F484199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 871 | 457 | 725 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300046513|Ga0495616_0001804|Ga0495616_0001804_8504_9103 |
| Length | 199 |
| Sequence | MKLYYAPQACSLAPHIVLRELQLPFVLIRVDNRSKRTTSGEDFLAINPKGYVAALQLENGEVLTEGPAILQYLADLQPQSGLAPAPAPGSFERVRLQEWLNFVSSEIHGGLGALFDERMPAEVIKEKLFKRFAVLVAVLEQQDYLLPSGFSVADALLFVVLRWAGLFGIELERWPALARFQDRIGKRPTVIAALTAEAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 4 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 5 | 2508501071 | Serratia proteamaculans S4 | Isolate | Rhizosphere |
| 6 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 7 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 10 | 2554235234 | Klebsiella michiganensis SA2 | Isolate | Unclassified |
| 11 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 12 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 13 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 14 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 15 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 16 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 17 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 18 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 19 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 20 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 21 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 22 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 23 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 24 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 25 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 26 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 27 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 28 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 29 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 30 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 31 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 32 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 33 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 34 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 35 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 36 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 37 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 38 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 39 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 40 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 41 | 2600255256 | Enterobacter sp. NFIX08 | Isolate | Rhizoplane |
| 42 | 2600255257 | Enterobacter sp. NFIX03 | Isolate | Rhizoplane |
| 43 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 44 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 45 | 2600255310 | Enterobacter sp. NFIX06 | Isolate | Rhizoplane |
| 46 | 2600255311 | Enterobacter sp. NFIX04 | Isolate | Rhizoplane |
| 47 | 2602042046 | Enterobacter sp. NFIX09 | Isolate | Rhizoplane |
| 48 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 49 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 50 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 51 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 52 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 53 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 54 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 55 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 56 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 57 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 58 | 2667528173 | Rahnella sp. NFIX50 | Isolate | Rhizoplane |
| 59 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 60 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 61 | 2671180115 | Cedecea sp. NFIX57 | Isolate | Rhizoplane |
| 62 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 63 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 64 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 65 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 66 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 67 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 68 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 69 | 2734482264 | Dyella sp. AD052 | Isolate | Unclassified |
| 70 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 71 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 72 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 73 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 74 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 75 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 76 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 77 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 78 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 79 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 80 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 81 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 82 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 83 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 84 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 85 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 86 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 87 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 88 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 89 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 90 | 2811995292 | Kosakonia oryzae Ola 51 | Isolate | Unclassified |
| 91 | 2814123068 | Kosakonia radicincitans GXGL-4A | Isolate | Rhizosphere |
| 92 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 93 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 94 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 95 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 96 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 97 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 98 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 99 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 100 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 101 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 102 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 103 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 104 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 105 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 106 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 107 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 108 | 2904474040 | Rahnella aquatilis 4485 | Isolate | Rhizosphere |
| 109 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 110 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 111 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 112 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 113 | 2919108558 | Klebsiella sp. 1400 | Isolate | Rhizosphere |
| 114 | 2919150387 | Rahnella aceris 1817 | Isolate | Unclassified |
| 115 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 116 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 117 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 118 | 2927143783 | Rahnella sp. 2050 | Isolate | Unclassified |
| 119 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 120 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 121 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 122 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 123 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 124 | 2937539931 | Pantoea sp. LS15 | Isolate | Unclassified |
| 125 | 2941479691 | |||
| 126 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 127 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 128 | 2971820967 | Klebsiella sp. MPUS7 | Isolate | Rhizosphere |
| 129 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 130 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 131 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 132 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 133 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 134 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 135 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 136 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 137 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 138 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 139 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 140 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 141 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 142 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 143 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 144 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 145 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 146 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 147 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 148 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 149 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 150 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 151 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 152 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 153 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 154 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 155 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 156 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 157 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 158 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 160 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 161 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 162 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 165 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 166 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 167 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 169 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 170 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 171 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 172 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 173 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 174 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 175 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 176 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 177 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 178 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 179 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 180 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 181 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 182 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 183 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 184 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 185 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 186 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 187 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 188 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 189 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 190 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 191 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 192 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 193 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 194 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 195 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 196 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 197 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 199 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 200 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 201 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 202 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 203 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 204 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 205 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 206 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 207 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 208 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 209 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 210 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 211 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 212 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 213 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 214 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 215 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 216 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 217 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 218 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 219 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 220 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 221 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 222 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 223 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 224 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 225 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 226 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 227 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 228 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 229 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 230 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 231 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 232 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 233 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 234 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 235 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 236 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 237 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 238 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 239 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 240 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 241 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 242 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 243 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 244 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 255 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 256 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 257 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 258 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 260 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 261 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 264 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 265 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 266 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 267 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 268 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 269 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 270 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 271 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 272 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 273 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 274 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 275 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 276 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 277 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 278 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 279 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 280 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 281 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 282 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 283 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 284 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 285 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 286 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 287 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 288 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 289 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 290 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 291 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 292 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 293 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 294 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 295 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 296 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 297 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 298 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 299 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 300 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 301 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 302 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 303 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 304 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 305 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 306 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 307 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 308 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 309 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 310 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 311 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 312 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 313 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 314 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 392 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 393 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 394 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 395 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 396 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 397 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 398 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 402 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 403 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 404 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 405 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 406 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 407 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 408 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 409 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 410 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 411 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 412 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 413 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 414 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 415 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 421 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 426 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 427 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 428 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 429 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 430 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 432 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 434 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 435 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 436 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 437 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 440 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 441 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 442 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 443 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 444 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 445 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 446 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 447 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 448 | 640753048 | Serratia proteamaculans 568 | Isolate | Endosphere |
| 449 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 450 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 451 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 452 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 453 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 454 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 455 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 456 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 457 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.24 |
| Metatranscriptomes | 0 |
| Isolates | 16.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 8.27 |
| Nodule | 1.26 |
| Rhizoplane | 7.81 |
| Rhizosphere | 62.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 20.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1351 | 2124908027 | Bacteria | 1291 |
| 2 | MRS2a_Contig_27077 | 2124908027 | Bacteria | 761 |
| 3 | MRS2a_Contig_339 | 2124908027 | Bacteria | 17793 |
| 4 | SwRhRL2b_contig_783059 | 2162886007 | Bacteria | 3887 |
| 5 | JGI24739J22299_10097095 | 3300001989 | Bacteria | 892 |
| 6 | JGI25162J39368_1000038 | 3300002737 | Bacteria | 179049 |
| 7 | JGI25162J39368_1000092 | 3300002737 | Bacteria | 100905 |
| 8 | JGI25162J39368_1000231 | 3300002737 | Bacteria | 56968 |
| 9 | JGI25162J39368_1002383 | 3300002737 | Bacteria | 7411 |
| 10 | JGI25163J39215_1000013 | 3300002771 | Bacteria | 86331 |
| 11 | JGI25163J39215_1000504 | 3300002771 | Bacteria | 11627 |
| 12 | JGI25164J39214_1000071 | 3300002772 | Bacteria | 100905 |
| 13 | JGI25164J39214_1000179 | 3300002772 | Bacteria | 56968 |
| 14 | JGI25151J46595_10000559 | 3300003187 | Bacteria | 33736 |
| 15 | JGI25151J46595_10000719 | 3300003187 | Bacteria | 27557 |
| 16 | JGI25165J46597_1000045 | 3300003214 | Bacteria | 257539 |
| 17 | JGI25165J46597_1000327 | 3300003214 | Bacteria | 56968 |
| 18 | JGI25153J46596_10039030 | 3300003215 | Bacteria | 1488 |
| 19 | rootH2_10110653 | 3300003320 | Bacteria | 1386 |
| 20 | rootL2_10018643 | 3300003322 | Bacteria | 2411 |
| 21 | rootL2_10155604 | 3300003322 | Bacteria | 4673 |
| 22 | JGI25160J50197_1004440 | 3300003354 | Bacteria | 6068 |
| 23 | Ga0055538_1000022 | 3300003751 | Bacteria | 257539 |
| 24 | Ga0055538_1000064 | 3300003751 | Bacteria | 100905 |
| 25 | Ga0055539_1000028 | 3300003752 | Bacteria | 257539 |
| 26 | Ga0055539_1000098 | 3300003752 | Bacteria | 100905 |
| 27 | Ga0055533_1000036 | 3300003756 | Bacteria | 257539 |
| 28 | Ga0055533_1000108 | 3300003756 | Bacteria | 100905 |
| 29 | Ga0055525_1000071 | 3300003759 | Bacteria | 182624 |
| 30 | Ga0055525_1000141 | 3300003759 | Bacteria | 100905 |
| 31 | Ga0055525_1007489 | 3300003759 | Bacteria | 921 |
| 32 | Ga0055530_10000105 | 3300003791 | Bacteria | 71978 |
| 33 | Ga0055530_10000256 | 3300003791 | Bacteria | 47915 |
| 34 | Ga0055540_1001478 | 3300003792 | Bacteria | 13987 |
| 35 | Ga0055541_1000037 | 3300003841 | Bacteria | 182624 |
| 36 | Ga0055541_1000065 | 3300003841 | Bacteria | 100905 |
| 37 | Ga0058692_1000135 | 3300003856 | Bacteria | 46715 |
| 38 | Ga0058692_1014160 | 3300003856 | Bacteria | 1835 |
| 39 | Ga0065703_1021008 | 3300005272 | Bacteria | 1395 |
| 40 | Ga0065714_10000495 | 3300005288 | Bacteria | 4231 |
| 41 | Ga0065714_10069538 | 3300005288 | Bacteria | 4188 |
| 42 | Ga0065704_10000285 | 3300005289 | Bacteria | 54664 |
| 43 | Ga0065704_10004692 | 3300005289 | Bacteria | 3244 |
| 44 | Ga0065712_10006415 | 3300005290 | Bacteria | 3365 |
| 45 | Ga0065715_10028109 | 3300005293 | Bacteria | 2147 |
| 46 | Ga0070658_10190676 | 3300005327 | Bacteria | 1727 |
| 47 | Ga0070676_10097935 | 3300005328 | Bacteria | 1807 |
| 48 | Ga0070690_100724861 | 3300005330 | Bacteria | 765 |
| 49 | Ga0070670_100000161 | 3300005331 | Bacteria | 60718 |
| 50 | Ga0070670_100000221 | 3300005331 | Bacteria | 52485 |
| 51 | Ga0070670_100325150 | 3300005331 | Bacteria | 1348 |
| 52 | Ga0068869_100466195 | 3300005334 | Bacteria | 1049 |
| 53 | Ga0070666_10248026 | 3300005335 | Bacteria | 1260 |
| 54 | Ga0068868_100355727 | 3300005338 | Bacteria | 1255 |
| 55 | Ga0070661_100000640 | 3300005344 | Bacteria | 25992 |
| 56 | Ga0070668_100034128 | 3300005347 | Bacteria | 3877 |
| 57 | Ga0070669_100000299 | 3300005353 | Bacteria | 38931 |
| 58 | Ga0070675_100216966 | 3300005354 | Bacteria | 1665 |
| 59 | Ga0070673_100177993 | 3300005364 | Bacteria | 1819 |
| 60 | Ga0070688_100428084 | 3300005365 | Bacteria | 985 |
| 61 | Ga0070667_100321849 | 3300005367 | Bacteria | 1395 |
| 62 | Ga0070662_100001026 | 3300005457 | Bacteria | 17077 |
| 63 | Ga0070662_100098528 | 3300005457 | Bacteria | 2208 |
| 64 | Ga0070662_100207068 | 3300005457 | Bacteria | 1559 |
| 65 | Ga0070684_100414485 | 3300005535 | Bacteria | 1243 |
| 66 | Ga0068853_100033799 | 3300005539 | Bacteria | 4338 |
| 67 | Ga0068853_100472424 | 3300005539 | Bacteria | 1181 |
| 68 | Ga0070672_100045412 | 3300005543 | Bacteria | 3398 |
| 69 | Ga0070693_100096092 | 3300005547 | Bacteria | 1795 |
| 70 | Ga0070665_100039980 | 3300005548 | Bacteria | 4715 |
| 71 | Ga0068855_100059616 | 3300005563 | Bacteria | 4465 |
| 72 | Ga0070664_100000489 | 3300005564 | Bacteria | 29977 |
| 73 | Ga0070664_100146767 | 3300005564 | Bacteria | 2081 |
| 74 | Ga0068857_100667298 | 3300005577 | Bacteria | 986 |
| 75 | Ga0068854_100008186 | 3300005578 | Bacteria | 6707 |
| 76 | Ga0068856_100057337 | 3300005614 | Bacteria | 3845 |
| 77 | Ga0068856_100192049 | 3300005614 | Bacteria | 2056 |
| 78 | Ga0068859_100556123 | 3300005617 | Bacteria | 1242 |
| 79 | Ga0068851_10000036 | 3300005834 | Bacteria | 105179 |
| 80 | Ga0068870_10402166 | 3300005840 | Bacteria | 891 |
| 81 | Ga0068860_100551405 | 3300005843 | Bacteria | 1155 |
| 82 | Ga0081540_1049520 | 3300005983 | Bacteria | 2095 |
| 83 | Ga0070717_10085800 | 3300006028 | Bacteria | 2650 |
| 84 | Ga0075364_10009886 | 3300006051 | Bacteria | 5739 |
| 85 | Ga0075364_10062388 | 3300006051 | Bacteria | 2445 |
| 86 | Ga0075432_10000389 | 3300006058 | Bacteria | 12729 |
| 87 | Ga0075432_10084063 | 3300006058 | Bacteria | 1157 |
| 88 | Ga0075369_10028270 | 3300006186 | Bacteria | 2350 |
| 89 | Ga0068865_100017011 | 3300006881 | Bacteria | 4668 |
| 90 | Ga0097620_100556117 | 3300006931 | Bacteria | 1242 |
| 91 | Ga0079104_1005087 | 3300006946 | Bacteria | 5358 |
| 92 | Ga0079104_1057562 | 3300006946 | Bacteria | 847 |
| 93 | Ga0099794_10000054 | 3300007265 | Bacteria | 43801 |
| 94 | Ga0105251_10000109 | 3300009011 | Bacteria | 81396 |
| 95 | Ga0105251_10000632 | 3300009011 | Bacteria | 32332 |
| 96 | Ga0105251_10002446 | 3300009011 | Bacteria | 14593 |
| 97 | Ga0105251_10002477 | 3300009011 | Bacteria | 14465 |
| 98 | Ga0105251_10004209 | 3300009011 | Bacteria | 9956 |
| 99 | Ga0105251_10005496 | 3300009011 | Bacteria | 8258 |
| 100 | Ga0105251_10007551 | 3300009011 | Bacteria | 6676 |
| 101 | Ga0105251_10112568 | 3300009011 | Bacteria | 1239 |
| 102 | Ga0105251_10138322 | 3300009011 | Bacteria | 1102 |
| 103 | Ga0105251_10232389 | 3300009011 | Bacteria | 830 |
| 104 | Ga0105244_10000690 | 3300009036 | Bacteria | 29348 |
| 105 | Ga0105244_10001260 | 3300009036 | Bacteria | 20753 |
| 106 | Ga0105244_10001623 | 3300009036 | Bacteria | 17821 |
| 107 | Ga0105244_10002664 | 3300009036 | Bacteria | 13380 |
| 108 | Ga0105244_10006790 | 3300009036 | Bacteria | 7362 |
| 109 | Ga0105244_10007221 | 3300009036 | Bacteria | 7084 |
| 110 | Ga0105244_10036931 | 3300009036 | Bacteria | 2556 |
| 111 | Ga0105244_10051389 | 3300009036 | Bacteria | 2100 |
| 112 | Ga0105244_10052630 | 3300009036 | Bacteria | 2072 |
| 113 | Ga0105244_10161982 | 3300009036 | Bacteria | 1068 |
| 114 | Ga0105250_10000980 | 3300009092 | Bacteria | 16633 |
| 115 | Ga0105250_10001610 | 3300009092 | Bacteria | 12083 |
| 116 | Ga0105250_10003840 | 3300009092 | Bacteria | 7046 |
| 117 | Ga0105250_10020674 | 3300009092 | Bacteria | 2659 |
| 118 | Ga0105240_10021162 | 3300009093 | Bacteria | 8659 |
| 119 | Ga0105240_10040554 | 3300009093 | Bacteria | 5953 |
| 120 | Ga0105240_10076396 | 3300009093 | Bacteria | 4129 |
| 121 | Ga0105247_10000025 | 3300009101 | Bacteria | 208459 |
| 122 | Ga0105243_10006244 | 3300009148 | Bacteria | 9208 |
| 123 | Ga0105243_10135564 | 3300009148 | Bacteria | 2094 |
| 124 | Ga0105241_10000005 | 3300009174 | Bacteria | 384203 |
| 125 | Ga0105242_10000238 | 3300009176 | Bacteria | 43389 |
| 126 | Ga0105242_10566113 | 3300009176 | Bacteria | 1092 |
| 127 | Ga0105239_10001431 | 3300010375 | Bacteria | 31823 |
| 128 | Ga0105239_10770933 | 3300010375 | Bacteria | 1101 |
| 129 | Ga0105246_10210134 | 3300011119 | Bacteria | 1518 |
| 130 | Ga0105246_10684597 | 3300011119 | Bacteria | 897 |
| 131 | Ga0157373_10004421 | 3300013100 | Bacteria | 10589 |
| 132 | Ga0157373_10005271 | 3300013100 | Bacteria | 9710 |
| 133 | Ga0157373_10005861 | 3300013100 | Bacteria | 9191 |
| 134 | Ga0157373_10007988 | 3300013100 | Bacteria | 7867 |
| 135 | Ga0157373_10179482 | 3300013100 | Bacteria | 1490 |
| 136 | Ga0157371_10003359 | 3300013102 | Bacteria | 14572 |
| 137 | Ga0157371_10259645 | 3300013102 | Bacteria | 1252 |
| 138 | Ga0157371_10264236 | 3300013102 | Bacteria | 1241 |
| 139 | Ga0157370_10024387 | 3300013104 | Bacteria | 5991 |
| 140 | Ga0157370_10060151 | 3300013104 | Bacteria | 3608 |
| 141 | Ga0157370_10070146 | 3300013104 | Bacteria | 3309 |
| 142 | Ga0157370_10100182 | 3300013104 | Bacteria | 2715 |
| 143 | Ga0157370_10204410 | 3300013104 | Bacteria | 1831 |
| 144 | Ga0157370_10238850 | 3300013104 | Bacteria | 1681 |
| 145 | Ga0157370_10250296 | 3300013104 | Bacteria | 1639 |
| 146 | Ga0157370_10272285 | 3300013104 | Bacteria | 1564 |
| 147 | Ga0157370_10451491 | 3300013104 | Bacteria | 1182 |
| 148 | Ga0157370_10981132 | 3300013104 | Bacteria | 765 |
| 149 | Ga0157369_10000646 | 3300013105 | Bacteria | 45033 |
| 150 | Ga0157369_10005544 | 3300013105 | Bacteria | 14663 |
| 151 | Ga0157369_10007554 | 3300013105 | Bacteria | 12507 |
| 152 | Ga0157369_10009657 | 3300013105 | Bacteria | 11032 |
| 153 | Ga0157369_10064490 | 3300013105 | Bacteria | 3945 |
| 154 | Ga0157369_10093023 | 3300013105 | Bacteria | 3218 |
| 155 | Ga0157369_10249118 | 3300013105 | Bacteria | 1854 |
| 156 | Ga0157374_10035668 | 3300013296 | Bacteria | 4551 |
| 157 | Ga0157372_10003765 | 3300013307 | Bacteria | 16290 |
| 158 | Ga0157372_10008148 | 3300013307 | Bacteria | 11138 |
| 159 | Ga0157372_10141186 | 3300013307 | Bacteria | 2775 |
| 160 | Ga0157372_10205989 | 3300013307 | Bacteria | 2279 |
| 161 | Ga0157372_10664017 | 3300013307 | Bacteria | 1214 |
| 162 | Ga0157375_10000979 | 3300013308 | Bacteria | 24702 |
| 163 | Ga0157375_10011925 | 3300013308 | Bacteria | 7690 |
| 164 | Ga0157375_10186611 | 3300013308 | Bacteria | 2227 |
| 165 | Ga0163163_10829545 | 3300014325 | Bacteria | 988 |
| 166 | Ga0182008_10000753 | 3300014497 | Bacteria | 22750 |
| 167 | Ga0182008_10001764 | 3300014497 | Bacteria | 14173 |
| 168 | Ga0182008_10002169 | 3300014497 | Bacteria | 12486 |
| 169 | Ga0182008_10002354 | 3300014497 | Bacteria | 11896 |
| 170 | Ga0182008_10016078 | 3300014497 | Bacteria | 3893 |
| 171 | Ga0157376_10035314 | 3300014969 | Bacteria | 4043 |
| 172 | Ga0182006_1002148 | 3300015261 | Bacteria | 10942 |
| 173 | Ga0182006_1007173 | 3300015261 | Bacteria | 5123 |
| 174 | Ga0182006_1007195 | 3300015261 | Bacteria | 5112 |
| 175 | Ga0182007_10002918 | 3300015262 | Bacteria | 8307 |
| 176 | Ga0182007_10003477 | 3300015262 | Bacteria | 7415 |
| 177 | Ga0182005_1000928 | 3300015265 | Bacteria | 12791 |
| 178 | Ga0182005_1002531 | 3300015265 | Bacteria | 6489 |
| 179 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 180 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 181 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 182 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 183 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 184 | Ga0163161_10037352 | 3300017792 | Bacteria | 3482 |
| 185 | Ga0163161_10057629 | 3300017792 | Bacteria | 2822 |
| 186 | Ga0163161_10136388 | 3300017792 | Bacteria | 1855 |
| 187 | Ga0163161_10365862 | 3300017792 | Bacteria | 1149 |
| 188 | Ga0209760_100189 | 3300025207 | Bacteria | 30616 |
| 189 | Ga0209760_100257 | 3300025207 | Bacteria | 21351 |
| 190 | Ga0209760_102005 | 3300025207 | Bacteria | 1981 |
| 191 | Ga0209784_100001 | 3300025224 | Bacteria | 3600592 |
| 192 | Ga0209784_100036 | 3300025224 | Bacteria | 263689 |
| 193 | Ga0209566_100001 | 3300025225 | Bacteria | 3600765 |
| 194 | Ga0209566_100044 | 3300025225 | Bacteria | 263689 |
| 195 | Ga0209674_100002 | 3300025226 | Bacteria | 3600592 |
| 196 | Ga0209674_100065 | 3300025226 | Bacteria | 263689 |
| 197 | Ga0209563_100002 | 3300025230 | Bacteria | 2045675 |
| 198 | Ga0209563_100063 | 3300025230 | Bacteria | 263689 |
| 199 | Ga0209563_101321 | 3300025230 | Bacteria | 6766 |
| 200 | Ga0207427_100008 | 3300025231 | Bacteria | 740731 |
| 201 | Ga0207427_100020 | 3300025231 | Bacteria | 507515 |
| 202 | Ga0207427_100664 | 3300025231 | Bacteria | 16489 |
| 203 | Ga0209437_100001 | 3300025233 | Bacteria | 2045675 |
| 204 | Ga0209437_100014 | 3300025233 | Bacteria | 740714 |
| 205 | Ga0209437_100032 | 3300025233 | Bacteria | 520075 |
| 206 | Ga0209437_100082 | 3300025233 | Bacteria | 263689 |
| 207 | Ga0209677_100002 | 3300025253 | Bacteria | 2045675 |
| 208 | Ga0209677_100038 | 3300025253 | Bacteria | 263689 |
| 209 | Ga0209233_1000008 | 3300025261 | Bacteria | 1356712 |
| 210 | Ga0209233_1000109 | 3300025261 | Bacteria | 263689 |
| 211 | Ga0209130_1000436 | 3300025284 | Bacteria | 44714 |
| 212 | Ga0209676_1000006 | 3300025292 | Bacteria | 1039588 |
| 213 | Ga0209025_1000099 | 3300025294 | Bacteria | 231353 |
| 214 | Ga0209758_1001714 | 3300025297 | Bacteria | 24545 |
| 215 | Ga0209050_1000070 | 3300025298 | Bacteria | 296366 |
| 216 | Ga0207426_1000065 | 3300025302 | Bacteria | 353625 |
| 217 | Ga0209051_1000093 | 3300025303 | Bacteria | 169092 |
| 218 | Ga0207697_10133950 | 3300025315 | Bacteria | 1072 |
| 219 | Ga0207656_10000021 | 3300025321 | Bacteria | 113329 |
| 220 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 221 | Ga0207696_1000073 | 3300025711 | Bacteria | 215388 |
| 222 | Ga0207696_1002951 | 3300025711 | Bacteria | 7969 |
| 223 | Ga0207696_1026790 | 3300025711 | Bacteria | 1781 |
| 224 | Ga0207655_1000021 | 3300025728 | Bacteria | 518596 |
| 225 | Ga0207655_1000060 | 3300025728 | Bacteria | 260572 |
| 226 | Ga0207655_1000595 | 3300025728 | Bacteria | 44227 |
| 227 | Ga0207655_1000679 | 3300025728 | Bacteria | 39682 |
| 228 | Ga0207655_1001849 | 3300025728 | Bacteria | 18288 |
| 229 | Ga0207655_1001923 | 3300025728 | Bacteria | 17778 |
| 230 | Ga0207655_1002280 | 3300025728 | Bacteria | 15795 |
| 231 | Ga0207655_1002998 | 3300025728 | Bacteria | 12932 |
| 232 | Ga0207655_1010672 | 3300025728 | Bacteria | 5553 |
| 233 | Ga0207655_1019953 | 3300025728 | Bacteria | 3474 |
| 234 | Ga0207655_1023432 | 3300025728 | Bacteria | 3062 |
| 235 | Ga0207713_1000003 | 3300025735 | Bacteria | 860698 |
| 236 | Ga0207713_1000011 | 3300025735 | Bacteria | 507224 |
| 237 | Ga0207713_1000092 | 3300025735 | Bacteria | 148309 |
| 238 | Ga0207713_1000142 | 3300025735 | Bacteria | 107313 |
| 239 | Ga0207713_1000671 | 3300025735 | Bacteria | 32337 |
| 240 | Ga0207713_1002192 | 3300025735 | Bacteria | 14482 |
| 241 | Ga0207713_1010307 | 3300025735 | Bacteria | 5185 |
| 242 | Ga0207713_1014047 | 3300025735 | Bacteria | 4182 |
| 243 | Ga0207713_1014492 | 3300025735 | Bacteria | 4092 |
| 244 | Ga0207713_1014499 | 3300025735 | Bacteria | 4091 |
| 245 | Ga0207713_1015037 | 3300025735 | Bacteria | 3988 |
| 246 | Ga0207713_1017844 | 3300025735 | Bacteria | 3536 |
| 247 | Ga0207713_1033314 | 3300025735 | Bacteria | 2252 |
| 248 | Ga0207710_10000074 | 3300025900 | Bacteria | 147390 |
| 249 | Ga0207645_10128755 | 3300025907 | Bacteria | 1647 |
| 250 | Ga0207643_10277292 | 3300025908 | Bacteria | 1039 |
| 251 | Ga0207705_10265352 | 3300025909 | Bacteria | 1312 |
| 252 | Ga0207654_10000007 | 3300025911 | Bacteria | 384211 |
| 253 | Ga0207695_10065987 | 3300025913 | Bacteria | 3719 |
| 254 | Ga0207671_10000263 | 3300025914 | Bacteria | 78721 |
| 255 | Ga0207649_10000288 | 3300025920 | Bacteria | 39325 |
| 256 | Ga0207681_10001287 | 3300025923 | Bacteria | 16196 |
| 257 | Ga0207650_10000191 | 3300025925 | Bacteria | 71126 |
| 258 | Ga0207650_10000194 | 3300025925 | Bacteria | 70396 |
| 259 | Ga0207650_10259019 | 3300025925 | Bacteria | 1410 |
| 260 | Ga0207650_10351626 | 3300025925 | Bacteria | 1212 |
| 261 | Ga0207659_10096672 | 3300025926 | Bacteria | 2217 |
| 262 | Ga0207706_10000493 | 3300025933 | Bacteria | 42224 |
| 263 | Ga0207706_10012239 | 3300025933 | Bacteria | 7819 |
| 264 | Ga0207706_10259521 | 3300025933 | Bacteria | 1517 |
| 265 | Ga0207686_10011944 | 3300025934 | Bacteria | 4767 |
| 266 | Ga0207709_10027877 | 3300025935 | Bacteria | 3259 |
| 267 | Ga0207709_10193879 | 3300025935 | Bacteria | 1445 |
| 268 | Ga0207704_10102824 | 3300025938 | Bacteria | 1909 |
| 269 | Ga0207691_10028446 | 3300025940 | Bacteria | 5234 |
| 270 | Ga0207689_10245149 | 3300025942 | Bacteria | 1481 |
| 271 | Ga0207679_10000226 | 3300025945 | Bacteria | 44414 |
| 272 | Ga0207679_10164444 | 3300025945 | Bacteria | 1820 |
| 273 | Ga0207667_10071345 | 3300025949 | Bacteria | 3612 |
| 274 | Ga0207640_10035714 | 3300025981 | Bacteria | 3113 |
| 275 | Ga0207658_10546123 | 3300025986 | Bacteria | 1036 |
| 276 | Ga0207639_10014082 | 3300026041 | Bacteria | 5614 |
| 277 | Ga0207639_10699654 | 3300026041 | Bacteria | 940 |
| 278 | Ga0207702_10001503 | 3300026078 | Bacteria | 23056 |
| 279 | Ga0207702_10586018 | 3300026078 | Bacteria | 1093 |
| 280 | Ga0207648_10332758 | 3300026089 | Bacteria | 1366 |
| 281 | Ga0207674_10001166 | 3300026116 | Bacteria | 34125 |
| 282 | Ga0207698_10194869 | 3300026142 | Bacteria | 1809 |
| 283 | Ga0209281_1000027 | 3300027111 | Bacteria | 463409 |
| 284 | Ga0209281_1001505 | 3300027111 | Bacteria | 13289 |
| 285 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 286 | Ga0209371_1000471 | 3300027312 | Bacteria | 39614 |
| 287 | Ga0209371_1017128 | 3300027312 | Bacteria | 1887 |
| 288 | Ga0209282_1000093 | 3300027666 | Bacteria | 62036 |
| 289 | Ga0209588_1000017 | 3300027671 | Bacteria | 97342 |
| 290 | Ga0207428_10115187 | 3300027907 | Bacteria | 2065 |
| 291 | Ga0207428_10134967 | 3300027907 | Bacteria | 1887 |
| 292 | Ga0207428_10400031 | 3300027907 | Bacteria | 1006 |
| 293 | Ga0268266_10206371 | 3300028379 | Bacteria | 1800 |
| 294 | Ga0268264_11014095 | 3300028381 | Bacteria | 837 |
| 295 | Ga0307517_10067934 | 3300028786 | Bacteria | 3255 |
| 296 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 297 | Ga0268256_1000057 | 3300030500 | Bacteria | 229991 |
| 298 | Ga0268256_1000398 | 3300030500 | Bacteria | 39614 |
| 299 | Ga0268256_1019079 | 3300030500 | Bacteria | 1886 |
| 300 | Ga0265328_10082971 | 3300031239 | Bacteria | 1182 |
| 301 | Ga0307509_10151367 | 3300031507 | Bacteria | 2234 |
| 302 | Ga0307516_10030996 | 3300031730 | Bacteria | 5393 |
| 303 | Ga0307412_10005500 | 3300031911 | Bacteria | 7116 |
| 304 | Ga0395899_0004173 | 3300037312 | Bacteria | 11345 |
| 305 | Ga0395900_0013792 | 3300037418 | Bacteria | 8247 |
| 306 | Ga0436365_1060686 | 3300039437 | Bacteria | 2203 |
| 307 | Ga0439438_036176 | 3300041405 | Bacteria | 1295 |
| 308 | Ga0439447_001156 | 3300041407 | Bacteria | 9608 |
| 309 | Ga0439447_023131 | 3300041407 | Bacteria | 1621 |
| 310 | Ga0439466_0000953 | 3300041411 | Bacteria | 11092 |
| 311 | Ga0439466_0002095 | 3300041411 | Bacteria | 7815 |
| 312 | Ga0439466_0078346 | 3300041411 | Bacteria | 1044 |
| 313 | Ga0439451_000970 | 3300042009 | Bacteria | 5544 |
| 314 | Ga0439451_046280 | 3300042009 | Bacteria | 871 |
| 315 | Ga0439452_000126 | 3300042010 | Bacteria | 59072 |
| 316 | Ga0439452_015882 | 3300042010 | Bacteria | 2055 |
| 317 | Ga0439456_016540 | 3300042013 | Bacteria | 1542 |
| 318 | Ga0439463_000047 | 3300042016 | Bacteria | 25575 |
| 319 | Ga0450903_008180 | 3300042138 | Bacteria | 1713 |
| 320 | Ga0450889_002580 | 3300042144 | Bacteria | 1797 |
| 321 | Ga0439464_0016738 | 3300042439 | Bacteria | 1985 |
| 322 | Ga0439460_0040485 | 3300042461 | Bacteria | 1365 |
| 323 | Ga0450893_0003281 | 3300042532 | Bacteria | 2545 |
| 324 | Ga0439440_0010531 | 3300042993 | Bacteria | 1935 |
| 325 | Ga0466972_0006635 | 3300044658 | Bacteria | 5810 |
| 326 | Ga0466989_0173783 | 3300044663 | Bacteria | 1286 |
| 327 | Ga0466965_0093015 | 3300044683 | Bacteria | 1535 |
| 328 | Ga0466961_0101325 | 3300044693 | Bacteria | 1814 |
| 329 | Ga0466963_0275197 | 3300044694 | Bacteria | 1183 |
| 330 | Ga0466964_0002273 | 3300044706 | Bacteria | 6814 |
| 331 | Ga0453684_0421915 | 3300044712 | Bacteria | 1490 |
| 332 | Ga0466968_0138534 | 3300044735 | Bacteria | 1111 |
| 333 | Ga0466970_0190841 | 3300044765 | Bacteria | 1138 |
| 334 | Ga0466960_0028244 | 3300044901 | Bacteria | 2566 |
| 335 | Ga0495617_000028 | 3300046452 | Bacteria | 156686 |
| 336 | Ga0495617_000408 | 3300046452 | Bacteria | 23783 |
| 337 | Ga0495617_002126 | 3300046452 | Bacteria | 8151 |
| 338 | Ga0495617_018492 | 3300046452 | Bacteria | 2356 |
| 339 | Ga0495617_023670 | 3300046452 | Bacteria | 2074 |
| 340 | Ga0495627_000018 | 3300046453 | Bacteria | 315125 |
| 341 | Ga0495627_021434 | 3300046453 | Bacteria | 2142 |
| 342 | Ga0495603_0399956 | 3300046455 | Bacteria | 787 |
| 343 | Ga0495590_0000901 | 3300046457 | Bacteria | 13287 |
| 344 | Ga0495590_0009751 | 3300046457 | Bacteria | 3637 |
| 345 | Ga0495590_0035907 | 3300046457 | Bacteria | 1729 |
| 346 | Ga0495591_003722 | 3300046458 | Bacteria | 7724 |
| 347 | Ga0495591_112969 | 3300046458 | Bacteria | 666 |
| 348 | Ga0495638_0012816 | 3300046460 | Bacteria | 5728 |
| 349 | Ga0495638_0020181 | 3300046460 | Bacteria | 4403 |
| 350 | Ga0495638_0197554 | 3300046460 | Bacteria | 1137 |
| 351 | Ga0495651_0167561 | 3300046462 | Bacteria | 1567 |
| 352 | Ga0495653_0006143 | 3300046463 | Bacteria | 9851 |
| 353 | Ga0495650_0000043 | 3300046471 | Bacteria | 357197 |
| 354 | Ga0495650_0002158 | 3300046471 | Bacteria | 16702 |
| 355 | Ga0495650_0002618 | 3300046471 | Bacteria | 14099 |
| 356 | Ga0495650_0004589 | 3300046471 | Bacteria | 9394 |
| 357 | Ga0495650_0005525 | 3300046471 | Bacteria | 8171 |
| 358 | Ga0495580_0244028 | 3300046472 | Bacteria | 1231 |
| 359 | Ga0495605_0004566 | 3300046474 | Bacteria | 8108 |
| 360 | Ga0495605_0022108 | 3300046474 | Bacteria | 3362 |
| 361 | Ga0495605_0055809 | 3300046474 | Bacteria | 1906 |
| 362 | Ga0495605_0069888 | 3300046474 | Bacteria | 1661 |
| 363 | Ga0495639_0000633 | 3300046475 | Bacteria | 16236 |
| 364 | Ga0495639_0013803 | 3300046475 | Bacteria | 3493 |
| 365 | Ga0495584_0001297 | 3300046491 | Bacteria | 15204 |
| 366 | Ga0495584_0001499 | 3300046491 | Bacteria | 13928 |
| 367 | Ga0495584_0019448 | 3300046491 | Bacteria | 3449 |
| 368 | Ga0495585_0022219 | 3300046492 | Bacteria | 3642 |
| 369 | Ga0495585_0065684 | 3300046492 | Bacteria | 1987 |
| 370 | Ga0495585_0306652 | 3300046492 | Bacteria | 779 |
| 371 | Ga0495594_0016635 | 3300046499 | Bacteria | 3877 |
| 372 | Ga0495594_0022850 | 3300046499 | Bacteria | 3348 |
| 373 | Ga0495596_0006155 | 3300046500 | Bacteria | 5572 |
| 374 | Ga0495607_0000411 | 3300046501 | Bacteria | 43380 |
| 375 | Ga0495607_0002094 | 3300046501 | Bacteria | 16666 |
| 376 | Ga0495607_0003292 | 3300046501 | Bacteria | 12409 |
| 377 | Ga0495607_0007091 | 3300046501 | Bacteria | 7793 |
| 378 | Ga0495607_0008369 | 3300046501 | Bacteria | 7075 |
| 379 | Ga0495607_0333335 | 3300046501 | Bacteria | 704 |
| 380 | Ga0495583_0003439 | 3300046506 | Bacteria | 12048 |
| 381 | Ga0495583_0012803 | 3300046506 | Bacteria | 4721 |
| 382 | Ga0495606_0002737 | 3300046507 | Bacteria | 19840 |
| 383 | Ga0495606_0024403 | 3300046507 | Bacteria | 4357 |
| 384 | Ga0495606_0043657 | 3300046507 | Bacteria | 2987 |
| 385 | Ga0495606_0174073 | 3300046507 | Bacteria | 1246 |
| 386 | Ga0495606_0212949 | 3300046507 | Bacteria | 1093 |
| 387 | Ga0495610_0006447 | 3300046512 | Bacteria | 8072 |
| 388 | Ga0495610_0012908 | 3300046512 | Bacteria | 4996 |
| 389 | Ga0495610_0050457 | 3300046512 | Bacteria | 2031 |
| 390 | Ga0495610_0108460 | 3300046512 | Bacteria | 1233 |
| 391 | Ga0495610_0114039 | 3300046512 | Bacteria | 1193 |
| 392 | Ga0495616_0001804 | 3300046513 | Bacteria | 14520 |
| 393 | Ga0495616_0021597 | 3300046513 | Bacteria | 3481 |
| 394 | Ga0495620_0000046 | 3300046515 | Bacteria | 108205 |
| 395 | Ga0495628_0010287 | 3300046516 | Bacteria | 7950 |
| 396 | Ga0495631_0000955 | 3300046518 | Bacteria | 18003 |
| 397 | Ga0495631_0013652 | 3300046518 | Bacteria | 3937 |
| 398 | Ga0495631_0179313 | 3300046518 | Bacteria | 908 |
| 399 | Ga0495632_0001104 | 3300046519 | Bacteria | 23112 |
| 400 | Ga0495632_0001282 | 3300046519 | Bacteria | 21263 |
| 401 | Ga0495637_0006805 | 3300046520 | Bacteria | 5720 |
| 402 | Ga0495637_0022452 | 3300046520 | Bacteria | 2877 |
| 403 | Ga0495637_0024071 | 3300046520 | Bacteria | 2756 |
| 404 | Ga0495637_0056948 | 3300046520 | Bacteria | 1616 |
| 405 | Ga0495643_0014773 | 3300046522 | Bacteria | 4635 |
| 406 | Ga0495644_0012139 | 3300046523 | Bacteria | 3311 |
| 407 | Ga0495648_0015363 | 3300046524 | Bacteria | 5560 |
| 408 | Ga0495648_0019072 | 3300046524 | Bacteria | 4836 |
| 409 | Ga0495648_0021049 | 3300046524 | Bacteria | 4528 |
| 410 | Ga0495648_0021473 | 3300046524 | Bacteria | 4468 |
| 411 | Ga0495648_0038353 | 3300046524 | Bacteria | 3065 |
| 412 | Ga0495648_0042482 | 3300046524 | Bacteria | 2859 |
| 413 | Ga0495666_0033975 | 3300046526 | Bacteria | 2489 |
| 414 | Ga0495666_0076812 | 3300046526 | Bacteria | 1583 |
| 415 | Ga0495666_0102266 | 3300046526 | Bacteria | 1349 |
| 416 | Ga0495666_0112604 | 3300046526 | Bacteria | 1277 |
| 417 | Ga0495642_0006583 | 3300046528 | Bacteria | 4457 |
| 418 | Ga0495642_0089350 | 3300046528 | Bacteria | 1303 |
| 419 | Ga0495654_0002150 | 3300046530 | Bacteria | 12852 |
| 420 | Ga0495654_0002557 | 3300046530 | Bacteria | 11635 |
| 421 | Ga0495654_0006797 | 3300046530 | Bacteria | 6459 |
| 422 | Ga0495654_0008007 | 3300046530 | Bacteria | 5868 |
| 423 | Ga0495654_0044893 | 3300046530 | Bacteria | 2182 |
| 424 | Ga0495654_0059304 | 3300046530 | Bacteria | 1843 |
| 425 | Ga0495654_0061363 | 3300046530 | Bacteria | 1805 |
| 426 | Ga0495587_0021564 | 3300046536 | Bacteria | 3972 |
| 427 | Ga0495609_0007194 | 3300046538 | Bacteria | 5586 |
| 428 | Ga0495609_0169133 | 3300046538 | Bacteria | 923 |
| 429 | Ga0495597_0028178 | 3300046542 | Bacteria | 2571 |
| 430 | Ga0495597_0130342 | 3300046542 | Bacteria | 1043 |
| 431 | Ga0495645_0066398 | 3300046543 | Bacteria | 2607 |
| 432 | Ga0495622_0001748 | 3300046557 | Bacteria | 10746 |
| 433 | Ga0495622_0002064 | 3300046557 | Bacteria | 9813 |
| 434 | Ga0495622_0024138 | 3300046557 | Bacteria | 2839 |
| 435 | Ga0495633_0017145 | 3300046558 | Bacteria | 3712 |
| 436 | Ga0495656_0000711 | 3300046615 | Bacteria | 10742 |
| 437 | Ga0495656_0047448 | 3300046615 | Bacteria | 1821 |
| 438 | Ga0495634_0001752 | 3300046642 | Bacteria | 18797 |
| 439 | Ga0495634_0051353 | 3300046642 | Bacteria | 2766 |
| 440 | Ga0495611_0012475 | 3300046648 | Bacteria | 3612 |
| 441 | Ga0495625_0004335 | 3300046660 | Bacteria | 13472 |
| 442 | Ga0495635_0003099 | 3300046663 | Bacteria | 11436 |
| 443 | Ga0495659_0000475 | 3300046664 | Bacteria | 14814 |
| 444 | Ga0495659_0036981 | 3300046664 | Bacteria | 1727 |
| 445 | Ga0495659_0081086 | 3300046664 | Bacteria | 1231 |
| 446 | Ga0495661_0001671 | 3300046665 | Bacteria | 18076 |
| 447 | Ga0495661_0006087 | 3300046665 | Bacteria | 8502 |
| 448 | Ga0495661_0030769 | 3300046665 | Bacteria | 3415 |
| 449 | Ga0495661_0219835 | 3300046665 | Bacteria | 985 |
| 450 | Ga0495661_0255204 | 3300046665 | Bacteria | 893 |
| 451 | Ga0495588_0007357 | 3300046674 | Bacteria | 5005 |
| 452 | Ga0495588_0014823 | 3300046674 | Bacteria | 3739 |
| 453 | Ga0495588_0019900 | 3300046674 | Bacteria | 3293 |
| 454 | Ga0495588_0079503 | 3300046674 | Bacteria | 1711 |
| 455 | Ga0495588_0181880 | 3300046674 | Bacteria | 1111 |
| 456 | Ga0495657_0021569 | 3300046675 | Bacteria | 4622 |
| 457 | Ga0495599_0004928 | 3300046678 | Bacteria | 7931 |
| 458 | Ga0495623_0039302 | 3300046679 | Bacteria | 3025 |
| 459 | Ga0495646_0019001 | 3300046680 | Bacteria | 4352 |
| 460 | Ga0495646_0086198 | 3300046680 | Bacteria | 1821 |
| 461 | Ga0495669_0004695 | 3300046684 | Bacteria | 5666 |
| 462 | Ga0495613_0047415 | 3300046689 | Bacteria | 3174 |
| 463 | Ga0495613_0186496 | 3300046689 | Bacteria | 1467 |
| 464 | Ga0495624_0001741 | 3300046690 | Bacteria | 16628 |
| 465 | Ga0495624_0006025 | 3300046690 | Bacteria | 8645 |
| 466 | Ga0495670_0003382 | 3300046691 | Bacteria | 7847 |
| 467 | Ga0495670_0008205 | 3300046691 | Bacteria | 5135 |
| 468 | Ga0495670_0252554 | 3300046691 | Bacteria | 940 |
| 469 | Ga0495670_0320234 | 3300046691 | Bacteria | 832 |
| 470 | Ga0495671_0001718 | 3300046692 | Bacteria | 14225 |
| 471 | Ga0495671_0004099 | 3300046692 | Bacteria | 8788 |
| 472 | Ga0495671_0112379 | 3300046692 | Bacteria | 1330 |
| 473 | Ga0495649_0004079 | 3300046694 | Bacteria | 9610 |
| 474 | Ga0495649_0014473 | 3300046694 | Bacteria | 4519 |
| 475 | Ga0495649_0019636 | 3300046694 | Bacteria | 3796 |
| 476 | Ga0495649_0095766 | 3300046694 | Bacteria | 1580 |
| 477 | Ga0495649_0154753 | 3300046694 | Bacteria | 1203 |
| 478 | Ga0495589_0000002 | 3300046794 | Bacteria | 758846 |
| 479 | Ga0495589_0000316 | 3300046794 | Bacteria | 38558 |
| 480 | Ga0495589_0010734 | 3300046794 | Bacteria | 4760 |
| 481 | Ga0495589_0017529 | 3300046794 | Bacteria | 3674 |
| 482 | Ga0495589_0022296 | 3300046794 | Bacteria | 3231 |
| 483 | Ga0495589_0037035 | 3300046794 | Bacteria | 2444 |
| 484 | Ga0495589_0076528 | 3300046794 | Bacteria | 1631 |
| 485 | Ga0495600_0001683 | 3300046809 | Bacteria | 12350 |
| 486 | Ga0495600_0050069 | 3300046809 | Bacteria | 2725 |
| 487 | Ga0495660_0000014 | 3300046810 | Bacteria | 337328 |
| 488 | Ga0495660_0044853 | 3300046810 | Bacteria | 2430 |
| 489 | Ga0495660_0051843 | 3300046810 | Bacteria | 2231 |
| 490 | Ga0495660_0080886 | 3300046810 | Bacteria | 1704 |
| 491 | Ga0495581_0018253 | 3300047315 | Bacteria | 4074 |
| 492 | Ga0495604_0009622 | 3300047317 | Bacteria | 7645 |
| 493 | Ga0495604_0085933 | 3300047317 | Bacteria | 2346 |
| 494 | Ga0495604_0129159 | 3300047317 | Bacteria | 1818 |
| 495 | Ga0495636_0001719 | 3300047318 | Bacteria | 8354 |
| 496 | Ga0495636_0380132 | 3300047318 | Bacteria | 670 |
| 497 | Ga0495674_0048328 | 3300047319 | Bacteria | 3765 |
| 498 | Ga0495672_0000466 | 3300047320 | Bacteria | 47885 |
| 499 | Ga0495672_0002548 | 3300047320 | Bacteria | 16615 |
| 500 | Ga0495672_0002855 | 3300047320 | Bacteria | 15357 |
| 501 | Ga0495672_0012988 | 3300047320 | Bacteria | 5768 |
| 502 | Ga0495672_0014231 | 3300047320 | Bacteria | 5458 |
| 503 | Ga0495672_0067189 | 3300047320 | Bacteria | 2042 |
| 504 | Ga0495672_0088478 | 3300047320 | Bacteria | 1706 |
| 505 | Ga0495672_0122834 | 3300047320 | Bacteria | 1377 |
| 506 | Ga0495680_0021857 | 3300047322 | Bacteria | 5345 |
| 507 | Ga0495680_0065001 | 3300047322 | Bacteria | 2796 |
| 508 | Ga0495683_0001064 | 3300047323 | Bacteria | 18983 |
| 509 | Ga0495683_0012748 | 3300047323 | Bacteria | 4411 |
| 510 | Ga0495683_0020550 | 3300047323 | Bacteria | 3404 |
| 511 | Ga0495683_0038618 | 3300047323 | Bacteria | 2416 |
| 512 | Ga0495683_0077943 | 3300047323 | Bacteria | 1619 |
| 513 | Ga0495687_001366 | 3300047443 | Bacteria | 22552 |
| 514 | Ga0495687_002446 | 3300047443 | Bacteria | 14911 |
| 515 | Ga0495687_005004 | 3300047443 | Bacteria | 8659 |
| 516 | Ga0495675_0095401 | 3300047444 | Bacteria | 1865 |
| 517 | Ga0495677_0002912 | 3300047445 | Bacteria | 6661 |
| 518 | Ga0495679_018277 | 3300047446 | Bacteria | 2492 |
| 519 | Ga0495679_128422 | 3300047446 | Bacteria | 689 |
| 520 | Ga0495685_018729 | 3300047447 | Bacteria | 2377 |
| 521 | Ga0495673_0001574 | 3300047469 | Bacteria | 17893 |
| 522 | Ga0495673_0005451 | 3300047469 | Bacteria | 7689 |
| 523 | Ga0495673_0005619 | 3300047469 | Bacteria | 7537 |
| 524 | Ga0495673_0007416 | 3300047469 | Bacteria | 6307 |
| 525 | Ga0495673_0020954 | 3300047469 | Bacteria | 3241 |
| 526 | Ga0495673_0031003 | 3300047469 | Bacteria | 2506 |
| 527 | Ga0495681_0001637 | 3300047470 | Bacteria | 16631 |
| 528 | Ga0495681_0001661 | 3300047470 | Bacteria | 16502 |
| 529 | Ga0495681_0042081 | 3300047470 | Bacteria | 2213 |
| 530 | Ga0495684_0063662 | 3300047471 | Bacteria | 2803 |
| 531 | Ga0495593_0008934 | 3300047673 | Bacteria | 5817 |
| 532 | Ga0495593_0047716 | 3300047673 | Bacteria | 2277 |
| 533 | Ga0495602_0010257 | 3300048088 | Bacteria | 9723 |
| 534 | Ga0495602_0192465 | 3300048088 | Bacteria | 1562 |
| 535 | Ga0495602_0308645 | 3300048088 | Bacteria | 1155 |
| 536 | Ga0495626_0002000 | 3300048091 | Bacteria | 15046 |
| 537 | Ga0495626_0002125 | 3300048091 | Bacteria | 14354 |
| 538 | Ga0495626_0002657 | 3300048091 | Bacteria | 12129 |
| 539 | Ga0495626_0019589 | 3300048091 | Bacteria | 3383 |
| 540 | Ga0495626_0041491 | 3300048091 | Bacteria | 2166 |
| 541 | Ga0496100_0193749 | 3300048903 | Bacteria | 1477 |
| 542 | Ga0496102_0000428 | 3300048905 | Bacteria | 48609 |
| 543 | Ga0496102_0005158 | 3300048905 | Bacteria | 11085 |
| 544 | Ga0496102_0007116 | 3300048905 | Bacteria | 9554 |
| 545 | Ga0496102_0475249 | 3300048905 | Bacteria | 1171 |
| 546 | Ga0496103_0003929 | 3300048906 | Bacteria | 9035 |
| 547 | Ga0496103_0016491 | 3300048906 | Bacteria | 4407 |
| 548 | Ga0496103_0033664 | 3300048906 | Bacteria | 3131 |
| 549 | Ga0496103_0088032 | 3300048906 | Bacteria | 1958 |
| 550 | Ga0496104_0011766 | 3300048907 | Bacteria | 7850 |
| 551 | Ga0496104_0086195 | 3300048907 | Bacteria | 2998 |
| 552 | Ga0496104_0729289 | 3300048907 | Bacteria | 898 |
| 553 | Ga0496105_0050594 | 3300048908 | Bacteria | 3432 |
| 554 | Ga0496105_0300328 | 3300048908 | Bacteria | 1291 |
| 555 | Ga0496106_0083839 | 3300048909 | Bacteria | 2452 |
| 556 | Ga0496106_0133176 | 3300048909 | Bacteria | 1950 |
| 557 | Ga0496106_0233265 | 3300048909 | Bacteria | 1470 |
| 558 | Ga0496110_0241174 | 3300048913 | Bacteria | 1645 |
| 559 | Ga0496112_0330103 | 3300048915 | Bacteria | 1469 |
| 560 | Ga0496114_0265119 | 3300048917 | Bacteria | 1513 |
| 561 | Ga0496114_0519237 | 3300048917 | Bacteria | 1053 |
| 562 | Ga0496115_0000002 | 3300048918 | Bacteria | 365286 |
| 563 | Ga0496115_0060537 | 3300048918 | Bacteria | 3051 |
| 564 | Ga0496116_0000023 | 3300048919 | Bacteria | 475792 |
| 565 | Ga0496116_0000288 | 3300048919 | Bacteria | 85510 |
| 566 | Ga0496116_0001134 | 3300048919 | Bacteria | 31693 |
| 567 | Ga0496116_0001634 | 3300048919 | Bacteria | 24666 |
| 568 | Ga0496116_0001773 | 3300048919 | Bacteria | 23475 |
| 569 | Ga0496116_0011727 | 3300048919 | Bacteria | 7221 |
| 570 | Ga0496116_0013358 | 3300048919 | Bacteria | 6627 |
| 571 | Ga0496116_0016138 | 3300048919 | Bacteria | 5862 |
| 572 | Ga0496116_0032950 | 3300048919 | Bacteria | 3684 |
| 573 | Ga0496116_0044660 | 3300048919 | Bacteria | 3007 |
| 574 | Ga0496116_0110437 | 3300048919 | Bacteria | 1617 |
| 575 | Ga0496117_0000017 | 3300048920 | Bacteria | 490421 |
| 576 | Ga0496117_0000100 | 3300048920 | Bacteria | 194307 |
| 577 | Ga0496117_0000881 | 3300048920 | Bacteria | 46286 |
| 578 | Ga0496117_0001508 | 3300048920 | Bacteria | 33364 |
| 579 | Ga0496117_0004279 | 3300048920 | Bacteria | 15907 |
| 580 | Ga0496117_0004461 | 3300048920 | Bacteria | 15424 |
| 581 | Ga0496117_0011254 | 3300048920 | Bacteria | 8030 |
| 582 | Ga0496117_0015201 | 3300048920 | Bacteria | 6582 |
| 583 | Ga0496117_0018488 | 3300048920 | Bacteria | 5766 |
| 584 | Ga0496117_0094879 | 3300048920 | Bacteria | 1908 |
| 585 | Ga0496117_0133557 | 3300048920 | Bacteria | 1499 |
| 586 | Ga0496117_0156476 | 3300048920 | Bacteria | 1341 |
| 587 | Ga0496117_0166625 | 3300048920 | Bacteria | 1284 |
| 588 | Ga0496118_0000018 | 3300048921 | Bacteria | 490421 |
| 589 | Ga0496118_0000446 | 3300048921 | Bacteria | 68504 |
| 590 | Ga0496118_0006957 | 3300048921 | Bacteria | 12221 |
| 591 | Ga0496118_0009591 | 3300048921 | Bacteria | 9744 |
| 592 | Ga0496118_0010834 | 3300048921 | Bacteria | 8978 |
| 593 | Ga0496118_0013425 | 3300048921 | Bacteria | 7749 |
| 594 | Ga0496118_0018094 | 3300048921 | Bacteria | 6376 |
| 595 | Ga0496118_0034507 | 3300048921 | Bacteria | 4125 |
| 596 | Ga0496118_0040586 | 3300048921 | Bacteria | 3698 |
| 597 | Ga0496118_0065795 | 3300048921 | Bacteria | 2650 |
| 598 | Ga0496118_0075574 | 3300048921 | Bacteria | 2401 |
| 599 | Ga0496118_0087713 | 3300048921 | Bacteria | 2156 |
| 600 | Ga0496118_0092549 | 3300048921 | Bacteria | 2074 |
| 601 | Ga0496119_0001520 | 3300048922 | Bacteria | 27728 |
| 602 | Ga0496119_0004367 | 3300048922 | Bacteria | 14110 |
| 603 | Ga0496119_0012369 | 3300048922 | Bacteria | 6938 |
| 604 | Ga0496119_0018312 | 3300048922 | Bacteria | 5223 |
| 605 | Ga0496119_0032896 | 3300048922 | Bacteria | 3449 |
| 606 | Ga0496119_0046911 | 3300048922 | Bacteria | 2692 |
| 607 | Ga0496119_0052103 | 3300048922 | Bacteria | 2509 |
| 608 | Ga0496119_0063357 | 3300048922 | Bacteria | 2199 |
| 609 | Ga0496120_0000756 | 3300048923 | Bacteria | 46775 |
| 610 | Ga0496120_0000801 | 3300048923 | Bacteria | 45287 |
| 611 | Ga0496120_0001475 | 3300048923 | Bacteria | 28007 |
| 612 | Ga0496120_0005017 | 3300048923 | Bacteria | 10738 |
| 613 | Ga0496120_0014607 | 3300048923 | Bacteria | 5223 |
| 614 | Ga0496120_0024408 | 3300048923 | Bacteria | 3770 |
| 615 | Ga0496120_0096834 | 3300048923 | Bacteria | 1566 |
| 616 | Ga0496121_0000211 | 3300048924 | Bacteria | 127602 |
| 617 | Ga0496121_0000492 | 3300048924 | Bacteria | 75747 |
| 618 | Ga0496121_0003591 | 3300048924 | Bacteria | 21895 |
| 619 | Ga0496121_0005934 | 3300048924 | Bacteria | 15449 |
| 620 | Ga0496121_0010805 | 3300048924 | Bacteria | 10226 |
| 621 | Ga0496121_0037631 | 3300048924 | Bacteria | 4295 |
| 622 | Ga0496121_0054729 | 3300048924 | Bacteria | 3331 |
| 623 | Ga0496121_0087045 | 3300048924 | Bacteria | 2453 |
| 624 | Ga0496121_0102898 | 3300048924 | Bacteria | 2198 |
| 625 | Ga0496121_0136054 | 3300048924 | Bacteria | 1830 |
| 626 | Ga0496122_0000021 | 3300048925 | Bacteria | 391363 |
| 627 | Ga0496122_0000545 | 3300048925 | Bacteria | 77927 |
| 628 | Ga0496122_0000562 | 3300048925 | Bacteria | 75980 |
| 629 | Ga0496122_0004076 | 3300048925 | Bacteria | 18525 |
| 630 | Ga0496122_0004697 | 3300048925 | Bacteria | 16777 |
| 631 | Ga0496122_0006570 | 3300048925 | Bacteria | 13285 |
| 632 | Ga0496122_0006988 | 3300048925 | Bacteria | 12706 |
| 633 | Ga0496122_0008314 | 3300048925 | Bacteria | 11239 |
| 634 | Ga0496122_0010774 | 3300048925 | Bacteria | 9376 |
| 635 | Ga0496122_0011919 | 3300048925 | Bacteria | 8730 |
| 636 | Ga0496122_0035536 | 3300048925 | Bacteria | 4050 |
| 637 | Ga0496122_0055189 | 3300048925 | Bacteria | 2975 |
| 638 | Ga0496122_0266583 | 3300048925 | Bacteria | 946 |
| 639 | Ga0496122_0298673 | 3300048925 | Bacteria | 870 |
| 640 | Ga0496122_0382034 | 3300048925 | Bacteria | 722 |
| 641 | Ga0496123_0000174 | 3300048926 | Bacteria | 130310 |
| 642 | Ga0496123_0000189 | 3300048926 | Bacteria | 124719 |
| 643 | Ga0496123_0000200 | 3300048926 | Bacteria | 122026 |
| 644 | Ga0496123_0000422 | 3300048926 | Bacteria | 76364 |
| 645 | Ga0496123_0002636 | 3300048926 | Bacteria | 21745 |
| 646 | Ga0496123_0003370 | 3300048926 | Bacteria | 18067 |
| 647 | Ga0496123_0007219 | 3300048926 | Bacteria | 10543 |
| 648 | Ga0496123_0012939 | 3300048926 | Bacteria | 7055 |
| 649 | Ga0496123_0055453 | 3300048926 | Bacteria | 2600 |
| 650 | Ga0496123_0082051 | 3300048926 | Bacteria | 1956 |
| 651 | Ga0496123_0084639 | 3300048926 | Bacteria | 1911 |
| 652 | Ga0496123_0105772 | 3300048926 | Bacteria | 1623 |
| 653 | Ga0496123_0182337 | 3300048926 | Bacteria | 1095 |
| 654 | Ga0496124_0000017 | 3300048927 | Bacteria | 444389 |
| 655 | Ga0496124_0000066 | 3300048927 | Bacteria | 222815 |
| 656 | Ga0496124_0001331 | 3300048927 | Bacteria | 37099 |
| 657 | Ga0496124_0003122 | 3300048927 | Bacteria | 20551 |
| 658 | Ga0496124_0019070 | 3300048927 | Bacteria | 6400 |
| 659 | Ga0496124_0042147 | 3300048927 | Bacteria | 3932 |
| 660 | Ga0496124_0047710 | 3300048927 | Bacteria | 3663 |
| 661 | Ga0496124_0057366 | 3300048927 | Bacteria | 3281 |
| 662 | Ga0496124_0141951 | 3300048927 | Bacteria | 1894 |
| 663 | Ga0496124_0669032 | 3300048927 | Bacteria | 663 |
| 664 | Ga0496125_0000005 | 3300048928 | Bacteria | 827598 |
| 665 | Ga0496125_0000033 | 3300048928 | Bacteria | 351850 |
| 666 | Ga0496125_0000355 | 3300048928 | Bacteria | 86577 |
| 667 | Ga0496125_0002571 | 3300048928 | Bacteria | 23376 |
| 668 | Ga0496125_0003383 | 3300048928 | Bacteria | 19409 |
| 669 | Ga0496125_0005826 | 3300048928 | Bacteria | 13538 |
| 670 | Ga0496125_0011365 | 3300048928 | Bacteria | 8912 |
| 671 | Ga0496125_0013660 | 3300048928 | Bacteria | 7970 |
| 672 | Ga0496125_0014405 | 3300048928 | Bacteria | 7703 |
| 673 | Ga0496125_0018498 | 3300048928 | Bacteria | 6617 |
| 674 | Ga0496125_0028466 | 3300048928 | Bacteria | 5046 |
| 675 | Ga0496125_0049392 | 3300048928 | Bacteria | 3496 |
| 676 | Ga0496125_0082792 | 3300048928 | Bacteria | 2444 |
| 677 | Ga0496125_0098545 | 3300048928 | Bacteria | 2162 |
| 678 | Ga0496126_0000052 | 3300048929 | Bacteria | 312383 |
| 679 | Ga0496126_0003448 | 3300048929 | Bacteria | 19958 |
| 680 | Ga0496126_0004528 | 3300048929 | Bacteria | 16534 |
| 681 | Ga0496126_0048458 | 3300048929 | Bacteria | 3882 |
| 682 | Ga0496126_0053397 | 3300048929 | Bacteria | 3667 |
| 683 | Ga0496126_0193057 | 3300048929 | Bacteria | 1724 |
| 684 | Ga0496126_0882501 | 3300048929 | Bacteria | 679 |
| 685 | Ga0496126_0959556 | 3300048929 | Bacteria | 644 |
| 686 | Ga0495678_001326 | 3300049459 | Bacteria | 19844 |
| 687 | Ga0495678_007820 | 3300049459 | Bacteria | 5497 |
| 688 | Ga0495678_022628 | 3300049459 | Bacteria | 2745 |
| 689 | Ga0495682_0004466 | 3300049460 | Bacteria | 5976 |
| 690 | Ga0495682_0044143 | 3300049460 | Bacteria | 1631 |
| 691 | Ga0501032_0245916 | 3300049569 | Bacteria | 1162 |
| 692 | Ga0501038_0170851 | 3300049574 | Bacteria | 1760 |
| 693 | Ga0501039_0035498 | 3300049575 | Bacteria | 3847 |
| 694 | Ga0501040_0003234 | 3300049576 | Bacteria | 10542 |
| 695 | Ga0501041_0008304 | 3300049577 | Bacteria | 6112 |
| 696 | Ga0501046_0072609 | 3300049580 | Bacteria | 2671 |
| 697 | Ga0501048_0073813 | 3300049582 | Bacteria | 2407 |
| 698 | Ga0501071_0146295 | 3300049587 | Bacteria | 1762 |
| 699 | Ga0501072_0002188 | 3300049588 | Bacteria | 14605 |
| 700 | Ga0501073_0041080 | 3300049589 | Bacteria | 3269 |
| 701 | Ga0501074_0016923 | 3300049590 | Bacteria | 5290 |
| 702 | Ga0501075_0042153 | 3300049591 | Bacteria | 3421 |
| 703 | Ga0501076_0030268 | 3300049592 | Bacteria | 4215 |
| 704 | Ga0501077_0000947 | 3300049593 | Bacteria | 17478 |
| 705 | Ga0501249_005345 | 3300049679 | Bacteria | 2627 |
| 706 | Ga0501079_0078556 | 3300049741 | Bacteria | 2552 |
| 707 | Ga0501080_0008005 | 3300049742 | Bacteria | 9579 |
| 708 | Ga0501080_0372279 | 3300049742 | Bacteria | 1288 |
| 709 | Ga0501081_0206530 | 3300049743 | Bacteria | 1425 |
| 710 | Ga0501083_0031956 | 3300049744 | Bacteria | 3611 |
| 711 | Ga0501269_000165 | 3300049766 | Bacteria | 20359 |
| 712 | Ga0501045_0015814 | 3300049824 | Bacteria | 5351 |
| 713 | nmdc:mga03683_105454_c1 | 3300050489 | Bacteria | 1242 |
| 714 | nmdc:mga00v17_368287_c1 | 3300050491 | Bacteria | 934 |
| 715 | nmdc:mga0sz30_12993_c1 | 3300050516 | Bacteria | 3251 |
| 716 | Ga0495601_0001480 | 3300053077 | Bacteria | 12956 |
| 717 | Ga0500595_005107 | 3300053119 | Bacteria | 5761 |
| 718 | Ga0500618_005498 | 3300053125 | Bacteria | 3839 |
| 719 | Ga0500573_0230181 | 3300053140 | Bacteria | 967 |
| 720 | Ga0500616_0139173 | 3300053153 | Bacteria | 1137 |
| 721 | Ga0500619_003223 | 3300053154 | Bacteria | 3301 |
| 722 | Ga0500634_0000240 | 3300053161 | Bacteria | 17898 |
| 723 | Ga0500567_022233 | 3300053723 | Bacteria | 3037 |
| 724 | Ga0501084_0008006 | 3300054114 | Bacteria | 8702 |
| 725 | Ga0501082_0008685 | 3300060353 | Bacteria | 8760 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048925 | Ga0496122_0266583 | Ga0496122_0266583_12_572 | 165 |
| 2 | 3300005457 | Ga0070662_100098528 | Ga0070662_1000985282 | 176 |
| 3 | 3300009011 | Ga0105251_10138322 | Ga0105251_101383222 | 176 |
| 4 | 3300009092 | Ga0105250_10000980 | Ga0105250_100009808 | 176 |
| 5 | 3300013307 | Ga0157372_10003765 | Ga0157372_1000376512 | 176 |
| 6 | 3300025711 | Ga0207696_1000073 | Ga0207696_100007360 | 176 |
| 7 | 3300025735 | Ga0207713_1014492 | Ga0207713_10144924 | 176 |
| 8 | 3300025933 | Ga0207706_10012239 | Ga0207706_100122397 | 176 |
| 9 | 3300048921 | Ga0496118_0009591 | Ga0496118_0009591_7720_8313 | 176 |
| 10 | 3300048926 | Ga0496123_0082051 | Ga0496123_0082051_363_956 | 176 |
| 11 | 3300048928 | Ga0496125_0082792 | Ga0496125_0082792_1531_2124 | 176 |
| 12 | 3300048929 | Ga0496126_0959556 | Ga0496126_0959556_71_616 | 181 |
| 13 | iso_pu_bacteria | 2842922631 | 2842928210 | 188 |
| 14 | 3300009036 | Ga0105244_10051389 | Ga0105244_100513892 | 189 |
| 15 | 3300013100 | Ga0157373_10007988 | Ga0157373_100079889 | 189 |
| 16 | 3300025728 | Ga0207655_1001923 | Ga0207655_100192310 | 189 |
| 17 | iso_pu_bacteria | 2511231011 | 2511298565 | 193 |
| 18 | iso_pu_bacteria | 2773857673 | 2774133196 | 193 |
| 19 | iso_pu_bacteria | 2784132063 | 2784262943 | 193 |
| 20 | iso_pu_bacteria | 2818991456 | 2819655989 | 193 |
| 21 | iso_pu_bacteria | 2880230671 | 2880234866 | 193 |
| 22 | iso_pu_bacteria | 2904518522 | 2904522282 | 193 |
| 23 | iso_pu_bacteria | 2675903420 | 2677897741 | 194 |
| 24 | iso_pu_bacteria | 3007861166 | 3007861673 | 194 |
| 25 | iso_pu_bacteria | 2599185212 | 2599611734 | 195 |
| 26 | iso_pu_bacteria | 2599185289 | 2599884669 | 195 |
| 27 | iso_pu_bacteria | 2599185291 | 2599896152 | 195 |
| 28 | iso_pu_bacteria | 2599185305 | 2599958038 | 195 |
| 29 | iso_pu_bacteria | 2599185306 | 2599968839 | 195 |
| 30 | iso_pu_bacteria | 2599185308 | 2599980039 | 195 |
| 31 | iso_pu_bacteria | 2599185311 | 2599992753 | 195 |
| 32 | iso_pu_bacteria | 2599185313 | 2600003876 | 195 |
| 33 | iso_pu_bacteria | 2599185314 | 2600013919 | 195 |
| 34 | iso_pu_bacteria | 2599185315 | 2600015761 | 195 |
| 35 | iso_pu_bacteria | 2599185317 | 2600028150 | 195 |
| 36 | iso_pu_bacteria | 2599185318 | 2600034052 | 195 |
| 37 | iso_pu_bacteria | 2599185319 | 2600040429 | 195 |
| 38 | iso_pu_bacteria | 2599185321 | 2600050968 | 195 |
| 39 | iso_pu_bacteria | 2599185322 | 2600058586 | 195 |
| 40 | iso_pu_bacteria | 2599185323 | 2600063433 | 195 |
| 41 | iso_pu_bacteria | 2599185324 | 2600069044 | 195 |
| 42 | iso_pu_bacteria | 2600254930 | 2600357401 | 195 |
| 43 | iso_pu_bacteria | 2643221650 | 2644281169 | 195 |
| 44 | iso_pu_bacteria | 2651869719 | 2652546449 | 195 |
| 45 | iso_pu_bacteria | 2667528170 | 2671088846 | 195 |
| 46 | iso_pu_bacteria | 2667528176 | 2671124894 | 195 |
| 47 | iso_pu_bacteria | 2713897148 | 2715752637 | 195 |
| 48 | iso_pu_bacteria | 2718217725 | 2718634927 | 195 |
| 49 | iso_pu_bacteria | 2808606361 | 2808857763 | 195 |
| 50 | iso_pu_bacteria | 2808606376 | 2808921601 | 195 |
| 51 | iso_pu_bacteria | 2808606378 | 2808937956 | 195 |
| 52 | iso_pu_bacteria | 2808606380 | 2808943722 | 195 |
| 53 | iso_pu_bacteria | 2808606383 | 2808966270 | 195 |
| 54 | iso_pu_bacteria | 2808606389 | 2809001162 | 195 |
| 55 | iso_pu_bacteria | 2825651385 | 2825652174 | 195 |
| 56 | iso_pu_bacteria | 2842843487 | 2842846999 | 195 |
| 57 | iso_pu_bacteria | 2908669403 | 2908670262 | 195 |
| 58 | iso_pu_bacteria | 2919487758 | 2919492759 | 195 |
| 59 | iso_pu_bacteria | 2931369376 | 2931374990 | 195 |
| 60 | iso_pu_bacteria | 2988728565 | 2988730314 | 195 |
| 61 | iso_pu_bacteria | 3007614139 | 3007615091 | 195 |
| 62 | iso_pu_bacteria | 8002285264 | 8002290929 | 195 |
| 63 | iso_pu_bacteria | 8056172158 | 8056174661 | 195 |
| 64 | iso_pu_bacteria | 2506520007 | 2506577717 | 196 |
| 65 | iso_pu_bacteria | 2506520008 | 2506582855 | 196 |
| 66 | iso_pu_bacteria | 2508501071 | 2508851648 | 196 |
| 67 | iso_pu_bacteria | 2511231006 | 2511265187 | 196 |
| 68 | iso_pu_bacteria | 2511231007 | 2511270056 | 196 |
| 69 | iso_pu_bacteria | 2512047018 | 2512329022 | 196 |
| 70 | iso_pu_bacteria | 2554235234 | 2555258092 | 196 |
| 71 | iso_pu_bacteria | 2582580891 | 2583794086 | 196 |
| 72 | iso_pu_bacteria | 2597489887 | 2597859679 | 196 |
| 73 | iso_pu_bacteria | 2599185156 | 2599335378 | 196 |
| 74 | iso_pu_bacteria | 2599185167 | 2599400058 | 196 |
| 75 | iso_pu_bacteria | 2599185179 | 2599452878 | 196 |
| 76 | iso_pu_bacteria | 2599185185 | 2599482508 | 196 |
| 77 | iso_pu_bacteria | 2599185190 | 2599514512 | 196 |
| 78 | iso_pu_bacteria | 2599185191 | 2599520594 | 196 |
| 79 | iso_pu_bacteria | 2599185257 | 2599803771 | 196 |
| 80 | iso_pu_bacteria | 2599185290 | 2599893888 | 196 |
| 81 | iso_pu_bacteria | 2599185292 | 2599905578 | 196 |
| 82 | iso_pu_bacteria | 2600254931 | 2600364581 | 196 |
| 83 | iso_pu_bacteria | 2600255256 | 2601533053 | 196 |
| 84 | iso_pu_bacteria | 2600255257 | 2601538420 | 196 |
| 85 | iso_pu_bacteria | 2600255279 | 2601612987 | 196 |
| 86 | iso_pu_bacteria | 2600255308 | 2601749721 | 196 |
| 87 | iso_pu_bacteria | 2600255310 | 2601756766 | 196 |
| 88 | iso_pu_bacteria | 2600255311 | 2601761779 | 196 |
| 89 | iso_pu_bacteria | 2602042047 | 2603643466 | 196 |
| 90 | iso_pu_bacteria | 2623620446 | 2624490643 | 196 |
| 91 | iso_pu_bacteria | 2636415599 | 2637225200 | 196 |
| 92 | iso_pu_bacteria | 2643221556 | 2643802664 | 196 |
| 93 | iso_pu_bacteria | 2643221684 | 2644472169 | 196 |
| 94 | iso_pu_bacteria | 2654587920 | 2656278600 | 196 |
| 95 | iso_pu_bacteria | 2667528172 | 2671102355 | 196 |
| 96 | iso_pu_bacteria | 2667528173 | 2671110503 | 196 |
| 97 | iso_pu_bacteria | 2667528175 | 2671118275 | 196 |
| 98 | iso_pu_bacteria | 2671180115 | 2671584465 | 196 |
| 99 | iso_pu_bacteria | 2671180172 | 2671770660 | 196 |
| 100 | iso_pu_bacteria | 2681812866 | 2681995800 | 196 |
| 101 | iso_pu_bacteria | 2681812869 | 2682007628 | 196 |
| 102 | iso_pu_bacteria | 2687453601 | 2689444252 | 196 |
| 103 | iso_pu_bacteria | 2734482264 | 2735835141 | 196 |
| 104 | iso_pu_bacteria | 2738541307 | 2738879425 | 196 |
| 105 | iso_pu_bacteria | 2738543004 | 2739196790 | 196 |
| 106 | iso_pu_bacteria | 2740892503 | 2743739217 | 196 |
| 107 | iso_pu_bacteria | 2751185917 | 2753855020 | 196 |
| 108 | iso_pu_bacteria | 2765235840 | 2765579663 | 196 |
| 109 | iso_pu_bacteria | 2765235842 | 2765587908 | 196 |
| 110 | iso_pu_bacteria | 2773857670 | 2774122336 | 196 |
| 111 | iso_pu_bacteria | 2775506706 | 2775541728 | 196 |
| 112 | iso_pu_bacteria | 2775507074 | 2777022792 | 196 |
| 113 | iso_pu_bacteria | 2784132072 | 2784316174 | 196 |
| 114 | iso_pu_bacteria | 2808606385 | 2808979555 | 196 |
| 115 | iso_pu_bacteria | 2808606388 | 2808995175 | 196 |
| 116 | iso_pu_bacteria | 2811995292 | 2813727256 | 196 |
| 117 | iso_pu_bacteria | 2814123068 | 2814694789 | 196 |
| 118 | iso_pu_bacteria | 2818991436 | 2819544164 | 196 |
| 119 | iso_pu_bacteria | 2821443989 | 2821446389 | 196 |
| 120 | iso_pu_bacteria | 2823373977 | 2823376996 | 196 |
| 121 | iso_pu_bacteria | 2834028612 | 2834031470 | 196 |
| 122 | iso_pu_bacteria | 2844533157 | 2844539383 | 196 |
| 123 | iso_pu_bacteria | 2852612431 | 2852612684 | 196 |
| 124 | iso_pu_bacteria | 2852667396 | 2852669580 | 196 |
| 125 | iso_pu_bacteria | 2858950400 | 2858951784 | 196 |
| 126 | iso_pu_bacteria | 2860339153 | 2860341167 | 196 |
| 127 | iso_pu_bacteria | 2869551831 | 2869553562 | 196 |
| 128 | iso_pu_bacteria | 2888366609 | 2888368316 | 196 |
| 129 | iso_pu_bacteria | 2904474040 | 2904477000 | 196 |
| 130 | iso_pu_bacteria | 2904513164 | 2904513911 | 196 |
| 131 | iso_pu_bacteria | 2908446538 | 2908451503 | 196 |
| 132 | iso_pu_bacteria | 2919108558 | 2919109335 | 196 |
| 133 | iso_pu_bacteria | 2919150387 | 2919153167 | 196 |
| 134 | iso_pu_bacteria | 2919697872 | 2919701839 | 196 |
| 135 | iso_pu_bacteria | 2923153595 | 2923158299 | 196 |
| 136 | iso_pu_bacteria | 2927143783 | 2927143793 | 196 |
| 137 | iso_pu_bacteria | 2927833300 | 2927835063 | 196 |
| 138 | iso_pu_bacteria | 2929189879 | 2929194086 | 196 |
| 139 | iso_pu_bacteria | 2931390751 | 2931395381 | 196 |
| 140 | iso_pu_bacteria | 2931396565 | 2931396902 | 196 |
| 141 | iso_pu_bacteria | 2937539931 | 2937542991 | 196 |
| 142 | iso_pu_bacteria | 2941479691 | 2941483403 | 196 |
| 143 | iso_pu_bacteria | 2945961074 | 2945965484 | 196 |
| 144 | iso_pu_bacteria | 2969079654 | 2969082196 | 196 |
| 145 | iso_pu_bacteria | 2971820967 | 2971823893 | 196 |
| 146 | iso_pu_bacteria | 2974310843 | 2974313170 | 196 |
| 147 | iso_pu_bacteria | 2984286254 | 2984287880 | 196 |
| 148 | iso_pu_bacteria | 2984559226 | 2984564638 | 196 |
| 149 | iso_pu_bacteria | 2984595703 | 2984597367 | 196 |
| 150 | iso_pu_bacteria | 3007395558 | 3007397591 | 196 |
| 151 | iso_pu_bacteria | 3007419365 | 3007424742 | 196 |
| 152 | iso_pu_bacteria | 3007511990 | 3007516080 | 196 |
| 153 | iso_pu_bacteria | 640753048 | 640937211 | 196 |
| 154 | iso_pu_bacteria | 8015687852 | 8015692386 | 196 |
| 155 | iso_pu_bacteria | 8019775933 | 8019780637 | 196 |
| 156 | iso_pu_bacteria | 8054285046 | 8054291053 | 196 |
| 157 | iso_pu_bacteria | 8055770955 | 8055775605 | 196 |
| 158 | iso_pu_bacteria | 8055817908 | 8055822859 | 196 |
| 159 | iso_pu_bacteria | 8056131705 | 8056136272 | 196 |
| 160 | 3300003759 | Ga0055525_1007489 | Ga0055525_10074891 | 197 |
| 161 | 3300009011 | Ga0105251_10112568 | Ga0105251_101125682 | 197 |
| 162 | 3300009036 | Ga0105244_10052630 | Ga0105244_100526302 | 197 |
| 163 | 3300013100 | Ga0157373_10179482 | Ga0157373_101794822 | 197 |
| 164 | 3300013104 | Ga0157370_10204410 | Ga0157370_102044102 | 197 |
| 165 | 3300014497 | Ga0182008_10001764 | Ga0182008_100017648 | 197 |
| 166 | 3300015261 | Ga0182006_1007173 | Ga0182006_10071734 | 197 |
| 167 | 3300017792 | Ga0163161_10037352 | Ga0163161_100373522 | 197 |
| 168 | 3300025230 | Ga0209563_101321 | Ga0209563_1013215 | 197 |
| 169 | 3300025735 | Ga0207713_1014499 | Ga0207713_10144994 | 197 |
| 170 | 3300042138 | Ga0450903_008180 | Ga0450903_008180_595_1188 | 197 |
| 171 | 3300042144 | Ga0450889_002580 | Ga0450889_002580_118_711 | 197 |
| 172 | 3300042532 | Ga0450893_0003281 | Ga0450893_0003281_707_1300 | 197 |
| 173 | 3300046457 | Ga0495590_0009751 | Ga0495590_0009751_2282_2875 | 197 |
| 174 | 3300046460 | Ga0495638_0012816 | Ga0495638_0012816_786_1379 | 197 |
| 175 | 3300046463 | Ga0495653_0006143 | Ga0495653_0006143_1731_2324 | 197 |
| 176 | 3300046471 | Ga0495650_0002618 | Ga0495650_0002618_8338_8931 | 197 |
| 177 | 3300046501 | Ga0495607_0002094 | Ga0495607_0002094_8472_9065 | 197 |
| 178 | 3300046513 | Ga0495616_0001804 | Ga0495616_0001804_8504_9103 | 197 |
| 179 | 3300046526 | Ga0495666_0033975 | Ga0495666_0033975_428_1021 | 197 |
| 180 | 3300046530 | Ga0495654_0059304 | Ga0495654_0059304_1140_1733 | 197 |
| 181 | 3300046543 | Ga0495645_0066398 | Ga0495645_0066398_520_1113 | 197 |
| 182 | 3300046642 | Ga0495634_0051353 | Ga0495634_0051353_624_1217 | 197 |
| 183 | 3300046674 | Ga0495588_0079503 | Ga0495588_0079503_53_646 | 197 |
| 184 | 3300046680 | Ga0495646_0086198 | Ga0495646_0086198_823_1416 | 197 |
| 185 | 3300046689 | Ga0495613_0186496 | Ga0495613_0186496_263_856 | 197 |
| 186 | 3300046690 | Ga0495624_0001741 | Ga0495624_0001741_7573_8166 | 197 |
| 187 | 3300046692 | Ga0495671_0112379 | Ga0495671_0112379_19_618 | 197 |
| 188 | 3300046809 | Ga0495600_0050069 | Ga0495600_0050069_1527_2120 | 197 |
| 189 | 3300047317 | Ga0495604_0085933 | Ga0495604_0085933_699_1292 | 197 |
| 190 | 3300047320 | Ga0495672_0002548 | Ga0495672_0002548_7599_8192 | 197 |
| 191 | 3300047322 | Ga0495680_0021857 | Ga0495680_0021857_2249_2842 | 197 |
| 192 | 3300047444 | Ga0495675_0095401 | Ga0495675_0095401_1204_1797 | 197 |
| 193 | 3300047470 | Ga0495681_0001637 | Ga0495681_0001637_8428_9027 | 197 |
| 194 | 3300047471 | Ga0495684_0063662 | Ga0495684_0063662_1570_2163 | 197 |
| 195 | 3300047673 | Ga0495593_0008934 | Ga0495593_0008934_2721_3314 | 197 |
| 196 | 3300048088 | Ga0495602_0010257 | Ga0495602_0010257_7585_8178 | 197 |
| 197 | 3300048903 | Ga0496100_0193749 | Ga0496100_0193749_271_864 | 197 |
| 198 | 3300048905 | Ga0496102_0475249 | Ga0496102_0475249_119_712 | 197 |
| 199 | 3300048909 | Ga0496106_0133176 | Ga0496106_0133176_961_1554 | 197 |
| 200 | 3300048919 | Ga0496116_0044660 | Ga0496116_0044660_1780_2373 | 197 |
| 201 | 3300048923 | Ga0496120_0096834 | Ga0496120_0096834_728_1321 | 197 |
| 202 | 3300048924 | Ga0496121_0054729 | Ga0496121_0054729_2131_2724 | 197 |
| 203 | 3300048925 | Ga0496122_0298673 | Ga0496122_0298673_45_638 | 197 |
| 204 | 3300048926 | Ga0496123_0084639 | Ga0496123_0084639_1001_1594 | 197 |
| 205 | 3300048927 | Ga0496124_0042147 | Ga0496124_0042147_1753_2346 | 197 |
| 206 | 3300049460 | Ga0495682_0004466 | Ga0495682_0004466_4721_5314 | 197 |
| 207 | iso_pu_bacteria | 8056689827 | 8056692367 | 197 |
| 208 | 3300046810 | Ga0495660_0051843 | Ga0495660_0051843_441_1037 | 198 |
| 209 | 3300048919 | Ga0496116_0001634 | Ga0496116_0001634_14397_14993 | 198 |
| 210 | 3300049459 | Ga0495678_007820 | Ga0495678_007820_1202_1798 | 198 |
| 211 | 3300005563 | Ga0068855_100059616 | Ga0068855_1000596166 | 199 |
| 212 | 3300007265 | Ga0099794_10000054 | Ga0099794_100000544 | 199 |
| 213 | 3300009093 | Ga0105240_10021162 | Ga0105240_1002116212 | 199 |
| 214 | 3300013104 | Ga0157370_10272285 | Ga0157370_102722852 | 199 |
| 215 | 3300013105 | Ga0157369_10064490 | Ga0157369_100644902 | 199 |
| 216 | 3300013307 | Ga0157372_10141186 | Ga0157372_101411863 | 199 |
| 217 | 3300025913 | Ga0207695_10065987 | Ga0207695_100659871 | 199 |
| 218 | 3300025949 | Ga0207667_10071345 | Ga0207667_100713451 | 199 |
| 219 | 3300027671 | Ga0209588_1000017 | Ga0209588_100001747 | 199 |
| 220 | 3300041407 | Ga0439447_001156 | Ga0439447_001156_8329_8928 | 199 |
| 221 | 3300041411 | Ga0439466_0002095 | Ga0439466_0002095_5458_6057 | 199 |
| 222 | 3300046507 | Ga0495606_0024403 | Ga0495606_0024403_3662_4261 | 199 |
| 223 | 2124908027 | MRS2a_Contig_1351 | MRS2a_00248490 | 200 |
| 224 | 2124908027 | MRS2a_Contig_27077 | MRS2a_00627540 | 200 |
| 225 | 2124908027 | MRS2a_Contig_339 | MRS2a_00236470 | 200 |
| 226 | 2162886007 | SwRhRL2b_contig_783059 | SwRhRL2b_0312.00000620 | 200 |
| 227 | 3300001989 | JGI24739J22299_10097095 | JGI24739J22299_100970951 | 200 |
| 228 | 3300002737 | JGI25162J39368_1000038 | JGI25162J39368_100003841 | 200 |
| 229 | 3300002737 | JGI25162J39368_1000092 | JGI25162J39368_100009228 | 200 |
| 230 | 3300002737 | JGI25162J39368_1000231 | JGI25162J39368_100023150 | 200 |
| 231 | 3300002737 | JGI25162J39368_1002383 | JGI25162J39368_10023832 | 200 |
| 232 | 3300002771 | JGI25163J39215_1000013 | JGI25163J39215_100001310 | 200 |
| 233 | 3300002771 | JGI25163J39215_1000504 | JGI25163J39215_10005042 | 200 |
| 234 | 3300002772 | JGI25164J39214_1000071 | JGI25164J39214_100007128 | 200 |
| 235 | 3300002772 | JGI25164J39214_1000179 | JGI25164J39214_100017949 | 200 |
| 236 | 3300003187 | JGI25151J46595_10000559 | JGI25151J46595_100005599 | 200 |
| 237 | 3300003187 | JGI25151J46595_10000719 | JGI25151J46595_1000071928 | 200 |
| 238 | 3300003214 | JGI25165J46597_1000045 | JGI25165J46597_100004541 | 200 |
| 239 | 3300003214 | JGI25165J46597_1000327 | JGI25165J46597_100032711 | 200 |
| 240 | 3300003215 | JGI25153J46596_10039030 | JGI25153J46596_100390302 | 200 |
| 241 | 3300003320 | rootH2_10110653 | rootH2_101106532 | 200 |
| 242 | 3300003322 | rootL2_10018643 | rootL2_100186433 | 200 |
| 243 | 3300003322 | rootL2_10155604 | rootL2_101556042 | 200 |
| 244 | 3300003354 | JGI25160J50197_1004440 | JGI25160J50197_10044402 | 200 |
| 245 | 3300003751 | Ga0055538_1000022 | Ga0055538_100002241 | 200 |
| 246 | 3300003751 | Ga0055538_1000064 | Ga0055538_100006428 | 200 |
| 247 | 3300003752 | Ga0055539_1000028 | Ga0055539_100002841 | 200 |
| 248 | 3300003752 | Ga0055539_1000098 | Ga0055539_100009828 | 200 |
| 249 | 3300003756 | Ga0055533_1000036 | Ga0055533_100003641 | 200 |
| 250 | 3300003756 | Ga0055533_1000108 | Ga0055533_100010828 | 200 |
| 251 | 3300003759 | Ga0055525_1000071 | Ga0055525_1000071123 | 200 |
| 252 | 3300003759 | Ga0055525_1000141 | Ga0055525_100014128 | 200 |
| 253 | 3300003791 | Ga0055530_10000105 | Ga0055530_1000010561 | 200 |
| 254 | 3300003791 | Ga0055530_10000256 | Ga0055530_1000025631 | 200 |
| 255 | 3300003792 | Ga0055540_1001478 | Ga0055540_10014783 | 200 |
| 256 | 3300003841 | Ga0055541_1000037 | Ga0055541_1000037123 | 200 |
| 257 | 3300003841 | Ga0055541_1000065 | Ga0055541_100006563 | 200 |
| 258 | 3300003856 | Ga0058692_1000135 | Ga0058692_100013514 | 200 |
| 259 | 3300003856 | Ga0058692_1014160 | Ga0058692_10141602 | 200 |
| 260 | 3300005272 | Ga0065703_1021008 | Ga0065703_10210082 | 200 |
| 261 | 3300005288 | Ga0065714_10000495 | Ga0065714_100004952 | 200 |
| 262 | 3300005288 | Ga0065714_10069538 | Ga0065714_100695383 | 200 |
| 263 | 3300005289 | Ga0065704_10000285 | Ga0065704_100002852 | 200 |
| 264 | 3300005289 | Ga0065704_10004692 | Ga0065704_100046925 | 200 |
| 265 | 3300005290 | Ga0065712_10006415 | Ga0065712_100064153 | 200 |
| 266 | 3300005293 | Ga0065715_10028109 | Ga0065715_100281092 | 200 |
| 267 | 3300005327 | Ga0070658_10190676 | Ga0070658_101906761 | 200 |
| 268 | 3300005328 | Ga0070676_10097935 | Ga0070676_100979352 | 200 |
| 269 | 3300005330 | Ga0070690_100724861 | Ga0070690_1007248611 | 200 |
| 270 | 3300005331 | Ga0070670_100000161 | Ga0070670_1000001618 | 200 |
| 271 | 3300005331 | Ga0070670_100000221 | Ga0070670_10000022117 | 200 |
| 272 | 3300005331 | Ga0070670_100325150 | Ga0070670_1003251501 | 200 |
| 273 | 3300005334 | Ga0068869_100466195 | Ga0068869_1004661952 | 200 |
| 274 | 3300005335 | Ga0070666_10248026 | Ga0070666_102480262 | 200 |
| 275 | 3300005338 | Ga0068868_100355727 | Ga0068868_1003557272 | 200 |
| 276 | 3300005344 | Ga0070661_100000640 | Ga0070661_1000006402 | 200 |
| 277 | 3300005347 | Ga0070668_100034128 | Ga0070668_1000341282 | 200 |
| 278 | 3300005353 | Ga0070669_100000299 | Ga0070669_10000029929 | 200 |
| 279 | 3300005354 | Ga0070675_100216966 | Ga0070675_1002169663 | 200 |
| 280 | 3300005364 | Ga0070673_100177993 | Ga0070673_1001779933 | 200 |
| 281 | 3300005365 | Ga0070688_100428084 | Ga0070688_1004280842 | 200 |
| 282 | 3300005367 | Ga0070667_100321849 | Ga0070667_1003218492 | 200 |
| 283 | 3300005457 | Ga0070662_100001026 | Ga0070662_10000102616 | 200 |
| 284 | 3300005457 | Ga0070662_100207068 | Ga0070662_1002070682 | 200 |
| 285 | 3300005535 | Ga0070684_100414485 | Ga0070684_1004144852 | 200 |
| 286 | 3300005539 | Ga0068853_100033799 | Ga0068853_1000337993 | 200 |
| 287 | 3300005539 | Ga0068853_100472424 | Ga0068853_1004724242 | 200 |
| 288 | 3300005543 | Ga0070672_100045412 | Ga0070672_1000454122 | 200 |
| 289 | 3300005547 | Ga0070693_100096092 | Ga0070693_1000960923 | 200 |
| 290 | 3300005548 | Ga0070665_100039980 | Ga0070665_1000399801 | 200 |
| 291 | 3300005564 | Ga0070664_100000489 | Ga0070664_10000048917 | 200 |
| 292 | 3300005564 | Ga0070664_100146767 | Ga0070664_1001467672 | 200 |
| 293 | 3300005577 | Ga0068857_100667298 | Ga0068857_1006672982 | 200 |
| 294 | 3300005578 | Ga0068854_100008186 | Ga0068854_1000081864 | 200 |
| 295 | 3300005614 | Ga0068856_100057337 | Ga0068856_1000573372 | 200 |
| 296 | 3300005614 | Ga0068856_100192049 | Ga0068856_1001920492 | 200 |
| 297 | 3300005617 | Ga0068859_100556123 | Ga0068859_1005561232 | 200 |
| 298 | 3300005834 | Ga0068851_10000036 | Ga0068851_1000003630 | 200 |
| 299 | 3300005840 | Ga0068870_10402166 | Ga0068870_104021661 | 200 |
| 300 | 3300005843 | Ga0068860_100551405 | Ga0068860_1005514051 | 200 |
| 301 | 3300005983 | Ga0081540_1049520 | Ga0081540_10495202 | 200 |
| 302 | 3300006028 | Ga0070717_10085800 | Ga0070717_100858003 | 200 |
| 303 | 3300006051 | Ga0075364_10009886 | Ga0075364_100098864 | 200 |
| 304 | 3300006051 | Ga0075364_10062388 | Ga0075364_100623885 | 200 |
| 305 | 3300006058 | Ga0075432_10000389 | Ga0075432_100003897 | 200 |
| 306 | 3300006058 | Ga0075432_10084063 | Ga0075432_100840632 | 200 |
| 307 | 3300006186 | Ga0075369_10028270 | Ga0075369_100282702 | 200 |
| 308 | 3300006881 | Ga0068865_100017011 | Ga0068865_1000170111 | 200 |
| 309 | 3300006931 | Ga0097620_100556117 | Ga0097620_1005561172 | 200 |
| 310 | 3300006946 | Ga0079104_1005087 | Ga0079104_10050873 | 200 |
| 311 | 3300006946 | Ga0079104_1057562 | Ga0079104_10575621 | 200 |
| 312 | 3300009011 | Ga0105251_10000109 | Ga0105251_100001099 | 200 |
| 313 | 3300009011 | Ga0105251_10000632 | Ga0105251_100006329 | 200 |
| 314 | 3300009011 | Ga0105251_10002446 | Ga0105251_100024464 | 200 |
| 315 | 3300009011 | Ga0105251_10002477 | Ga0105251_100024774 | 200 |
| 316 | 3300009011 | Ga0105251_10004209 | Ga0105251_1000420914 | 200 |
| 317 | 3300009011 | Ga0105251_10005496 | Ga0105251_100054967 | 200 |
| 318 | 3300009011 | Ga0105251_10007551 | Ga0105251_100075516 | 200 |
| 319 | 3300009011 | Ga0105251_10232389 | Ga0105251_102323891 | 200 |
| 320 | 3300009036 | Ga0105244_10000690 | Ga0105244_100006909 | 200 |
| 321 | 3300009036 | Ga0105244_10001260 | Ga0105244_1000126012 | 200 |
| 322 | 3300009036 | Ga0105244_10001623 | Ga0105244_1000162318 | 200 |
| 323 | 3300009036 | Ga0105244_10002664 | Ga0105244_100026647 | 200 |
| 324 | 3300009036 | Ga0105244_10006790 | Ga0105244_100067902 | 200 |
| 325 | 3300009036 | Ga0105244_10007221 | Ga0105244_100072217 | 200 |
| 326 | 3300009036 | Ga0105244_10036931 | Ga0105244_100369312 | 200 |
| 327 | 3300009036 | Ga0105244_10161982 | Ga0105244_101619822 | 200 |
| 328 | 3300009092 | Ga0105250_10001610 | Ga0105250_100016106 | 200 |
| 329 | 3300009092 | Ga0105250_10003840 | Ga0105250_100038405 | 200 |
| 330 | 3300009092 | Ga0105250_10020674 | Ga0105250_100206742 | 200 |
| 331 | 3300009093 | Ga0105240_10040554 | Ga0105240_100405544 | 200 |
| 332 | 3300009093 | Ga0105240_10076396 | Ga0105240_100763964 | 200 |
| 333 | 3300009101 | Ga0105247_10000025 | Ga0105247_1000002518 | 200 |
| 334 | 3300009148 | Ga0105243_10006244 | Ga0105243_100062444 | 200 |
| 335 | 3300009148 | Ga0105243_10135564 | Ga0105243_101355644 | 200 |
| 336 | 3300009174 | Ga0105241_10000005 | Ga0105241_1000000586 | 200 |
| 337 | 3300009176 | Ga0105242_10000238 | Ga0105242_1000023826 | 200 |
| 338 | 3300009176 | Ga0105242_10566113 | Ga0105242_105661132 | 200 |
| 339 | 3300010375 | Ga0105239_10001431 | Ga0105239_1000143119 | 200 |
| 340 | 3300010375 | Ga0105239_10770933 | Ga0105239_107709331 | 200 |
| 341 | 3300011119 | Ga0105246_10210134 | Ga0105246_102101341 | 200 |
| 342 | 3300011119 | Ga0105246_10684597 | Ga0105246_106845971 | 200 |
| 343 | 3300013100 | Ga0157373_10004421 | Ga0157373_100044212 | 200 |
| 344 | 3300013100 | Ga0157373_10005271 | Ga0157373_100052717 | 200 |
| 345 | 3300013100 | Ga0157373_10005861 | Ga0157373_100058613 | 200 |
| 346 | 3300013102 | Ga0157371_10003359 | Ga0157371_1000335911 | 200 |
| 347 | 3300013102 | Ga0157371_10259645 | Ga0157371_102596451 | 200 |
| 348 | 3300013102 | Ga0157371_10264236 | Ga0157371_102642362 | 200 |
| 349 | 3300013104 | Ga0157370_10024387 | Ga0157370_100243872 | 200 |
| 350 | 3300013104 | Ga0157370_10060151 | Ga0157370_100601513 | 200 |
| 351 | 3300013104 | Ga0157370_10070146 | Ga0157370_100701463 | 200 |
| 352 | 3300013104 | Ga0157370_10100182 | Ga0157370_101001822 | 200 |
| 353 | 3300013104 | Ga0157370_10238850 | Ga0157370_102388501 | 200 |
| 354 | 3300013104 | Ga0157370_10250296 | Ga0157370_102502962 | 200 |
| 355 | 3300013104 | Ga0157370_10451491 | Ga0157370_104514911 | 200 |
| 356 | 3300013104 | Ga0157370_10981132 | Ga0157370_109811321 | 200 |
| 357 | 3300013105 | Ga0157369_10000646 | Ga0157369_1000064619 | 200 |
| 358 | 3300013105 | Ga0157369_10005544 | Ga0157369_1000554414 | 200 |
| 359 | 3300013105 | Ga0157369_10007554 | Ga0157369_100075548 | 200 |
| 360 | 3300013105 | Ga0157369_10009657 | Ga0157369_100096572 | 200 |
| 361 | 3300013105 | Ga0157369_10093023 | Ga0157369_100930234 | 200 |
| 362 | 3300013105 | Ga0157369_10249118 | Ga0157369_102491182 | 200 |
| 363 | 3300013296 | Ga0157374_10035668 | Ga0157374_100356682 | 200 |
| 364 | 3300013307 | Ga0157372_10008148 | Ga0157372_100081484 | 200 |
| 365 | 3300013307 | Ga0157372_10205989 | Ga0157372_102059892 | 200 |
| 366 | 3300013307 | Ga0157372_10664017 | Ga0157372_106640172 | 200 |
| 367 | 3300013308 | Ga0157375_10000979 | Ga0157375_1000097917 | 200 |
| 368 | 3300013308 | Ga0157375_10011925 | Ga0157375_100119253 | 200 |
| 369 | 3300013308 | Ga0157375_10186611 | Ga0157375_101866113 | 200 |
| 370 | 3300014325 | Ga0163163_10829545 | Ga0163163_108295451 | 200 |
| 371 | 3300014497 | Ga0182008_10000753 | Ga0182008_1000075310 | 200 |
| 372 | 3300014497 | Ga0182008_10002169 | Ga0182008_100021696 | 200 |
| 373 | 3300014497 | Ga0182008_10002354 | Ga0182008_100023549 | 200 |
| 374 | 3300014497 | Ga0182008_10016078 | Ga0182008_100160783 | 200 |
| 375 | 3300014969 | Ga0157376_10035314 | Ga0157376_100353142 | 200 |
| 376 | 3300015261 | Ga0182006_1002148 | Ga0182006_10021485 | 200 |
| 377 | 3300015261 | Ga0182006_1007195 | Ga0182006_10071956 | 200 |
| 378 | 3300015262 | Ga0182007_10002918 | Ga0182007_100029185 | 200 |
| 379 | 3300015262 | Ga0182007_10003477 | Ga0182007_1000347711 | 200 |
| 380 | 3300015265 | Ga0182005_1000928 | Ga0182005_10009287 | 200 |
| 381 | 3300015265 | Ga0182005_1002531 | Ga0182005_10025318 | 200 |
| 382 | 3300015679 | Ga0183366_1001 | Ga0183366_1001321 | 200 |
| 383 | 3300015680 | Ga0183370_1001 | Ga0183370_1001321 | 200 |
| 384 | 3300015685 | Ga0183369_1001 | Ga0183369_1001321 | 200 |
| 385 | 3300015687 | Ga0183368_1001 | Ga0183368_1001321 | 200 |
| 386 | 3300017792 | Ga0163161_10000001 | Ga0163161_10000001431 | 200 |
| 387 | 3300017792 | Ga0163161_10057629 | Ga0163161_100576291 | 200 |
| 388 | 3300017792 | Ga0163161_10136388 | Ga0163161_101363882 | 200 |
| 389 | 3300017792 | Ga0163161_10365862 | Ga0163161_103658622 | 200 |
| 390 | 3300025207 | Ga0209760_100189 | Ga0209760_1001897 | 200 |
| 391 | 3300025207 | Ga0209760_100257 | Ga0209760_10025711 | 200 |
| 392 | 3300025207 | Ga0209760_102005 | Ga0209760_1020053 | 200 |
| 393 | 3300025224 | Ga0209784_100001 | Ga0209784_1000011827 | 200 |
| 394 | 3300025224 | Ga0209784_100036 | Ga0209784_100036193 | 200 |
| 395 | 3300025225 | Ga0209566_100001 | Ga0209566_1000011827 | 200 |
| 396 | 3300025225 | Ga0209566_100044 | Ga0209566_100044193 | 200 |
| 397 | 3300025226 | Ga0209674_100002 | Ga0209674_1000021827 | 200 |
| 398 | 3300025226 | Ga0209674_100065 | Ga0209674_100065193 | 200 |
| 399 | 3300025230 | Ga0209563_100002 | Ga0209563_100002362 | 200 |
| 400 | 3300025230 | Ga0209563_100063 | Ga0209563_100063193 | 200 |
| 401 | 3300025231 | Ga0207427_100008 | Ga0207427_10000811 | 200 |
| 402 | 3300025231 | Ga0207427_100020 | Ga0207427_100020415 | 200 |
| 403 | 3300025231 | Ga0207427_100664 | Ga0207427_1006644 | 200 |
| 404 | 3300025233 | Ga0209437_100001 | Ga0209437_100001362 | 200 |
| 405 | 3300025233 | Ga0209437_100014 | Ga0209437_100014700 | 200 |
| 406 | 3300025233 | Ga0209437_100032 | Ga0209437_100032347 | 200 |
| 407 | 3300025233 | Ga0209437_100082 | Ga0209437_100082193 | 200 |
| 408 | 3300025253 | Ga0209677_100002 | Ga0209677_100002362 | 200 |
| 409 | 3300025253 | Ga0209677_100038 | Ga0209677_100038193 | 200 |
| 410 | 3300025261 | Ga0209233_1000008 | Ga0209233_1000008700 | 200 |
| 411 | 3300025261 | Ga0209233_1000109 | Ga0209233_1000109193 | 200 |
| 412 | 3300025284 | Ga0209130_1000436 | Ga0209130_100043622 | 200 |
| 413 | 3300025292 | Ga0209676_1000006 | Ga0209676_1000006430 | 200 |
| 414 | 3300025294 | Ga0209025_1000099 | Ga0209025_1000099117 | 200 |
| 415 | 3300025297 | Ga0209758_1001714 | Ga0209758_10017142 | 200 |
| 416 | 3300025298 | Ga0209050_1000070 | Ga0209050_100007089 | 200 |
| 417 | 3300025302 | Ga0207426_1000065 | Ga0207426_1000065244 | 200 |
| 418 | 3300025303 | Ga0209051_1000093 | Ga0209051_100009380 | 200 |
| 419 | 3300025315 | Ga0207697_10133950 | Ga0207697_101339502 | 200 |
| 420 | 3300025321 | Ga0207656_10000021 | Ga0207656_1000002188 | 200 |
| 421 | 3300025711 | Ga0207696_1000001 | Ga0207696_1000001510 | 200 |
| 422 | 3300025711 | Ga0207696_1002951 | Ga0207696_10029513 | 200 |
| 423 | 3300025711 | Ga0207696_1026790 | Ga0207696_10267902 | 200 |
| 424 | 3300025728 | Ga0207655_1000021 | Ga0207655_1000021432 | 200 |
| 425 | 3300025728 | Ga0207655_1000060 | Ga0207655_1000060195 | 200 |
| 426 | 3300025728 | Ga0207655_1000595 | Ga0207655_100059526 | 200 |
| 427 | 3300025728 | Ga0207655_1000679 | Ga0207655_100067922 | 200 |
| 428 | 3300025728 | Ga0207655_1001849 | Ga0207655_100184911 | 200 |
| 429 | 3300025728 | Ga0207655_1002280 | Ga0207655_100228021 | 200 |
| 430 | 3300025728 | Ga0207655_1002998 | Ga0207655_100299813 | 200 |
| 431 | 3300025728 | Ga0207655_1010672 | Ga0207655_10106724 | 200 |
| 432 | 3300025728 | Ga0207655_1019953 | Ga0207655_10199533 | 200 |
| 433 | 3300025728 | Ga0207655_1023432 | Ga0207655_10234322 | 200 |
| 434 | 3300025735 | Ga0207713_1000003 | Ga0207713_1000003718 | 200 |
| 435 | 3300025735 | Ga0207713_1000011 | Ga0207713_1000011378 | 200 |
| 436 | 3300025735 | Ga0207713_1000092 | Ga0207713_100009276 | 200 |
| 437 | 3300025735 | Ga0207713_1000142 | Ga0207713_100014222 | 200 |
| 438 | 3300025735 | Ga0207713_1000671 | Ga0207713_10006719 | 200 |
| 439 | 3300025735 | Ga0207713_1002192 | Ga0207713_10021928 | 200 |
| 440 | 3300025735 | Ga0207713_1010307 | Ga0207713_10103072 | 200 |
| 441 | 3300025735 | Ga0207713_1014047 | Ga0207713_10140477 | 200 |
| 442 | 3300025735 | Ga0207713_1015037 | Ga0207713_10150373 | 200 |
| 443 | 3300025735 | Ga0207713_1017844 | Ga0207713_10178443 | 200 |
| 444 | 3300025735 | Ga0207713_1033314 | Ga0207713_10333142 | 200 |
| 445 | 3300025900 | Ga0207710_10000074 | Ga0207710_1000007463 | 200 |
| 446 | 3300025907 | Ga0207645_10128755 | Ga0207645_101287552 | 200 |
| 447 | 3300025908 | Ga0207643_10277292 | Ga0207643_102772922 | 200 |
| 448 | 3300025909 | Ga0207705_10265352 | Ga0207705_102653522 | 200 |
| 449 | 3300025911 | Ga0207654_10000007 | Ga0207654_10000007306 | 200 |
| 450 | 3300025914 | Ga0207671_10000263 | Ga0207671_1000026354 | 200 |
| 451 | 3300025920 | Ga0207649_10000288 | Ga0207649_1000028826 | 200 |
| 452 | 3300025923 | Ga0207681_10001287 | Ga0207681_1000128713 | 200 |
| 453 | 3300025925 | Ga0207650_10000191 | Ga0207650_1000019162 | 200 |
| 454 | 3300025925 | Ga0207650_10000194 | Ga0207650_100001945 | 200 |
| 455 | 3300025925 | Ga0207650_10259019 | Ga0207650_102590191 | 200 |
| 456 | 3300025925 | Ga0207650_10351626 | Ga0207650_103516262 | 200 |
| 457 | 3300025926 | Ga0207659_10096672 | Ga0207659_100966722 | 200 |
| 458 | 3300025933 | Ga0207706_10000493 | Ga0207706_1000049327 | 200 |
| 459 | 3300025933 | Ga0207706_10259521 | Ga0207706_102595212 | 200 |
| 460 | 3300025934 | Ga0207686_10011944 | Ga0207686_100119444 | 200 |
| 461 | 3300025935 | Ga0207709_10027877 | Ga0207709_100278772 | 200 |
| 462 | 3300025935 | Ga0207709_10193879 | Ga0207709_101938791 | 200 |
| 463 | 3300025938 | Ga0207704_10102824 | Ga0207704_101028242 | 200 |
| 464 | 3300025940 | Ga0207691_10028446 | Ga0207691_100284464 | 200 |
| 465 | 3300025942 | Ga0207689_10245149 | Ga0207689_102451492 | 200 |
| 466 | 3300025945 | Ga0207679_10000226 | Ga0207679_1000022617 | 200 |
| 467 | 3300025945 | Ga0207679_10164444 | Ga0207679_101644442 | 200 |
| 468 | 3300025981 | Ga0207640_10035714 | Ga0207640_100357143 | 200 |
| 469 | 3300025986 | Ga0207658_10546123 | Ga0207658_105461232 | 200 |
| 470 | 3300026041 | Ga0207639_10014082 | Ga0207639_100140823 | 200 |
| 471 | 3300026041 | Ga0207639_10699654 | Ga0207639_106996542 | 200 |
| 472 | 3300026078 | Ga0207702_10001503 | Ga0207702_100015039 | 200 |
| 473 | 3300026078 | Ga0207702_10586018 | Ga0207702_105860181 | 200 |
| 474 | 3300026089 | Ga0207648_10332758 | Ga0207648_103327583 | 200 |
| 475 | 3300026116 | Ga0207674_10001166 | Ga0207674_1000116610 | 200 |
| 476 | 3300026142 | Ga0207698_10194869 | Ga0207698_101948692 | 200 |
| 477 | 3300027111 | Ga0209281_1000027 | Ga0209281_1000027391 | 200 |
| 478 | 3300027111 | Ga0209281_1001505 | Ga0209281_10015053 | 200 |
| 479 | 3300027312 | Ga0209371_1000001 | Ga0209371_1000001275 | 200 |
| 480 | 3300027312 | Ga0209371_1000471 | Ga0209371_10004713 | 200 |
| 481 | 3300027312 | Ga0209371_1017128 | Ga0209371_10171282 | 200 |
| 482 | 3300027666 | Ga0209282_1000093 | Ga0209282_100009328 | 200 |
| 483 | 3300027907 | Ga0207428_10115187 | Ga0207428_101151872 | 200 |
| 484 | 3300027907 | Ga0207428_10134967 | Ga0207428_101349672 | 200 |
| 485 | 3300027907 | Ga0207428_10400031 | Ga0207428_104000311 | 200 |
| 486 | 3300028379 | Ga0268266_10206371 | Ga0268266_102063713 | 200 |
| 487 | 3300028381 | Ga0268264_11014095 | Ga0268264_110140952 | 200 |
| 488 | 3300028786 | Ga0307517_10067934 | Ga0307517_100679343 | 200 |
| 489 | 3300030500 | Ga0268256_1000001 | Ga0268256_10000012366 | 200 |
| 490 | 3300030500 | Ga0268256_1000057 | Ga0268256_100005796 | 200 |
| 491 | 3300030500 | Ga0268256_1000398 | Ga0268256_100039837 | 200 |
| 492 | 3300030500 | Ga0268256_1019079 | Ga0268256_10190792 | 200 |
| 493 | 3300031239 | Ga0265328_10082971 | Ga0265328_100829713 | 200 |
| 494 | 3300031507 | Ga0307509_10151367 | Ga0307509_101513674 | 200 |
| 495 | 3300031730 | Ga0307516_10030996 | Ga0307516_100309964 | 200 |
| 496 | 3300031911 | Ga0307412_10005500 | Ga0307412_100055002 | 200 |
| 497 | 3300037312 | Ga0395899_0004173 | Ga0395899_0004173_1917_2522 | 200 |
| 498 | 3300037418 | Ga0395900_0013792 | Ga0395900_0013792_2216_2821 | 200 |
| 499 | 3300039437 | Ga0436365_1060686 | Ga0436365_1060686_160_768 | 200 |
| 500 | 3300041405 | Ga0439438_036176 | Ga0439438_036176_188_790 | 200 |
| 501 | 3300041407 | Ga0439447_023131 | Ga0439447_023131_237_839 | 200 |
| 502 | 3300041411 | Ga0439466_0000953 | Ga0439466_0000953_8525_9127 | 200 |
| 503 | 3300041411 | Ga0439466_0078346 | Ga0439466_0078346_252_854 | 200 |
| 504 | 3300042009 | Ga0439451_000970 | Ga0439451_000970_1133_1735 | 200 |
| 505 | 3300042009 | Ga0439451_046280 | Ga0439451_046280_148_750 | 200 |
| 506 | 3300042010 | Ga0439452_000126 | Ga0439452_000126_57050_57655 | 200 |
| 507 | 3300042010 | Ga0439452_015882 | Ga0439452_015882_1227_1829 | 200 |
| 508 | 3300042013 | Ga0439456_016540 | Ga0439456_016540_127_729 | 200 |
| 509 | 3300042016 | Ga0439463_000047 | Ga0439463_000047_15393_15998 | 200 |
| 510 | 3300042439 | Ga0439464_0016738 | Ga0439464_0016738_184_789 | 200 |
| 511 | 3300042461 | Ga0439460_0040485 | Ga0439460_0040485_316_918 | 200 |
| 512 | 3300042993 | Ga0439440_0010531 | Ga0439440_0010531_1293_1898 | 200 |
| 513 | 3300044658 | Ga0466972_0006635 | Ga0466972_0006635_4177_4779 | 200 |
| 514 | 3300044663 | Ga0466989_0173783 | Ga0466989_0173783_481_1095 | 200 |
| 515 | 3300044683 | Ga0466965_0093015 | Ga0466965_0093015_130_732 | 200 |
| 516 | 3300044693 | Ga0466961_0101325 | Ga0466961_0101325_786_1400 | 200 |
| 517 | 3300044694 | Ga0466963_0275197 | Ga0466963_0275197_173_787 | 200 |
| 518 | 3300044706 | Ga0466964_0002273 | Ga0466964_0002273_5792_6394 | 200 |
| 519 | 3300044712 | Ga0453684_0421915 | Ga0453684_0421915_855_1460 | 200 |
| 520 | 3300044735 | Ga0466968_0138534 | Ga0466968_0138534_403_1005 | 200 |
| 521 | 3300044765 | Ga0466970_0190841 | Ga0466970_0190841_107_709 | 200 |
| 522 | 3300044901 | Ga0466960_0028244 | Ga0466960_0028244_420_1022 | 200 |
| 523 | 3300046452 | Ga0495617_000028 | Ga0495617_000028_33352_33954 | 200 |
| 524 | 3300046452 | Ga0495617_000408 | Ga0495617_000408_17668_18270 | 200 |
| 525 | 3300046452 | Ga0495617_002126 | Ga0495617_002126_501_1103 | 200 |
| 526 | 3300046452 | Ga0495617_018492 | Ga0495617_018492_998_1600 | 200 |
| 527 | 3300046452 | Ga0495617_023670 | Ga0495617_023670_1293_1895 | 200 |
| 528 | 3300046453 | Ga0495627_000018 | Ga0495627_000018_90302_90919 | 200 |
| 529 | 3300046453 | Ga0495627_021434 | Ga0495627_021434_567_1172 | 200 |
| 530 | 3300046455 | Ga0495603_0399956 | Ga0495603_0399956_42_644 | 200 |
| 531 | 3300046457 | Ga0495590_0000901 | Ga0495590_0000901_7279_7881 | 200 |
| 532 | 3300046457 | Ga0495590_0035907 | Ga0495590_0035907_994_1596 | 200 |
| 533 | 3300046458 | Ga0495591_003722 | Ga0495591_003722_673_1275 | 200 |
| 534 | 3300046458 | Ga0495591_112969 | Ga0495591_112969_54_656 | 200 |
| 535 | 3300046460 | Ga0495638_0020181 | Ga0495638_0020181_3063_3665 | 200 |
| 536 | 3300046460 | Ga0495638_0197554 | Ga0495638_0197554_390_992 | 200 |
| 537 | 3300046462 | Ga0495651_0167561 | Ga0495651_0167561_616_1314 | 200 |
| 538 | 3300046471 | Ga0495650_0000043 | Ga0495650_0000043_15413_16075 | 200 |
| 539 | 3300046471 | Ga0495650_0002158 | Ga0495650_0002158_4588_5190 | 200 |
| 540 | 3300046471 | Ga0495650_0004589 | Ga0495650_0004589_3234_3836 | 200 |
| 541 | 3300046471 | Ga0495650_0005525 | Ga0495650_0005525_483_1085 | 200 |
| 542 | 3300046472 | Ga0495580_0244028 | Ga0495580_0244028_389_991 | 200 |
| 543 | 3300046474 | Ga0495605_0004566 | Ga0495605_0004566_6884_7486 | 200 |
| 544 | 3300046474 | Ga0495605_0022108 | Ga0495605_0022108_2470_3072 | 200 |
| 545 | 3300046474 | Ga0495605_0055809 | Ga0495605_0055809_1230_1832 | 200 |
| 546 | 3300046474 | Ga0495605_0069888 | Ga0495605_0069888_1007_1609 | 200 |
| 547 | 3300046475 | Ga0495639_0000633 | Ga0495639_0000633_6409_7011 | 200 |
| 548 | 3300046475 | Ga0495639_0013803 | Ga0495639_0013803_2806_3408 | 200 |
| 549 | 3300046491 | Ga0495584_0001297 | Ga0495584_0001297_8448_9050 | 200 |
| 550 | 3300046491 | Ga0495584_0001499 | Ga0495584_0001499_5407_6009 | 200 |
| 551 | 3300046491 | Ga0495584_0019448 | Ga0495584_0019448_1067_1669 | 200 |
| 552 | 3300046492 | Ga0495585_0022219 | Ga0495585_0022219_2858_3460 | 200 |
| 553 | 3300046492 | Ga0495585_0065684 | Ga0495585_0065684_376_978 | 200 |
| 554 | 3300046492 | Ga0495585_0306652 | Ga0495585_0306652_141_743 | 200 |
| 555 | 3300046499 | Ga0495594_0016635 | Ga0495594_0016635_429_1031 | 200 |
| 556 | 3300046499 | Ga0495594_0022850 | Ga0495594_0022850_931_1533 | 200 |
| 557 | 3300046500 | Ga0495596_0006155 | Ga0495596_0006155_3125_3730 | 200 |
| 558 | 3300046501 | Ga0495607_0000411 | Ga0495607_0000411_32361_32963 | 200 |
| 559 | 3300046501 | Ga0495607_0003292 | Ga0495607_0003292_7542_8144 | 200 |
| 560 | 3300046501 | Ga0495607_0007091 | Ga0495607_0007091_6708_7310 | 200 |
| 561 | 3300046501 | Ga0495607_0008369 | Ga0495607_0008369_4380_4982 | 200 |
| 562 | 3300046501 | Ga0495607_0333335 | Ga0495607_0333335_50_652 | 200 |
| 563 | 3300046506 | Ga0495583_0003439 | Ga0495583_0003439_9218_9820 | 200 |
| 564 | 3300046506 | Ga0495583_0012803 | Ga0495583_0012803_186_788 | 200 |
| 565 | 3300046507 | Ga0495606_0002737 | Ga0495606_0002737_4209_4811 | 200 |
| 566 | 3300046507 | Ga0495606_0043657 | Ga0495606_0043657_2222_2824 | 200 |
| 567 | 3300046507 | Ga0495606_0174073 | Ga0495606_0174073_566_1171 | 200 |
| 568 | 3300046507 | Ga0495606_0212949 | Ga0495606_0212949_295_897 | 200 |
| 569 | 3300046512 | Ga0495610_0006447 | Ga0495610_0006447_676_1278 | 200 |
| 570 | 3300046512 | Ga0495610_0012908 | Ga0495610_0012908_2755_3471 | 200 |
| 571 | 3300046512 | Ga0495610_0050457 | Ga0495610_0050457_252_932 | 200 |
| 572 | 3300046512 | Ga0495610_0108460 | Ga0495610_0108460_80_694 | 200 |
| 573 | 3300046512 | Ga0495610_0114039 | Ga0495610_0114039_414_1016 | 200 |
| 574 | 3300046513 | Ga0495616_0021597 | Ga0495616_0021597_2447_3049 | 200 |
| 575 | 3300046515 | Ga0495620_0000046 | Ga0495620_0000046_74327_74929 | 200 |
| 576 | 3300046516 | Ga0495628_0010287 | Ga0495628_0010287_7264_7872 | 200 |
| 577 | 3300046518 | Ga0495631_0000955 | Ga0495631_0000955_9998_10600 | 200 |
| 578 | 3300046518 | Ga0495631_0013652 | Ga0495631_0013652_117_719 | 200 |
| 579 | 3300046518 | Ga0495631_0179313 | Ga0495631_0179313_261_863 | 200 |
| 580 | 3300046519 | Ga0495632_0001104 | Ga0495632_0001104_17455_18057 | 200 |
| 581 | 3300046519 | Ga0495632_0001282 | Ga0495632_0001282_9832_10434 | 200 |
| 582 | 3300046520 | Ga0495637_0006805 | Ga0495637_0006805_763_1365 | 200 |
| 583 | 3300046520 | Ga0495637_0022452 | Ga0495637_0022452_2046_2648 | 200 |
| 584 | 3300046520 | Ga0495637_0024071 | Ga0495637_0024071_188_790 | 200 |
| 585 | 3300046520 | Ga0495637_0056948 | Ga0495637_0056948_25_627 | 200 |
| 586 | 3300046522 | Ga0495643_0014773 | Ga0495643_0014773_1339_1941 | 200 |
| 587 | 3300046523 | Ga0495644_0012139 | Ga0495644_0012139_74_676 | 200 |
| 588 | 3300046524 | Ga0495648_0015363 | Ga0495648_0015363_2646_3248 | 200 |
| 589 | 3300046524 | Ga0495648_0019072 | Ga0495648_0019072_1230_1832 | 200 |
| 590 | 3300046524 | Ga0495648_0021049 | Ga0495648_0021049_2135_2737 | 200 |
| 591 | 3300046524 | Ga0495648_0021473 | Ga0495648_0021473_497_1099 | 200 |
| 592 | 3300046524 | Ga0495648_0038353 | Ga0495648_0038353_2227_2829 | 200 |
| 593 | 3300046524 | Ga0495648_0042482 | Ga0495648_0042482_434_1036 | 200 |
| 594 | 3300046526 | Ga0495666_0076812 | Ga0495666_0076812_713_1315 | 200 |
| 595 | 3300046526 | Ga0495666_0102266 | Ga0495666_0102266_608_1210 | 200 |
| 596 | 3300046526 | Ga0495666_0112604 | Ga0495666_0112604_379_981 | 200 |
| 597 | 3300046528 | Ga0495642_0006583 | Ga0495642_0006583_472_1074 | 200 |
| 598 | 3300046528 | Ga0495642_0089350 | Ga0495642_0089350_463_1065 | 200 |
| 599 | 3300046530 | Ga0495654_0002150 | Ga0495654_0002150_5107_5709 | 200 |
| 600 | 3300046530 | Ga0495654_0002557 | Ga0495654_0002557_3676_4278 | 200 |
| 601 | 3300046530 | Ga0495654_0006797 | Ga0495654_0006797_2840_3442 | 200 |
| 602 | 3300046530 | Ga0495654_0008007 | Ga0495654_0008007_4529_5131 | 200 |
| 603 | 3300046530 | Ga0495654_0044893 | Ga0495654_0044893_797_1399 | 200 |
| 604 | 3300046530 | Ga0495654_0061363 | Ga0495654_0061363_733_1350 | 200 |
| 605 | 3300046536 | Ga0495587_0021564 | Ga0495587_0021564_114_716 | 200 |
| 606 | 3300046538 | Ga0495609_0007194 | Ga0495609_0007194_1623_2225 | 200 |
| 607 | 3300046538 | Ga0495609_0169133 | Ga0495609_0169133_291_893 | 200 |
| 608 | 3300046542 | Ga0495597_0028178 | Ga0495597_0028178_1238_1840 | 200 |
| 609 | 3300046542 | Ga0495597_0130342 | Ga0495597_0130342_16_618 | 200 |
| 610 | 3300046557 | Ga0495622_0001748 | Ga0495622_0001748_2684_3286 | 200 |
| 611 | 3300046557 | Ga0495622_0002064 | Ga0495622_0002064_4869_5471 | 200 |
| 612 | 3300046557 | Ga0495622_0024138 | Ga0495622_0024138_477_1079 | 200 |
| 613 | 3300046558 | Ga0495633_0017145 | Ga0495633_0017145_194_796 | 200 |
| 614 | 3300046615 | Ga0495656_0000711 | Ga0495656_0000711_8661_9263 | 200 |
| 615 | 3300046615 | Ga0495656_0047448 | Ga0495656_0047448_478_1080 | 200 |
| 616 | 3300046642 | Ga0495634_0001752 | Ga0495634_0001752_10237_10839 | 200 |
| 617 | 3300046648 | Ga0495611_0012475 | Ga0495611_0012475_435_1037 | 200 |
| 618 | 3300046660 | Ga0495625_0004335 | Ga0495625_0004335_6549_7151 | 200 |
| 619 | 3300046663 | Ga0495635_0003099 | Ga0495635_0003099_10248_10850 | 200 |
| 620 | 3300046664 | Ga0495659_0000475 | Ga0495659_0000475_7682_8284 | 200 |
| 621 | 3300046664 | Ga0495659_0036981 | Ga0495659_0036981_71_673 | 200 |
| 622 | 3300046664 | Ga0495659_0081086 | Ga0495659_0081086_550_1152 | 200 |
| 623 | 3300046665 | Ga0495661_0001671 | Ga0495661_0001671_1364_1966 | 200 |
| 624 | 3300046665 | Ga0495661_0006087 | Ga0495661_0006087_1074_1676 | 200 |
| 625 | 3300046665 | Ga0495661_0030769 | Ga0495661_0030769_526_1128 | 200 |
| 626 | 3300046665 | Ga0495661_0219835 | Ga0495661_0219835_372_974 | 200 |
| 627 | 3300046665 | Ga0495661_0255204 | Ga0495661_0255204_76_678 | 200 |
| 628 | 3300046674 | Ga0495588_0007357 | Ga0495588_0007357_3981_4583 | 200 |
| 629 | 3300046674 | Ga0495588_0014823 | Ga0495588_0014823_1338_1940 | 200 |
| 630 | 3300046674 | Ga0495588_0019900 | Ga0495588_0019900_2340_2942 | 200 |
| 631 | 3300046674 | Ga0495588_0181880 | Ga0495588_0181880_340_942 | 200 |
| 632 | 3300046675 | Ga0495657_0021569 | Ga0495657_0021569_157_855 | 200 |
| 633 | 3300046678 | Ga0495599_0004928 | Ga0495599_0004928_7126_7824 | 200 |
| 634 | 3300046679 | Ga0495623_0039302 | Ga0495623_0039302_1865_2467 | 200 |
| 635 | 3300046680 | Ga0495646_0019001 | Ga0495646_0019001_114_716 | 200 |
| 636 | 3300046684 | Ga0495669_0004695 | Ga0495669_0004695_4478_5080 | 200 |
| 637 | 3300046689 | Ga0495613_0047415 | Ga0495613_0047415_1976_2578 | 200 |
| 638 | 3300046690 | Ga0495624_0006025 | Ga0495624_0006025_2761_3459 | 200 |
| 639 | 3300046691 | Ga0495670_0003382 | Ga0495670_0003382_4416_5018 | 200 |
| 640 | 3300046691 | Ga0495670_0008205 | Ga0495670_0008205_3734_4336 | 200 |
| 641 | 3300046691 | Ga0495670_0252554 | Ga0495670_0252554_48_650 | 200 |
| 642 | 3300046691 | Ga0495670_0320234 | Ga0495670_0320234_31_633 | 200 |
| 643 | 3300046692 | Ga0495671_0001718 | Ga0495671_0001718_5448_6050 | 200 |
| 644 | 3300046692 | Ga0495671_0004099 | Ga0495671_0004099_1366_1968 | 200 |
| 645 | 3300046694 | Ga0495649_0004079 | Ga0495649_0004079_2847_3449 | 200 |
| 646 | 3300046694 | Ga0495649_0014473 | Ga0495649_0014473_3313_3915 | 200 |
| 647 | 3300046694 | Ga0495649_0019636 | Ga0495649_0019636_1061_1663 | 200 |
| 648 | 3300046694 | Ga0495649_0095766 | Ga0495649_0095766_249_851 | 200 |
| 649 | 3300046694 | Ga0495649_0154753 | Ga0495649_0154753_544_1146 | 200 |
| 650 | 3300046794 | Ga0495589_0000002 | Ga0495589_0000002_145993_146610 | 200 |
| 651 | 3300046794 | Ga0495589_0000316 | Ga0495589_0000316_34949_35551 | 200 |
| 652 | 3300046794 | Ga0495589_0010734 | Ga0495589_0010734_2451_3053 | 200 |
| 653 | 3300046794 | Ga0495589_0017529 | Ga0495589_0017529_2788_3390 | 200 |
| 654 | 3300046794 | Ga0495589_0022296 | Ga0495589_0022296_97_699 | 200 |
| 655 | 3300046794 | Ga0495589_0037035 | Ga0495589_0037035_103_705 | 200 |
| 656 | 3300046794 | Ga0495589_0076528 | Ga0495589_0076528_646_1248 | 200 |
| 657 | 3300046809 | Ga0495600_0001683 | Ga0495600_0001683_5273_5971 | 200 |
| 658 | 3300046810 | Ga0495660_0000014 | Ga0495660_0000014_276780_277442 | 200 |
| 659 | 3300046810 | Ga0495660_0044853 | Ga0495660_0044853_546_1148 | 200 |
| 660 | 3300046810 | Ga0495660_0080886 | Ga0495660_0080886_540_1142 | 200 |
| 661 | 3300047315 | Ga0495581_0018253 | Ga0495581_0018253_341_943 | 200 |
| 662 | 3300047317 | Ga0495604_0009622 | Ga0495604_0009622_2629_3327 | 200 |
| 663 | 3300047317 | Ga0495604_0129159 | Ga0495604_0129159_647_1249 | 200 |
| 664 | 3300047318 | Ga0495636_0001719 | Ga0495636_0001719_6044_6646 | 200 |
| 665 | 3300047318 | Ga0495636_0380132 | Ga0495636_0380132_15_620 | 200 |
| 666 | 3300047319 | Ga0495674_0048328 | Ga0495674_0048328_2451_3053 | 200 |
| 667 | 3300047320 | Ga0495672_0000466 | Ga0495672_0000466_23270_23872 | 200 |
| 668 | 3300047320 | Ga0495672_0002855 | Ga0495672_0002855_8260_8862 | 200 |
| 669 | 3300047320 | Ga0495672_0012988 | Ga0495672_0012988_738_1340 | 200 |
| 670 | 3300047320 | Ga0495672_0014231 | Ga0495672_0014231_205_807 | 200 |
| 671 | 3300047320 | Ga0495672_0067189 | Ga0495672_0067189_1007_1609 | 200 |
| 672 | 3300047320 | Ga0495672_0088478 | Ga0495672_0088478_1007_1609 | 200 |
| 673 | 3300047320 | Ga0495672_0122834 | Ga0495672_0122834_615_1217 | 200 |
| 674 | 3300047322 | Ga0495680_0065001 | Ga0495680_0065001_1453_2055 | 200 |
| 675 | 3300047323 | Ga0495683_0001064 | Ga0495683_0001064_7685_8287 | 200 |
| 676 | 3300047323 | Ga0495683_0012748 | Ga0495683_0012748_73_675 | 200 |
| 677 | 3300047323 | Ga0495683_0020550 | Ga0495683_0020550_2264_2866 | 200 |
| 678 | 3300047323 | Ga0495683_0038618 | Ga0495683_0038618_1321_1923 | 200 |
| 679 | 3300047323 | Ga0495683_0077943 | Ga0495683_0077943_707_1309 | 200 |
| 680 | 3300047443 | Ga0495687_001366 | Ga0495687_001366_14032_14634 | 200 |
| 681 | 3300047443 | Ga0495687_002446 | Ga0495687_002446_7420_8022 | 200 |
| 682 | 3300047443 | Ga0495687_005004 | Ga0495687_005004_2498_3100 | 200 |
| 683 | 3300047445 | Ga0495677_0002912 | Ga0495677_0002912_5673_6275 | 200 |
| 684 | 3300047446 | Ga0495679_018277 | Ga0495679_018277_1836_2438 | 200 |
| 685 | 3300047446 | Ga0495679_128422 | Ga0495679_128422_73_678 | 200 |
| 686 | 3300047447 | Ga0495685_018729 | Ga0495685_018729_1360_1962 | 200 |
| 687 | 3300047469 | Ga0495673_0001574 | Ga0495673_0001574_8634_9236 | 200 |
| 688 | 3300047469 | Ga0495673_0005451 | Ga0495673_0005451_3141_3743 | 200 |
| 689 | 3300047469 | Ga0495673_0005619 | Ga0495673_0005619_833_1435 | 200 |
| 690 | 3300047469 | Ga0495673_0007416 | Ga0495673_0007416_4007_4609 | 200 |
| 691 | 3300047469 | Ga0495673_0020954 | Ga0495673_0020954_530_1132 | 200 |
| 692 | 3300047469 | Ga0495673_0031003 | Ga0495673_0031003_735_1337 | 200 |
| 693 | 3300047470 | Ga0495681_0001661 | Ga0495681_0001661_8585_9187 | 200 |
| 694 | 3300047470 | Ga0495681_0042081 | Ga0495681_0042081_1002_1604 | 200 |
| 695 | 3300047673 | Ga0495593_0047716 | Ga0495593_0047716_1336_1938 | 200 |
| 696 | 3300048088 | Ga0495602_0192465 | Ga0495602_0192465_708_1406 | 200 |
| 697 | 3300048088 | Ga0495602_0308645 | Ga0495602_0308645_107_709 | 200 |
| 698 | 3300048091 | Ga0495626_0002000 | Ga0495626_0002000_6595_7197 | 200 |
| 699 | 3300048091 | Ga0495626_0002125 | Ga0495626_0002125_7388_7990 | 200 |
| 700 | 3300048091 | Ga0495626_0002657 | Ga0495626_0002657_7064_7666 | 200 |
| 701 | 3300048091 | Ga0495626_0019589 | Ga0495626_0019589_419_1021 | 200 |
| 702 | 3300048091 | Ga0495626_0041491 | Ga0495626_0041491_977_1579 | 200 |
| 703 | 3300048905 | Ga0496102_0000428 | Ga0496102_0000428_8133_8735 | 200 |
| 704 | 3300048905 | Ga0496102_0005158 | Ga0496102_0005158_8935_9540 | 200 |
| 705 | 3300048905 | Ga0496102_0007116 | Ga0496102_0007116_4802_5410 | 200 |
| 706 | 3300048906 | Ga0496103_0003929 | Ga0496103_0003929_4575_5177 | 200 |
| 707 | 3300048906 | Ga0496103_0016491 | Ga0496103_0016491_3356_3970 | 200 |
| 708 | 3300048906 | Ga0496103_0033664 | Ga0496103_0033664_606_1211 | 200 |
| 709 | 3300048906 | Ga0496103_0088032 | Ga0496103_0088032_1059_1676 | 200 |
| 710 | 3300048907 | Ga0496104_0011766 | Ga0496104_0011766_5274_5936 | 200 |
| 711 | 3300048907 | Ga0496104_0086195 | Ga0496104_0086195_1031_1636 | 200 |
| 712 | 3300048907 | Ga0496104_0729289 | Ga0496104_0729289_138_740 | 200 |
| 713 | 3300048908 | Ga0496105_0050594 | Ga0496105_0050594_2196_2801 | 200 |
| 714 | 3300048908 | Ga0496105_0300328 | Ga0496105_0300328_338_940 | 200 |
| 715 | 3300048909 | Ga0496106_0083839 | Ga0496106_0083839_1393_1995 | 200 |
| 716 | 3300048909 | Ga0496106_0233265 | Ga0496106_0233265_280_885 | 200 |
| 717 | 3300048913 | Ga0496110_0241174 | Ga0496110_0241174_637_1239 | 200 |
| 718 | 3300048915 | Ga0496112_0330103 | Ga0496112_0330103_221_829 | 200 |
| 719 | 3300048917 | Ga0496114_0265119 | Ga0496114_0265119_851_1453 | 200 |
| 720 | 3300048917 | Ga0496114_0519237 | Ga0496114_0519237_266_880 | 200 |
| 721 | 3300048918 | Ga0496115_0000002 | Ga0496115_0000002_353149_353763 | 200 |
| 722 | 3300048918 | Ga0496115_0060537 | Ga0496115_0060537_931_1533 | 200 |
| 723 | 3300048919 | Ga0496116_0000023 | Ga0496116_0000023_448387_449004 | 200 |
| 724 | 3300048919 | Ga0496116_0000288 | Ga0496116_0000288_59887_60549 | 200 |
| 725 | 3300048919 | Ga0496116_0001134 | Ga0496116_0001134_10708_11313 | 200 |
| 726 | 3300048919 | Ga0496116_0001773 | Ga0496116_0001773_6597_7199 | 200 |
| 727 | 3300048919 | Ga0496116_0011727 | Ga0496116_0011727_2097_2702 | 200 |
| 728 | 3300048919 | Ga0496116_0013358 | Ga0496116_0013358_4513_5127 | 200 |
| 729 | 3300048919 | Ga0496116_0016138 | Ga0496116_0016138_2997_3599 | 200 |
| 730 | 3300048919 | Ga0496116_0032950 | Ga0496116_0032950_706_1311 | 200 |
| 731 | 3300048919 | Ga0496116_0110437 | Ga0496116_0110437_453_1058 | 200 |
| 732 | 3300048920 | Ga0496117_0000017 | Ga0496117_0000017_415475_416080 | 200 |
| 733 | 3300048920 | Ga0496117_0000100 | Ga0496117_0000100_10037_10639 | 200 |
| 734 | 3300048920 | Ga0496117_0000881 | Ga0496117_0000881_43650_44255 | 200 |
| 735 | 3300048920 | Ga0496117_0001508 | Ga0496117_0001508_10321_10938 | 200 |
| 736 | 3300048920 | Ga0496117_0004279 | Ga0496117_0004279_912_1517 | 200 |
| 737 | 3300048920 | Ga0496117_0004461 | Ga0496117_0004461_7026_7631 | 200 |
| 738 | 3300048920 | Ga0496117_0011254 | Ga0496117_0011254_2280_2882 | 200 |
| 739 | 3300048920 | Ga0496117_0015201 | Ga0496117_0015201_4256_4918 | 200 |
| 740 | 3300048920 | Ga0496117_0018488 | Ga0496117_0018488_1611_2216 | 200 |
| 741 | 3300048920 | Ga0496117_0094879 | Ga0496117_0094879_793_1395 | 200 |
| 742 | 3300048920 | Ga0496117_0133557 | Ga0496117_0133557_492_1094 | 200 |
| 743 | 3300048920 | Ga0496117_0156476 | Ga0496117_0156476_192_806 | 200 |
| 744 | 3300048920 | Ga0496117_0166625 | Ga0496117_0166625_415_1032 | 200 |
| 745 | 3300048921 | Ga0496118_0000018 | Ga0496118_0000018_415475_416080 | 200 |
| 746 | 3300048921 | Ga0496118_0000446 | Ga0496118_0000446_63935_64540 | 200 |
| 747 | 3300048921 | Ga0496118_0006957 | Ga0496118_0006957_3389_4003 | 200 |
| 748 | 3300048921 | Ga0496118_0010834 | Ga0496118_0010834_3846_4448 | 200 |
| 749 | 3300048921 | Ga0496118_0013425 | Ga0496118_0013425_1665_2327 | 200 |
| 750 | 3300048921 | Ga0496118_0018094 | Ga0496118_0018094_1127_1732 | 200 |
| 751 | 3300048921 | Ga0496118_0034507 | Ga0496118_0034507_1910_2515 | 200 |
| 752 | 3300048921 | Ga0496118_0040586 | Ga0496118_0040586_2583_3185 | 200 |
| 753 | 3300048921 | Ga0496118_0065795 | Ga0496118_0065795_522_1136 | 200 |
| 754 | 3300048921 | Ga0496118_0075574 | Ga0496118_0075574_408_1013 | 200 |
| 755 | 3300048921 | Ga0496118_0087713 | Ga0496118_0087713_1117_1719 | 200 |
| 756 | 3300048921 | Ga0496118_0092549 | Ga0496118_0092549_819_1436 | 200 |
| 757 | 3300048922 | Ga0496119_0001520 | Ga0496119_0001520_19075_19680 | 200 |
| 758 | 3300048922 | Ga0496119_0004367 | Ga0496119_0004367_9248_9865 | 200 |
| 759 | 3300048922 | Ga0496119_0012369 | Ga0496119_0012369_4613_5218 | 200 |
| 760 | 3300048922 | Ga0496119_0018312 | Ga0496119_0018312_2462_3067 | 200 |
| 761 | 3300048922 | Ga0496119_0032896 | Ga0496119_0032896_1632_2237 | 200 |
| 762 | 3300048922 | Ga0496119_0046911 | Ga0496119_0046911_1203_1865 | 200 |
| 763 | 3300048922 | Ga0496119_0052103 | Ga0496119_0052103_108_710 | 200 |
| 764 | 3300048922 | Ga0496119_0063357 | Ga0496119_0063357_1477_2094 | 200 |
| 765 | 3300048923 | Ga0496120_0000756 | Ga0496120_0000756_36548_37153 | 200 |
| 766 | 3300048923 | Ga0496120_0000801 | Ga0496120_0000801_15293_15898 | 200 |
| 767 | 3300048923 | Ga0496120_0001475 | Ga0496120_0001475_23145_23762 | 200 |
| 768 | 3300048923 | Ga0496120_0005017 | Ga0496120_0005017_1450_2052 | 200 |
| 769 | 3300048923 | Ga0496120_0014607 | Ga0496120_0014607_2462_3067 | 200 |
| 770 | 3300048923 | Ga0496120_0024408 | Ga0496120_0024408_1004_1609 | 200 |
| 771 | 3300048924 | Ga0496121_0000211 | Ga0496121_0000211_8931_9545 | 200 |
| 772 | 3300048924 | Ga0496121_0000492 | Ga0496121_0000492_63044_63682 | 200 |
| 773 | 3300048924 | Ga0496121_0003591 | Ga0496121_0003591_1732_2337 | 200 |
| 774 | 3300048924 | Ga0496121_0005934 | Ga0496121_0005934_737_1342 | 200 |
| 775 | 3300048924 | Ga0496121_0010805 | Ga0496121_0010805_5181_5783 | 200 |
| 776 | 3300048924 | Ga0496121_0037631 | Ga0496121_0037631_3013_3621 | 200 |
| 777 | 3300048924 | Ga0496121_0087045 | Ga0496121_0087045_849_1451 | 200 |
| 778 | 3300048924 | Ga0496121_0102898 | Ga0496121_0102898_187_792 | 200 |
| 779 | 3300048924 | Ga0496121_0136054 | Ga0496121_0136054_425_1030 | 200 |
| 780 | 3300048925 | Ga0496122_0000021 | Ga0496122_0000021_355084_355698 | 200 |
| 781 | 3300048925 | Ga0496122_0000545 | Ga0496122_0000545_16399_17004 | 200 |
| 782 | 3300048925 | Ga0496122_0000562 | Ga0496122_0000562_15424_16086 | 200 |
| 783 | 3300048925 | Ga0496122_0004076 | Ga0496122_0004076_11642_12280 | 200 |
| 784 | 3300048925 | Ga0496122_0004697 | Ga0496122_0004697_12567_13172 | 200 |
| 785 | 3300048925 | Ga0496122_0006570 | Ga0496122_0006570_1731_2336 | 200 |
| 786 | 3300048925 | Ga0496122_0006988 | Ga0496122_0006988_7331_7933 | 200 |
| 787 | 3300048925 | Ga0496122_0008314 | Ga0496122_0008314_6855_7457 | 200 |
| 788 | 3300048925 | Ga0496122_0010774 | Ga0496122_0010774_1882_2487 | 200 |
| 789 | 3300048925 | Ga0496122_0011919 | Ga0496122_0011919_7795_8400 | 200 |
| 790 | 3300048925 | Ga0496122_0035536 | Ga0496122_0035536_1822_2424 | 200 |
| 791 | 3300048925 | Ga0496122_0055189 | Ga0496122_0055189_1476_2081 | 200 |
| 792 | 3300048925 | Ga0496122_0382034 | Ga0496122_0382034_77_679 | 200 |
| 793 | 3300048926 | Ga0496123_0000174 | Ga0496123_0000174_106788_107402 | 200 |
| 794 | 3300048926 | Ga0496123_0000189 | Ga0496123_0000189_92129_92734 | 200 |
| 795 | 3300048926 | Ga0496123_0000200 | Ga0496123_0000200_101071_101676 | 200 |
| 796 | 3300048926 | Ga0496123_0000422 | Ga0496123_0000422_60279_60941 | 200 |
| 797 | 3300048926 | Ga0496123_0002636 | Ga0496123_0002636_9208_9813 | 200 |
| 798 | 3300048926 | Ga0496123_0003370 | Ga0496123_0003370_15983_16588 | 200 |
| 799 | 3300048926 | Ga0496123_0007219 | Ga0496123_0007219_6824_7426 | 200 |
| 800 | 3300048926 | Ga0496123_0012939 | Ga0496123_0012939_318_923 | 200 |
| 801 | 3300048926 | Ga0496123_0055453 | Ga0496123_0055453_797_1435 | 200 |
| 802 | 3300048926 | Ga0496123_0105772 | Ga0496123_0105772_966_1571 | 200 |
| 803 | 3300048926 | Ga0496123_0182337 | Ga0496123_0182337_191_793 | 200 |
| 804 | 3300048927 | Ga0496124_0000017 | Ga0496124_0000017_25068_25685 | 200 |
| 805 | 3300048927 | Ga0496124_0000066 | Ga0496124_0000066_2203_2865 | 200 |
| 806 | 3300048927 | Ga0496124_0001331 | Ga0496124_0001331_25306_25911 | 200 |
| 807 | 3300048927 | Ga0496124_0003122 | Ga0496124_0003122_7885_8487 | 200 |
| 808 | 3300048927 | Ga0496124_0019070 | Ga0496124_0019070_3708_4313 | 200 |
| 809 | 3300048927 | Ga0496124_0047710 | Ga0496124_0047710_2811_3413 | 200 |
| 810 | 3300048927 | Ga0496124_0057366 | Ga0496124_0057366_1239_1844 | 200 |
| 811 | 3300048927 | Ga0496124_0141951 | Ga0496124_0141951_465_1070 | 200 |
| 812 | 3300048927 | Ga0496124_0669032 | Ga0496124_0669032_15_617 | 200 |
| 813 | 3300048928 | Ga0496125_0000005 | Ga0496125_0000005_147538_148152 | 200 |
| 814 | 3300048928 | Ga0496125_0000033 | Ga0496125_0000033_327347_328009 | 200 |
| 815 | 3300048928 | Ga0496125_0000355 | Ga0496125_0000355_30429_31067 | 200 |
| 816 | 3300048928 | Ga0496125_0002571 | Ga0496125_0002571_18865_19470 | 200 |
| 817 | 3300048928 | Ga0496125_0003383 | Ga0496125_0003383_3110_3715 | 200 |
| 818 | 3300048928 | Ga0496125_0005826 | Ga0496125_0005826_7309_7911 | 200 |
| 819 | 3300048928 | Ga0496125_0011365 | Ga0496125_0011365_7714_8316 | 200 |
| 820 | 3300048928 | Ga0496125_0013660 | Ga0496125_0013660_6783_7385 | 200 |
| 821 | 3300048928 | Ga0496125_0014405 | Ga0496125_0014405_4013_4630 | 200 |
| 822 | 3300048928 | Ga0496125_0018498 | Ga0496125_0018498_3419_4033 | 200 |
| 823 | 3300048928 | Ga0496125_0028466 | Ga0496125_0028466_518_1120 | 200 |
| 824 | 3300048928 | Ga0496125_0049392 | Ga0496125_0049392_2024_2629 | 200 |
| 825 | 3300048928 | Ga0496125_0098545 | Ga0496125_0098545_143_748 | 200 |
| 826 | 3300048929 | Ga0496126_0000052 | Ga0496126_0000052_300320_300934 | 200 |
| 827 | 3300048929 | Ga0496126_0003448 | Ga0496126_0003448_2542_3204 | 200 |
| 828 | 3300048929 | Ga0496126_0004528 | Ga0496126_0004528_5879_6484 | 200 |
| 829 | 3300048929 | Ga0496126_0048458 | Ga0496126_0048458_972_1574 | 200 |
| 830 | 3300048929 | Ga0496126_0053397 | Ga0496126_0053397_45_659 | 200 |
| 831 | 3300048929 | Ga0496126_0193057 | Ga0496126_0193057_1040_1675 | 200 |
| 832 | 3300048929 | Ga0496126_0882501 | Ga0496126_0882501_60_662 | 200 |
| 833 | 3300049459 | Ga0495678_001326 | Ga0495678_001326_7574_8176 | 200 |
| 834 | 3300049459 | Ga0495678_022628 | Ga0495678_022628_1962_2564 | 200 |
| 835 | 3300049460 | Ga0495682_0044143 | Ga0495682_0044143_523_1125 | 200 |
| 836 | 3300049569 | Ga0501032_0245916 | Ga0501032_0245916_30_638 | 200 |
| 837 | 3300049574 | Ga0501038_0170851 | Ga0501038_0170851_968_1576 | 200 |
| 838 | 3300049575 | Ga0501039_0035498 | Ga0501039_0035498_1091_1699 | 200 |
| 839 | 3300049576 | Ga0501040_0003234 | Ga0501040_0003234_8925_9533 | 200 |
| 840 | 3300049577 | Ga0501041_0008304 | Ga0501041_0008304_2503_3111 | 200 |
| 841 | 3300049580 | Ga0501046_0072609 | Ga0501046_0072609_410_1018 | 200 |
| 842 | 3300049582 | Ga0501048_0073813 | Ga0501048_0073813_420_1028 | 200 |
| 843 | 3300049587 | Ga0501071_0146295 | Ga0501071_0146295_186_794 | 200 |
| 844 | 3300049588 | Ga0501072_0002188 | Ga0501072_0002188_13481_14089 | 200 |
| 845 | 3300049589 | Ga0501073_0041080 | Ga0501073_0041080_246_854 | 200 |
| 846 | 3300049590 | Ga0501074_0016923 | Ga0501074_0016923_4208_4816 | 200 |
| 847 | 3300049591 | Ga0501075_0042153 | Ga0501075_0042153_1105_1713 | 200 |
| 848 | 3300049592 | Ga0501076_0030268 | Ga0501076_0030268_1517_2125 | 200 |
| 849 | 3300049593 | Ga0501077_0000947 | Ga0501077_0000947_433_1041 | 200 |
| 850 | 3300049679 | Ga0501249_005345 | Ga0501249_005345_265_903 | 200 |
| 851 | 3300049741 | Ga0501079_0078556 | Ga0501079_0078556_440_1048 | 200 |
| 852 | 3300049742 | Ga0501080_0008005 | Ga0501080_0008005_6255_6863 | 200 |
| 853 | 3300049742 | Ga0501080_0372279 | Ga0501080_0372279_265_981 | 200 |
| 854 | 3300049743 | Ga0501081_0206530 | Ga0501081_0206530_245_853 | 200 |
| 855 | 3300049744 | Ga0501083_0031956 | Ga0501083_0031956_868_1476 | 200 |
| 856 | 3300049766 | Ga0501269_000165 | Ga0501269_000165_4190_4828 | 200 |
| 857 | 3300049824 | Ga0501045_0015814 | Ga0501045_0015814_4306_4914 | 200 |
| 858 | 3300050489 | nmdc:mga03683_105454_c1 | nmdc:mga03683_105454_c1_483_1085 | 200 |
| 859 | 3300050491 | nmdc:mga00v17_368287_c1 | nmdc:mga00v17_368287_c1_192_797 | 200 |
| 860 | 3300050516 | nmdc:mga0sz30_12993_c1 | nmdc:mga0sz30_12993_c1_789_1391 | 200 |
| 861 | 3300053077 | Ga0495601_0001480 | Ga0495601_0001480_6716_7414 | 200 |
| 862 | 3300053119 | Ga0500595_005107 | Ga0500595_005107_5033_5641 | 200 |
| 863 | 3300053125 | Ga0500618_005498 | Ga0500618_005498_3157_3759 | 200 |
| 864 | 3300053140 | Ga0500573_0230181 | Ga0500573_0230181_194_892 | 200 |
| 865 | 3300053153 | Ga0500616_0139173 | Ga0500616_0139173_458_1060 | 200 |
| 866 | 3300053154 | Ga0500619_003223 | Ga0500619_003223_1719_2417 | 200 |
| 867 | 3300053161 | Ga0500634_0000240 | Ga0500634_0000240_16004_16606 | 200 |
| 868 | 3300053723 | Ga0500567_022233 | Ga0500567_022233_1270_1926 | 200 |
| 869 | 3300054114 | Ga0501084_0008006 | Ga0501084_0008006_7710_8318 | 200 |
| 870 | 3300060353 | Ga0501082_0008685 | Ga0501082_0008685_6868_7476 | 200 |
| 871 | iso_pu_bacteria | 2602042046 | 2603641395 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3uap-assembly1.cif.gz_A | crystal structure of glutathione transferase (target efi-501774) from methylococcus capsulatus str. bath | 0.9819 | 2 | 199 |
| 1pmt-assembly1.cif.gz_A | glutathione transferase from proteus mirabilis | 0.9816 | 1 | 198 |
| 2dsa-assembly2.cif.gz_C | ternary complex of bphk, a bacterial gst | 0.9815 | 1 | 200 |
| 1f2e-assembly1.cif.gz_A | structure of sphingomonad, glutathione s-transferase complexed with glutathione | 0.9725 | 1 | 199 |
| 4gci-assembly1.cif.gz_B | crystal structure of glutahtione s-transferase homolog from yersinia pestis, target efi-501894, with bound glutathione, monoclinic form | 0.9707 | 2 | 200 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dsaC01 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9922 | 1 | 82 | 3.40.30.10 |
| 2dsaD02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9789 | 83 | 188 | 1.20.1050.10 |
| 2gdrB02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9749 | 83 | 188 | 1.20.1050.10 |
| 2dsaC02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9727 | 83 | 188 | 1.20.1050.10 |
| 2gdrF02 | Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; | 0.9726 | 83 | 188 | 1.20.1050.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2J4XVA0-F1-model_v4 | Glutathione transferase GstA | 0.9939 | 1 | 108 |
GO:0016740
|
| AF-A0A1I1I7F4-F1-model_v4 | Glutathione S-transferase | 0.9913 | 1 | 199 |
GO:0016740
|
| AF-A0A1I3YP29-F1-model_v4 | deleted | 0.9912 | 2 | 200 |
|
| AF-A0A1T4LTD2-F1-model_v4 | Glutathione S-transferase | 0.9902 | 1 | 200 |
GO:0016740
|
| AF-A0A011N0X2-F1-model_v4 | Glutathione S-transferase GstA (EC 2.5.1.18) | 0.9887 | 2 | 198 |
GO:0004364
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar