025893 Bacteria 9238
406 Ga0207682_10046558 3300025893 Unclassified 1783
407 Ga0207682_10113333 3300025893 Bacteria 1196
408 Ga0207642_10007110 3300025899 Bacteria 3761
409 Ga0207642_10019367 3300025899 Bacteria 2634
410 Ga0207642_10102461 3300025899 Bacteria 1440
411 Ga0207710_10235940 3300025900 Bacteria 911
412 Ga0207688_10063561 3300025901 Bacteria 2082
413 Ga0207680_10030326 3300025903 Bacteria 3049
414 Ga0207680_10768307 3300025903 Bacteria 691
415 Ga0207699_10046862 3300025906 Bacteria 2531
416 Ga0207645_10004952 3300025907 Bacteria 9766
417 Ga0207645_10016370 3300025907 Bacteria 4908
418 Ga0207645_10036205 3300025907 Bacteria 3169
419 Ga0207645_10229401 3300025907 Bacteria 1225
420 Ga0207643_10000654 3300025908 Bacteria 21619
421 Ga0207643_10022700 3300025908 Bacteria 3457
422 Ga0207643_10092927 3300025908 Bacteria 1761
423 Ga0207643_10192200 3300025908 Unclassified 1239
424 Ga0207705_10033935 3300025909 Bacteria 3647
425 Ga0207684_10695072 3300025910 Bacteria 865
426 Ga0207707_10086716 3300025912 Unclassified 2735
427 Ga0207695_10114151 3300025913 Bacteria 2677
428 Ga0207695_10331039 3300025913 Bacteria 1411
429 Ga0207671_10604176 3300025914 Unclassified 874
430 Ga0207693_10299089 3300025915 Bacteria 1261
431 Ga0207693_10656214 3300025915 Unclassified 815
432 Ga0207663_10017665 3300025916 Bacteria 3981
433 Ga0207663_10792887 3300025916 Unclassified 754
434 Ga0207660_10139143 3300025917 Unclassified 1855
435 Ga0207660_10186948 3300025917 Bacteria 1611
436 Ga0207662_10006665 3300025918 Bacteria 6241
437 Ga0207662_10025229 3300025918 Bacteria 3423
438 Ga0207657_10004520 3300025919 Bacteria 14695
439 Ga0207652_10126439 3300025921 Bacteria 2277
440 Ga0207652_10223304 3300025921 Bacteria 1697
441 Ga0207652_10762082 3300025921 Bacteria 861
442 Ga0207646_10087625 3300025922 Bacteria 2786
443 Ga0207646_10087828 3300025922 Bacteria 2782
444 Ga0207646_10245479 3300025922 Unclassified 1617
445 Ga0207646_10348781 3300025922 Bacteria 1338
446 Ga0207681_10023980 3300025923 Bacteria 3909
447 Ga0207681_10032245 3300025923 Bacteria 3429
448 Ga0207681_10043308 3300025923 Bacteria 3012
449 Ga0207681_10100524 3300025923 Bacteria 2084
450 Ga0207681_10137184 3300025923 Bacteria 1817
451 Ga0207681_10687564 3300025923 Bacteria 850
452 Ga0207694_10243456 3300025924 Unclassified 1470
453 Ga0207650_10070339 3300025925 Unclassified 2630
454 Ga0207650_10806723 3300025925 Bacteria 796
455 Ga0207650_10917502 3300025925 Bacteria 744
456 Ga0207650_10927367 3300025925 Bacteria 740
457 Ga0207659_10001289 3300025926 Bacteria 14977
458 Ga0207659_10005282 3300025926 Bacteria 7827
459 Ga0207659_10009646 3300025926 Bacteria 6039
460 Ga0207659_10137299 3300025926 Unclassified 1894
461 Ga0207687_10236504 3300025927 Bacteria 1445
462 Ga0207687_10530284 3300025927 Bacteria 986
463 Ga0207700_10042143 3300025928 Bacteria 3345
464 Ga0207664_10060225 3300025929 Bacteria 3025
465 Ga0207644_10003503 3300025931 Bacteria 10157
466 Ga0207644_10004023 3300025931 Bacteria 9540
467 Ga0207644_10064163 3300025931 Unclassified 2669
468 Ga0207644_10193404 3300025931 Bacteria 1601
469 Ga0207690_10398551 3300025932 Unclassified 1097
470 Ga0207706_10012515 3300025933 Bacteria 7729
471 Ga0207706_10041489 3300025933 Bacteria 4079
472 Ga0207706_10049097 3300025933 Bacteria 3731
473 Ga0207706_10149846 3300025933 Unclassified 2051
474 Ga0207686_10015748 3300025934 Bacteria 4235
475 Ga0207686_10018613 3300025934 Unclassified 3935
476 Ga0207686_10068563 3300025934 Bacteria 2273
477 Ga0207709_10015911 3300025935 Bacteria 4175
478 Ga0207709_10373110 3300025935 Bacteria 1083
479 Ga0207670_10018565 3300025936 Bacteria 4232
480 Ga0207670_10570388 3300025936 Bacteria 927
481 Ga0207670_10821092 3300025936 Bacteria 775
482 Ga0207669_10010232 3300025937 Bacteria 4509
483 Ga0207669_10109045 3300025937 Bacteria 1850
484 Ga0207669_10147472 3300025937 Unclassified 1643
485 Ga0207669_10869231 3300025937 Bacteria 751
486 Ga0207704_10005454 3300025938 Bacteria 5864
487 Ga0207704_10416627 3300025938 Bacteria 1064
488 Ga0207665_10251765 3300025939 Bacteria 1305
489 Ga0207691_10007062 3300025940 Bacteria 10834
490 Ga0207691_10029383 3300025940 Bacteria 5142
491 Ga0207691_10066243 3300025940 Bacteria 3268
492 Ga0207691_10201059 3300025940 Unclassified 1734
493 Ga0207691_10212176 3300025940 Bacteria 1681
494 Ga0207691_10242949 3300025940 Bacteria 1556
495 Ga0207691_10299860 3300025940 Bacteria 1381
496 Ga0207691_10451331 3300025940 Unclassified 1094
497 Ga0207711_10036732 3300025941 Bacteria 4158
498 Ga0207711_10052137 3300025941 Bacteria 3505
499 Ga0207711_10114733 3300025941 Bacteria 2399
500 Ga0207711_10238726 3300025941 Bacteria 1666
501 Ga0207711_10852497 3300025941 Bacteria 848
502 Ga0207711_11103300 3300025941 Bacteria 734
503 Ga0207689_10008723 3300025942 Bacteria 8823
504 Ga0207689_10041287 3300025942 Bacteria 3817
505 Ga0207689_10181414 3300025942 Bacteria 1736
506 Ga0207661_10351454 3300025944 Bacteria 1330
507 Ga0207679_10025339 3300025945 Bacteria 4077
508 Ga0207679_10026081 3300025945 Bacteria 4027
509 Ga0207679_10039351 3300025945 Unclassified 3375
510 Ga0207667_10004724 3300025949 Bacteria 16679
511 Ga0207651_10591776 3300025960 Unclassified 969
512 Ga0207712_10028123 3300025961 Bacteria 3759
513 Ga0207712_10071200 3300025961 Bacteria 2500
514 Ga0207712_10120027 3300025961 Unclassified 1988
515 Ga0207712_10450603 3300025961 Bacteria 1091
516 Ga0207668_10056418 3300025972 Unclassified 2736
517 Ga0207668_10202690 3300025972 Bacteria 1581
518 Ga0207668_10230584 3300025972 Bacteria 1493
519 Ga0207640_10027176 3300025981 Bacteria 3484
520 Ga0207640_10134995 3300025981 Bacteria 1790
521 Ga0207640_10377726 3300025981 Unclassified 1147
522 Ga0207658_10004157 3300025986 Bacteria 10091
523 Ga0207658_10192025 3300025986 Bacteria 1698
524 Ga0207658_10433060 3300025986 Bacteria 1162
525 Ga0207658_10477163 3300025986 Unclassified 1108
526 Ga0207658_10844111 3300025986 Bacteria 833
527 Ga0207677_10050686 3300026023 Bacteria 2809
528 Ga0207677_10114763 3300026023 Bacteria 2013
529 Ga0207677_10433907 3300026023 Bacteria 1122
530 Ga0207677_10761346 3300026023 Unclassified 864
531 Ga0207703_10020322 3300026035 Bacteria 5192
532 Ga0207703_10039495 3300026035 Bacteria 3772
533 Ga0207703_10048671 3300026035 Bacteria 3423
534 Ga0207703_10073019 3300026035 Bacteria 2837
535 Ga0207703_10087445 3300026035 Bacteria 2613
536 Ga0207703_10144348 3300026035 Unclassified 2069
537 Ga0207703_10157819 3300026035 Bacteria 1984
538 Ga0207678_10025453 3300026067 Bacteria 5165
539 Ga0207678_10031262 3300026067 Bacteria 4644
540 Ga0207708_10004348 3300026075 Bacteria 10436
541 Ga0207708_10014366 3300026075 Bacteria 5925
542 Ga0207708_10040036 3300026075 Bacteria 3572
543 Ga0207708_10377950 3300026075 Bacteria 1167
544 Ga0207708_10526425 3300026075 Bacteria 994
545 Ga0207702_10291442 3300026078 Unclassified 1546
546 Ga0207641_10002814 3300026088 Bacteria 15835
547 Ga0207641_10168570 3300026088 Bacteria 1996
548 Ga0207641_10419856 3300026088 Bacteria 1288
549 Ga0207641_10481156 3300026088 Bacteria 1203
550 Ga0207641_10520940 3300026088 Bacteria 1156
551 Ga0207641_10531897 3300026088 Bacteria 1144
552 Ga0207648_10005564 3300026089 Bacteria 12679
553 Ga0207648_10012281 3300026089 Bacteria 8018
554 Ga0207648_10018662 3300026089 Bacteria 6276
555 Ga0207648_10103255 3300026089 Bacteria 2500
556 Ga0207648_10128235 3300026089 Bacteria 2232
557 Ga0207648_10672933 3300026089 Bacteria 958
558 Ga0207676_10012766 3300026095 Bacteria 6028
559 Ga0207676_10070775 3300026095 Bacteria 2798
560 Ga0207676_10162939 3300026095 Bacteria 1934
561 Ga0207676_10769551 3300026095 Bacteria 937
562 Ga0207674_10056883 3300026116 Bacteria 3968
563 Ga0207674_10444445 3300026116 Bacteria 1253
564 Ga0207674_10466575 3300026116 Bacteria 1220
565 Ga0207675_100000257 3300026118 Bacteria 50714
566 Ga0207675_100002749 3300026118 Bacteria 17293
567 Ga0207675_100009450 3300026118 Bacteria 9128
568 Ga0207675_100012673 3300026118 Bacteria 7879
569 Ga0207675_100086538 3300026118 Bacteria 2943
570 Ga0207675_100242373 3300026118 Bacteria 1742
571 Ga0207675_100270369 3300026118 Bacteria 1649
572 Ga0207675_101026488 3300026118 Unclassified 843
573 Ga0207683_10002874 3300026121 Bacteria 15015
574 Ga0207683_10105824 3300026121 Bacteria 2515
575 Ga0207683_10263223 3300026121 Bacteria 1575
576 Ga0207683_10273583 3300026121 Bacteria 1543
577 Ga0207698_10025537 3300026142 Bacteria 4164
578 Ga0209179_1006039 3300027512 Bacteria 1929
579 Ga0209588_1013023 3300027671 Unclassified 2532
580 Ga0209813_10149968 3300027866 Bacteria 834
581 Ga0207428_10002766 3300027907 Bacteria 17438
582 Ga0207428_10067565 3300027907 Bacteria 2814
583 Ga0207428_10283265 3300027907 Bacteria 1230
584 Ga0268266_10035070 3300028379 Bacteria 4267
585 Ga0268266_11107561 3300028379 Bacteria 766
586 Ga0268265_10004633 3300028380 Bacteria 9500
587 Ga0268265_10009558 3300028380 Bacteria 6547
588 Ga0268265_10025520 3300028380 Bacteria 4197
589 Ga0268265_10044483 3300028380 Bacteria 3306
590 Ga0268265_10220461 3300028380 Bacteria 1659
591 Ga0268265_10294029 3300028380 Bacteria 1459
592 Ga0268265_10409076 3300028380 Bacteria 1256
593 Ga0268264_10014663 3300028381 Bacteria 6440
594 Ga0268264_10030057 3300028381 Bacteria 4454
595 Ga0268264_10113684 3300028381 Bacteria 2375
596 Ga0268264_10269244 3300028381 Bacteria 1591
597 Ga0268264_10424659 3300028381 Bacteria 1283
598 Ga0268264_10772982 3300028381 Bacteria 958
599 Ga0268264_10873900 3300028381 Bacteria 901
600 Ga0307408_100766019 3300031548 Unclassified 873
601 Ga0307405_10064708 3300031731 Bacteria 2325
602 Ga0307407_10126608 3300031903 Unclassified 1628
603 Ga0307412_10111227 3300031911 Bacteria 1956
604 Ga0307409_100041547 3300031995 Bacteria 3436
605 Ga0307416_100079637 3300032002 Bacteria 2762
606 Ga0307416_100233989 3300032002 Unclassified 1774
607 Ga0307416_100269631 3300032002 Unclassified 1670
608 Ga0307416_101362761 3300032002 Bacteria 815
609 Ga0307414_10168336 3300032004 Bacteria 1749
610 Ga0307411_10616942 3300032005 Bacteria 935
611 Ga0307411_10977018 3300032005 Bacteria 757
612 Ga0307415_100058934 3300032126 Bacteria 2646
613 Ga0307415_100078168 3300032126 Bacteria 2353
614 Ga0307415_100270787 3300032126 Bacteria 1391
615 Ga0373948_0002873 3300034817 Bacteria 2591
616 Ga0373948_0063669 3300034817 Bacteria 814
617 Ga0373959_0003650 3300034820 Bacteria 2463
618 Ga0373928_0003355 3300035084 Bacteria 3055
619 Ga0373929_0014648 3300035085 Bacteria 1517
620 Ga0373940_0000575 3300035088 Bacteria 5831
621 Ga0373949_0000894 3300035090 Bacteria 9345
622 Ga0373949_0008041 3300035090 Bacteria 2311
623 Ga0373951_0000173 3300035091 Bacteria 23304
624 Ga0373951_0028140 3300035091 Bacteria 1316
625 Ga0373952_0003299 3300035092 Bacteria 2910
626 Ga0373923_0039530 3300035111 Bacteria 1938
627 Ga0373932_0000876 3300035112 Bacteria 8871
628 Ga0373939_0000544 3300035114 Bacteria 9433
629 Ga0373941_0000084 3300035115 Bacteria 15458
630 Ga0373941_0076293 3300035115 Bacteria 1123
631 Ga0373945_0043391 3300035116 Bacteria 1632
632 Ga0373953_0038680 3300035117 Bacteria 1888
633 Ga0373953_0135098 3300035117 Bacteria 1053
634 Ga0373954_0101854 3300035118 Bacteria 1386
635 Ga0373956_0008525 3300035119 Bacteria 4150
636 Ga0373956_0083740 3300035119 Bacteria 1466
637 Ga0373960_0000891 3300035121 Bacteria 6340
638 Ga0373960_0206942 3300035121 Unclassified 696
639 Ga0373955_0006337 3300035172 Bacteria 5390
640 Ga0373955_0076574 3300035172 Bacteria 1882
641 Ga0373942_0021770 3300035207 Bacteria 1620
642 Ga0373961_0002058 3300035241 Bacteria 5371
643 Ga0373961_0047683 3300035241 Bacteria 1260
644 Ga0373924_0151435 3300035410 Unclassified 1015
645 Ga0373931_0000164 3300035691 Bacteria 28816
646 Ga0373931_0005646 3300035691 Bacteria 5805
647 Ga0373935_0091041 3300035692 Bacteria 1997
648 Ga0373935_0293921 3300035692 Unclassified 1147
649 Ga0373927_0015048 3300035695 Bacteria 5114
650 Ga0373927_0035945 3300035695 Bacteria 3223
651 Ga0373927_0066322 3300035695 Unclassified 2335
652 Ga0373927_0263838 3300035695 Unclassified 1133
653 Ga0373927_0427216 3300035695 Unclassified 875
654 Ga0373933_0004464 3300035724 Bacteria 7673
655 Ga0373933_0605675 3300035724 Bacteria 719
656 Ga0373947_0173825 3300035725 Unclassified 1399
657 Ga0373947_0176252 3300035725 Bacteria 1390
658 Ga0373947_0309071 3300035725 Bacteria 1055
659 Ga0373937_0002979 3300036401 Bacteria 14182
660 Ga0373937_0007450 3300036401 Bacteria 9470
661 Ga0373937_0014835 3300036401 Bacteria 6883
662 Ga0373937_0025421 3300036401 Bacteria 5344
663 Ga0373937_0075532 3300036401 Bacteria 3111
664 Ga0373925_0082346 3300037068 Unclassified 2449
665 Ga0373925_0104144 3300037068 Bacteria 2185
666 Ga0373925_0123213 3300037068 Unclassified 2014
667 Ga0373925_0529595 3300037068 Bacteria 968
668 Ga0436364_0015492 3300037853 Unclassified 1563
669 Ga0436364_1448381 3300037853 Bacteria 1153
670 Ga0436361_0811267 3300039447 Bacteria 1027
671 Ga0436362_0519100 3300039453 Bacteria 968
672 Ga0439439_0034118 3300041406 Unclassified 1305
673 Ga0439450_034889 3300042008 Bacteria 1145
674 Ga0439440_0005748 3300042993 Bacteria 2471
675 Ga0439440_0047009 3300042993 Bacteria 1068
676 Ga0451576_0083562 3300045051 Bacteria 3321
677 Ga0451576_0170633 3300045051 Unclassified 2271
678 Ga0451576_0250584 3300045051 Bacteria 1851
679 Ga0451576_0497789 3300045051 Bacteria 1280
680 Ga0451576_0727826 3300045051 Unclassified 1042
681 Ga0466967_1336007 3300045976 Unclassified 714
682 Ga0495592_0009093 3300046454 Bacteria 7473
683 Ga0495629_0006090 3300046459 Bacteria 8963
684 Ga0495629_0011515 3300046459 Bacteria 6424
685 Ga0495651_0012522 3300046462 Bacteria 6543
686 Ga0495653_0004302 3300046463 Bacteria 11524
687 Ga0495653_0475131 3300046463 Unclassified 783
688 Ga0495580_0018477 3300046472 Bacteria 5191
689 Ga0495580_0261618 3300046472 Bacteria 1183
690 Ga0495662_0059030 3300046476 Unclassified 1853
691 Ga0495664_0024427 3300046477 Bacteria 3513
692 Ga0495584_0332409 3300046491 Bacteria 772
693 Ga0495594_0031042 3300046499 Bacteria 2895
694 Ga0495608_0023570 3300046511 Bacteria 4218
695 Ga0495618_0004754 3300046514 Bacteria 8303
696 Ga0495620_0141200 3300046515 Unclassified 942
697 Ga0495628_0038970 3300046516 Bacteria 3802
698 Ga0495628_0330943 3300046516 Unclassified 1123
699 Ga0495628_0524144 3300046516 Bacteria 853
700 Ga0495630_0026225 3300046517 Bacteria 4314
701 Ga0495630_0237141 3300046517 Bacteria 1394
702 Ga0495630_0254812 3300046517 Bacteria 1341
703 Ga0495643_0003398 3300046522 Bacteria 11704
704 Ga0495644_0090047 3300046523 Bacteria 1158
705 Ga0495644_0211558 3300046523 Bacteria 749
706 Ga0495663_0059730 3300046525 Bacteria 1197
707 Ga0495642_0028295 3300046528 Bacteria 2233
708 Ga0495642_0062784 3300046528 Bacteria 1543
709 Ga0495652_0004766 3300046529 Bacteria 12906
710 Ga0495640_0011679 3300046533 Bacteria 6744
711 Ga0495587_0000355 3300046536 Bacteria 32860
712 Ga0495609_0077464 3300046538 Bacteria 1456
713 Ga0495621_0044122 3300046539 Bacteria 1575
714 Ga0495645_0059985 3300046543 Bacteria 2758
715 Ga0495645_0068240 3300046543 Bacteria 2567
716 Ga0495645_0525994 3300046543 Unclassified 736
717 Ga0495667_0003570 3300046559 Bacteria 10461
718 Ga0495634_0009496 3300046642 Bacteria 7172
719 Ga0495635_0007990 3300046663 Bacteria 7396
720 Ga0495635_0370007 3300046663 Unclassified 955
721 Ga0495659_0005200 3300046664 Bacteria 4090
722 Ga0495659_0017586 3300046664 Bacteria 2372
723 Ga0495659_0064835 3300046664 Bacteria 1357
724 Ga0495588_0009782 3300046674 Bacteria 4446
725 Ga0495657_0007878 3300046675 Bacteria 8175
726 Ga0495657_0142046 3300046675 Unclassified 1496
727 Ga0495599_0003059 3300046678 Bacteria 9732
728 Ga0495623_0006935 3300046679 Bacteria 7365
729 Ga0495646_0010941 3300046680 Bacteria 5762
730 Ga0495647_0124027 3300046681 Unclassified 1089
731 Ga0495658_0028749 3300046683 Unclassified 3003
732 Ga0495658_0095512 3300046683 Bacteria 1767
733 Ga0495658_0106255 3300046683 Unclassified 1682
734 Ga0495658_0435134 3300046683 Unclassified 837
735 Ga0495669_0005561 3300046684 Bacteria 5258
736 Ga0495669_0155191 3300046684 Bacteria 1085
737 Ga0495669_0173848 3300046684 Bacteria 1025
738 Ga0495613_0038050 3300046689 Bacteria 3566
739 Ga0495624_0073604 3300046690 Bacteria 2124
740 Ga0495670_0026373 3300046691 Bacteria 2876
741 Ga0495671_0270127 3300046692 Bacteria 820
742 Ga0495600_0002574 3300046809 Bacteria 10450
743 Ga0495581_0168885 3300047315 Unclassified 1279
744 Ga0495604_0015454 3300047317 Bacteria 6093
745 Ga0495636_0018804 3300047318 Bacteria 2773
746 Ga0495674_0003169 3300047319 Bacteria 15973
747 Ga0495676_0079619 3300047321 Unclassified 2490
748 Ga0495680_0016803 3300047322 Bacteria 6273
749 Ga0495677_0031076 3300047445 Bacteria 1944
750 Ga0495685_065014 3300047447 Bacteria 1226
751 Ga0495684_0004500 3300047471 Bacteria 10887
752 Ga0495593_0023997 3300047673 Bacteria 3384
753 Ga0495593_0161563 3300047673 Unclassified 1131
754 Ga0495602_0000766 3300048088 Bacteria 30602
755 Ga0495602_0254135 3300048088 Unclassified 1308
756 Ga0496102_0555088 3300048905 Bacteria 1071
757 Ga0496102_1098433 3300048905 Unclassified 715
758 Ga0496104_0135278 3300048907 Bacteria 2368
759 Ga0496104_0221839 3300048907 Unclassified 1803
760 Ga0496104_0389996 3300048907 Bacteria 1305
761 Ga0496106_0111786 3300048909 Unclassified 2128
762 Ga0496106_0285387 3300048909 Bacteria 1323
763 Ga0496106_0919007 3300048909 Bacteria 690
764 Ga0496107_0061017 3300048910 Bacteria 2730
765 Ga0496108_0107002 3300048911 Bacteria 2388
766 Ga0496108_0365667 3300048911 Bacteria 1259
767 Ga0496109_0119942 3300048912 Bacteria 2450
768 Ga0496110_0072703 3300048913 Bacteria 3052
769 Ga0496110_0184548 3300048913 Bacteria 1894
770 Ga0496110_0549049 3300048913 Unclassified 1050
771 Ga0496111_0171170 3300048914 Bacteria 1614
772 Ga0496111_0828476 3300048914 Unclassified 669
773 Ga0496112_0073338 3300048915 Bacteria 3384
774 Ga0496112_0093501 3300048915 Unclassified 2977
775 Ga0496112_0175085 3300048915 Bacteria 2111
776 Ga0496113_0346340 3300048916 Bacteria 1192
777 Ga0496114_0105729 3300048917 Bacteria 2408
778 Ga0496114_0120641 3300048917 Bacteria 2254
779 Ga0496114_0127351 3300048917 Bacteria 2196
780 Ga0496114_0156231 3300048917 Bacteria 1981
781 Ga0496115_0077670 3300048918 Unclassified 2700
782 Ga0496115_0102749 3300048918 Bacteria 2344
783 Ga0501036_0101308 3300049572 Bacteria 2436
784 Ga0501036_0615694 3300049572 Bacteria 900
785 Ga0501039_0060537 3300049575 Bacteria 2933
786 Ga0501040_0093858 3300049576 Bacteria 2087
787 Ga0501041_0139212 3300049577 Bacteria 1513
788 Ga0501043_0142304 3300049579 Bacteria 1878
789 Ga0501046_0013938 3300049580 Bacteria 6790
790 Ga0501047_0824643 3300049581 Unclassified 742
791 Ga0501048_0103774 3300049582 Bacteria 2006
792 Ga0501067_0039257 3300049583 Bacteria 2629
793 Ga0501072_0506630 3300049588 Unclassified 955
794 Ga0501074_0118255 3300049590 Bacteria 1896
795 Ga0501074_0321787 3300049590 Bacteria 1098
796 Ga0501075_0046909 3300049591 Bacteria 3246
797 Ga0501075_0182215 3300049591 Bacteria 1602
798 Ga0501075_0647335 3300049591 Bacteria 806
799 Ga0501076_0023251 3300049592 Bacteria 4776
800 Ga0501076_0074240 3300049592 Bacteria 2724
801 Ga0501077_0045514 3300049593 Bacteria 2788
802 Ga0501225_0025431 3300049705 Bacteria 1628
803 Ga0501079_0085856 3300049741 Bacteria 2436
804 Ga0501081_0028899 3300049743 Bacteria 3744
805 Ga0501035_0228372 3300049822 Bacteria 1587
806 Ga0501045_0046117 3300049824 Bacteria 3174
807 Ga0501045_0433747 3300049824 Bacteria 977
808 nmdc:mga06z11_498046_c1 3300050494 Bacteria 738
809 nmdc:mga05p37_101965_c1 3300050507 Bacteria 3534
810 nmdc:mga05p37_116589_c1 3300050507 Bacteria 3282
811 nmdc:mga05p37_249278_c1 3300050507 Bacteria 2131
812 nmdc:mga05p37_295711_c1 3300050507 Bacteria 1926
813 nmdc:mga05p37_30783_c1 3300050507 Bacteria 6550
814 nmdc:mga05p37_3175_c1 3300050507 Bacteria 19126
815 nmdc:mga05p37_44274_c1 3300050507 Bacteria 5476
816 nmdc:mga05p37_47653_c1 3300050507 Bacteria 5270
817 nmdc:mga05p37_54470_c1 3300050507 Bacteria 4921
818 nmdc:mga05p37_590614_c1 3300050507 Bacteria 1255
819 nmdc:mga05p37_763601_c1 3300050507 Bacteria 1064
820 nmdc:mga05p37_88462_c1 3300050507 Unclassified 3817
821 nmdc:mga09592_11283_c1 3300050508 Bacteria 7272
822 nmdc:mga09592_130766_c1 3300050508 Bacteria 2160
823 nmdc:mga09592_529140_c1 3300050508 Unclassified 1013
824 nmdc:mga09592_71839_c1 3300050508 Bacteria 2938
825 nmdc:mga09592_77257_c1 3300050508 Bacteria 2832
826 nmdc:mga0qj67_77477_c1 3300050509 Unclassified 2660
827 nmdc:mga0qj67_97836_c1 3300050509 Bacteria 2364
828 nmdc:mga06r32_151878_c1 3300050510 Bacteria 2295
829 nmdc:mga06r32_170062_c1 3300050510 Bacteria 2163
830 nmdc:mga06r32_641440_c1 3300050510 Bacteria 1031
831 nmdc:mga08y16_265877_c1 3300050511 Bacteria 1771
832 nmdc:mga08y16_37602_c1 3300050511 Bacteria 5082
833 nmdc:mga08y16_389921_c1 3300050511 Unclassified 1427
834 nmdc:mga08y16_506624_c1 3300050511 Bacteria 1226
835 nmdc:mga08y16_57548_c1 3300050511 Bacteria 4062
836 nmdc:mga0n895_120342_c1 3300050512 Bacteria 2647
837 nmdc:mga0n895_14062_c1 3300050512 Bacteria 7254
838 nmdc:mga0n895_35918_c1 3300050512 Bacteria 3332
839 nmdc:mga0n895_373057_c1 3300050512 Bacteria 1444
840 nmdc:mga0n895_49874_c1 3300050512 Bacteria 4104
841 nmdc:mga0rr50_1001554_c1 3300050513 Bacteria 712
842 nmdc:mga0rr50_1236540_c1 3300050513 Unclassified 634
843 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
844 nmdc:mga0rr50_19061_c1 3300050513 Bacteria 4622
845 nmdc:mga0rr50_237013_c1 3300050513 Bacteria 1511
846 nmdc:mga0rr50_36934_c1 3300050513 Bacteria 3522
847 nmdc:mga0rr50_5083_c1 3300050513 Bacteria 7804
848 nmdc:mga0rr50_604899_c1 3300050513 Unclassified 935
849 nmdc:mga0rr50_88422_c1 3300050513 Bacteria 2407
850 nmdc:mga08x19_126638_c1 3300050514 Bacteria 1716
851 nmdc:mga08x19_155389_c1 3300050514 Bacteria 1551
852 nmdc:mga08x19_208959_c1 3300050514 Bacteria 1340
853 nmdc:mga08x19_235_c1 3300050514 Bacteria 42307
854 nmdc:mga08x19_252442_c1 3300050514 Bacteria 1218
855 nmdc:mga08x19_331103_c1 3300050514 Bacteria 1061
856 nmdc:mga08x19_539384_c1 3300050514 Bacteria 825
857 nmdc:mga0a205_181223_c1 3300050515 Bacteria 2001
858 nmdc:mga0a205_54352_c1 3300050515 Bacteria 3866
859 nmdc:mga0a205_593495_c1 3300050515 Bacteria 961
860 nmdc:mga0a205_60439_c1 3300050515 Bacteria 3660
861 Ga0495601_0033163 3300053077 Bacteria 3216
862 Ga0495601_0198668 3300053077 Unclassified 1310
863 Ga0495601_0213083 3300053077 Bacteria 1262
864 Ga0495612_0004409 3300053078 Bacteria 5837
865 Ga0495595_0000398 3300053084 Bacteria 16508
866 Ga0495595_0286969 3300053084 Bacteria 827
867 Ga0495619_0000526 3300053085 Bacteria 25389
868 Ga0495619_0009552 3300053085 Bacteria 6121
869 Ga0495619_0031963 3300053085 Bacteria 3413
870 Ga0495619_0037227 3300053085 Bacteria 3169
871 Ga0501082_0058271 3300060353 Unclassified 3328
872 Ga0501082_0152753 3300060353 Bacteria 2006
873 Ga0530510_0001566 3300061734 Bacteria 15443
874 Ga0070664_100239660
875 JGI24746J21847_1026205
876 JGI24748J21848_1010998
877 JGI24751J29686_10023444
878 Ga0065704_10275541
879 Ga0065704_10311845
880 Ga0065712_10014941
881 Ga0065712_10102617
882 Ga0065715_10184517
883 Ga0065715_10204796
884 Ga0065707_10354510
885 Ga0070676_10025976
886 Ga0070676_10067510
887 Ga0070676_10073525
888 Ga0070690_100011281
889 Ga0070690_100032368
890 Ga0070690_100069202
891 Ga0070690_100442021
892 Ga0070670_100013341
893 Ga0070670_100040768
894 Ga0070670_100170678
895 Ga0070670_100984204
896 Ga0070677_10062739
897 Ga0068869_100021553
898 Ga0068869_100085807
899 Ga0068869_100112338
900 Ga0068869_101234037
901 Ga0070666_10007215
902 Ga0070666_10019396
903 Ga0070666_10115967
904 Ga0070680_100169596
905 Ga0070680_100466577
906 Ga0070682_100294643
907 Ga0068868_100042257
908 Ga0068868_100135786
909 Ga0068868_100190636
910 Ga0068868_100546620
911 Ga0070660_100021434
912 Ga0070689_100015106
913 Ga0070689_100051576
914 Ga0070689_100052814
915 Ga0070689_100142120
916 Ga0070689_100194088
917 Ga0070689_100322798
918 Ga0070689_100569427
919 Ga0070689_101116513
920 Ga0070691_10005742
921 Ga0070687_100005955
922 Ga0070687_100026862
923 Ga0070687_100079638
924 Ga0070661_100378313
925 Ga0070661_100695830
926 Ga0070692_10010926
927 Ga0070692_10223350
928 Ga0070668_100015041
929 Ga0070668_100185668
930 Ga0070668_100579906
931 Ga0070668_100921815
932 Ga0070669_100000856
933 Ga0070669_100087679
934 Ga0070669_100097156
935 Ga0070669_100546736
936 Ga0070669_100626914
937 Ga0070669_100788505
938 Ga0070675_100001217
939 Ga0070675_100005111
940 Ga0070675_100011088
941 Ga0070675_100050220
942 Ga0070675_100080591
943 Ga0070675_100138371
944 Ga0070671_100003433
945 Ga0070671_100015469
946 Ga0070671_100039414
947 Ga0070671_100087178
948 Ga0070671_100095129
949 Ga0070671_100383015
950 Ga0070674_100030246
951 Ga0070674_100055670
952 Ga0070674_100060937
953 Ga0070674_100520243
954 Ga0070674_100742240
955 Ga0070673_100062197
956 Ga0070673_100358343
957 Ga0070688_100039501
958 Ga0070659_100300678
959 Ga0070659_100326917
960 Ga0070709_10375115
961 Ga0070714_100446842
962 Ga0070713_100014105
963 Ga0070713_100068591
964 Ga0070710_10570633
965 Ga0070701_10010578
966 Ga0070701_10010826
967 Ga0070701_10015466
968 Ga0070701_10033486
969 Ga0070711_100021119
970 Ga0070705_100001559
971 Ga0070705_100001998
972 Ga0070705_100063789
973 Ga0070700_100003262
974 Ga0070700_100010932
975 Ga0070700_100036580
976 Ga0070700_100155043
977 Ga0070700_100271699
978 Ga0070694_100003745
979 Ga0070694_100019023
980 Ga0070694_100075195
981 Ga0070694_100141004
982 Ga0070694_100228269
983 Ga0070663_100014490
984 Ga0070662_100287871
985 Ga0070662_100458683
986 Ga0070681_10035019
987 Ga0070681_10086097
988 Ga0068867_100002732
989 Ga0068867_100020598
990 Ga0068867_100295625
991 Ga0070685_10031388
992 Ga0070706_100761543
993 Ga0070707_100008538
994 Ga0070707_100041902
995 Ga0070707_100172310
996 Ga0070707_100189746
997 Ga0070698_100031616
998 Ga0070698_100051201
999 Ga0070698_100651066
1000 Ga0070698_100718348
1001 Ga0070699_100000249
1002 Ga0070699_100001648
1003 Ga0070699_100010580
1004 Ga0070699_100113104
1005 Ga0070699_100465861
1006 Ga0070679_100059901
1007 Ga0070684_100857679
1008 Ga0070697_100084321
1009 Ga0070672_100001866
1010 Ga0070672_100028041
1011 Ga0070672_100144645
1012 Ga0070672_100177101
1013 Ga0070672_100252852
1014 Ga0070672_100297018
1015 Ga0070672_100363454
1016 Ga0070672_100688685
1017 Ga0070686_100115242
1018 Ga0070686_100115881
1019 Ga0070686_100203186
1020 Ga0070686_100508614
1021 Ga0070695_100000104
1022 Ga0070695_100004676
1023 Ga0070695_100011495
1024 Ga0070695_100029929
1025 Ga0070695_100121151
1026 Ga0070695_100289472
1027 Ga0070665_100005360
1028 Ga0070665_100191324
1029 Ga0070665_100630209
1030 Ga0070704_100004129
1031 Ga0070704_100013232
1032 Ga0070704_100057360
1033 Ga0070704_100070873
1034 Ga0070704_100101456
1035 Ga0070704_100106360
1036 Ga0068855_100081680
1037 Ga0070664_100041399
1038 Ga0070664_100045055
1039 Ga0070664_100232201
1040 Ga0070664_101270953
1041 Ga0068857_100091062
1042 Ga0068857_100228254
1043 Ga0068857_100823628
1044 Ga0068857_100892738
1045 Ga0068854_100015722
1046 Ga0068854_100105683
1047 Ga0068854_100164800
1048 Ga0068856_100194394
1049 Ga0070702_100000807
1050 Ga0070702_100005855
1051 Ga0070702_100007812
1052 Ga0070702_100049288
1053 Ga0070702_100111008
1054 Ga0068852_100029026
1055 Ga0068859_100080795
1056 Ga0068859_100205460
1057 Ga0068859_100525002
1058 Ga0068859_100581168
1059 Ga0068859_100978008
1060 Ga0068859_101108659
1061 Ga0068864_100003281
1062 Ga0068864_100011422
1063 Ga0068864_100092499
1064 Ga0068864_100246948
1065 Ga0068866_10023167
1066 Ga0068866_10185785
1067 Ga0068861_100004493
1068 Ga0068861_100018740
1069 Ga0068861_100118009
1070 Ga0068861_100147559
1071 Ga0068861_100191611
1072 Ga0068861_100691059
1073 Ga0068851_10048684
1074 Ga0068870_10029962
1075 Ga0068870_10099905
1076 Ga0068863_100003785
1077 Ga0068863_100048812
1078 Ga0068863_100120016
1079 Ga0068863_100495581
1080 Ga0068858_100012279
1081 Ga0068858_100014277
1082 Ga0068858_100026929
1083 Ga0068858_100045110
1084 Ga0068858_100065238
1085 Ga0068858_100115553
1086 Ga0068858_100127016
1087 Ga0068858_100230524
1088 Ga0068858_100281689
1089 Ga0068858_101190625
1090 Ga0068860_100084891
1091 Ga0068860_100174147
1092 Ga0068860_100220240
1093 Ga0068860_100235739
1094 Ga0068860_100311181
1095 Ga0068860_100398614
1096 Ga0068860_100606205
1097 Ga0068862_100003116
1098 Ga0068862_100032149
1099 Ga0068862_100037798
1100 Ga0068862_100149034
1101 Ga0068862_100311477
1102 Ga0068862_100340995
1103 Ga0068862_100698836
1104 Ga0081455_10022337
1105 Ga0081455_10029354
1106 Ga0081455_10062734
1107 Ga0081540_1008840
1108 Ga0081540_1179098
1109 Ga0081539_10000071
1110 Ga0070717_10305737
1111 Ga0075432_10069108
1112 Ga0070712_100110700
1113 Ga0075367_10356237
1114 Ga0097621_100093875
1115 Ga0097621_100116168
1116 Ga0097621_100156954
1117 Ga0097621_100228239
1118 Ga0097621_100288626
1119 Ga0068871_100030815
1120 Ga0068871_100129796
1121 Ga0068871_100137187
1122 Ga0068871_100366292
1123 Ga0068871_100398874
1124 Ga0075428_100001190
1125 Ga0075428_100017466
1126 Ga0075428_100174386
1127 Ga0075428_100226858
1128 Ga0075428_100405642
1129 Ga0075428_100665367
1130 Ga0075430_100006519
1131 Ga0075430_100061587
1132 Ga0075430_100289434
1133 Ga0075431_100006480
1134 Ga0075431_100198507
1135 Ga0075431_100267355
1136 Ga0075433_10058363
1137 Ga0075433_10064477
1138 Ga0075433_10107778
1139 Ga0075433_10163589
1140 Ga0075433_10190603
1141 Ga0075433_10197340
1142 Ga0075434_100002827
1143 Ga0075434_100003678
1144 Ga0075434_100006134
1145 Ga0075434_100019263
1146 Ga0075434_101334402
1147 Ga0075429_100005103
1148 Ga0075429_100015846
1149 Ga0075429_100023751
1150 Ga0075429_100043961
1151 Ga0075429_100161397
1152 Ga0068865_100466448
1153 Ga0075436_100000928
1154 Ga0075436_100010457
1155 Ga0075436_100377451
1156 Ga0097620_100080793
1157 Ga0097620_100205445
1158 Ga0097620_100525018
1159 Ga0097620_100581141
1160 Ga0097620_100977817
1161 Ga0097620_101108522
1162 Ga0075435_100000216
1163 Ga0075435_100005332
1164 Ga0075435_100111207
1165 Ga0075435_100363509
1166 Ga0075435_100422667
1167 Ga0099794_10036009
1168 Ga0105240_10104703
1169 Ga0111539_10060071
1170 Ga0111539_10225134
1171 Ga0111539_10297469
1172 Ga0111539_10446280
1173 Ga0111539_10585824
1174 Ga0111539_10671908
1175 Ga0105245_10047030
1176 Ga0105245_10181082
1177 Ga0105245_10247468
1178 Ga0105245_10311754
1179 Ga0105247_10006773
1180 Ga0105247_10213017
1181 Ga0114129_10000872
1182 Ga0114129_10001463
1183 Ga0114129_10025064
1184 Ga0114129_10026499
1185 Ga0114129_10041163
1186 Ga0114129_10043466
1187 Ga0114129_10067783
1188 Ga0114129_10080175
1189 Ga0114129_10150354
1190 Ga0114129_10213923
1191 Ga0114129_10238725
1192 Ga0114129_10313671
1193 Ga0114129_10457408
1194 Ga0114129_10586584
1195 Ga0114129_11798185
1196 Ga0105243_10018229
1197 Ga0105243_10081530
1198 Ga0105243_10558232
1199 Ga0105243_10574784
1200 Ga0105243_10675709
1201 Ga0105243_10685850
1202 Ga0105242_10004388
1203 Ga0105242_10005798
1204 Ga0105242_10008281
1205 Ga0105242_10136797
1206 Ga0105242_10162706
1207 Ga0105242_10321345
1208 Ga0105242_10602395
1209 Ga0105248_10001321
1210 Ga0105248_10001837
1211 Ga0105248_10071474
1212 Ga0105248_10085301
1213 Ga0105248_10390296
1214 Ga0105248_10553377
1215 Ga0105248_10644767
1216 Ga0105248_10755820
1217 Ga0105237_10431143
1218 Ga0105237_10650493
1219 Ga0105238_10007997
1220 Ga0105238_10195118
1221 Ga0105249_10138430
1222 Ga0105249_10161273
1223 Ga0105249_10304537
1224 Ga0105249_10893912
1225 Ga0105249_10974194
1226 Ga0105249_11115192
1227 Ga0099796_10010804
1228 Ga0099796_10051386
1229 Ga0099796_10271784
1230 Ga0105239_10156926
1231 Ga0105246_10174880
1232 Ga0157315_1019904
1233 Ga0157370_10073559
1234 Ga0157369_10046603
1235 Ga0157374_10029002
1236 Ga0157374_10159856
1237 Ga0157378_10350703
1238 Ga0157378_10362924
1239 Ga0163162_10035155
1240 Ga0157372_10039247
1241 Ga0157375_10258524
1242 Ga0157375_11117366
1243 Ga0163163_10004060
1244 Ga0163163_10025213
1245 Ga0163163_10039618
1246 Ga0163163_10042434
1247 Ga0163163_10157612
1248 Ga0163163_10473343
1249 Ga0157380_10057651
1250 Ga0157380_10059149
1251 Ga0157380_10135030
1252 Ga0157380_10212897
1253 Ga0157380_10283903
1254 Ga0157380_10315452
1255 Ga0157380_10472081
1256 Ga0157380_10539726
1257 Ga0157380_10736737
1258 Ga0157380_10835451
1259 Ga0157380_11355236
1260 Ga0157377_10023095
1261 Ga0157377_10040793
1262 Ga0157377_10172055
1263 Ga0157379_10037484
1264 Ga0157379_10057329
1265 Ga0157379_10117003
1266 Ga0157379_10433503
1267 Ga0157376_10035998
1268 Ga0157376_10097819
1269 Ga0157376_10147431
1270 Ga0157376_10147946
1271 Ga0157376_10181794
1272 Ga0157376_10746005
1273 Ga0207697_10004503
1274 Ga0207697_10213180
1275 Ga0207697_10302372
1276 Ga0207656_10025111
1277 Ga0207653_10165295
1278 Ga0207682_10001994
1279 Ga0207682_10046558
1280 Ga0207682_10113333
1281 Ga0207642_10007110
1282 Ga0207642_10019367
1283 Ga0207642_10102461
1284 Ga0207710_10235940
1285 Ga0207688_10063561
1286 Ga0207680_10030326
1287 Ga0207680_10768307
1288 Ga0207699_10046862
1289 Ga0207645_10004952
1290 Ga0207645_10016370
1291 Ga0207645_10036205
1292 Ga0207645_10229401
1293 Ga0207643_10000654
1294 Ga0207643_10022700
1295 Ga0207643_10092927
1296 Ga0207643_10192200
1297 Ga0207705_10033935
1298 Ga0207684_10695072
1299 Ga0207707_10086716
1300 Ga0207695_10114151
1301 Ga0207695_10331039
1302 Ga0207671_10604176
1303 Ga0207693_10299089
1304 Ga0207693_10656214
1305 Ga0207663_10017665
1306 Ga0207663_10792887
1307 Ga0207660_10139143
1308 Ga0207660_10186948
1309 Ga0207662_10006665
1310 Ga0207662_10025229
1311 Ga0207657_10004520
1312 Ga0207652_10126439
1313 Ga0207652_10223304
1314 Ga0207652_10762082
1315 Ga0207646_10087625
1316 Ga0207646_10087828
1317 Ga0207646_10245479
1318 Ga0207646_10348781
1319 Ga0207681_10023980
1320 Ga0207681_10032245
1321 Ga0207681_10043308
1322 Ga0207681_10100524
1323 Ga0207681_10137184
1324 Ga0207681_10687564
1325 Ga0207694_10243456
1326 Ga0207650_10070339
1327 Ga0207650_10806723
1328 Ga0207650_10917502
1329 Ga0207650_10927367
1330 Ga0207659_10001289
1331 Ga0207659_10005282
1332 Ga0207659_10009646
1333 Ga0207659_10137299
1334 Ga0207687_10236504
1335 Ga0207687_10530284
1336 Ga0207700_10042143
1337 Ga0207664_10060225
1338 Ga0207644_10003503
1339 Ga0207644_10004023
1340 Ga0207644_10064163
1341 Ga0207644_10193404
1342 Ga0207690_10398551
1343 Ga0207706_10012515
1344 Ga0207706_10041489
1345 Ga0207706_10049097
1346 Ga0207706_10149846
1347 Ga0207686_10015748
1348 Ga0207686_10018613
1349 Ga0207686_10068563
1350 Ga0207709_10015911
1351 Ga0207709_10373110
1352 Ga0207670_10018565
1353 Ga0207670_10570388
1354 Ga0207670_10821092
1355 Ga0207669_10010232
1356 Ga0207669_10109045
1357 Ga0207669_10147472
1358 Ga0207669_10869231
1359 Ga0207704_10005454
1360 Ga0207704_10416627
1361 Ga0207665_10251765
1362 Ga0207691_10007062
1363 Ga0207691_10029383
1364 Ga0207691_10066243
1365 Ga0207691_10201059
1366 Ga0207691_10212176
1367 Ga0207691_10242949
1368 Ga0207691_10299860
1369 Ga0207691_10451331
1370 Ga0207711_10036732
1371 Ga0207711_10052137
1372 Ga0207711_10114733
1373 Ga0207711_10238726
1374 Ga0207711_10852497
1375 Ga0207711_11103300
1376 Ga0207689_10008723
1377 Ga0207689_10041287
1378 Ga0207689_10181414
1379 Ga0207661_10351454
1380 Ga0207679_10025339
1381 Ga0207679_10026081
1382 Ga0207679_10039351
1383 Ga0207667_10004724
1384 Ga0207651_10591776
1385 Ga0207712_10028123
1386 Ga0207712_10071200
1387 Ga0207712_10120027
1388 Ga0207712_10450603
1389 Ga0207668_10056418
1390 Ga0207668_10202690
1391 Ga0207668_10230584
1392 Ga0207640_10027176
1393 Ga0207640_10134995
1394 Ga0207640_10377726
1395 Ga0207658_10004157
1396 Ga0207658_10192025
1397 Ga0207658_10433060
1398 Ga0207658_10477163
1399 Ga0207658_10844111
1400 Ga0207677_10050686
1401 Ga0207677_10114763
1402 Ga0207677_10433907
1403 Ga0207677_10761346
1404 Ga0207703_10020322
1405 Ga0207703_10039495
1406 Ga0207703_10048671
1407 Ga0207703_10073019
1408 Ga0207703_10087445
1409 Ga0207703_10144348
1410 Ga0207703_10157819
1411 Ga0207678_10025453
1412 Ga0207678_10031262
1413 Ga0207708_10004348
1414 Ga0207708_10014366
1415 Ga0207708_10040036
1416 Ga0207708_10377950
1417 Ga0207708_10526425
1418 Ga0207702_10291442
1419 Ga0207641_10002814
1420 Ga0207641_10168570
1421 Ga0207641_10419856
1422 Ga0207641_10481156
1423 Ga0207641_10520940
1424 Ga0207641_10531897
1425 Ga0207648_10005564
1426 Ga0207648_10012281
1427 Ga0207648_10018662
1428 Ga0207648_10103255
1429 Ga0207648_10128235
1430 Ga0207648_10672933
1431 Ga0207676_10012766
1432 Ga0207676_10070775
1433 Ga0207676_10162939
1434 Ga0207676_10769551
1435 Ga0207674_10056883
1436 Ga0207674_10444445
1437 Ga0207674_10466575
1438 Ga0207675_100000257
1439 Ga0207675_100002749
1440 Ga0207675_100009450
1441 Ga0207675_100012673
1442 Ga0207675_100086538
1443 Ga0207675_100242373
1444 Ga0207675_100270369
1445 Ga0207675_101026488
1446 Ga0207683_10002874
1447 Ga0207683_10105824
1448 Ga0207683_10263223
1449 Ga0207683_10273583
1450 Ga0207698_10025537
1451 Ga0209179_1006039
1452 Ga0209588_1013023
1453 Ga0209813_10149968
1454 Ga0207428_10002766
1455 Ga0207428_10067565
1456 Ga0207428_10283265
1457 Ga0268266_10035070
1458 Ga0268266_11107561
1459 Ga0268265_10004633
1460 Ga0268265_10009558
1461 Ga0268265_10025520
1462 Ga0268265_10044483
1463 Ga0268265_10220461
1464 Ga0268265_10294029
1465 Ga0268265_10409076
1466 Ga0268264_10014663
1467 Ga0268264_10030057
1468 Ga0268264_10113684
1469 Ga0268264_10269244
1470 Ga0268264_10424659
1471 Ga0268264_10772982
1472 Ga0268264_10873900
1473 Ga0307408_100766019
1474 Ga0307405_10064708
1475 Ga0307407_10126608
1476 Ga0307412_10111227
1477 Ga0307409_100041547
1478 Ga0307416_100079637
1479 Ga0307416_100233989
1480 Ga0307416_100269631
1481 Ga0307416_101362761
1482 Ga0307414_10168336
1483 Ga0307411_10616942
1484 Ga0307411_10977018
1485 Ga0307415_100058934
1486 Ga0307415_100078168
1487 Ga0307415_100270787
1488 Ga0373948_0002873
1489 Ga0373948_0063669
1490 Ga0373959_0003650
1491 Ga0373928_0003355
1492 Ga0373929_0014648
1493 Ga0373940_0000575
1494 Ga0373949_0000894
1495 Ga0373949_0008041
1496 Ga0373951_0000173
1497 Ga0373951_0028140
1498 Ga0373952_0003299
1499 Ga0373923_0039530
1500 Ga0373932_0000876
1501 Ga0373939_0000544
1502 Ga0373941_0000084
1503 Ga0373941_0076293
1504 Ga0373945_0043391
1505 Ga0373953_0038680
1506 Ga0373953_0135098
1507 Ga0373954_0101854
1508 Ga0373956_0008525
1509 Ga0373956_0083740
1510 Ga0373960_0000891
1511 Ga0373960_0206942
1512 Ga0373955_0006337
1513 Ga0373955_0076574
1514 Ga0373942_0021770
1515 Ga0373961_0002058
1516 Ga0373961_0047683
1517 Ga0373924_0151435
1518 Ga0373931_0000164
1519 Ga0373931_0005646
1520 Ga0373935_0091041
1521 Ga0373935_0293921
1522 Ga0373927_0015048
1523 Ga0373927_0035945
1524 Ga0373927_0066322
1525 Ga0373927_0263838
1526 Ga0373927_0427216
1527 Ga0373933_0004464
1528 Ga0373933_0605675
1529 Ga0373947_0173825
1530 Ga0373947_0176252
1531 Ga0373947_0309071
1532 Ga0373937_0002979
1533 Ga0373937_0007450
1534 Ga0373937_0014835
1535 Ga0373937_0025421
1536 Ga0373937_0075532
1537 Ga0373925_0082346
1538 Ga0373925_0104144
1539 Ga0373925_0123213
1540 Ga0373925_0529595
1541 Ga0436364_0015492
1542 Ga0436364_1448381
1543 Ga0436361_0811267
1544 Ga0436362_0519100
1545 Ga0439439_0034118
1546 Ga0439450_034889
1547 Ga0439440_0005748
1548 Ga0439440_0047009
1549 Ga0451576_0083562
1550 Ga0451576_0170633
1551 Ga0451576_0250584
1552 Ga0451576_0497789
1553 Ga0451576_0727826
1554 Ga0466967_1336007
1555 Ga0495592_0009093
1556 Ga0495629_0006090
1557 Ga0495629_0011515
1558 Ga0495651_0012522
1559 Ga0495653_0004302
1560 Ga0495653_0475131
1561 Ga0495580_0018477
1562 Ga0495580_0261618
1563 Ga0495662_0059030
1564 Ga0495664_0024427
1565 Ga0495584_0332409
1566 Ga0495594_0031042
1567 Ga0495608_0023570
1568 Ga0495618_0004754
1569 Ga0495620_0141200
1570 Ga0495628_0038970
1571 Ga0495628_0330943
1572 Ga0495628_0524144
1573 Ga0495630_0026225
1574 Ga0495630_0237141
1575 Ga0495630_0254812
1576 Ga0495643_0003398
1577 Ga0495644_0090047
1578 Ga0495644_0211558
1579 Ga0495663_0059730
1580 Ga0495642_0028295
1581 Ga0495642_0062784
1582 Ga0495652_0004766
1583 Ga0495640_0011679
1584 Ga0495587_0000355
1585 Ga0495609_0077464
1586 Ga0495621_0044122
1587 Ga0495645_0059985
1588 Ga0495645_0068240
1589 Ga0495645_0525994
1590 Ga0495667_0003570
1591 Ga0495634_0009496
1592 Ga0495635_0007990
1593 Ga0495635_0370007
1594 Ga0495659_0005200
1595 Ga0495659_0017586
1596 Ga0495659_0064835
1597 Ga0495588_0009782
1598 Ga0495657_0007878
1599 Ga0495657_0142046
1600 Ga0495599_0003059
1601 Ga0495623_0006935
1602 Ga0495646_0010941
1603 Ga0495647_0124027
1604 Ga0495658_0028749
1605 Ga0495658_0095512
1606 Ga0495658_0106255
1607 Ga0495658_0435134
1608 Ga0495669_0005561
1609 Ga0495669_0155191
1610 Ga0495669_0173848
1611 Ga0495613_0038050
1612 Ga0495624_0073604
1613 Ga0495670_0026373
1614 Ga0495671_0270127
1615 Ga0495600_0002574
1616 Ga0495581_0168885
1617 Ga0495604_0015454
1618 Ga0495636_0018804
1619 Ga0495674_0003169
1620 Ga0495676_0079619
1621 Ga0495680_0016803
1622 Ga0495677_0031076
1623 Ga0495685_065014
1624 Ga0495684_0004500
1625 Ga0495593_0023997
1626 Ga0495593_0161563
1627 Ga0495602_0000766
1628 Ga0495602_0254135
1629 Ga0496102_0555088
1630 Ga0496102_1098433
1631 Ga0496104_0135278
1632 Ga0496104_0221839
1633 Ga0496104_0389996
1634 Ga0496106_0111786
1635 Ga0496106_0285387
1636 Ga0496106_0919007
1637 Ga0496107_0061017
1638 Ga0496108_0107002
1639 Ga0496108_0365667
1640 Ga0496109_0119942
1641 Ga0496110_0072703
1642 Ga0496110_0184548
1643 Ga0496110_0549049
1644 Ga0496111_0171170
1645 Ga0496111_0828476
1646 Ga0496112_0073338
1647 Ga0496112_0093501
1648 Ga0496112_0175085
1649 Ga0496113_0346340
1650 Ga0496114_0105729
1651 Ga0496114_0120641
1652 Ga0496114_0127351
1653 Ga0496114_0156231
1654 Ga0496115_0077670
1655 Ga0496115_0102749
1656 Ga0501036_0101308
1657 Ga0501036_0615694
1658 Ga0501039_0060537
1659 Ga0501040_0093858
1660 Ga0501041_0139212
1661 Ga0501043_0142304
1662 Ga0501046_0013938
1663 Ga0501047_0824643
1664 Ga0501048_0103774
1665 Ga0501067_0039257
1666 Ga0501072_0506630
1667 Ga0501074_0118255
1668 Ga0501074_0321787
1669 Ga0501075_0046909
1670 Ga0501075_0182215
1671 Ga0501075_0647335
1672 Ga0501076_0023251
1673 Ga0501076_0074240
1674 Ga0501077_0045514
1675 Ga0501225_0025431
1676 Ga0501079_0085856
1677 Ga0501081_0028899
1678 Ga0501035_0228372
1679 Ga0501045_0046117
1680 Ga0501045_0433747
1681 nmdc:mga06z11_498046_c1
1682 nmdc:mga05p37_101965_c1
1683 nmdc:mga05p37_116589_c1
1684 nmdc:mga05p37_249278_c1
1685 nmdc:mga05p37_295711_c1
1686 nmdc:mga05p37_30783_c1
1687 nmdc:mga05p37_3175_c1
1688 nmdc:mga05p37_44274_c1
1689 nmdc:mga05p37_47653_c1
1690 nmdc:mga05p37_54470_c1
1691 nmdc:mga05p37_590614_c1
1692 nmdc:mga05p37_763601_c1
1693 nmdc:mga05p37_88462_c1
1694 nmdc:mga09592_11283_c1
1695 nmdc:mga09592_130766_c1
1696 nmdc:mga09592_529140_c1
1697 nmdc:mga09592_71839_c1
1698 nmdc:mga09592_77257_c1
1699 nmdc:mga0qj67_77477_c1
1700 nmdc:mga0qj67_97836_c1
1701 nmdc:mga06r32_151878_c1
1702 nmdc:mga06r32_170062_c1
1703 nmdc:mga06r32_641440_c1
1704 nmdc:mga08y16_265877_c1
1705 nmdc:mga08y16_37602_c1
1706 nmdc:mga08y16_389921_c1
1707 nmdc:mga08y16_506624_c1
1708 nmdc:mga08y16_57548_c1
1709 nmdc:mga0n895_120342_c1
1710 nmdc:mga0n895_14062_c1
1711 nmdc:mga0n895_35918_c1
1712 nmdc:mga0n895_373057_c1
1713 nmdc:mga0n895_49874_c1
1714 nmdc:mga0rr50_1001554_c1
1715 nmdc:mga0rr50_1236540_c1
1716 nmdc:mga0rr50_14_c1
1717 nmdc:mga0rr50_19061_c1
1718 nmdc:mga0rr50_237013_c1
1719 nmdc:mga0rr50_36934_c1
1720 nmdc:mga0rr50_5083_c1
1721 nmdc:mga0rr50_604899_c1
1722 nmdc:mga0rr50_88422_c1
1723 nmdc:mga08x19_126638_c1
1724 nmdc:mga08x19_155389_c1
1725 nmdc:mga08x19_208959_c1
1726 nmdc:mga08x19_235_c1
1727 nmdc:mga08x19_252442_c1
1728 nmdc:mga08x19_331103_c1
1729 nmdc:mga08x19_539384_c1
1730 nmdc:mga0a205_181223_c1
1731 nmdc:mga0a205_54352_c1
1732 nmdc:mga0a205_593495_c1
1733 nmdc:mga0a205_60439_c1
1734 Ga0495601_0033163
1735 Ga0495601_0198668
1736 Ga0495601_0213083
1737 Ga0495612_0004409
1738 Ga0495595_0000398
1739 Ga0495595_0286969
1740 Ga0495619_0000526
1741 Ga0495619_0009552
1742 Ga0495619_0031963
1743 Ga0495619_0037227
1744 Ga0501082_0058271
1745 Ga0501082_0152753
1746 Ga0530510_0001566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fli-assembly1.cif.gz_K enzyme-substrate complex of ni-quercetinase 0.8387 68 178
5uqp-assembly1.cif.gz_B the crystal structure of cupin protein from rhodococcus jostii rha1 0.8131 61 174
5cu1-assembly1.cif.gz_A crystal structure of dmsp lyase dddq from ruegeria pomeroyi dss-3 0.8053 68 184
4la3-assembly2.cif.gz_B crystal structure of dimethylsulphoniopropionate (dmsp) lyase dddq y131a in complex with dmsp 0.8013 68 180
1gqh-assembly1.cif.gz_B quercetin 2,3-dioxygenase in complex with the inhibitor kojic acid 0.7979 64 176
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8117 68 176 2.60.120.10
5cu1A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8053 68 184 2.60.120.10
5jspB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7986 68 180 2.60.120.10
af_P24174_373_472_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7934 60 177 2.60.120.10
4b29A00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.7685 68 184 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A2V8EEL4-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9786 43 200
AF-A0A2V9E4L6-F1-model_v4 Uncharacterized protein 0.9778 17 198
AF-A0A382GSZ5-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.976 54 194
AF-A0A6N9CFR8-F1-model_v4 deleted 0.9669 17 194
AF-A0A2V8EEL4-F1-model_v4 AraC-type arabinose-binding/dimerisation domain-containing protein 0.9605 43 200

Map