F484199

General Info

Members Datasets Scaffolds Average Seq Length
871 457 725 201

Family's Representative Sequence

Representative Sequence 3300046513|Ga0495616_0001804|Ga0495616_0001804_8504_9103
Length 199
Sequence MKLYYAPQACSLAPHIVLRELQLPFVLIRVDNRSKRTTSGEDFLAINPKGYVAALQLENGEVLTEGPAILQYLADLQPQSGLAPAPAPGSFERVRLQEWLNFVSSEIHGGLGALFDERMPAEVIKEKLFKRFAVLVAVLEQQDYLLPSGFSVADALLFVVLRWAGLFGIELERWPALARFQDRIGKRPTVIAALTAEAA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231006 Pseudomonas sp. GM17 Isolate Nodule
7 2511231007 Pseudomonas sp. GM18 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
12 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
13 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
14 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
15 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
16 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
17 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
18 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
19 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
20 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
21 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
22 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
23 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
24 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
25 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
26 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
27 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
28 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
29 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
30 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
31 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
32 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
33 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
34 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
35 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
36 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
37 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
38 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
39 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
40 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
41 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
42 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
43 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
44 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
45 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
46 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
47 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
48 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
49 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
50 2636415599 Klebsiella variicola DX120E Isolate Unclassified
51 2643221556 Massilia sp. Root1485 Isolate Unclassified
52 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
53 2643221684 Massilia sp. Root133 Isolate Unclassified
54 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
55 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
56 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
57 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
58 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
59 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
60 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
61 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
62 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
63 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
64 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
65 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
66 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
67 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
68 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
69 2734482264 Dyella sp. AD052 Isolate Unclassified
70 2738541307 Variovorax sp. GV008 Isolate Unclassified
71 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
72 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
73 2751185917 Enterobacter sp. HK169 Isolate Unclassified
74 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
75 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
76 2773857670 Pseudomonas sp. 478 Isolate Unclassified
77 2773857673 Pseudomonas sp. 443 Isolate Unclassified
78 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
79 2775507074 Klebsiella sp. D5A Isolate Unclassified
80 2784132063 Pseudomonas sp. 424 Isolate Unclassified
81 2784132072 Pseudomonas sp. 460 Isolate Unclassified
82 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
83 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
84 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
85 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
86 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
87 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
88 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
89 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
90 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
91 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
92 2818991436 Collimonas arenae 515 Isolate Unclassified
93 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
94 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
95 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
96 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
97 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
98 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
99 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
100 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
101 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
102 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
103 2858950400 Achromobacter sp. K91 Isolate Unclassified
104 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
105 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
106 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
107 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
108 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
109 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
110 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
111 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
112 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
113 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
114 2919150387 Rahnella aceris 1817 Isolate Unclassified
115 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
116 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
117 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
118 2927143783 Rahnella sp. 2050 Isolate Unclassified
119 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
120 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
121 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
122 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
123 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
124 2937539931 Pantoea sp. LS15 Isolate Unclassified
125 2941479691
126 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
127 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
128 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
129 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
130 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
131 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
132 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
133 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
134 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
135 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
136 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
137 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
138 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
139 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
140 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
141 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
142 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
143 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
144 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
145 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
146 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
147 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
148 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
149 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
150 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
151 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
152 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
153 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
155 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
156 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
157 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
161 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
162 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
163 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
164 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
165 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
166 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
167 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
168 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
169 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
170 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
171 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
172 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
173 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
174 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
175 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
176 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
177 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
178 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
179 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
180 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
181 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
182 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
183 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
184 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
185 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
186 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
187 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
188 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
189 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
190 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
191 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
192 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
193 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
194 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
195 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
196 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
197 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
198 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
199 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
200 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
201 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
202 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
203 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
204 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
205 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
206 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
207 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
208 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
209 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
210 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
211 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
212 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
213 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
214 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
215 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
216 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
217 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
218 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
219 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
220 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
221 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
222 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
223 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
224 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
225 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
226 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
227 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
228 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
229 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
230 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
231 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
232 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
233 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
234 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
235 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
237 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
238 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
240 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
241 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
243 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
244 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
263 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
276 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
278 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
280 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
282 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
283 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
284 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
285 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
286 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
287 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
288 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
289 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
290 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
291 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
292 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
293 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
294 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
295 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
296 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
297 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
298 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
299 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
300 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
301 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
302 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
303 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
304 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
305 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
306 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
307 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
308 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
309 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
310 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
311 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
312 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
313 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
314 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
315 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
316 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
317 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
318 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
319 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
320 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
321 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
322 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
323 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
324 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
325 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
326 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
327 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
328 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
329 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
330 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
331 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
332 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
333 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
334 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
335 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
336 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
337 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
338 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
339 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
340 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
341 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
342 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
343 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
344 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
345 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
346 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
347 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
348 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
349 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
350 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
351 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
352 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
353 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
354 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
355 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
356 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
357 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
358 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
359 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
360 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
361 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
362 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
363 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
364 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
365 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
366 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
367 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
368 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
369 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
370 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
371 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
372 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
373 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
374 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
375 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
376 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
377 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
378 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
379 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
380 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
381 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
382 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
383 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
386 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
387 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
388 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
389 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
390 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
391 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
392 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
393 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
394 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
395 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
396 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
397 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
398 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
402 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
403 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
404 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
405 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
406 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
407 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
408 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
409 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
410 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
411 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
412 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
413 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
414 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
416 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
417 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
418 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
421 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
422 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
423 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
424 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
425 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
426 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
427 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
428 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
429 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
430 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
431 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
432 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
433 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
434 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
435 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
436 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
437 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
440 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
441 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
442 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
443 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
444 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
445 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
446 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
447 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
448 640753048 Serratia proteamaculans 568 Isolate Endosphere
449 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
450 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
451 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
452 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
453 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
454 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
455 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
456 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
457 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.24
Metatranscriptomes 0
Isolates 16.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 8.27
Nodule 1.26
Rhizoplane 7.81
Rhizosphere 62.23
Stem 0
Stem Tuber 0
Unclassified 20.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1351 2124908027 Bacteria 1291
2 MRS2a_Contig_27077 2124908027 Bacteria 761
3 MRS2a_Contig_339 2124908027 Bacteria 17793
4 SwRhRL2b_contig_783059 2162886007 Bacteria 3887
5 JGI24739J22299_10097095 3300001989 Bacteria 892
6 JGI25162J39368_1000038 3300002737 Bacteria 179049
7 JGI25162J39368_1000092 3300002737 Bacteria 100905
8 JGI25162J39368_1000231 3300002737 Bacteria 56968
9 JGI25162J39368_1002383 3300002737 Bacteria 7411
10 JGI25163J39215_1000013 3300002771 Bacteria 86331
11 JGI25163J39215_1000504 3300002771 Bacteria 11627
12 JGI25164J39214_1000071 3300002772 Bacteria 100905
13 JGI25164J39214_1000179 3300002772 Bacteria 56968
14 JGI25151J46595_10000559 3300003187 Bacteria 33736
15 JGI25151J46595_10000719 3300003187 Bacteria 27557
16 JGI25165J46597_1000045 3300003214 Bacteria 257539
17 JGI25165J46597_1000327 3300003214 Bacteria 56968
18 JGI25153J46596_10039030 3300003215 Bacteria 1488
19 rootH2_10110653 3300003320 Bacteria 1386
20 rootL2_10018643 3300003322 Bacteria 2411
21 rootL2_10155604 3300003322 Bacteria 4673
22 JGI25160J50197_1004440 3300003354 Bacteria 6068
23 Ga0055538_1000022 3300003751 Bacteria 257539
24 Ga0055538_1000064 3300003751 Bacteria 100905
25 Ga0055539_1000028 3300003752 Bacteria 257539
26 Ga0055539_1000098 3300003752 Bacteria 100905
27 Ga0055533_1000036 3300003756 Bacteria 257539
28 Ga0055533_1000108 3300003756 Bacteria 100905
29 Ga0055525_1000071 3300003759 Bacteria 182624
30 Ga0055525_1000141 3300003759 Bacteria 100905
31 Ga0055525_1007489 3300003759 Bacteria 921
32 Ga0055530_10000105 3300003791 Bacteria 71978
33 Ga0055530_10000256 3300003791 Bacteria 47915
34 Ga0055540_1001478 3300003792 Bacteria 13987
35 Ga0055541_1000037 3300003841 Bacteria 182624
36 Ga0055541_1000065 3300003841 Bacteria 100905
37 Ga0058692_1000135 3300003856 Bacteria 46715
38 Ga0058692_1014160 3300003856 Bacteria 1835
39 Ga0065703_1021008 3300005272 Bacteria 1395
40 Ga0065714_10000495 3300005288 Bacteria 4231
41 Ga0065714_10069538 3300005288 Bacteria 4188
42 Ga0065704_10000285 3300005289 Bacteria 54664
43 Ga0065704_10004692 3300005289 Bacteria 3244
44 Ga0065712_10006415 3300005290 Bacteria 3365
45 Ga0065715_10028109 3300005293 Bacteria 2147
46 Ga0070658_10190676 3300005327 Bacteria 1727
47 Ga0070676_10097935 3300005328 Bacteria 1807
48 Ga0070690_100724861 3300005330 Bacteria 765
49 Ga0070670_100000161 3300005331 Bacteria 60718
50 Ga0070670_100000221 3300005331 Bacteria 52485
51 Ga0070670_100325150 3300005331 Bacteria 1348
52 Ga0068869_100466195 3300005334 Bacteria 1049
53 Ga0070666_10248026 3300005335 Bacteria 1260
54 Ga0068868_100355727 3300005338 Bacteria 1255
55 Ga0070661_100000640 3300005344 Bacteria 25992
56 Ga0070668_100034128 3300005347 Bacteria 3877
57 Ga0070669_100000299 3300005353 Bacteria 38931
58 Ga0070675_100216966 3300005354 Bacteria 1665
59 Ga0070673_100177993 3300005364 Bacteria 1819
60 Ga0070688_100428084 3300005365 Bacteria 985
61 Ga0070667_100321849 3300005367 Bacteria 1395
62 Ga0070662_100001026 3300005457 Bacteria 17077
63 Ga0070662_100098528 3300005457 Bacteria 2208
64 Ga0070662_100207068 3300005457 Bacteria 1559
65 Ga0070684_100414485 3300005535 Bacteria 1243
66 Ga0068853_100033799 3300005539 Bacteria 4338
67 Ga0068853_100472424 3300005539 Bacteria 1181
68 Ga0070672_100045412 3300005543 Bacteria 3398
69 Ga0070693_100096092 3300005547 Bacteria 1795
70 Ga0070665_100039980 3300005548 Bacteria 4715
71 Ga0068855_100059616 3300005563 Bacteria 4465
72 Ga0070664_100000489 3300005564 Bacteria 29977
73 Ga0070664_100146767 3300005564 Bacteria 2081
74 Ga0068857_100667298 3300005577 Bacteria 986
75 Ga0068854_100008186 3300005578 Bacteria 6707
76 Ga0068856_100057337 3300005614 Bacteria 3845
77 Ga0068856_100192049 3300005614 Bacteria 2056
78 Ga0068859_100556123 3300005617 Bacteria 1242
79 Ga0068851_10000036 3300005834 Bacteria 105179
80 Ga0068870_10402166 3300005840 Bacteria 891
81 Ga0068860_100551405 3300005843 Bacteria 1155
82 Ga0081540_1049520 3300005983 Bacteria 2095
83 Ga0070717_10085800 3300006028 Bacteria 2650
84 Ga0075364_10009886 3300006051 Bacteria 5739
85 Ga0075364_10062388 3300006051 Bacteria 2445
86 Ga0075432_10000389 3300006058 Bacteria 12729
87 Ga0075432_10084063 3300006058 Bacteria 1157
88 Ga0075369_10028270 3300006186 Bacteria 2350
89 Ga0068865_100017011 3300006881 Bacteria 4668
90 Ga0097620_100556117 3300006931 Bacteria 1242
91 Ga0079104_1005087 3300006946 Bacteria 5358
92 Ga0079104_1057562 3300006946 Bacteria 847
93 Ga0099794_10000054 3300007265 Bacteria 43801
94 Ga0105251_10000109 3300009011 Bacteria 81396
95 Ga0105251_10000632 3300009011 Bacteria 32332
96 Ga0105251_10002446 3300009011 Bacteria 14593
97 Ga0105251_10002477 3300009011 Bacteria 14465
98 Ga0105251_10004209 3300009011 Bacteria 9956
99 Ga0105251_10005496 3300009011 Bacteria 8258
100 Ga0105251_10007551 3300009011 Bacteria 6676
101 Ga0105251_10112568 3300009011 Bacteria 1239
102 Ga0105251_10138322 3300009011 Bacteria 1102
103 Ga0105251_10232389 3300009011 Bacteria 830
104 Ga0105244_10000690 3300009036 Bacteria 29348
105 Ga0105244_10001260 3300009036 Bacteria 20753
106 Ga0105244_10001623 3300009036 Bacteria 17821
107 Ga0105244_10002664 3300009036 Bacteria 13380
108 Ga0105244_10006790 3300009036 Bacteria 7362
109 Ga0105244_10007221 3300009036 Bacteria 7084
110 Ga0105244_10036931 3300009036 Bacteria 2556
111 Ga0105244_10051389 3300009036 Bacteria 2100
112 Ga0105244_10052630 3300009036 Bacteria 2072
113 Ga0105244_10161982 3300009036 Bacteria 1068
114 Ga0105250_10000980 3300009092 Bacteria 16633
115 Ga0105250_10001610 3300009092 Bacteria 12083
116 Ga0105250_10003840 3300009092 Bacteria 7046
117 Ga0105250_10020674 3300009092 Bacteria 2659
118 Ga0105240_10021162 3300009093 Bacteria 8659
119 Ga0105240_10040554 3300009093 Bacteria 5953
120 Ga0105240_10076396 3300009093 Bacteria 4129
121 Ga0105247_10000025 3300009101 Bacteria 208459
122 Ga0105243_10006244 3300009148 Bacteria 9208
123 Ga0105243_10135564 3300009148 Bacteria 2094
124 Ga0105241_10000005 3300009174 Bacteria 384203
125 Ga0105242_10000238 3300009176 Bacteria 43389
126 Ga0105242_10566113 3300009176 Bacteria 1092
127 Ga0105239_10001431 3300010375 Bacteria 31823
128 Ga0105239_10770933 3300010375 Bacteria 1101
129 Ga0105246_10210134 3300011119 Bacteria 1518
130 Ga0105246_10684597 3300011119 Bacteria 897
131 Ga0157373_10004421 3300013100 Bacteria 10589
132 Ga0157373_10005271 3300013100 Bacteria 9710
133 Ga0157373_10005861 3300013100 Bacteria 9191
134 Ga0157373_10007988 3300013100 Bacteria 7867
135 Ga0157373_10179482 3300013100 Bacteria 1490
136 Ga0157371_10003359 3300013102 Bacteria 14572
137 Ga0157371_10259645 3300013102 Bacteria 1252
138 Ga0157371_10264236 3300013102 Bacteria 1241
139 Ga0157370_10024387 3300013104 Bacteria 5991
140 Ga0157370_10060151 3300013104 Bacteria 3608
141 Ga0157370_10070146 3300013104 Bacteria 3309
142 Ga0157370_10100182 3300013104 Bacteria 2715
143 Ga0157370_10204410 3300013104 Bacteria 1831
144 Ga0157370_10238850 3300013104 Bacteria 1681
145 Ga0157370_10250296 3300013104 Bacteria 1639
146 Ga0157370_10272285 3300013104 Bacteria 1564
147 Ga0157370_10451491 3300013104 Bacteria 1182
148 Ga0157370_10981132 3300013104 Bacteria 765
149 Ga0157369_10000646 3300013105 Bacteria 45033
150 Ga0157369_10005544 3300013105 Bacteria 14663
151 Ga0157369_10007554 3300013105 Bacteria 12507
152 Ga0157369_10009657 3300013105 Bacteria 11032
153 Ga0157369_10064490 3300013105 Bacteria 3945
154 Ga0157369_10093023 3300013105 Bacteria 3218
155 Ga0157369_10249118 3300013105 Bacteria 1854
156 Ga0157374_10035668 3300013296 Bacteria 4551
157 Ga0157372_10003765 3300013307 Bacteria 16290
158 Ga0157372_10008148 3300013307 Bacteria 11138
159 Ga0157372_10141186 3300013307 Bacteria 2775
160 Ga0157372_10205989 3300013307 Bacteria 2279
161 Ga0157372_10664017 3300013307 Bacteria 1214
162 Ga0157375_10000979 3300013308 Bacteria 24702
163 Ga0157375_10011925 3300013308 Bacteria 7690
164 Ga0157375_10186611 3300013308 Bacteria 2227
165 Ga0163163_10829545 3300014325 Bacteria 988
166 Ga0182008_10000753 3300014497 Bacteria 22750
167 Ga0182008_10001764 3300014497 Bacteria 14173
168 Ga0182008_10002169 3300014497 Bacteria 12486
169 Ga0182008_10002354 3300014497 Bacteria 11896
170 Ga0182008_10016078 3300014497 Bacteria 3893
171 Ga0157376_10035314 3300014969 Bacteria 4043
172 Ga0182006_1002148 3300015261 Bacteria 10942
173 Ga0182006_1007173 3300015261 Bacteria 5123
174 Ga0182006_1007195 3300015261 Bacteria 5112
175 Ga0182007_10002918 3300015262 Bacteria 8307
176 Ga0182007_10003477 3300015262 Bacteria 7415
177 Ga0182005_1000928 3300015265 Bacteria 12791
178 Ga0182005_1002531 3300015265 Bacteria 6489
179 Ga0183366_1001 3300015679 Bacteria 2743932
180 Ga0183370_1001 3300015680 Bacteria 2743932
181 Ga0183369_1001 3300015685 Bacteria 2743932
182 Ga0183368_1001 3300015687 Bacteria 2743932
183 Ga0163161_10000001 3300017792 Bacteria 2041488
184 Ga0163161_10037352 3300017792 Bacteria 3482
185 Ga0163161_10057629 3300017792 Bacteria 2822
186 Ga0163161_10136388 3300017792 Bacteria 1855
187 Ga0163161_10365862 3300017792 Bacteria 1149
188 Ga0209760_100189 3300025207 Bacteria 30616
189 Ga0209760_100257 3300025207 Bacteria 21351
190 Ga0209760_102005 3300025207 Bacteria 1981
191 Ga0209784_100001 3300025224 Bacteria 3600592
192 Ga0209784_100036 3300025224 Bacteria 263689
193 Ga0209566_100001 3300025225 Bacteria 3600765
194 Ga0209566_100044 3300025225 Bacteria 263689
195 Ga0209674_100002 3300025226 Bacteria 3600592
196 Ga0209674_100065 3300025226 Bacteria 263689
197 Ga0209563_100002 3300025230 Bacteria 2045675
198 Ga0209563_100063 3300025230 Bacteria 263689
199 Ga0209563_101321 3300025230 Bacteria 6766
200 Ga0207427_100008 3300025231 Bacteria 740731
201 Ga0207427_100020 3300025231 Bacteria 507515
202 Ga0207427_100664 3300025231 Bacteria 16489
203 Ga0209437_100001 3300025233 Bacteria 2045675
204 Ga0209437_100014 3300025233 Bacteria 740714
205 Ga0209437_100032 3300025233 Bacteria 520075
206 Ga0209437_100082 3300025233 Bacteria 263689
207 Ga0209677_100002 3300025253 Bacteria 2045675
208 Ga0209677_100038 3300025253 Bacteria 263689
209 Ga0209233_1000008 3300025261 Bacteria 1356712
210 Ga0209233_1000109 3300025261 Bacteria 263689
211 Ga0209130_1000436 3300025284 Bacteria 44714
212 Ga0209676_1000006 3300025292 Bacteria 1039588
213 Ga0209025_1000099 3300025294 Bacteria 231353
214 Ga0209758_1001714 3300025297 Bacteria 24545
215 Ga0209050_1000070 3300025298 Bacteria 296366
216 Ga0207426_1000065 3300025302 Bacteria 353625
217 Ga0209051_1000093 3300025303 Bacteria 169092
218 Ga0207697_10133950 3300025315 Bacteria 1072
219 Ga0207656_10000021 3300025321 Bacteria 113329
220 Ga0207696_1000001 3300025711 Bacteria 2579611
221 Ga0207696_1000073 3300025711 Bacteria 215388
222 Ga0207696_1002951 3300025711 Bacteria 7969
223 Ga0207696_1026790 3300025711 Bacteria 1781
224 Ga0207655_1000021 3300025728 Bacteria 518596
225 Ga0207655_1000060 3300025728 Bacteria 260572
226 Ga0207655_1000595 3300025728 Bacteria 44227
227 Ga0207655_1000679 3300025728 Bacteria 39682
228 Ga0207655_1001849 3300025728 Bacteria 18288
229 Ga0207655_1001923 3300025728 Bacteria 17778
230 Ga0207655_1002280 3300025728 Bacteria 15795
231 Ga0207655_1002998 3300025728 Bacteria 12932
232 Ga0207655_1010672 3300025728 Bacteria 5553
233 Ga0207655_1019953 3300025728 Bacteria 3474
234 Ga0207655_1023432 3300025728 Bacteria 3062
235 Ga0207713_1000003 3300025735 Bacteria 860698
236 Ga0207713_1000011 3300025735 Bacteria 507224
237 Ga0207713_1000092 3300025735 Bacteria 148309
238 Ga0207713_1000142 3300025735 Bacteria 107313
239 Ga0207713_1000671 3300025735 Bacteria 32337
240 Ga0207713_1002192 3300025735 Bacteria 14482
241 Ga0207713_1010307 3300025735 Bacteria 5185
242 Ga0207713_1014047 3300025735 Bacteria 4182
243 Ga0207713_1014492 3300025735 Bacteria 4092
244 Ga0207713_1014499 3300025735 Bacteria 4091
245 Ga0207713_1015037 3300025735 Bacteria 3988
246 Ga0207713_1017844 3300025735 Bacteria 3536
247 Ga0207713_1033314 3300025735 Bacteria 2252
248 Ga0207710_10000074 3300025900 Bacteria 147390
249 Ga0207645_10128755 3300025907 Bacteria 1647
250 Ga0207643_10277292 3300025908 Bacteria 1039
251 Ga0207705_10265352 3300025909 Bacteria 1312
252 Ga0207654_10000007 3300025911 Bacteria 384211
253 Ga0207695_10065987 3300025913 Bacteria 3719
254 Ga0207671_10000263 3300025914 Bacteria 78721
255 Ga0207649_10000288 3300025920 Bacteria 39325
256 Ga0207681_10001287 3300025923 Bacteria 16196
257 Ga0207650_10000191 3300025925 Bacteria 71126
258 Ga0207650_10000194 3300025925 Bacteria 70396
259 Ga0207650_10259019 3300025925 Bacteria 1410
260 Ga0207650_10351626 3300025925 Bacteria 1212
261 Ga0207659_10096672 3300025926 Bacteria 2217
262 Ga0207706_10000493 3300025933 Bacteria 42224
263 Ga0207706_10012239 3300025933 Bacteria 7819
264 Ga0207706_10259521 3300025933 Bacteria 1517
265 Ga0207686_10011944 3300025934 Bacteria 4767
266 Ga0207709_10027877 3300025935 Bacteria 3259
267 Ga0207709_10193879 3300025935 Bacteria 1445
268 Ga0207704_10102824 3300025938 Bacteria 1909
269 Ga0207691_10028446 3300025940 Bacteria 5234
270 Ga0207689_10245149 3300025942 Bacteria 1481
271 Ga0207679_10000226 3300025945 Bacteria 44414
272 Ga0207679_10164444 3300025945 Bacteria 1820
273 Ga0207667_10071345 3300025949 Bacteria 3612
274 Ga0207640_10035714 3300025981 Bacteria 3113
275 Ga0207658_10546123 3300025986 Bacteria 1036
276 Ga0207639_10014082 3300026041 Bacteria 5614
277 Ga0207639_10699654 3300026041 Bacteria 940
278 Ga0207702_10001503 3300026078 Bacteria 23056
279 Ga0207702_10586018 3300026078 Bacteria 1093
280 Ga0207648_10332758 3300026089 Bacteria 1366
281 Ga0207674_10001166 3300026116 Bacteria 34125
282 Ga0207698_10194869 3300026142 Bacteria 1809
283 Ga0209281_1000027 3300027111 Bacteria 463409
284 Ga0209281_1001505 3300027111 Bacteria 13289
285 Ga0209371_1000001 3300027312 Bacteria 2771503
286 Ga0209371_1000471 3300027312 Bacteria 39614
287 Ga0209371_1017128 3300027312 Bacteria 1887
288 Ga0209282_1000093 3300027666 Bacteria 62036
289 Ga0209588_1000017 3300027671 Bacteria 97342
290 Ga0207428_10115187 3300027907 Bacteria 2065
291 Ga0207428_10134967 3300027907 Bacteria 1887
292 Ga0207428_10400031 3300027907 Bacteria 1006
293 Ga0268266_10206371 3300028379 Bacteria 1800
294 Ga0268264_11014095 3300028381 Bacteria 837
295 Ga0307517_10067934 3300028786 Bacteria 3255
296 Ga0268256_1000001 3300030500 Bacteria 2771065
297 Ga0268256_1000057 3300030500 Bacteria 229991
298 Ga0268256_1000398 3300030500 Bacteria 39614
299 Ga0268256_1019079 3300030500 Bacteria 1886
300 Ga0265328_10082971 3300031239 Bacteria 1182
301 Ga0307509_10151367 3300031507 Bacteria 2234
302 Ga0307516_10030996 3300031730 Bacteria 5393
303 Ga0307412_10005500 3300031911 Bacteria 7116
304 Ga0395899_0004173 3300037312 Bacteria 11345
305 Ga0395900_0013792 3300037418 Bacteria 8247
306 Ga0436365_1060686 3300039437 Bacteria 2203
307 Ga0439438_036176 3300041405 Bacteria 1295
308 Ga0439447_001156 3300041407 Bacteria 9608
309 Ga0439447_023131 3300041407 Bacteria 1621
310 Ga0439466_0000953 3300041411 Bacteria 11092
311 Ga0439466_0002095 3300041411 Bacteria 7815
312 Ga0439466_0078346 3300041411 Bacteria 1044
313 Ga0439451_000970 3300042009 Bacteria 5544
314 Ga0439451_046280 3300042009 Bacteria 871
315 Ga0439452_000126 3300042010 Bacteria 59072
316 Ga0439452_015882 3300042010 Bacteria 2055
317 Ga0439456_016540 3300042013 Bacteria 1542
318 Ga0439463_000047 3300042016 Bacteria 25575
319 Ga0450903_008180 3300042138 Bacteria 1713
320 Ga0450889_002580 3300042144 Bacteria 1797
321 Ga0439464_0016738 3300042439 Bacteria 1985
322 Ga0439460_0040485 3300042461 Bacteria 1365
323 Ga0450893_0003281 3300042532 Bacteria 2545
324 Ga0439440_0010531 3300042993 Bacteria 1935
325 Ga0466972_0006635 3300044658 Bacteria 5810
326 Ga0466989_0173783 3300044663 Bacteria 1286
327 Ga0466965_0093015 3300044683 Bacteria 1535
328 Ga0466961_0101325 3300044693 Bacteria 1814
329 Ga0466963_0275197 3300044694 Bacteria 1183
330 Ga0466964_0002273 3300044706 Bacteria 6814
331 Ga0453684_0421915 3300044712 Bacteria 1490
332 Ga0466968_0138534 3300044735 Bacteria 1111
333 Ga0466970_0190841 3300044765 Bacteria 1138
334 Ga0466960_0028244 3300044901 Bacteria 2566
335 Ga0495617_000028 3300046452 Bacteria 156686
336 Ga0495617_000408 3300046452 Bacteria 23783
337 Ga0495617_002126 3300046452 Bacteria 8151
338 Ga0495617_018492 3300046452 Bacteria 2356
339 Ga0495617_023670 3300046452 Bacteria 2074
340 Ga0495627_000018 3300046453 Bacteria 315125
341 Ga0495627_021434 3300046453 Bacteria 2142
342 Ga0495603_0399956 3300046455 Bacteria 787
343 Ga0495590_0000901 3300046457 Bacteria 13287
344 Ga0495590_0009751 3300046457 Bacteria 3637
345 Ga0495590_0035907 3300046457 Bacteria 1729
346 Ga0495591_003722 3300046458 Bacteria 7724
347 Ga0495591_112969 3300046458 Bacteria 666
348 Ga0495638_0012816 3300046460 Bacteria 5728
349 Ga0495638_0020181 3300046460 Bacteria 4403
350 Ga0495638_0197554 3300046460 Bacteria 1137
351 Ga0495651_0167561 3300046462 Bacteria 1567
352 Ga0495653_0006143 3300046463 Bacteria 9851
353 Ga0495650_0000043 3300046471 Bacteria 357197
354 Ga0495650_0002158 3300046471 Bacteria 16702
355 Ga0495650_0002618 3300046471 Bacteria 14099
356 Ga0495650_0004589 3300046471 Bacteria 9394
357 Ga0495650_0005525 3300046471 Bacteria 8171
358 Ga0495580_0244028 3300046472 Bacteria 1231
359 Ga0495605_0004566 3300046474 Bacteria 8108
360 Ga0495605_0022108 3300046474 Bacteria 3362
361 Ga0495605_0055809 3300046474 Bacteria 1906
362 Ga0495605_0069888 3300046474 Bacteria 1661
363 Ga0495639_0000633 3300046475 Bacteria 16236
364 Ga0495639_0013803 3300046475 Bacteria 3493
365 Ga0495584_0001297 3300046491 Bacteria 15204
366 Ga0495584_0001499 3300046491 Bacteria 13928
367 Ga0495584_0019448 3300046491 Bacteria 3449
368 Ga0495585_0022219 3300046492 Bacteria 3642
369 Ga0495585_0065684 3300046492 Bacteria 1987
370 Ga0495585_0306652 3300046492 Bacteria 779
371 Ga0495594_0016635 3300046499 Bacteria 3877
372 Ga0495594_0022850 3300046499 Bacteria 3348
373 Ga0495596_0006155 3300046500 Bacteria 5572
374 Ga0495607_0000411 3300046501 Bacteria 43380
375 Ga0495607_0002094 3300046501 Bacteria 16666
376 Ga0495607_0003292 3300046501 Bacteria 12409
377 Ga0495607_0007091 3300046501 Bacteria 7793
378 Ga0495607_0008369 3300046501 Bacteria 7075
379 Ga0495607_0333335 3300046501 Bacteria 704
380 Ga0495583_0003439 3300046506 Bacteria 12048
381 Ga0495583_0012803 3300046506 Bacteria 4721
382 Ga0495606_0002737 3300046507 Bacteria 19840
383 Ga0495606_0024403 3300046507 Bacteria 4357
384 Ga0495606_0043657 3300046507 Bacteria 2987
385 Ga0495606_0174073 3300046507 Bacteria 1246
386 Ga0495606_0212949 3300046507 Bacteria 1093
387 Ga0495610_0006447 3300046512 Bacteria 8072
388 Ga0495610_0012908 3300046512 Bacteria 4996
389 Ga0495610_0050457 3300046512 Bacteria 2031
390 Ga0495610_0108460 3300046512 Bacteria 1233
391 Ga0495610_0114039 3300046512 Bacteria 1193
392 Ga0495616_0001804 3300046513 Bacteria 14520
393 Ga0495616_0021597 3300046513 Bacteria 3481
394 Ga0495620_0000046 3300046515 Bacteria 108205
395 Ga0495628_0010287 3300046516 Bacteria 7950
396 Ga0495631_0000955 3300046518 Bacteria 18003
397 Ga0495631_0013652 3300046518 Bacteria 3937
398 Ga0495631_0179313 3300046518 Bacteria 908
399 Ga0495632_0001104 3300046519 Bacteria 23112
400 Ga0495632_0001282 3300046519 Bacteria 21263
401 Ga0495637_0006805 3300046520 Bacteria 5720
402 Ga0495637_0022452 3300046520 Bacteria 2877
403 Ga0495637_0024071 3300046520 Bacteria 2756
404 Ga0495637_0056948 3300046520 Bacteria 1616
405 Ga0495643_0014773 3300046522 Bacteria 4635
406 Ga0495644_0012139 3300046523 Bacteria 3311
407 Ga0495648_0015363 3300046524 Bacteria 5560
408 Ga0495648_0019072 3300046524 Bacteria 4836
409 Ga0495648_0021049 3300046524 Bacteria 4528
410 Ga0495648_0021473 3300046524 Bacteria 4468
411 Ga0495648_0038353 3300046524 Bacteria 3065
412 Ga0495648_0042482 3300046524 Bacteria 2859
413 Ga0495666_0033975 3300046526 Bacteria 2489
414 Ga0495666_0076812 3300046526 Bacteria 1583
415 Ga0495666_0102266 3300046526 Bacteria 1349
416 Ga0495666_0112604 3300046526 Bacteria 1277
417 Ga0495642_0006583 3300046528 Bacteria 4457
418 Ga0495642_0089350 3300046528 Bacteria 1303
419 Ga0495654_0002150 3300046530 Bacteria 12852
420 Ga0495654_0002557 3300046530 Bacteria 11635
421 Ga0495654_0006797 3300046530 Bacteria 6459
422 Ga0495654_0008007 3300046530 Bacteria 5868
423 Ga0495654_0044893 3300046530 Bacteria 2182
424 Ga0495654_0059304 3300046530 Bacteria 1843
425 Ga0495654_0061363 3300046530 Bacteria 1805
426 Ga0495587_0021564 3300046536 Bacteria 3972
427 Ga0495609_0007194 3300046538 Bacteria 5586
428 Ga0495609_0169133 3300046538 Bacteria 923
429 Ga0495597_0028178 3300046542 Bacteria 2571
430 Ga0495597_0130342 3300046542 Bacteria 1043
431 Ga0495645_0066398 3300046543 Bacteria 2607
432 Ga0495622_0001748 3300046557 Bacteria 10746
433 Ga0495622_0002064 3300046557 Bacteria 9813
434 Ga0495622_0024138 3300046557 Bacteria 2839
435 Ga0495633_0017145 3300046558 Bacteria 3712
436 Ga0495656_0000711 3300046615 Bacteria 10742
437 Ga0495656_0047448 3300046615 Bacteria 1821
438 Ga0495634_0001752 3300046642 Bacteria 18797
439 Ga0495634_0051353 3300046642 Bacteria 2766
440 Ga0495611_0012475 3300046648 Bacteria 3612
441 Ga0495625_0004335 3300046660 Bacteria 13472
442 Ga0495635_0003099 3300046663 Bacteria 11436
443 Ga0495659_0000475 3300046664 Bacteria 14814
444 Ga0495659_0036981 3300046664 Bacteria 1727
445 Ga0495659_0081086 3300046664 Bacteria 1231
446 Ga0495661_0001671 3300046665 Bacteria 18076
447 Ga0495661_0006087 3300046665 Bacteria 8502
448 Ga0495661_0030769 3300046665 Bacteria 3415
449 Ga0495661_0219835 3300046665 Bacteria 985
450 Ga0495661_0255204 3300046665 Bacteria 893
451 Ga0495588_0007357 3300046674 Bacteria 5005
452 Ga0495588_0014823 3300046674 Bacteria 3739
453 Ga0495588_0019900 3300046674 Bacteria 3293
454 Ga0495588_0079503 3300046674 Bacteria 1711
455 Ga0495588_0181880 3300046674 Bacteria 1111
456 Ga0495657_0021569 3300046675 Bacteria 4622
457 Ga0495599_0004928 3300046678 Bacteria 7931
458 Ga0495623_0039302 3300046679 Bacteria 3025
459 Ga0495646_0019001 3300046680 Bacteria 4352
460 Ga0495646_0086198 3300046680 Bacteria 1821
461 Ga0495669_0004695 3300046684 Bacteria 5666
462 Ga0495613_0047415 3300046689 Bacteria 3174
463 Ga0495613_0186496 3300046689 Bacteria 1467
464 Ga0495624_0001741 3300046690 Bacteria 16628
465 Ga0495624_0006025 3300046690 Bacteria 8645
466 Ga0495670_0003382 3300046691 Bacteria 7847
467 Ga0495670_0008205 3300046691 Bacteria 5135
468 Ga0495670_0252554 3300046691 Bacteria 940
469 Ga0495670_0320234 3300046691 Bacteria 832
470 Ga0495671_0001718 3300046692 Bacteria 14225
471 Ga0495671_0004099 3300046692 Bacteria 8788
472 Ga0495671_0112379 3300046692 Bacteria 1330
473 Ga0495649_0004079 3300046694 Bacteria 9610
474 Ga0495649_0014473 3300046694 Bacteria 4519
475 Ga0495649_0019636 3300046694 Bacteria 3796
476 Ga0495649_0095766 3300046694 Bacteria 1580
477 Ga0495649_0154753 3300046694 Bacteria 1203
478 Ga0495589_0000002 3300046794 Bacteria 758846
479 Ga0495589_0000316 3300046794 Bacteria 38558
480 Ga0495589_0010734 3300046794 Bacteria 4760
481 Ga0495589_0017529 3300046794 Bacteria 3674
482 Ga0495589_0022296 3300046794 Bacteria 3231
483 Ga0495589_0037035 3300046794 Bacteria 2444
484 Ga0495589_0076528 3300046794 Bacteria 1631
485 Ga0495600_0001683 3300046809 Bacteria 12350
486 Ga0495600_0050069 3300046809 Bacteria 2725
487 Ga0495660_0000014 3300046810 Bacteria 337328
488 Ga0495660_0044853 3300046810 Bacteria 2430
489 Ga0495660_0051843 3300046810 Bacteria 2231
490 Ga0495660_0080886 3300046810 Bacteria 1704
491 Ga0495581_0018253 3300047315 Bacteria 4074
492 Ga0495604_0009622 3300047317 Bacteria 7645
493 Ga0495604_0085933 3300047317 Bacteria 2346
494 Ga0495604_0129159 3300047317 Bacteria 1818
495 Ga0495636_0001719 3300047318 Bacteria 8354
496 Ga0495636_0380132 3300047318 Bacteria 670
497 Ga0495674_0048328 3300047319 Bacteria 3765
498 Ga0495672_0000466 3300047320 Bacteria 47885
499 Ga0495672_0002548 3300047320 Bacteria 16615
500 Ga0495672_0002855 3300047320 Bacteria 15357
501 Ga0495672_0012988 3300047320 Bacteria 5768
502 Ga0495672_0014231 3300047320 Bacteria 5458
503 Ga0495672_0067189 3300047320 Bacteria 2042
504 Ga0495672_0088478 3300047320 Bacteria 1706
505 Ga0495672_0122834 3300047320 Bacteria 1377
506 Ga0495680_0021857 3300047322 Bacteria 5345
507 Ga0495680_0065001 3300047322 Bacteria 2796
508 Ga0495683_0001064 3300047323 Bacteria 18983
509 Ga0495683_0012748 3300047323 Bacteria 4411
510 Ga0495683_0020550 3300047323 Bacteria 3404
511 Ga0495683_0038618 3300047323 Bacteria 2416
512 Ga0495683_0077943 3300047323 Bacteria 1619
513 Ga0495687_001366 3300047443 Bacteria 22552
514 Ga0495687_002446 3300047443 Bacteria 14911
515 Ga0495687_005004 3300047443 Bacteria 8659
516 Ga0495675_0095401 3300047444 Bacteria 1865
517 Ga0495677_0002912 3300047445 Bacteria 6661
518 Ga0495679_018277 3300047446 Bacteria 2492
519 Ga0495679_128422 3300047446 Bacteria 689
520 Ga0495685_018729 3300047447 Bacteria 2377
521 Ga0495673_0001574 3300047469 Bacteria 17893
522 Ga0495673_0005451 3300047469 Bacteria 7689
523 Ga0495673_0005619 3300047469 Bacteria 7537
524 Ga0495673_0007416 3300047469 Bacteria 6307
525 Ga0495673_0020954 3300047469 Bacteria 3241
526 Ga0495673_0031003 3300047469 Bacteria 2506
527 Ga0495681_0001637 3300047470 Bacteria 16631
528 Ga0495681_0001661 3300047470 Bacteria 16502
529 Ga0495681_0042081 3300047470 Bacteria 2213
530 Ga0495684_0063662 3300047471 Bacteria 2803
531 Ga0495593_0008934 3300047673 Bacteria 5817
532 Ga0495593_0047716 3300047673 Bacteria 2277
533 Ga0495602_0010257 3300048088 Bacteria 9723
534 Ga0495602_0192465 3300048088 Bacteria 1562
535 Ga0495602_0308645 3300048088 Bacteria 1155
536 Ga0495626_0002000 3300048091 Bacteria 15046
537 Ga0495626_0002125 3300048091 Bacteria 14354
538 Ga0495626_0002657 3300048091 Bacteria 12129
539 Ga0495626_0019589 3300048091 Bacteria 3383
540 Ga0495626_0041491 3300048091 Bacteria 2166
541 Ga0496100_0193749 3300048903 Bacteria 1477
542 Ga0496102_0000428 3300048905 Bacteria 48609
543 Ga0496102_0005158 3300048905 Bacteria 11085
544 Ga0496102_0007116 3300048905 Bacteria 9554
545 Ga0496102_0475249 3300048905 Bacteria 1171
546 Ga0496103_0003929 3300048906 Bacteria 9035
547 Ga0496103_0016491 3300048906 Bacteria 4407
548 Ga0496103_0033664 3300048906 Bacteria 3131
549 Ga0496103_0088032 3300048906 Bacteria 1958
550 Ga0496104_0011766 3300048907 Bacteria 7850
551 Ga0496104_0086195 3300048907 Bacteria 2998
552 Ga0496104_0729289 3300048907 Bacteria 898
553 Ga0496105_0050594 3300048908 Bacteria 3432
554 Ga0496105_0300328 3300048908 Bacteria 1291
555 Ga0496106_0083839 3300048909 Bacteria 2452
556 Ga0496106_0133176 3300048909 Bacteria 1950
557 Ga0496106_0233265 3300048909 Bacteria 1470
558 Ga0496110_0241174 3300048913 Bacteria 1645
559 Ga0496112_0330103 3300048915 Bacteria 1469
560 Ga0496114_0265119 3300048917 Bacteria 1513
561 Ga0496114_0519237 3300048917 Bacteria 1053
562 Ga0496115_0000002 3300048918 Bacteria 365286
563 Ga0496115_0060537 3300048918 Bacteria 3051
564 Ga0496116_0000023 3300048919 Bacteria 475792
565 Ga0496116_0000288 3300048919 Bacteria 85510
566 Ga0496116_0001134 3300048919 Bacteria 31693
567 Ga0496116_0001634 3300048919 Bacteria 24666
568 Ga0496116_0001773 3300048919 Bacteria 23475
569 Ga0496116_0011727 3300048919 Bacteria 7221
570 Ga0496116_0013358 3300048919 Bacteria 6627
571 Ga0496116_0016138 3300048919 Bacteria 5862
572 Ga0496116_0032950 3300048919 Bacteria 3684
573 Ga0496116_0044660 3300048919 Bacteria 3007
574 Ga0496116_0110437 3300048919 Bacteria 1617
575 Ga0496117_0000017 3300048920 Bacteria 490421
576 Ga0496117_0000100 3300048920 Bacteria 194307
577 Ga0496117_0000881 3300048920 Bacteria 46286
578 Ga0496117_0001508 3300048920 Bacteria 33364
579 Ga0496117_0004279 3300048920 Bacteria 15907
580 Ga0496117_0004461 3300048920 Bacteria 15424
581 Ga0496117_0011254 3300048920 Bacteria 8030
582 Ga0496117_0015201 3300048920 Bacteria 6582
583 Ga0496117_0018488 3300048920 Bacteria 5766
584 Ga0496117_0094879 3300048920 Bacteria 1908
585 Ga0496117_0133557 3300048920 Bacteria 1499
586 Ga0496117_0156476 3300048920 Bacteria 1341
587 Ga0496117_0166625 3300048920 Bacteria 1284
588 Ga0496118_0000018 3300048921 Bacteria 490421
589 Ga0496118_0000446 3300048921 Bacteria 68504
590 Ga0496118_0006957 3300048921 Bacteria 12221
591 Ga0496118_0009591 3300048921 Bacteria 9744
592 Ga0496118_0010834 3300048921 Bacteria 8978
593 Ga0496118_0013425 3300048921 Bacteria 7749
594 Ga0496118_0018094 3300048921 Bacteria 6376
595 Ga0496118_0034507 3300048921 Bacteria 4125
596 Ga0496118_0040586 3300048921 Bacteria 3698
597 Ga0496118_0065795 3300048921 Bacteria 2650
598 Ga0496118_0075574 3300048921 Bacteria 2401
599 Ga0496118_0087713 3300048921 Bacteria 2156
600 Ga0496118_0092549 3300048921 Bacteria 2074
601 Ga0496119_0001520 3300048922 Bacteria 27728
602 Ga0496119_0004367 3300048922 Bacteria 14110
603 Ga0496119_0012369 3300048922 Bacteria 6938
604 Ga0496119_0018312 3300048922 Bacteria 5223
605 Ga0496119_0032896 3300048922 Bacteria 3449
606 Ga0496119_0046911 3300048922 Bacteria 2692
607 Ga0496119_0052103 3300048922 Bacteria 2509
608 Ga0496119_0063357 3300048922 Bacteria 2199
609 Ga0496120_0000756 3300048923 Bacteria 46775
610 Ga0496120_0000801 3300048923 Bacteria 45287
611 Ga0496120_0001475 3300048923 Bacteria 28007
612 Ga0496120_0005017 3300048923 Bacteria 10738
613 Ga0496120_0014607 3300048923 Bacteria 5223
614 Ga0496120_0024408 3300048923 Bacteria 3770
615 Ga0496120_0096834 3300048923 Bacteria 1566
616 Ga0496121_0000211 3300048924 Bacteria 127602
617 Ga0496121_0000492 3300048924 Bacteria 75747
618 Ga0496121_0003591 3300048924 Bacteria 21895
619 Ga0496121_0005934 3300048924 Bacteria 15449
620 Ga0496121_0010805 3300048924 Bacteria 10226
621 Ga0496121_0037631 3300048924 Bacteria 4295
622 Ga0496121_0054729 3300048924 Bacteria 3331
623 Ga0496121_0087045 3300048924 Bacteria 2453
624 Ga0496121_0102898 3300048924 Bacteria 2198
625 Ga0496121_0136054 3300048924 Bacteria 1830
626 Ga0496122_0000021 3300048925 Bacteria 391363
627 Ga0496122_0000545 3300048925 Bacteria 77927
628 Ga0496122_0000562 3300048925 Bacteria 75980
629 Ga0496122_0004076 3300048925 Bacteria 18525
630 Ga0496122_0004697 3300048925 Bacteria 16777
631 Ga0496122_0006570 3300048925 Bacteria 13285
632 Ga0496122_0006988 3300048925 Bacteria 12706
633 Ga0496122_0008314 3300048925 Bacteria 11239
634 Ga0496122_0010774 3300048925 Bacteria 9376
635 Ga0496122_0011919 3300048925 Bacteria 8730
636 Ga0496122_0035536 3300048925 Bacteria 4050
637 Ga0496122_0055189 3300048925 Bacteria 2975
638 Ga0496122_0266583 3300048925 Bacteria 946
639 Ga0496122_0298673 3300048925 Bacteria 870
640 Ga0496122_0382034 3300048925 Bacteria 722
641 Ga0496123_0000174 3300048926 Bacteria 130310
642 Ga0496123_0000189 3300048926 Bacteria 124719
643 Ga0496123_0000200 3300048926 Bacteria 122026
644 Ga0496123_0000422 3300048926 Bacteria 76364
645 Ga0496123_0002636 3300048926 Bacteria 21745
646 Ga0496123_0003370 3300048926 Bacteria 18067
647 Ga0496123_0007219 3300048926 Bacteria 10543
648 Ga0496123_0012939 3300048926 Bacteria 7055
649 Ga0496123_0055453 3300048926 Bacteria 2600
650 Ga0496123_0082051 3300048926 Bacteria 1956
651 Ga0496123_0084639 3300048926 Bacteria 1911
652 Ga0496123_0105772 3300048926 Bacteria 1623
653 Ga0496123_0182337 3300048926 Bacteria 1095
654 Ga0496124_0000017 3300048927 Bacteria 444389
655 Ga0496124_0000066 3300048927 Bacteria 222815
656 Ga0496124_0001331 3300048927 Bacteria 37099
657 Ga0496124_0003122 3300048927 Bacteria 20551
658 Ga0496124_0019070 3300048927 Bacteria 6400
659 Ga0496124_0042147 3300048927 Bacteria 3932
660 Ga0496124_0047710 3300048927 Bacteria 3663
661 Ga0496124_0057366 3300048927 Bacteria 3281
662 Ga0496124_0141951 3300048927 Bacteria 1894
663 Ga0496124_0669032 3300048927 Bacteria 663
664 Ga0496125_0000005 3300048928 Bacteria 827598
665 Ga0496125_0000033 3300048928 Bacteria 351850
666 Ga0496125_0000355 3300048928 Bacteria 86577
667 Ga0496125_0002571 3300048928 Bacteria 23376
668 Ga0496125_0003383 3300048928 Bacteria 19409
669 Ga0496125_0005826 3300048928 Bacteria 13538
670 Ga0496125_0011365 3300048928 Bacteria 8912
671 Ga0496125_0013660 3300048928 Bacteria 7970
672 Ga0496125_0014405 3300048928 Bacteria 7703
673 Ga0496125_0018498 3300048928 Bacteria 6617
674 Ga0496125_0028466 3300048928 Bacteria 5046
675 Ga0496125_0049392 3300048928 Bacteria 3496
676 Ga0496125_0082792 3300048928 Bacteria 2444
677 Ga0496125_0098545 3300048928 Bacteria 2162
678 Ga0496126_0000052 3300048929 Bacteria 312383
679 Ga0496126_0003448 3300048929 Bacteria 19958
680 Ga0496126_0004528 3300048929 Bacteria 16534
681 Ga0496126_0048458 3300048929 Bacteria 3882
682 Ga0496126_0053397 3300048929 Bacteria 3667
683 Ga0496126_0193057 3300048929 Bacteria 1724
684 Ga0496126_0882501 3300048929 Bacteria 679
685 Ga0496126_0959556 3300048929 Bacteria 644
686 Ga0495678_001326 3300049459 Bacteria 19844
687 Ga0495678_007820 3300049459 Bacteria 5497
688 Ga0495678_022628 3300049459 Bacteria 2745
689 Ga0495682_0004466 3300049460 Bacteria 5976
690 Ga0495682_0044143 3300049460 Bacteria 1631
691 Ga0501032_0245916 3300049569 Bacteria 1162
692 Ga0501038_0170851 3300049574 Bacteria 1760
693 Ga0501039_0035498 3300049575 Bacteria 3847
694 Ga0501040_0003234 3300049576 Bacteria 10542
695 Ga0501041_0008304 3300049577 Bacteria 6112
696 Ga0501046_0072609 3300049580 Bacteria 2671
697 Ga0501048_0073813 3300049582 Bacteria 2407
698 Ga0501071_0146295 3300049587 Bacteria 1762
699 Ga0501072_0002188 3300049588 Bacteria 14605
700 Ga0501073_0041080 3300049589 Bacteria 3269
701 Ga0501074_0016923 3300049590 Bacteria 5290
702 Ga0501075_0042153 3300049591 Bacteria 3421
703 Ga0501076_0030268 3300049592 Bacteria 4215
704 Ga0501077_0000947 3300049593 Bacteria 17478
705 Ga0501249_005345 3300049679 Bacteria 2627
706 Ga0501079_0078556 3300049741 Bacteria 2552
707 Ga0501080_0008005 3300049742 Bacteria 9579
708 Ga0501080_0372279 3300049742 Bacteria 1288
709 Ga0501081_0206530 3300049743 Bacteria 1425
710 Ga0501083_0031956 3300049744 Bacteria 3611
711 Ga0501269_000165 3300049766 Bacteria 20359
712 Ga0501045_0015814 3300049824 Bacteria 5351
713 nmdc:mga03683_105454_c1 3300050489 Bacteria 1242
714 nmdc:mga00v17_368287_c1 3300050491 Bacteria 934
715 nmdc:mga0sz30_12993_c1 3300050516 Bacteria 3251
716 Ga0495601_0001480 3300053077 Bacteria 12956
717 Ga0500595_005107 3300053119 Bacteria 5761
718 Ga0500618_005498 3300053125 Bacteria 3839
719 Ga0500573_0230181 3300053140 Bacteria 967
720 Ga0500616_0139173 3300053153 Bacteria 1137
721 Ga0500619_003223 3300053154 Bacteria 3301
722 Ga0500634_0000240 3300053161 Bacteria 17898
723 Ga0500567_022233 3300053723 Bacteria 3037
724 Ga0501084_0008006 3300054114 Bacteria 8702
725 Ga0501082_0008685 3300060353 Bacteria 8760

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048925 Ga0496122_0266583 Ga0496122_0266583_12_572 165
2 3300005457 Ga0070662_100098528 Ga0070662_1000985282 176
3 3300009011 Ga0105251_10138322 Ga0105251_101383222 176
4 3300009092 Ga0105250_10000980 Ga0105250_100009808 176
5 3300013307 Ga0157372_10003765 Ga0157372_1000376512 176
6 3300025711 Ga0207696_1000073 Ga0207696_100007360 176
7 3300025735 Ga0207713_1014492 Ga0207713_10144924 176
8 3300025933 Ga0207706_10012239 Ga0207706_100122397 176
9 3300048921 Ga0496118_0009591 Ga0496118_0009591_7720_8313 176
10 3300048926 Ga0496123_0082051 Ga0496123_0082051_363_956 176
11 3300048928 Ga0496125_0082792 Ga0496125_0082792_1531_2124 176
12 3300048929 Ga0496126_0959556 Ga0496126_0959556_71_616 181
13 iso_pu_bacteria 2842922631 2842928210 188
14 3300009036 Ga0105244_10051389 Ga0105244_100513892 189
15 3300013100 Ga0157373_10007988 Ga0157373_100079889 189
16 3300025728 Ga0207655_1001923 Ga0207655_100192310 189
17 iso_pu_bacteria 2511231011 2511298565 193
18 iso_pu_bacteria 2773857673 2774133196 193
19 iso_pu_bacteria 2784132063 2784262943 193
20 iso_pu_bacteria 2818991456 2819655989 193
21 iso_pu_bacteria 2880230671 2880234866 193
22 iso_pu_bacteria 2904518522 2904522282 193
23 iso_pu_bacteria 2675903420 2677897741 194
24 iso_pu_bacteria 3007861166 3007861673 194
25 iso_pu_bacteria 2599185212 2599611734 195
26 iso_pu_bacteria 2599185289 2599884669 195
27 iso_pu_bacteria 2599185291 2599896152 195
28 iso_pu_bacteria 2599185305 2599958038 195
29 iso_pu_bacteria 2599185306 2599968839 195
30 iso_pu_bacteria 2599185308 2599980039 195
31 iso_pu_bacteria 2599185311 2599992753 195
32 iso_pu_bacteria 2599185313 2600003876 195
33 iso_pu_bacteria 2599185314 2600013919 195
34 iso_pu_bacteria 2599185315 2600015761 195
35 iso_pu_bacteria 2599185317 2600028150 195
36 iso_pu_bacteria 2599185318 2600034052 195
37 iso_pu_bacteria 2599185319 2600040429 195
38 iso_pu_bacteria 2599185321 2600050968 195
39 iso_pu_bacteria 2599185322 2600058586 195
40 iso_pu_bacteria 2599185323 2600063433 195
41 iso_pu_bacteria 2599185324 2600069044 195
42 iso_pu_bacteria 2600254930 2600357401 195
43 iso_pu_bacteria 2643221650 2644281169 195
44 iso_pu_bacteria 2651869719 2652546449 195
45 iso_pu_bacteria 2667528170 2671088846 195
46 iso_pu_bacteria 2667528176 2671124894 195
47 iso_pu_bacteria 2713897148 2715752637 195
48 iso_pu_bacteria 2718217725 2718634927 195
49 iso_pu_bacteria 2808606361 2808857763 195
50 iso_pu_bacteria 2808606376 2808921601 195
51 iso_pu_bacteria 2808606378 2808937956 195
52 iso_pu_bacteria 2808606380 2808943722 195
53 iso_pu_bacteria 2808606383 2808966270 195
54 iso_pu_bacteria 2808606389 2809001162 195
55 iso_pu_bacteria 2825651385 2825652174 195
56 iso_pu_bacteria 2842843487 2842846999 195
57 iso_pu_bacteria 2908669403 2908670262 195
58 iso_pu_bacteria 2919487758 2919492759 195
59 iso_pu_bacteria 2931369376 2931374990 195
60 iso_pu_bacteria 2988728565 2988730314 195
61 iso_pu_bacteria 3007614139 3007615091 195
62 iso_pu_bacteria 8002285264 8002290929 195
63 iso_pu_bacteria 8056172158 8056174661 195
64 iso_pu_bacteria 2506520007 2506577717 196
65 iso_pu_bacteria 2506520008 2506582855 196
66 iso_pu_bacteria 2508501071 2508851648 196
67 iso_pu_bacteria 2511231006 2511265187 196
68 iso_pu_bacteria 2511231007 2511270056 196
69 iso_pu_bacteria 2512047018 2512329022 196
70 iso_pu_bacteria 2554235234 2555258092 196
71 iso_pu_bacteria 2582580891 2583794086 196
72 iso_pu_bacteria 2597489887 2597859679 196
73 iso_pu_bacteria 2599185156 2599335378 196
74 iso_pu_bacteria 2599185167 2599400058 196
75 iso_pu_bacteria 2599185179 2599452878 196
76 iso_pu_bacteria 2599185185 2599482508 196
77 iso_pu_bacteria 2599185190 2599514512 196
78 iso_pu_bacteria 2599185191 2599520594 196
79 iso_pu_bacteria 2599185257 2599803771 196
80 iso_pu_bacteria 2599185290 2599893888 196
81 iso_pu_bacteria 2599185292 2599905578 196
82 iso_pu_bacteria 2600254931 2600364581 196
83 iso_pu_bacteria 2600255256 2601533053 196
84 iso_pu_bacteria 2600255257 2601538420 196
85 iso_pu_bacteria 2600255279 2601612987 196
86 iso_pu_bacteria 2600255308 2601749721 196
87 iso_pu_bacteria 2600255310 2601756766 196
88 iso_pu_bacteria 2600255311 2601761779 196
89 iso_pu_bacteria 2602042047 2603643466 196
90 iso_pu_bacteria 2623620446 2624490643 196
91 iso_pu_bacteria 2636415599 2637225200 196
92 iso_pu_bacteria 2643221556 2643802664 196
93 iso_pu_bacteria 2643221684 2644472169 196
94 iso_pu_bacteria 2654587920 2656278600 196
95 iso_pu_bacteria 2667528172 2671102355 196
96 iso_pu_bacteria 2667528173 2671110503 196
97 iso_pu_bacteria 2667528175 2671118275 196
98 iso_pu_bacteria 2671180115 2671584465 196
99 iso_pu_bacteria 2671180172 2671770660 196
100 iso_pu_bacteria 2681812866 2681995800 196
101 iso_pu_bacteria 2681812869 2682007628 196
102 iso_pu_bacteria 2687453601 2689444252 196
103 iso_pu_bacteria 2734482264 2735835141 196
104 iso_pu_bacteria 2738541307 2738879425 196
105 iso_pu_bacteria 2738543004 2739196790 196
106 iso_pu_bacteria 2740892503 2743739217 196
107 iso_pu_bacteria 2751185917 2753855020 196
108 iso_pu_bacteria 2765235840 2765579663 196
109 iso_pu_bacteria 2765235842 2765587908 196
110 iso_pu_bacteria 2773857670 2774122336 196
111 iso_pu_bacteria 2775506706 2775541728 196
112 iso_pu_bacteria 2775507074 2777022792 196
113 iso_pu_bacteria 2784132072 2784316174 196
114 iso_pu_bacteria 2808606385 2808979555 196
115 iso_pu_bacteria 2808606388 2808995175 196
116 iso_pu_bacteria 2811995292 2813727256 196
117 iso_pu_bacteria 2814123068 2814694789 196
118 iso_pu_bacteria 2818991436 2819544164 196
119 iso_pu_bacteria 2821443989 2821446389 196
120 iso_pu_bacteria 2823373977 2823376996 196
121 iso_pu_bacteria 2834028612 2834031470 196
122 iso_pu_bacteria 2844533157 2844539383 196
123 iso_pu_bacteria 2852612431 2852612684 196
124 iso_pu_bacteria 2852667396 2852669580 196
125 iso_pu_bacteria 2858950400 2858951784 196
126 iso_pu_bacteria 2860339153 2860341167 196
127 iso_pu_bacteria 2869551831 2869553562 196
128 iso_pu_bacteria 2888366609 2888368316 196
129 iso_pu_bacteria 2904474040 2904477000 196
130 iso_pu_bacteria 2904513164 2904513911 196
131 iso_pu_bacteria 2908446538 2908451503 196
132 iso_pu_bacteria 2919108558 2919109335 196
133 iso_pu_bacteria 2919150387 2919153167 196
134 iso_pu_bacteria 2919697872 2919701839 196
135 iso_pu_bacteria 2923153595 2923158299 196
136 iso_pu_bacteria 2927143783 2927143793 196
137 iso_pu_bacteria 2927833300 2927835063 196
138 iso_pu_bacteria 2929189879 2929194086 196
139 iso_pu_bacteria 2931390751 2931395381 196
140 iso_pu_bacteria 2931396565 2931396902 196
141 iso_pu_bacteria 2937539931 2937542991 196
142 iso_pu_bacteria 2941479691 2941483403 196
143 iso_pu_bacteria 2945961074 2945965484 196
144 iso_pu_bacteria 2969079654 2969082196 196
145 iso_pu_bacteria 2971820967 2971823893 196
146 iso_pu_bacteria 2974310843 2974313170 196
147 iso_pu_bacteria 2984286254 2984287880 196
148 iso_pu_bacteria 2984559226 2984564638 196
149 iso_pu_bacteria 2984595703 2984597367 196
150 iso_pu_bacteria 3007395558 3007397591 196
151 iso_pu_bacteria 3007419365 3007424742 196
152 iso_pu_bacteria 3007511990 3007516080 196
153 iso_pu_bacteria 640753048 640937211 196
154 iso_pu_bacteria 8015687852 8015692386 196
155 iso_pu_bacteria 8019775933 8019780637 196
156 iso_pu_bacteria 8054285046 8054291053 196
157 iso_pu_bacteria 8055770955 8055775605 196
158 iso_pu_bacteria 8055817908 8055822859 196
159 iso_pu_bacteria 8056131705 8056136272 196
160 3300003759 Ga0055525_1007489 Ga0055525_10074891 197
161 3300009011 Ga0105251_10112568 Ga0105251_101125682 197
162 3300009036 Ga0105244_10052630 Ga0105244_100526302 197
163 3300013100 Ga0157373_10179482 Ga0157373_101794822 197
164 3300013104 Ga0157370_10204410 Ga0157370_102044102 197
165 3300014497 Ga0182008_10001764 Ga0182008_100017648 197
166 3300015261 Ga0182006_1007173 Ga0182006_10071734 197
167 3300017792 Ga0163161_10037352 Ga0163161_100373522 197
168 3300025230 Ga0209563_101321 Ga0209563_1013215 197
169 3300025735 Ga0207713_1014499 Ga0207713_10144994 197
170 3300042138 Ga0450903_008180 Ga0450903_008180_595_1188 197
171 3300042144 Ga0450889_002580 Ga0450889_002580_118_711 197
172 3300042532 Ga0450893_0003281 Ga0450893_0003281_707_1300 197
173 3300046457 Ga0495590_0009751 Ga0495590_0009751_2282_2875 197
174 3300046460 Ga0495638_0012816 Ga0495638_0012816_786_1379 197
175 3300046463 Ga0495653_0006143 Ga0495653_0006143_1731_2324 197
176 3300046471 Ga0495650_0002618 Ga0495650_0002618_8338_8931 197
177 3300046501 Ga0495607_0002094 Ga0495607_0002094_8472_9065 197
178 3300046513 Ga0495616_0001804 Ga0495616_0001804_8504_9103 197
179 3300046526 Ga0495666_0033975 Ga0495666_0033975_428_1021 197
180 3300046530 Ga0495654_0059304 Ga0495654_0059304_1140_1733 197
181 3300046543 Ga0495645_0066398 Ga0495645_0066398_520_1113 197
182 3300046642 Ga0495634_0051353 Ga0495634_0051353_624_1217 197
183 3300046674 Ga0495588_0079503 Ga0495588_0079503_53_646 197
184 3300046680 Ga0495646_0086198 Ga0495646_0086198_823_1416 197
185 3300046689 Ga0495613_0186496 Ga0495613_0186496_263_856 197
186 3300046690 Ga0495624_0001741 Ga0495624_0001741_7573_8166 197
187 3300046692 Ga0495671_0112379 Ga0495671_0112379_19_618 197
188 3300046809 Ga0495600_0050069 Ga0495600_0050069_1527_2120 197
189 3300047317 Ga0495604_0085933 Ga0495604_0085933_699_1292 197
190 3300047320 Ga0495672_0002548 Ga0495672_0002548_7599_8192 197
191 3300047322 Ga0495680_0021857 Ga0495680_0021857_2249_2842 197
192 3300047444 Ga0495675_0095401 Ga0495675_0095401_1204_1797 197
193 3300047470 Ga0495681_0001637 Ga0495681_0001637_8428_9027 197
194 3300047471 Ga0495684_0063662 Ga0495684_0063662_1570_2163 197
195 3300047673 Ga0495593_0008934 Ga0495593_0008934_2721_3314 197
196 3300048088 Ga0495602_0010257 Ga0495602_0010257_7585_8178 197
197 3300048903 Ga0496100_0193749 Ga0496100_0193749_271_864 197
198 3300048905 Ga0496102_0475249 Ga0496102_0475249_119_712 197
199 3300048909 Ga0496106_0133176 Ga0496106_0133176_961_1554 197
200 3300048919 Ga0496116_0044660 Ga0496116_0044660_1780_2373 197
201 3300048923 Ga0496120_0096834 Ga0496120_0096834_728_1321 197
202 3300048924 Ga0496121_0054729 Ga0496121_0054729_2131_2724 197
203 3300048925 Ga0496122_0298673 Ga0496122_0298673_45_638 197
204 3300048926 Ga0496123_0084639 Ga0496123_0084639_1001_1594 197
205 3300048927 Ga0496124_0042147 Ga0496124_0042147_1753_2346 197
206 3300049460 Ga0495682_0004466 Ga0495682_0004466_4721_5314 197
207 iso_pu_bacteria 8056689827 8056692367 197
208 3300046810 Ga0495660_0051843 Ga0495660_0051843_441_1037 198
209 3300048919 Ga0496116_0001634 Ga0496116_0001634_14397_14993 198
210 3300049459 Ga0495678_007820 Ga0495678_007820_1202_1798 198
211 3300005563 Ga0068855_100059616 Ga0068855_1000596166 199
212 3300007265 Ga0099794_10000054 Ga0099794_100000544 199
213 3300009093 Ga0105240_10021162 Ga0105240_1002116212 199
214 3300013104 Ga0157370_10272285 Ga0157370_102722852 199
215 3300013105 Ga0157369_10064490 Ga0157369_100644902 199
216 3300013307 Ga0157372_10141186 Ga0157372_101411863 199
217 3300025913 Ga0207695_10065987 Ga0207695_100659871 199
218 3300025949 Ga0207667_10071345 Ga0207667_100713451 199
219 3300027671 Ga0209588_1000017 Ga0209588_100001747 199
220 3300041407 Ga0439447_001156 Ga0439447_001156_8329_8928 199
221 3300041411 Ga0439466_0002095 Ga0439466_0002095_5458_6057 199
222 3300046507 Ga0495606_0024403 Ga0495606_0024403_3662_4261 199
223 2124908027 MRS2a_Contig_1351 MRS2a_00248490 200
224 2124908027 MRS2a_Contig_27077 MRS2a_00627540 200
225 2124908027 MRS2a_Contig_339 MRS2a_00236470 200
226 2162886007 SwRhRL2b_contig_783059 SwRhRL2b_0312.00000620 200
227 3300001989 JGI24739J22299_10097095 JGI24739J22299_100970951 200
228 3300002737 JGI25162J39368_1000038 JGI25162J39368_100003841 200
229 3300002737 JGI25162J39368_1000092 JGI25162J39368_100009228 200
230 3300002737 JGI25162J39368_1000231 JGI25162J39368_100023150 200
231 3300002737 JGI25162J39368_1002383 JGI25162J39368_10023832 200
232 3300002771 JGI25163J39215_1000013 JGI25163J39215_100001310 200
233 3300002771 JGI25163J39215_1000504 JGI25163J39215_10005042 200
234 3300002772 JGI25164J39214_1000071 JGI25164J39214_100007128 200
235 3300002772 JGI25164J39214_1000179 JGI25164J39214_100017949 200
236 3300003187 JGI25151J46595_10000559 JGI25151J46595_100005599 200
237 3300003187 JGI25151J46595_10000719 JGI25151J46595_1000071928 200
238 3300003214 JGI25165J46597_1000045 JGI25165J46597_100004541 200
239 3300003214 JGI25165J46597_1000327 JGI25165J46597_100032711 200
240 3300003215 JGI25153J46596_10039030 JGI25153J46596_100390302 200
241 3300003320 rootH2_10110653 rootH2_101106532 200
242 3300003322 rootL2_10018643 rootL2_100186433 200
243 3300003322 rootL2_10155604 rootL2_101556042 200
244 3300003354 JGI25160J50197_1004440 JGI25160J50197_10044402 200
245 3300003751 Ga0055538_1000022 Ga0055538_100002241 200
246 3300003751 Ga0055538_1000064 Ga0055538_100006428 200
247 3300003752 Ga0055539_1000028 Ga0055539_100002841 200
248 3300003752 Ga0055539_1000098 Ga0055539_100009828 200
249 3300003756 Ga0055533_1000036 Ga0055533_100003641 200
250 3300003756 Ga0055533_1000108 Ga0055533_100010828 200
251 3300003759 Ga0055525_1000071 Ga0055525_1000071123 200
252 3300003759 Ga0055525_1000141 Ga0055525_100014128 200
253 3300003791 Ga0055530_10000105 Ga0055530_1000010561 200
254 3300003791 Ga0055530_10000256 Ga0055530_1000025631 200
255 3300003792 Ga0055540_1001478 Ga0055540_10014783 200
256 3300003841 Ga0055541_1000037 Ga0055541_1000037123 200
257 3300003841 Ga0055541_1000065 Ga0055541_100006563 200
258 3300003856 Ga0058692_1000135 Ga0058692_100013514 200
259 3300003856 Ga0058692_1014160 Ga0058692_10141602 200
260 3300005272 Ga0065703_1021008 Ga0065703_10210082 200
261 3300005288 Ga0065714_10000495 Ga0065714_100004952 200
262 3300005288 Ga0065714_10069538 Ga0065714_100695383 200
263 3300005289 Ga0065704_10000285 Ga0065704_100002852 200
264 3300005289 Ga0065704_10004692 Ga0065704_100046925 200
265 3300005290 Ga0065712_10006415 Ga0065712_100064153 200
266 3300005293 Ga0065715_10028109 Ga0065715_100281092 200
267 3300005327 Ga0070658_10190676 Ga0070658_101906761 200
268 3300005328 Ga0070676_10097935 Ga0070676_100979352 200
269 3300005330 Ga0070690_100724861 Ga0070690_1007248611 200
270 3300005331 Ga0070670_100000161 Ga0070670_1000001618 200
271 3300005331 Ga0070670_100000221 Ga0070670_10000022117 200
272 3300005331 Ga0070670_100325150 Ga0070670_1003251501 200
273 3300005334 Ga0068869_100466195 Ga0068869_1004661952 200
274 3300005335 Ga0070666_10248026 Ga0070666_102480262 200
275 3300005338 Ga0068868_100355727 Ga0068868_1003557272 200
276 3300005344 Ga0070661_100000640 Ga0070661_1000006402 200
277 3300005347 Ga0070668_100034128 Ga0070668_1000341282 200
278 3300005353 Ga0070669_100000299 Ga0070669_10000029929 200
279 3300005354 Ga0070675_100216966 Ga0070675_1002169663 200
280 3300005364 Ga0070673_100177993 Ga0070673_1001779933 200
281 3300005365 Ga0070688_100428084 Ga0070688_1004280842 200
282 3300005367 Ga0070667_100321849 Ga0070667_1003218492 200
283 3300005457 Ga0070662_100001026 Ga0070662_10000102616 200
284 3300005457 Ga0070662_100207068 Ga0070662_1002070682 200
285 3300005535 Ga0070684_100414485 Ga0070684_1004144852 200
286 3300005539 Ga0068853_100033799 Ga0068853_1000337993 200
287 3300005539 Ga0068853_100472424 Ga0068853_1004724242 200
288 3300005543 Ga0070672_100045412 Ga0070672_1000454122 200
289 3300005547 Ga0070693_100096092 Ga0070693_1000960923 200
290 3300005548 Ga0070665_100039980 Ga0070665_1000399801 200
291 3300005564 Ga0070664_100000489 Ga0070664_10000048917 200
292 3300005564 Ga0070664_100146767 Ga0070664_1001467672 200
293 3300005577 Ga0068857_100667298 Ga0068857_1006672982 200
294 3300005578 Ga0068854_100008186 Ga0068854_1000081864 200
295 3300005614 Ga0068856_100057337 Ga0068856_1000573372 200
296 3300005614 Ga0068856_100192049 Ga0068856_1001920492 200
297 3300005617 Ga0068859_100556123 Ga0068859_1005561232 200
298 3300005834 Ga0068851_10000036 Ga0068851_1000003630 200
299 3300005840 Ga0068870_10402166 Ga0068870_104021661 200
300 3300005843 Ga0068860_100551405 Ga0068860_1005514051 200
301 3300005983 Ga0081540_1049520 Ga0081540_10495202 200
302 3300006028 Ga0070717_10085800 Ga0070717_100858003 200
303 3300006051 Ga0075364_10009886 Ga0075364_100098864 200
304 3300006051 Ga0075364_10062388 Ga0075364_100623885 200
305 3300006058 Ga0075432_10000389 Ga0075432_100003897 200
306 3300006058 Ga0075432_10084063 Ga0075432_100840632 200
307 3300006186 Ga0075369_10028270 Ga0075369_100282702 200
308 3300006881 Ga0068865_100017011 Ga0068865_1000170111 200
309 3300006931 Ga0097620_100556117 Ga0097620_1005561172 200
310 3300006946 Ga0079104_1005087 Ga0079104_10050873 200
311 3300006946 Ga0079104_1057562 Ga0079104_10575621 200
312 3300009011 Ga0105251_10000109 Ga0105251_100001099 200
313 3300009011 Ga0105251_10000632 Ga0105251_100006329 200
314 3300009011 Ga0105251_10002446 Ga0105251_100024464 200
315 3300009011 Ga0105251_10002477 Ga0105251_100024774 200
316 3300009011 Ga0105251_10004209 Ga0105251_1000420914 200
317 3300009011 Ga0105251_10005496 Ga0105251_100054967 200
318 3300009011 Ga0105251_10007551 Ga0105251_100075516 200
319 3300009011 Ga0105251_10232389 Ga0105251_102323891 200
320 3300009036 Ga0105244_10000690 Ga0105244_100006909 200
321 3300009036 Ga0105244_10001260 Ga0105244_1000126012 200
322 3300009036 Ga0105244_10001623 Ga0105244_1000162318 200
323 3300009036 Ga0105244_10002664 Ga0105244_100026647 200
324 3300009036 Ga0105244_10006790 Ga0105244_100067902 200
325 3300009036 Ga0105244_10007221 Ga0105244_100072217 200
326 3300009036 Ga0105244_10036931 Ga0105244_100369312 200
327 3300009036 Ga0105244_10161982 Ga0105244_101619822 200
328 3300009092 Ga0105250_10001610 Ga0105250_100016106 200
329 3300009092 Ga0105250_10003840 Ga0105250_100038405 200
330 3300009092 Ga0105250_10020674 Ga0105250_100206742 200
331 3300009093 Ga0105240_10040554 Ga0105240_100405544 200
332 3300009093 Ga0105240_10076396 Ga0105240_100763964 200
333 3300009101 Ga0105247_10000025 Ga0105247_1000002518 200
334 3300009148 Ga0105243_10006244 Ga0105243_100062444 200
335 3300009148 Ga0105243_10135564 Ga0105243_101355644 200
336 3300009174 Ga0105241_10000005 Ga0105241_1000000586 200
337 3300009176 Ga0105242_10000238 Ga0105242_1000023826 200
338 3300009176 Ga0105242_10566113 Ga0105242_105661132 200
339 3300010375 Ga0105239_10001431 Ga0105239_1000143119 200
340 3300010375 Ga0105239_10770933 Ga0105239_107709331 200
341 3300011119 Ga0105246_10210134 Ga0105246_102101341 200
342 3300011119 Ga0105246_10684597 Ga0105246_106845971 200
343 3300013100 Ga0157373_10004421 Ga0157373_100044212 200
344 3300013100 Ga0157373_10005271 Ga0157373_100052717 200
345 3300013100 Ga0157373_10005861 Ga0157373_100058613 200
346 3300013102 Ga0157371_10003359 Ga0157371_1000335911 200
347 3300013102 Ga0157371_10259645 Ga0157371_102596451 200
348 3300013102 Ga0157371_10264236 Ga0157371_102642362 200
349 3300013104 Ga0157370_10024387 Ga0157370_100243872 200
350 3300013104 Ga0157370_10060151 Ga0157370_100601513 200
351 3300013104 Ga0157370_10070146 Ga0157370_100701463 200
352 3300013104 Ga0157370_10100182 Ga0157370_101001822 200
353 3300013104 Ga0157370_10238850 Ga0157370_102388501 200
354 3300013104 Ga0157370_10250296 Ga0157370_102502962 200
355 3300013104 Ga0157370_10451491 Ga0157370_104514911 200
356 3300013104 Ga0157370_10981132 Ga0157370_109811321 200
357 3300013105 Ga0157369_10000646 Ga0157369_1000064619 200
358 3300013105 Ga0157369_10005544 Ga0157369_1000554414 200
359 3300013105 Ga0157369_10007554 Ga0157369_100075548 200
360 3300013105 Ga0157369_10009657 Ga0157369_100096572 200
361 3300013105 Ga0157369_10093023 Ga0157369_100930234 200
362 3300013105 Ga0157369_10249118 Ga0157369_102491182 200
363 3300013296 Ga0157374_10035668 Ga0157374_100356682 200
364 3300013307 Ga0157372_10008148 Ga0157372_100081484 200
365 3300013307 Ga0157372_10205989 Ga0157372_102059892 200
366 3300013307 Ga0157372_10664017 Ga0157372_106640172 200
367 3300013308 Ga0157375_10000979 Ga0157375_1000097917 200
368 3300013308 Ga0157375_10011925 Ga0157375_100119253 200
369 3300013308 Ga0157375_10186611 Ga0157375_101866113 200
370 3300014325 Ga0163163_10829545 Ga0163163_108295451 200
371 3300014497 Ga0182008_10000753 Ga0182008_1000075310 200
372 3300014497 Ga0182008_10002169 Ga0182008_100021696 200
373 3300014497 Ga0182008_10002354 Ga0182008_100023549 200
374 3300014497 Ga0182008_10016078 Ga0182008_100160783 200
375 3300014969 Ga0157376_10035314 Ga0157376_100353142 200
376 3300015261 Ga0182006_1002148 Ga0182006_10021485 200
377 3300015261 Ga0182006_1007195 Ga0182006_10071956 200
378 3300015262 Ga0182007_10002918 Ga0182007_100029185 200
379 3300015262 Ga0182007_10003477 Ga0182007_1000347711 200
380 3300015265 Ga0182005_1000928 Ga0182005_10009287 200
381 3300015265 Ga0182005_1002531 Ga0182005_10025318 200
382 3300015679 Ga0183366_1001 Ga0183366_1001321 200
383 3300015680 Ga0183370_1001 Ga0183370_1001321 200
384 3300015685 Ga0183369_1001 Ga0183369_1001321 200
385 3300015687 Ga0183368_1001 Ga0183368_1001321 200
386 3300017792 Ga0163161_10000001 Ga0163161_10000001431 200
387 3300017792 Ga0163161_10057629 Ga0163161_100576291 200
388 3300017792 Ga0163161_10136388 Ga0163161_101363882 200
389 3300017792 Ga0163161_10365862 Ga0163161_103658622 200
390 3300025207 Ga0209760_100189 Ga0209760_1001897 200
391 3300025207 Ga0209760_100257 Ga0209760_10025711 200
392 3300025207 Ga0209760_102005 Ga0209760_1020053 200
393 3300025224 Ga0209784_100001 Ga0209784_1000011827 200
394 3300025224 Ga0209784_100036 Ga0209784_100036193 200
395 3300025225 Ga0209566_100001 Ga0209566_1000011827 200
396 3300025225 Ga0209566_100044 Ga0209566_100044193 200
397 3300025226 Ga0209674_100002 Ga0209674_1000021827 200
398 3300025226 Ga0209674_100065 Ga0209674_100065193 200
399 3300025230 Ga0209563_100002 Ga0209563_100002362 200
400 3300025230 Ga0209563_100063 Ga0209563_100063193 200
401 3300025231 Ga0207427_100008 Ga0207427_10000811 200
402 3300025231 Ga0207427_100020 Ga0207427_100020415 200
403 3300025231 Ga0207427_100664 Ga0207427_1006644 200
404 3300025233 Ga0209437_100001 Ga0209437_100001362 200
405 3300025233 Ga0209437_100014 Ga0209437_100014700 200
406 3300025233 Ga0209437_100032 Ga0209437_100032347 200
407 3300025233 Ga0209437_100082 Ga0209437_100082193 200
408 3300025253 Ga0209677_100002 Ga0209677_100002362 200
409 3300025253 Ga0209677_100038 Ga0209677_100038193 200
410 3300025261 Ga0209233_1000008 Ga0209233_1000008700 200
411 3300025261 Ga0209233_1000109 Ga0209233_1000109193 200
412 3300025284 Ga0209130_1000436 Ga0209130_100043622 200
413 3300025292 Ga0209676_1000006 Ga0209676_1000006430 200
414 3300025294 Ga0209025_1000099 Ga0209025_1000099117 200
415 3300025297 Ga0209758_1001714 Ga0209758_10017142 200
416 3300025298 Ga0209050_1000070 Ga0209050_100007089 200
417 3300025302 Ga0207426_1000065 Ga0207426_1000065244 200
418 3300025303 Ga0209051_1000093 Ga0209051_100009380 200
419 3300025315 Ga0207697_10133950 Ga0207697_101339502 200
420 3300025321 Ga0207656_10000021 Ga0207656_1000002188 200
421 3300025711 Ga0207696_1000001 Ga0207696_1000001510 200
422 3300025711 Ga0207696_1002951 Ga0207696_10029513 200
423 3300025711 Ga0207696_1026790 Ga0207696_10267902 200
424 3300025728 Ga0207655_1000021 Ga0207655_1000021432 200
425 3300025728 Ga0207655_1000060 Ga0207655_1000060195 200
426 3300025728 Ga0207655_1000595 Ga0207655_100059526 200
427 3300025728 Ga0207655_1000679 Ga0207655_100067922 200
428 3300025728 Ga0207655_1001849 Ga0207655_100184911 200
429 3300025728 Ga0207655_1002280 Ga0207655_100228021 200
430 3300025728 Ga0207655_1002998 Ga0207655_100299813 200
431 3300025728 Ga0207655_1010672 Ga0207655_10106724 200
432 3300025728 Ga0207655_1019953 Ga0207655_10199533 200
433 3300025728 Ga0207655_1023432 Ga0207655_10234322 200
434 3300025735 Ga0207713_1000003 Ga0207713_1000003718 200
435 3300025735 Ga0207713_1000011 Ga0207713_1000011378 200
436 3300025735 Ga0207713_1000092 Ga0207713_100009276 200
437 3300025735 Ga0207713_1000142 Ga0207713_100014222 200
438 3300025735 Ga0207713_1000671 Ga0207713_10006719 200
439 3300025735 Ga0207713_1002192 Ga0207713_10021928 200
440 3300025735 Ga0207713_1010307 Ga0207713_10103072 200
441 3300025735 Ga0207713_1014047 Ga0207713_10140477 200
442 3300025735 Ga0207713_1015037 Ga0207713_10150373 200
443 3300025735 Ga0207713_1017844 Ga0207713_10178443 200
444 3300025735 Ga0207713_1033314 Ga0207713_10333142 200
445 3300025900 Ga0207710_10000074 Ga0207710_1000007463 200
446 3300025907 Ga0207645_10128755 Ga0207645_101287552 200
447 3300025908 Ga0207643_10277292 Ga0207643_102772922 200
448 3300025909 Ga0207705_10265352 Ga0207705_102653522 200
449 3300025911 Ga0207654_10000007 Ga0207654_10000007306 200
450 3300025914 Ga0207671_10000263 Ga0207671_1000026354 200
451 3300025920 Ga0207649_10000288 Ga0207649_1000028826 200
452 3300025923 Ga0207681_10001287 Ga0207681_1000128713 200
453 3300025925 Ga0207650_10000191 Ga0207650_1000019162 200
454 3300025925 Ga0207650_10000194 Ga0207650_100001945 200
455 3300025925 Ga0207650_10259019 Ga0207650_102590191 200
456 3300025925 Ga0207650_10351626 Ga0207650_103516262 200
457 3300025926 Ga0207659_10096672 Ga0207659_100966722 200
458 3300025933 Ga0207706_10000493 Ga0207706_1000049327 200
459 3300025933 Ga0207706_10259521 Ga0207706_102595212 200
460 3300025934 Ga0207686_10011944 Ga0207686_100119444 200
461 3300025935 Ga0207709_10027877 Ga0207709_100278772 200
462 3300025935 Ga0207709_10193879 Ga0207709_101938791 200
463 3300025938 Ga0207704_10102824 Ga0207704_101028242 200
464 3300025940 Ga0207691_10028446 Ga0207691_100284464 200
465 3300025942 Ga0207689_10245149 Ga0207689_102451492 200
466 3300025945 Ga0207679_10000226 Ga0207679_1000022617 200
467 3300025945 Ga0207679_10164444 Ga0207679_101644442 200
468 3300025981 Ga0207640_10035714 Ga0207640_100357143 200
469 3300025986 Ga0207658_10546123 Ga0207658_105461232 200
470 3300026041 Ga0207639_10014082 Ga0207639_100140823 200
471 3300026041 Ga0207639_10699654 Ga0207639_106996542 200
472 3300026078 Ga0207702_10001503 Ga0207702_100015039 200
473 3300026078 Ga0207702_10586018 Ga0207702_105860181 200
474 3300026089 Ga0207648_10332758 Ga0207648_103327583 200
475 3300026116 Ga0207674_10001166 Ga0207674_1000116610 200
476 3300026142 Ga0207698_10194869 Ga0207698_101948692 200
477 3300027111 Ga0209281_1000027 Ga0209281_1000027391 200
478 3300027111 Ga0209281_1001505 Ga0209281_10015053 200
479 3300027312 Ga0209371_1000001 Ga0209371_1000001275 200
480 3300027312 Ga0209371_1000471 Ga0209371_10004713 200
481 3300027312 Ga0209371_1017128 Ga0209371_10171282 200
482 3300027666 Ga0209282_1000093 Ga0209282_100009328 200
483 3300027907 Ga0207428_10115187 Ga0207428_101151872 200
484 3300027907 Ga0207428_10134967 Ga0207428_101349672 200
485 3300027907 Ga0207428_10400031 Ga0207428_104000311 200
486 3300028379 Ga0268266_10206371 Ga0268266_102063713 200
487 3300028381 Ga0268264_11014095 Ga0268264_110140952 200
488 3300028786 Ga0307517_10067934 Ga0307517_100679343 200
489 3300030500 Ga0268256_1000001 Ga0268256_10000012366 200
490 3300030500 Ga0268256_1000057 Ga0268256_100005796 200
491 3300030500 Ga0268256_1000398 Ga0268256_100039837 200
492 3300030500 Ga0268256_1019079 Ga0268256_10190792 200
493 3300031239 Ga0265328_10082971 Ga0265328_100829713 200
494 3300031507 Ga0307509_10151367 Ga0307509_101513674 200
495 3300031730 Ga0307516_10030996 Ga0307516_100309964 200
496 3300031911 Ga0307412_10005500 Ga0307412_100055002 200
497 3300037312 Ga0395899_0004173 Ga0395899_0004173_1917_2522 200
498 3300037418 Ga0395900_0013792 Ga0395900_0013792_2216_2821 200
499 3300039437 Ga0436365_1060686 Ga0436365_1060686_160_768 200
500 3300041405 Ga0439438_036176 Ga0439438_036176_188_790 200
501 3300041407 Ga0439447_023131 Ga0439447_023131_237_839 200
502 3300041411 Ga0439466_0000953 Ga0439466_0000953_8525_9127 200
503 3300041411 Ga0439466_0078346 Ga0439466_0078346_252_854 200
504 3300042009 Ga0439451_000970 Ga0439451_000970_1133_1735 200
505 3300042009 Ga0439451_046280 Ga0439451_046280_148_750 200
506 3300042010 Ga0439452_000126 Ga0439452_000126_57050_57655 200
507 3300042010 Ga0439452_015882 Ga0439452_015882_1227_1829 200
508 3300042013 Ga0439456_016540 Ga0439456_016540_127_729 200
509 3300042016 Ga0439463_000047 Ga0439463_000047_15393_15998 200
510 3300042439 Ga0439464_0016738 Ga0439464_0016738_184_789 200
511 3300042461 Ga0439460_0040485 Ga0439460_0040485_316_918 200
512 3300042993 Ga0439440_0010531 Ga0439440_0010531_1293_1898 200
513 3300044658 Ga0466972_0006635 Ga0466972_0006635_4177_4779 200
514 3300044663 Ga0466989_0173783 Ga0466989_0173783_481_1095 200
515 3300044683 Ga0466965_0093015 Ga0466965_0093015_130_732 200
516 3300044693 Ga0466961_0101325 Ga0466961_0101325_786_1400 200
517 3300044694 Ga0466963_0275197 Ga0466963_0275197_173_787 200
518 3300044706 Ga0466964_0002273 Ga0466964_0002273_5792_6394 200
519 3300044712 Ga0453684_0421915 Ga0453684_0421915_855_1460 200
520 3300044735 Ga0466968_0138534 Ga0466968_0138534_403_1005 200
521 3300044765 Ga0466970_0190841 Ga0466970_0190841_107_709 200
522 3300044901 Ga0466960_0028244 Ga0466960_0028244_420_1022 200
523 3300046452 Ga0495617_000028 Ga0495617_000028_33352_33954 200
524 3300046452 Ga0495617_000408 Ga0495617_000408_17668_18270 200
525 3300046452 Ga0495617_002126 Ga0495617_002126_501_1103 200
526 3300046452 Ga0495617_018492 Ga0495617_018492_998_1600 200
527 3300046452 Ga0495617_023670 Ga0495617_023670_1293_1895 200
528 3300046453 Ga0495627_000018 Ga0495627_000018_90302_90919 200
529 3300046453 Ga0495627_021434 Ga0495627_021434_567_1172 200
530 3300046455 Ga0495603_0399956 Ga0495603_0399956_42_644 200
531 3300046457 Ga0495590_0000901 Ga0495590_0000901_7279_7881 200
532 3300046457 Ga0495590_0035907 Ga0495590_0035907_994_1596 200
533 3300046458 Ga0495591_003722 Ga0495591_003722_673_1275 200
534 3300046458 Ga0495591_112969 Ga0495591_112969_54_656 200
535 3300046460 Ga0495638_0020181 Ga0495638_0020181_3063_3665 200
536 3300046460 Ga0495638_0197554 Ga0495638_0197554_390_992 200
537 3300046462 Ga0495651_0167561 Ga0495651_0167561_616_1314 200
538 3300046471 Ga0495650_0000043 Ga0495650_0000043_15413_16075 200
539 3300046471 Ga0495650_0002158 Ga0495650_0002158_4588_5190 200
540 3300046471 Ga0495650_0004589 Ga0495650_0004589_3234_3836 200
541 3300046471 Ga0495650_0005525 Ga0495650_0005525_483_1085 200
542 3300046472 Ga0495580_0244028 Ga0495580_0244028_389_991 200
543 3300046474 Ga0495605_0004566 Ga0495605_0004566_6884_7486 200
544 3300046474 Ga0495605_0022108 Ga0495605_0022108_2470_3072 200
545 3300046474 Ga0495605_0055809 Ga0495605_0055809_1230_1832 200
546 3300046474 Ga0495605_0069888 Ga0495605_0069888_1007_1609 200
547 3300046475 Ga0495639_0000633 Ga0495639_0000633_6409_7011 200
548 3300046475 Ga0495639_0013803 Ga0495639_0013803_2806_3408 200
549 3300046491 Ga0495584_0001297 Ga0495584_0001297_8448_9050 200
550 3300046491 Ga0495584_0001499 Ga0495584_0001499_5407_6009 200
551 3300046491 Ga0495584_0019448 Ga0495584_0019448_1067_1669 200
552 3300046492 Ga0495585_0022219 Ga0495585_0022219_2858_3460 200
553 3300046492 Ga0495585_0065684 Ga0495585_0065684_376_978 200
554 3300046492 Ga0495585_0306652 Ga0495585_0306652_141_743 200
555 3300046499 Ga0495594_0016635 Ga0495594_0016635_429_1031 200
556 3300046499 Ga0495594_0022850 Ga0495594_0022850_931_1533 200
557 3300046500 Ga0495596_0006155 Ga0495596_0006155_3125_3730 200
558 3300046501 Ga0495607_0000411 Ga0495607_0000411_32361_32963 200
559 3300046501 Ga0495607_0003292 Ga0495607_0003292_7542_8144 200
560 3300046501 Ga0495607_0007091 Ga0495607_0007091_6708_7310 200
561 3300046501 Ga0495607_0008369 Ga0495607_0008369_4380_4982 200
562 3300046501 Ga0495607_0333335 Ga0495607_0333335_50_652 200
563 3300046506 Ga0495583_0003439 Ga0495583_0003439_9218_9820 200
564 3300046506 Ga0495583_0012803 Ga0495583_0012803_186_788 200
565 3300046507 Ga0495606_0002737 Ga0495606_0002737_4209_4811 200
566 3300046507 Ga0495606_0043657 Ga0495606_0043657_2222_2824 200
567 3300046507 Ga0495606_0174073 Ga0495606_0174073_566_1171 200
568 3300046507 Ga0495606_0212949 Ga0495606_0212949_295_897 200
569 3300046512 Ga0495610_0006447 Ga0495610_0006447_676_1278 200
570 3300046512 Ga0495610_0012908 Ga0495610_0012908_2755_3471 200
571 3300046512 Ga0495610_0050457 Ga0495610_0050457_252_932 200
572 3300046512 Ga0495610_0108460 Ga0495610_0108460_80_694 200
573 3300046512 Ga0495610_0114039 Ga0495610_0114039_414_1016 200
574 3300046513 Ga0495616_0021597 Ga0495616_0021597_2447_3049 200
575 3300046515 Ga0495620_0000046 Ga0495620_0000046_74327_74929 200
576 3300046516 Ga0495628_0010287 Ga0495628_0010287_7264_7872 200
577 3300046518 Ga0495631_0000955 Ga0495631_0000955_9998_10600 200
578 3300046518 Ga0495631_0013652 Ga0495631_0013652_117_719 200
579 3300046518 Ga0495631_0179313 Ga0495631_0179313_261_863 200
580 3300046519 Ga0495632_0001104 Ga0495632_0001104_17455_18057 200
581 3300046519 Ga0495632_0001282 Ga0495632_0001282_9832_10434 200
582 3300046520 Ga0495637_0006805 Ga0495637_0006805_763_1365 200
583 3300046520 Ga0495637_0022452 Ga0495637_0022452_2046_2648 200
584 3300046520 Ga0495637_0024071 Ga0495637_0024071_188_790 200
585 3300046520 Ga0495637_0056948 Ga0495637_0056948_25_627 200
586 3300046522 Ga0495643_0014773 Ga0495643_0014773_1339_1941 200
587 3300046523 Ga0495644_0012139 Ga0495644_0012139_74_676 200
588 3300046524 Ga0495648_0015363 Ga0495648_0015363_2646_3248 200
589 3300046524 Ga0495648_0019072 Ga0495648_0019072_1230_1832 200
590 3300046524 Ga0495648_0021049 Ga0495648_0021049_2135_2737 200
591 3300046524 Ga0495648_0021473 Ga0495648_0021473_497_1099 200
592 3300046524 Ga0495648_0038353 Ga0495648_0038353_2227_2829 200
593 3300046524 Ga0495648_0042482 Ga0495648_0042482_434_1036 200
594 3300046526 Ga0495666_0076812 Ga0495666_0076812_713_1315 200
595 3300046526 Ga0495666_0102266 Ga0495666_0102266_608_1210 200
596 3300046526 Ga0495666_0112604 Ga0495666_0112604_379_981 200
597 3300046528 Ga0495642_0006583 Ga0495642_0006583_472_1074 200
598 3300046528 Ga0495642_0089350 Ga0495642_0089350_463_1065 200
599 3300046530 Ga0495654_0002150 Ga0495654_0002150_5107_5709 200
600 3300046530 Ga0495654_0002557 Ga0495654_0002557_3676_4278 200
601 3300046530 Ga0495654_0006797 Ga0495654_0006797_2840_3442 200
602 3300046530 Ga0495654_0008007 Ga0495654_0008007_4529_5131 200
603 3300046530 Ga0495654_0044893 Ga0495654_0044893_797_1399 200
604 3300046530 Ga0495654_0061363 Ga0495654_0061363_733_1350 200
605 3300046536 Ga0495587_0021564 Ga0495587_0021564_114_716 200
606 3300046538 Ga0495609_0007194 Ga0495609_0007194_1623_2225 200
607 3300046538 Ga0495609_0169133 Ga0495609_0169133_291_893 200
608 3300046542 Ga0495597_0028178 Ga0495597_0028178_1238_1840 200
609 3300046542 Ga0495597_0130342 Ga0495597_0130342_16_618 200
610 3300046557 Ga0495622_0001748 Ga0495622_0001748_2684_3286 200
611 3300046557 Ga0495622_0002064 Ga0495622_0002064_4869_5471 200
612 3300046557 Ga0495622_0024138 Ga0495622_0024138_477_1079 200
613 3300046558 Ga0495633_0017145 Ga0495633_0017145_194_796 200
614 3300046615 Ga0495656_0000711 Ga0495656_0000711_8661_9263 200
615 3300046615 Ga0495656_0047448 Ga0495656_0047448_478_1080 200
616 3300046642 Ga0495634_0001752 Ga0495634_0001752_10237_10839 200
617 3300046648 Ga0495611_0012475 Ga0495611_0012475_435_1037 200
618 3300046660 Ga0495625_0004335 Ga0495625_0004335_6549_7151 200
619 3300046663 Ga0495635_0003099 Ga0495635_0003099_10248_10850 200
620 3300046664 Ga0495659_0000475 Ga0495659_0000475_7682_8284 200
621 3300046664 Ga0495659_0036981 Ga0495659_0036981_71_673 200
622 3300046664 Ga0495659_0081086 Ga0495659_0081086_550_1152 200
623 3300046665 Ga0495661_0001671 Ga0495661_0001671_1364_1966 200
624 3300046665 Ga0495661_0006087 Ga0495661_0006087_1074_1676 200
625 3300046665 Ga0495661_0030769 Ga0495661_0030769_526_1128 200
626 3300046665 Ga0495661_0219835 Ga0495661_0219835_372_974 200
627 3300046665 Ga0495661_0255204 Ga0495661_0255204_76_678 200
628 3300046674 Ga0495588_0007357 Ga0495588_0007357_3981_4583 200
629 3300046674 Ga0495588_0014823 Ga0495588_0014823_1338_1940 200
630 3300046674 Ga0495588_0019900 Ga0495588_0019900_2340_2942 200
631 3300046674 Ga0495588_0181880 Ga0495588_0181880_340_942 200
632 3300046675 Ga0495657_0021569 Ga0495657_0021569_157_855 200
633 3300046678 Ga0495599_0004928 Ga0495599_0004928_7126_7824 200
634 3300046679 Ga0495623_0039302 Ga0495623_0039302_1865_2467 200
635 3300046680 Ga0495646_0019001 Ga0495646_0019001_114_716 200
636 3300046684 Ga0495669_0004695 Ga0495669_0004695_4478_5080 200
637 3300046689 Ga0495613_0047415 Ga0495613_0047415_1976_2578 200
638 3300046690 Ga0495624_0006025 Ga0495624_0006025_2761_3459 200
639 3300046691 Ga0495670_0003382 Ga0495670_0003382_4416_5018 200
640 3300046691 Ga0495670_0008205 Ga0495670_0008205_3734_4336 200
641 3300046691 Ga0495670_0252554 Ga0495670_0252554_48_650 200
642 3300046691 Ga0495670_0320234 Ga0495670_0320234_31_633 200
643 3300046692 Ga0495671_0001718 Ga0495671_0001718_5448_6050 200
644 3300046692 Ga0495671_0004099 Ga0495671_0004099_1366_1968 200
645 3300046694 Ga0495649_0004079 Ga0495649_0004079_2847_3449 200
646 3300046694 Ga0495649_0014473 Ga0495649_0014473_3313_3915 200
647 3300046694 Ga0495649_0019636 Ga0495649_0019636_1061_1663 200
648 3300046694 Ga0495649_0095766 Ga0495649_0095766_249_851 200
649 3300046694 Ga0495649_0154753 Ga0495649_0154753_544_1146 200
650 3300046794 Ga0495589_0000002 Ga0495589_0000002_145993_146610 200
651 3300046794 Ga0495589_0000316 Ga0495589_0000316_34949_35551 200
652 3300046794 Ga0495589_0010734 Ga0495589_0010734_2451_3053 200
653 3300046794 Ga0495589_0017529 Ga0495589_0017529_2788_3390 200
654 3300046794 Ga0495589_0022296 Ga0495589_0022296_97_699 200
655 3300046794 Ga0495589_0037035 Ga0495589_0037035_103_705 200
656 3300046794 Ga0495589_0076528 Ga0495589_0076528_646_1248 200
657 3300046809 Ga0495600_0001683 Ga0495600_0001683_5273_5971 200
658 3300046810 Ga0495660_0000014 Ga0495660_0000014_276780_277442 200
659 3300046810 Ga0495660_0044853 Ga0495660_0044853_546_1148 200
660 3300046810 Ga0495660_0080886 Ga0495660_0080886_540_1142 200
661 3300047315 Ga0495581_0018253 Ga0495581_0018253_341_943 200
662 3300047317 Ga0495604_0009622 Ga0495604_0009622_2629_3327 200
663 3300047317 Ga0495604_0129159 Ga0495604_0129159_647_1249 200
664 3300047318 Ga0495636_0001719 Ga0495636_0001719_6044_6646 200
665 3300047318 Ga0495636_0380132 Ga0495636_0380132_15_620 200
666 3300047319 Ga0495674_0048328 Ga0495674_0048328_2451_3053 200
667 3300047320 Ga0495672_0000466 Ga0495672_0000466_23270_23872 200
668 3300047320 Ga0495672_0002855 Ga0495672_0002855_8260_8862 200
669 3300047320 Ga0495672_0012988 Ga0495672_0012988_738_1340 200
670 3300047320 Ga0495672_0014231 Ga0495672_0014231_205_807 200
671 3300047320 Ga0495672_0067189 Ga0495672_0067189_1007_1609 200
672 3300047320 Ga0495672_0088478 Ga0495672_0088478_1007_1609 200
673 3300047320 Ga0495672_0122834 Ga0495672_0122834_615_1217 200
674 3300047322 Ga0495680_0065001 Ga0495680_0065001_1453_2055 200
675 3300047323 Ga0495683_0001064 Ga0495683_0001064_7685_8287 200
676 3300047323 Ga0495683_0012748 Ga0495683_0012748_73_675 200
677 3300047323 Ga0495683_0020550 Ga0495683_0020550_2264_2866 200
678 3300047323 Ga0495683_0038618 Ga0495683_0038618_1321_1923 200
679 3300047323 Ga0495683_0077943 Ga0495683_0077943_707_1309 200
680 3300047443 Ga0495687_001366 Ga0495687_001366_14032_14634 200
681 3300047443 Ga0495687_002446 Ga0495687_002446_7420_8022 200
682 3300047443 Ga0495687_005004 Ga0495687_005004_2498_3100 200
683 3300047445 Ga0495677_0002912 Ga0495677_0002912_5673_6275 200
684 3300047446 Ga0495679_018277 Ga0495679_018277_1836_2438 200
685 3300047446 Ga0495679_128422 Ga0495679_128422_73_678 200
686 3300047447 Ga0495685_018729 Ga0495685_018729_1360_1962 200
687 3300047469 Ga0495673_0001574 Ga0495673_0001574_8634_9236 200
688 3300047469 Ga0495673_0005451 Ga0495673_0005451_3141_3743 200
689 3300047469 Ga0495673_0005619 Ga0495673_0005619_833_1435 200
690 3300047469 Ga0495673_0007416 Ga0495673_0007416_4007_4609 200
691 3300047469 Ga0495673_0020954 Ga0495673_0020954_530_1132 200
692 3300047469 Ga0495673_0031003 Ga0495673_0031003_735_1337 200
693 3300047470 Ga0495681_0001661 Ga0495681_0001661_8585_9187 200
694 3300047470 Ga0495681_0042081 Ga0495681_0042081_1002_1604 200
695 3300047673 Ga0495593_0047716 Ga0495593_0047716_1336_1938 200
696 3300048088 Ga0495602_0192465 Ga0495602_0192465_708_1406 200
697 3300048088 Ga0495602_0308645 Ga0495602_0308645_107_709 200
698 3300048091 Ga0495626_0002000 Ga0495626_0002000_6595_7197 200
699 3300048091 Ga0495626_0002125 Ga0495626_0002125_7388_7990 200
700 3300048091 Ga0495626_0002657 Ga0495626_0002657_7064_7666 200
701 3300048091 Ga0495626_0019589 Ga0495626_0019589_419_1021 200
702 3300048091 Ga0495626_0041491 Ga0495626_0041491_977_1579 200
703 3300048905 Ga0496102_0000428 Ga0496102_0000428_8133_8735 200
704 3300048905 Ga0496102_0005158 Ga0496102_0005158_8935_9540 200
705 3300048905 Ga0496102_0007116 Ga0496102_0007116_4802_5410 200
706 3300048906 Ga0496103_0003929 Ga0496103_0003929_4575_5177 200
707 3300048906 Ga0496103_0016491 Ga0496103_0016491_3356_3970 200
708 3300048906 Ga0496103_0033664 Ga0496103_0033664_606_1211 200
709 3300048906 Ga0496103_0088032 Ga0496103_0088032_1059_1676 200
710 3300048907 Ga0496104_0011766 Ga0496104_0011766_5274_5936 200
711 3300048907 Ga0496104_0086195 Ga0496104_0086195_1031_1636 200
712 3300048907 Ga0496104_0729289 Ga0496104_0729289_138_740 200
713 3300048908 Ga0496105_0050594 Ga0496105_0050594_2196_2801 200
714 3300048908 Ga0496105_0300328 Ga0496105_0300328_338_940 200
715 3300048909 Ga0496106_0083839 Ga0496106_0083839_1393_1995 200
716 3300048909 Ga0496106_0233265 Ga0496106_0233265_280_885 200
717 3300048913 Ga0496110_0241174 Ga0496110_0241174_637_1239 200
718 3300048915 Ga0496112_0330103 Ga0496112_0330103_221_829 200
719 3300048917 Ga0496114_0265119 Ga0496114_0265119_851_1453 200
720 3300048917 Ga0496114_0519237 Ga0496114_0519237_266_880 200
721 3300048918 Ga0496115_0000002 Ga0496115_0000002_353149_353763 200
722 3300048918 Ga0496115_0060537 Ga0496115_0060537_931_1533 200
723 3300048919 Ga0496116_0000023 Ga0496116_0000023_448387_449004 200
724 3300048919 Ga0496116_0000288 Ga0496116_0000288_59887_60549 200
725 3300048919 Ga0496116_0001134 Ga0496116_0001134_10708_11313 200
726 3300048919 Ga0496116_0001773 Ga0496116_0001773_6597_7199 200
727 3300048919 Ga0496116_0011727 Ga0496116_0011727_2097_2702 200
728 3300048919 Ga0496116_0013358 Ga0496116_0013358_4513_5127 200
729 3300048919 Ga0496116_0016138 Ga0496116_0016138_2997_3599 200
730 3300048919 Ga0496116_0032950 Ga0496116_0032950_706_1311 200
731 3300048919 Ga0496116_0110437 Ga0496116_0110437_453_1058 200
732 3300048920 Ga0496117_0000017 Ga0496117_0000017_415475_416080 200
733 3300048920 Ga0496117_0000100 Ga0496117_0000100_10037_10639 200
734 3300048920 Ga0496117_0000881 Ga0496117_0000881_43650_44255 200
735 3300048920 Ga0496117_0001508 Ga0496117_0001508_10321_10938 200
736 3300048920 Ga0496117_0004279 Ga0496117_0004279_912_1517 200
737 3300048920 Ga0496117_0004461 Ga0496117_0004461_7026_7631 200
738 3300048920 Ga0496117_0011254 Ga0496117_0011254_2280_2882 200
739 3300048920 Ga0496117_0015201 Ga0496117_0015201_4256_4918 200
740 3300048920 Ga0496117_0018488 Ga0496117_0018488_1611_2216 200
741 3300048920 Ga0496117_0094879 Ga0496117_0094879_793_1395 200
742 3300048920 Ga0496117_0133557 Ga0496117_0133557_492_1094 200
743 3300048920 Ga0496117_0156476 Ga0496117_0156476_192_806 200
744 3300048920 Ga0496117_0166625 Ga0496117_0166625_415_1032 200
745 3300048921 Ga0496118_0000018 Ga0496118_0000018_415475_416080 200
746 3300048921 Ga0496118_0000446 Ga0496118_0000446_63935_64540 200
747 3300048921 Ga0496118_0006957 Ga0496118_0006957_3389_4003 200
748 3300048921 Ga0496118_0010834 Ga0496118_0010834_3846_4448 200
749 3300048921 Ga0496118_0013425 Ga0496118_0013425_1665_2327 200
750 3300048921 Ga0496118_0018094 Ga0496118_0018094_1127_1732 200
751 3300048921 Ga0496118_0034507 Ga0496118_0034507_1910_2515 200
752 3300048921 Ga0496118_0040586 Ga0496118_0040586_2583_3185 200
753 3300048921 Ga0496118_0065795 Ga0496118_0065795_522_1136 200
754 3300048921 Ga0496118_0075574 Ga0496118_0075574_408_1013 200
755 3300048921 Ga0496118_0087713 Ga0496118_0087713_1117_1719 200
756 3300048921 Ga0496118_0092549 Ga0496118_0092549_819_1436 200
757 3300048922 Ga0496119_0001520 Ga0496119_0001520_19075_19680 200
758 3300048922 Ga0496119_0004367 Ga0496119_0004367_9248_9865 200
759 3300048922 Ga0496119_0012369 Ga0496119_0012369_4613_5218 200
760 3300048922 Ga0496119_0018312 Ga0496119_0018312_2462_3067 200
761 3300048922 Ga0496119_0032896 Ga0496119_0032896_1632_2237 200
762 3300048922 Ga0496119_0046911 Ga0496119_0046911_1203_1865 200
763 3300048922 Ga0496119_0052103 Ga0496119_0052103_108_710 200
764 3300048922 Ga0496119_0063357 Ga0496119_0063357_1477_2094 200
765 3300048923 Ga0496120_0000756 Ga0496120_0000756_36548_37153 200
766 3300048923 Ga0496120_0000801 Ga0496120_0000801_15293_15898 200
767 3300048923 Ga0496120_0001475 Ga0496120_0001475_23145_23762 200
768 3300048923 Ga0496120_0005017 Ga0496120_0005017_1450_2052 200
769 3300048923 Ga0496120_0014607 Ga0496120_0014607_2462_3067 200
770 3300048923 Ga0496120_0024408 Ga0496120_0024408_1004_1609 200
771 3300048924 Ga0496121_0000211 Ga0496121_0000211_8931_9545 200
772 3300048924 Ga0496121_0000492 Ga0496121_0000492_63044_63682 200
773 3300048924 Ga0496121_0003591 Ga0496121_0003591_1732_2337 200
774 3300048924 Ga0496121_0005934 Ga0496121_0005934_737_1342 200
775 3300048924 Ga0496121_0010805 Ga0496121_0010805_5181_5783 200
776 3300048924 Ga0496121_0037631 Ga0496121_0037631_3013_3621 200
777 3300048924 Ga0496121_0087045 Ga0496121_0087045_849_1451 200
778 3300048924 Ga0496121_0102898 Ga0496121_0102898_187_792 200
779 3300048924 Ga0496121_0136054 Ga0496121_0136054_425_1030 200
780 3300048925 Ga0496122_0000021 Ga0496122_0000021_355084_355698 200
781 3300048925 Ga0496122_0000545 Ga0496122_0000545_16399_17004 200
782 3300048925 Ga0496122_0000562 Ga0496122_0000562_15424_16086 200
783 3300048925 Ga0496122_0004076 Ga0496122_0004076_11642_12280 200
784 3300048925 Ga0496122_0004697 Ga0496122_0004697_12567_13172 200
785 3300048925 Ga0496122_0006570 Ga0496122_0006570_1731_2336 200
786 3300048925 Ga0496122_0006988 Ga0496122_0006988_7331_7933 200
787 3300048925 Ga0496122_0008314 Ga0496122_0008314_6855_7457 200
788 3300048925 Ga0496122_0010774 Ga0496122_0010774_1882_2487 200
789 3300048925 Ga0496122_0011919 Ga0496122_0011919_7795_8400 200
790 3300048925 Ga0496122_0035536 Ga0496122_0035536_1822_2424 200
791 3300048925 Ga0496122_0055189 Ga0496122_0055189_1476_2081 200
792 3300048925 Ga0496122_0382034 Ga0496122_0382034_77_679 200
793 3300048926 Ga0496123_0000174 Ga0496123_0000174_106788_107402 200
794 3300048926 Ga0496123_0000189 Ga0496123_0000189_92129_92734 200
795 3300048926 Ga0496123_0000200 Ga0496123_0000200_101071_101676 200
796 3300048926 Ga0496123_0000422 Ga0496123_0000422_60279_60941 200
797 3300048926 Ga0496123_0002636 Ga0496123_0002636_9208_9813 200
798 3300048926 Ga0496123_0003370 Ga0496123_0003370_15983_16588 200
799 3300048926 Ga0496123_0007219 Ga0496123_0007219_6824_7426 200
800 3300048926 Ga0496123_0012939 Ga0496123_0012939_318_923 200
801 3300048926 Ga0496123_0055453 Ga0496123_0055453_797_1435 200
802 3300048926 Ga0496123_0105772 Ga0496123_0105772_966_1571 200
803 3300048926 Ga0496123_0182337 Ga0496123_0182337_191_793 200
804 3300048927 Ga0496124_0000017 Ga0496124_0000017_25068_25685 200
805 3300048927 Ga0496124_0000066 Ga0496124_0000066_2203_2865 200
806 3300048927 Ga0496124_0001331 Ga0496124_0001331_25306_25911 200
807 3300048927 Ga0496124_0003122 Ga0496124_0003122_7885_8487 200
808 3300048927 Ga0496124_0019070 Ga0496124_0019070_3708_4313 200
809 3300048927 Ga0496124_0047710 Ga0496124_0047710_2811_3413 200
810 3300048927 Ga0496124_0057366 Ga0496124_0057366_1239_1844 200
811 3300048927 Ga0496124_0141951 Ga0496124_0141951_465_1070 200
812 3300048927 Ga0496124_0669032 Ga0496124_0669032_15_617 200
813 3300048928 Ga0496125_0000005 Ga0496125_0000005_147538_148152 200
814 3300048928 Ga0496125_0000033 Ga0496125_0000033_327347_328009 200
815 3300048928 Ga0496125_0000355 Ga0496125_0000355_30429_31067 200
816 3300048928 Ga0496125_0002571 Ga0496125_0002571_18865_19470 200
817 3300048928 Ga0496125_0003383 Ga0496125_0003383_3110_3715 200
818 3300048928 Ga0496125_0005826 Ga0496125_0005826_7309_7911 200
819 3300048928 Ga0496125_0011365 Ga0496125_0011365_7714_8316 200
820 3300048928 Ga0496125_0013660 Ga0496125_0013660_6783_7385 200
821 3300048928 Ga0496125_0014405 Ga0496125_0014405_4013_4630 200
822 3300048928 Ga0496125_0018498 Ga0496125_0018498_3419_4033 200
823 3300048928 Ga0496125_0028466 Ga0496125_0028466_518_1120 200
824 3300048928 Ga0496125_0049392 Ga0496125_0049392_2024_2629 200
825 3300048928 Ga0496125_0098545 Ga0496125_0098545_143_748 200
826 3300048929 Ga0496126_0000052 Ga0496126_0000052_300320_300934 200
827 3300048929 Ga0496126_0003448 Ga0496126_0003448_2542_3204 200
828 3300048929 Ga0496126_0004528 Ga0496126_0004528_5879_6484 200
829 3300048929 Ga0496126_0048458 Ga0496126_0048458_972_1574 200
830 3300048929 Ga0496126_0053397 Ga0496126_0053397_45_659 200
831 3300048929 Ga0496126_0193057 Ga0496126_0193057_1040_1675 200
832 3300048929 Ga0496126_0882501 Ga0496126_0882501_60_662 200
833 3300049459 Ga0495678_001326 Ga0495678_001326_7574_8176 200
834 3300049459 Ga0495678_022628 Ga0495678_022628_1962_2564 200
835 3300049460 Ga0495682_0044143 Ga0495682_0044143_523_1125 200
836 3300049569 Ga0501032_0245916 Ga0501032_0245916_30_638 200
837 3300049574 Ga0501038_0170851 Ga0501038_0170851_968_1576 200
838 3300049575 Ga0501039_0035498 Ga0501039_0035498_1091_1699 200
839 3300049576 Ga0501040_0003234 Ga0501040_0003234_8925_9533 200
840 3300049577 Ga0501041_0008304 Ga0501041_0008304_2503_3111 200
841 3300049580 Ga0501046_0072609 Ga0501046_0072609_410_1018 200
842 3300049582 Ga0501048_0073813 Ga0501048_0073813_420_1028 200
843 3300049587 Ga0501071_0146295 Ga0501071_0146295_186_794 200
844 3300049588 Ga0501072_0002188 Ga0501072_0002188_13481_14089 200
845 3300049589 Ga0501073_0041080 Ga0501073_0041080_246_854 200
846 3300049590 Ga0501074_0016923 Ga0501074_0016923_4208_4816 200
847 3300049591 Ga0501075_0042153 Ga0501075_0042153_1105_1713 200
848 3300049592 Ga0501076_0030268 Ga0501076_0030268_1517_2125 200
849 3300049593 Ga0501077_0000947 Ga0501077_0000947_433_1041 200
850 3300049679 Ga0501249_005345 Ga0501249_005345_265_903 200
851 3300049741 Ga0501079_0078556 Ga0501079_0078556_440_1048 200
852 3300049742 Ga0501080_0008005 Ga0501080_0008005_6255_6863 200
853 3300049742 Ga0501080_0372279 Ga0501080_0372279_265_981 200
854 3300049743 Ga0501081_0206530 Ga0501081_0206530_245_853 200
855 3300049744 Ga0501083_0031956 Ga0501083_0031956_868_1476 200
856 3300049766 Ga0501269_000165 Ga0501269_000165_4190_4828 200
857 3300049824 Ga0501045_0015814 Ga0501045_0015814_4306_4914 200
858 3300050489 nmdc:mga03683_105454_c1 nmdc:mga03683_105454_c1_483_1085 200
859 3300050491 nmdc:mga00v17_368287_c1 nmdc:mga00v17_368287_c1_192_797 200
860 3300050516 nmdc:mga0sz30_12993_c1 nmdc:mga0sz30_12993_c1_789_1391 200
861 3300053077 Ga0495601_0001480 Ga0495601_0001480_6716_7414 200
862 3300053119 Ga0500595_005107 Ga0500595_005107_5033_5641 200
863 3300053125 Ga0500618_005498 Ga0500618_005498_3157_3759 200
864 3300053140 Ga0500573_0230181 Ga0500573_0230181_194_892 200
865 3300053153 Ga0500616_0139173 Ga0500616_0139173_458_1060 200
866 3300053154 Ga0500619_003223 Ga0500619_003223_1719_2417 200
867 3300053161 Ga0500634_0000240 Ga0500634_0000240_16004_16606 200
868 3300053723 Ga0500567_022233 Ga0500567_022233_1270_1926 200
869 3300054114 Ga0501084_0008006 Ga0501084_0008006_7710_8318 200
870 3300060353 Ga0501082_0008685 Ga0501082_0008685_6868_7476 200
871 iso_pu_bacteria 2602042046 2603641395 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

75

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

76

0.95

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

113

188

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

11

81

0.88

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

110

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uap-assembly1.cif.gz_A crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath 0.9819 2 199
1pmt-assembly1.cif.gz_A glutathione transferase from proteus mirabilis 0.9816 1 198
2dsa-assembly2.cif.gz_C ternary complex of bphk, a bacterial gst 0.9815 1 200
1f2e-assembly1.cif.gz_A structure of sphingomonad, glutathione s-transferase complexed with glutathione 0.9725 1 199
4gci-assembly1.cif.gz_B crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form 0.9707 2 200
ID Description Score Start End Superfamily
2dsaC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9922 1 82 3.40.30.10
2dsaD02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9789 83 188 1.20.1050.10
2gdrB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9749 83 188 1.20.1050.10
2dsaC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9727 83 188 1.20.1050.10
2gdrF02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9726 83 188 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A2J4XVA0-F1-model_v4 Glutathione transferase GstA 0.9939 1 108 GO:0016740
AF-A0A1I1I7F4-F1-model_v4 Glutathione S-transferase 0.9913 1 199 GO:0016740
AF-A0A1I3YP29-F1-model_v4 deleted 0.9912 2 200
AF-A0A1T4LTD2-F1-model_v4 Glutathione S-transferase 0.9902 1 200 GO:0016740
AF-A0A011N0X2-F1-model_v4 Glutathione S-transferase GstA (EC 2.5.1.18) 0.9887 2 198 GO:0004364

Feature Viewer

pLDDT pTM Quality
96.82 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map