F484140

General Info

Members Datasets Scaffolds Average Seq Length
870 289 844 157

Family's Representative Sequence

Representative Sequence 3300003187|JGI25151J46595_10000121|JGI25151J46595_1000012192
Length 174
Sequence MSDFEAVDHKAPFVPLDDLDRRILAQMQEDASLTNQELAEKVHASPPTCLRRVRRLVESGVIEKQVAILDPSRLGSTLTAIVEITLDVQAAEKMTEFEALVRDEPAILQCHRVSPGPDFVLIAQVADMPAYHALVHRAFTAQANVRNVRTFFSVHRSKFETRIAAAALKSDQGT

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
3 2643221556 Massilia sp. Root1485 Isolate Unclassified
4 2643221569 Achromobacter sp. Root565 Isolate Unclassified
5 2643221594 Achromobacter sp. Root170 Isolate Unclassified
6 2643221621 Achromobacter sp. Root83 Isolate Unclassified
7 2643221638 Duganella sp. Root336D2 Isolate Unclassified
8 2643221645 Massilia sp. Root351 Isolate Unclassified
9 2643221684 Massilia sp. Root133 Isolate Unclassified
10 2738541280 Massilia sp. GV090 Isolate Unclassified
11 2738541300 Massilia sp. GV016 Isolate Unclassified
12 2738543018 Massilia sp. GV045 Isolate Unclassified
13 2738543030 Massilia sp. GV097 Isolate Unclassified
14 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
15 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
16 2855730933 Achromobacter sp. HZ28 Isolate Nodule
17 2855767633 Achromobacter sp. HZ34 Isolate Nodule
18 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
19 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
20 2858950400 Achromobacter sp. K91 Isolate Unclassified
21 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
22 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
23 2904424332 Duganella sp. 1411 Isolate Rhizosphere
24 2941479691
25 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
26 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
27 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
28 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
31 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
32 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
33 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
34 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
35 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
36 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
37 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
38 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
39 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
40 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
41 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
42 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
46 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
47 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
53 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
54 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
131 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
141 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
142 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
143 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
144 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
145 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
146 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
153 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
158 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
159 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
160 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
161 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
166 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
167 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
179 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
184 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
185 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
186 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
192 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
193 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
194 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
195 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
198 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
203 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
207 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
216 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
217 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
218 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
219 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
229 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
230 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
231 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
232 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
233 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
234 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
252 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
255 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
256 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
257 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
258 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
259 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
260 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
261 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
267 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
268 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
269 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
270 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
271 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
272 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
273 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
274 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
275 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
276 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
277 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
278 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
282 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
285 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
286 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
289 8055225921 Achromobacter panacis KCTC 42751 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.9
Metatranscriptomes 0.11
Isolates 2.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.92
Nodule 0.57
Rhizoplane 3.56
Rhizosphere 78.28
Stem 0
Stem Tuber 0
Unclassified 6.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1014859 3300002739 Bacteria 1001
2 JGI25152J39213_1000167 3300002773 Bacteria 44888
3 JGI25150J39212_1003873 3300002774 Bacteria 3434
4 JGI25159J45721_1001390 3300002987 Bacteria 10054
5 JGI25159J45721_1025954 3300002987 Bacteria 1018
6 JGI25159J45721_1025965 3300002987 Bacteria 1018
7 JGI25151J46595_10000121 3300003187 Bacteria 106308
8 JGI25153J46596_10007800 3300003215 Bacteria 5201
9 rootL2_10271811 3300003322 Bacteria 1375
10 JGI25160J50197_1043176 3300003354 Bacteria 1018
11 JGI25160J50197_1043192 3300003354 Bacteria 1018
12 JGI25161J50226_1001036 3300003374 Bacteria 9569
13 JGI25161J50226_1011032 3300003374 Bacteria 1160
14 JGI25161J50226_1016535 3300003374 Bacteria 788
15 Ga0055525_1000023 3300003759 Bacteria 359920
16 Ga0055542_1020354 3300003762 Bacteria 974
17 Ga0055529_1004675 3300003763 Bacteria 2059
18 Ga0055526_1023986 3300003771 Bacteria 2013
19 Ga0055537_1019145 3300003773 Bacteria 1072
20 Ga0055524_1000038 3300003775 Bacteria 162683
21 Ga0055524_1000608 3300003775 Bacteria 25678
22 Ga0055524_1023971 3300003775 Bacteria 1950
23 Ga0055524_1049207 3300003775 Bacteria 974
24 Ga0055536_1039444 3300003781 Bacteria 1134
25 Ga0055534_1011502 3300003784 Bacteria 1794
26 Ga0055534_1024600 3300003784 Bacteria 974
27 Ga0055528_1008217 3300003790 Bacteria 4509
28 Ga0055530_10008998 3300003791 Bacteria 3903
29 Ga0055530_10014933 3300003791 Bacteria 2561
30 Ga0055531_10006255 3300003794 Bacteria 6794
31 Ga0055531_10009487 3300003794 Bacteria 4968
32 Ga0055543_1004210 3300004625 Bacteria 3984
33 Ga0055543_1025449 3300004625 Bacteria 1056
34 Ga0065165_1000495 3300005262 Bacteria 60868
35 Ga0065165_1012767 3300005262 Bacteria 3396
36 Ga0065165_1059071 3300005262 Bacteria 1056
37 Ga0065715_10050641 3300005293 Bacteria 1648
38 Ga0070658_10405392 3300005327 Bacteria 1171
39 Ga0070658_10428996 3300005327 Bacteria 1138
40 Ga0070658_10755289 3300005327 Bacteria 844
41 Ga0070680_100069973 3300005336 Bacteria 2882
42 Ga0070682_100166225 3300005337 Bacteria 1529
43 Ga0070660_100515437 3300005339 Bacteria 995
44 Ga0070661_100051185 3300005344 Bacteria 3022
45 Ga0070659_100015332 3300005366 Bacteria 5739
46 Ga0070659_100183538 3300005366 Bacteria 1717
47 Ga0070667_100001997 3300005367 Bacteria 18078
48 Ga0070663_100505741 3300005455 Bacteria 1004
49 Ga0070663_101283141 3300005455 Bacteria 646
50 Ga0070662_100119361 3300005457 Bacteria 2019
51 Ga0070662_100614532 3300005457 Bacteria 915
52 Ga0068853_100137258 3300005539 Bacteria 2193
53 Ga0068853_101156634 3300005539 Bacteria 747
54 Ga0070665_100121741 3300005548 Bacteria 2611
55 Ga0068855_100132767 3300005563 Bacteria 2842
56 Ga0068855_100239212 3300005563 Bacteria 2029
57 Ga0070664_100507058 3300005564 Bacteria 1112
58 Ga0068852_100729038 3300005616 Bacteria 1003
59 Ga0075364_10007806 3300006051 Bacteria 6372
60 Ga0075364_10082872 3300006051 Bacteria 2122
61 Ga0075364_10161940 3300006051 Bacteria 1510
62 Ga0075362_10168836 3300006177 Bacteria 1056
63 Ga0097621_100990574 3300006237 Bacteria 786
64 Ga0068871_100677623 3300006358 Bacteria 943
65 Ga0099826_10000008 3300006948 Bacteria 380974
66 Ga0099826_10353032 3300006948 Bacteria 731
67 Ga0105244_10003553 3300009036 Bacteria 11073
68 Ga0105244_10038011 3300009036 Bacteria 2512
69 Ga0105244_10041854 3300009036 Bacteria 2373
70 Ga0105240_10001254 3300009093 Bacteria 44050
71 Ga0105240_11706671 3300009093 Bacteria 657
72 Ga0105245_10026281 3300009098 Bacteria 5122
73 Ga0105245_10429914 3300009098 Bacteria 1325
74 Ga0105245_10846549 3300009098 Bacteria 954
75 Ga0105243_10074704 3300009148 Bacteria 2750
76 Ga0105241_10024835 3300009174 Bacteria 4452
77 Ga0105242_10000856 3300009176 Bacteria 23602
78 Ga0105242_10406341 3300009176 Bacteria 1272
79 Ga0105237_10194228 3300009545 Bacteria 2029
80 Ga0105238_10271302 3300009551 Bacteria 1677
81 Ga0105239_10294628 3300010375 Bacteria 1827
82 Ga0157373_10073814 3300013100 Bacteria 2407
83 Ga0157371_10289658 3300013102 Bacteria 1184
84 Ga0157370_10448132 3300013104 Bacteria 1187
85 Ga0157370_10479810 3300013104 Bacteria 1143
86 Ga0157374_10104660 3300013296 Bacteria 2717
87 Ga0157374_10324838 3300013296 Bacteria 1525
88 Ga0157372_10349370 3300013307 Bacteria 1723
89 Ga0157372_10697570 3300013307 Bacteria 1181
90 Ga0157372_10726086 3300013307 Bacteria 1155
91 Ga0157376_11112608 3300014969 Bacteria 816
92 Ga0182006_1085358 3300015261 Bacteria 1145
93 Ga0182007_10046502 3300015262 Bacteria 1437
94 Ga0209436_100040 3300025208 Bacteria 75392
95 Ga0209436_117835 3300025208 Bacteria 1026
96 Ga0209436_117836 3300025208 Bacteria 1026
97 Ga0209672_102913 3300025228 Bacteria 3818
98 Ga0209563_100011 3300025230 Bacteria 1187808
99 Ga0209258_105110 3300025242 Bacteria 2303
100 Ga0207425_1000009 3300025245 Bacteria 593135
101 Ga0207425_1000257 3300025245 Bacteria 39389
102 Ga0207425_1009042 3300025245 Bacteria 2505
103 Ga0207425_1036925 3300025245 Bacteria 945
104 Ga0209677_105405 3300025253 Bacteria 3341
105 Ga0209148_1000580 3300025254 Bacteria 33685
106 Ga0209129_1000051 3300025258 Bacteria 267104
107 Ga0209129_1006067 3300025258 Bacteria 4041
108 Ga0209565_1001480 3300025263 Bacteria 10257
109 Ga0209565_1002538 3300025263 Bacteria 6491
110 Ga0209565_1004936 3300025263 Bacteria 3969
111 Ga0209565_1005910 3300025263 Bacteria 3503
112 Ga0209565_1029299 3300025263 Bacteria 1082
113 Ga0209565_1031673 3300025263 Bacteria 1026
114 Ga0209565_1032621 3300025263 Bacteria 1007
115 Ga0209455_1003081 3300025272 Bacteria 6087
116 Ga0209673_1021734 3300025273 Bacteria 2235
117 Ga0209130_1000217 3300025284 Bacteria 75515
118 Ga0209130_1006188 3300025284 Bacteria 3937
119 Ga0209675_1001533 3300025291 Bacteria 13200
120 Ga0209675_1020283 3300025291 Bacteria 1806
121 Ga0209675_1040020 3300025291 Bacteria 1034
122 Ga0209676_1005251 3300025292 Bacteria 6851
123 Ga0209025_1000019 3300025294 Bacteria 631548
124 Ga0209025_1026873 3300025294 Bacteria 2873
125 Ga0209564_1004433 3300025295 Bacteria 8595
126 Ga0209564_1005893 3300025295 Bacteria 6795
127 Ga0209564_1031656 3300025295 Bacteria 1611
128 Ga0209564_1050090 3300025295 Bacteria 1026
129 Ga0209758_1000054 3300025297 Bacteria 337655
130 Ga0209758_1000379 3300025297 Bacteria 77337
131 Ga0209050_1000040 3300025298 Bacteria 408492
132 Ga0209050_1001052 3300025298 Bacteria 33980
133 Ga0209050_1006080 3300025298 Bacteria 7296
134 Ga0209256_1000018 3300025299 Bacteria 568467
135 Ga0209256_1000307 3300025299 Bacteria 85852
136 Ga0209256_1003794 3300025299 Bacteria 10160
137 Ga0209256_1006054 3300025299 Bacteria 6600
138 Ga0209256_1111938 3300025299 Bacteria 547
139 Ga0207426_1012456 3300025302 Bacteria 3191
140 Ga0209051_1033870 3300025303 Bacteria 1923
141 Ga0209051_1034706 3300025303 Bacteria 1887
142 Ga0209257_1000054 3300025304 Bacteria 416957
143 Ga0209257_1002267 3300025304 Bacteria 19627
144 Ga0207655_1003797 3300025728 Bacteria 11020
145 Ga0207655_1019168 3300025728 Bacteria 3591
146 Ga0207655_1038594 3300025728 Bacteria 2085
147 Ga0207705_10017793 3300025909 Bacteria 5083
148 Ga0207705_10908233 3300025909 Bacteria 682
149 Ga0207695_10075242 3300025913 Bacteria 3436
150 Ga0207671_10055267 3300025914 Bacteria 2941
151 Ga0207660_10057463 3300025917 Bacteria 2787
152 Ga0207657_10005222 3300025919 Bacteria 13606
153 Ga0207657_10076231 3300025919 Bacteria 2829
154 Ga0207649_10029886 3300025920 Bacteria 3222
155 Ga0207649_11112317 3300025920 Unclassified 623
156 Ga0207694_10399624 3300025924 Bacteria 1142
157 Ga0207690_10018849 3300025932 Bacteria 4237
158 Ga0207706_10076717 3300025933 Bacteria 2939
159 Ga0207686_10000388 3300025934 Bacteria 30596
160 Ga0207709_10010359 3300025935 Bacteria 5134
161 Ga0207704_10067996 3300025938 Bacteria 2244
162 Ga0207689_10574443 3300025942 Bacteria 948
163 Ga0207667_10001574 3300025949 Bacteria 28701
164 Ga0207667_10105606 3300025949 Bacteria 2906
165 Ga0207640_10114022 3300025981 Bacteria 1922
166 Ga0207658_10024757 3300025986 Bacteria 4200
167 Ga0207639_10691664 3300026041 Bacteria 946
168 Ga0207678_10075104 3300026067 Bacteria 2895
169 Ga0207678_10196412 3300026067 Bacteria 1724
170 Ga0207678_10693728 3300026067 Bacteria 896
171 Ga0207648_10522445 3300026089 Bacteria 1088
172 Ga0207674_10046745 3300026116 Bacteria 4442
173 Ga0209371_1019009 3300027312 Bacteria 1728
174 Ga0209371_1044808 3300027312 Bacteria 877
175 Ga0209282_1000005 3300027666 Bacteria 380858
176 Ga0268266_10095208 3300028379 Bacteria 2615
177 Ga0268256_1011399 3300030500 Bacteria 2814
178 Ga0268256_1050650 3300030500 Bacteria 877
179 Ga0316181_1270997 3300030744 Bacteria 2331
180 Ga0307408_100000281 3300031548 Bacteria 51252
181 Ga0307408_100000347 3300031548 Bacteria 43439
182 Ga0307408_100000747 3300031548 Bacteria 26307
183 Ga0307408_100000803 3300031548 Bacteria 25130
184 Ga0307408_100081507 3300031548 Bacteria 2419
185 Ga0307408_100935997 3300031548 Bacteria 795
186 Ga0307412_10000109 3300031911 Bacteria 64548
187 Ga0307416_100004731 3300032002 Bacteria 8254
188 Ga0395899_0000492 3300037312 Bacteria 44106
189 Ga0395899_0001821 3300037312 Bacteria 17656
190 Ga0395899_0005599 3300037312 Bacteria 9742
191 Ga0395899_0019791 3300037312 Bacteria 5107
192 Ga0395899_0096207 3300037312 Bacteria 2141
193 Ga0395899_0200356 3300037312 Bacteria 1392
194 Ga0395900_0001043 3300037418 Bacteria 35555
195 Ga0395900_0001113 3300037418 Bacteria 34100
196 Ga0395900_0001615 3300037418 Bacteria 26551
197 Ga0395900_0111926 3300037418 Bacteria 2803
198 Ga0395900_0181484 3300037418 Bacteria 2138
199 Ga0395900_0211437 3300037418 Bacteria 1958
200 Ga0395900_0228915 3300037418 Bacteria 1870
201 Ga0395900_0294867 3300037418 Bacteria 1609
202 Ga0395900_0315102 3300037418 Bacteria 1546
203 Ga0395900_0653861 3300037418 Bacteria 987
204 Ga0395900_0773455 3300037418 Bacteria 889
205 Ga0395900_1370422 3300037418 Bacteria 620
206 Ga0395898_0256797 3300037466 Bacteria 1666
207 Ga0395898_0373227 3300037466 Bacteria 1360
208 Ga0395898_0702172 3300037466 Bacteria 953
209 Ga0395898_0894135 3300037466 Bacteria 826
210 Ga0395905_0048881 3300037471 Bacteria 3962
211 Ga0395905_0146807 3300037471 Bacteria 2219
212 Ga0395905_0153810 3300037471 Bacteria 2163
213 Ga0395905_0249987 3300037471 Bacteria 1656
214 Ga0395905_0342299 3300037471 Bacteria 1387
215 Ga0395905_0668160 3300037471 Bacteria 941
216 Ga0395905_1031704 3300037471 Bacteria 726
217 Ga0395901_0000574 3300038443 Bacteria 42766
218 Ga0395901_0002565 3300038443 Bacteria 18411
219 Ga0395901_0007658 3300038443 Bacteria 10896
220 Ga0395901_0008153 3300038443 Bacteria 10581
221 Ga0395901_0135267 3300038443 Bacteria 2591
222 Ga0395901_0200577 3300038443 Bacteria 2091
223 Ga0395901_0437880 3300038443 Bacteria 1338
224 Ga0395901_1542236 3300038443 Bacteria 619
225 Ga0436361_0034381 3300039447 Unclassified 655
226 Ga0436361_0234826 3300039447 Bacteria 1717
227 Ga0439465_0162881 3300041413 Bacteria 801
228 Ga0451797_0898951 3300041453 Bacteria 690
229 Ga0439433_0124244 3300041999 Bacteria 652
230 Ga0439448_0002210 3300042005 Bacteria 5260
231 Ga0439449_0145472 3300042007 Bacteria 883
232 Ga0439450_010137 3300042008 Bacteria 1809
233 Ga0439450_021049 3300042008 Bacteria 1397
234 Ga0439455_0041268 3300042012 Bacteria 1182
235 Ga0439458_0044384 3300042157 Bacteria 1085
236 Ga0450893_0090685 3300042532 Bacteria 613
237 Ga0466969_0082535 3300044656 Bacteria 1531
238 Ga0466972_0008843 3300044658 Bacteria 5053
239 Ga0466972_0010972 3300044658 Bacteria 4548
240 Ga0466965_0000300 3300044683 Bacteria 16400
241 Ga0466965_0020707 3300044683 Bacteria 3164
242 Ga0466965_0068460 3300044683 Bacteria 1782
243 Ga0466965_0118837 3300044683 Bacteria 1363
244 Ga0466965_0299943 3300044683 Bacteria 871
245 Ga0466966_0001847 3300044684 Bacteria 13727
246 Ga0466966_0028396 3300044684 Bacteria 3644
247 Ga0466966_0131325 3300044684 Bacteria 1533
248 Ga0466966_0151271 3300044684 Bacteria 1415
249 Ga0466966_0214220 3300044684 Bacteria 1163
250 Ga0466966_0263991 3300044684 Bacteria 1036
251 Ga0466966_0287985 3300044684 Bacteria 987
252 Ga0466961_0530630 3300044693 Bacteria 709
253 Ga0466961_0734775 3300044693 Bacteria 590
254 Ga0466963_1016549 3300044694 Bacteria 584
255 Ga0466964_0001905 3300044706 Bacteria 7292
256 Ga0466964_0002005 3300044706 Bacteria 7159
257 Ga0466964_0143648 3300044706 Bacteria 1099
258 Ga0466964_0763822 3300044706 Bacteria 544
259 Ga0466971_0055217 3300044719 Bacteria 1790
260 Ga0466968_0003533 3300044735 Bacteria 5784
261 Ga0466968_0068736 3300044735 Bacteria 1538
262 Ga0466968_0127106 3300044735 Bacteria 1157
263 Ga0466970_0083422 3300044765 Bacteria 1729
264 Ga0466970_0262012 3300044765 Bacteria 970
265 Ga0466970_0295324 3300044765 Bacteria 913
266 Ga0466970_0366956 3300044765 Bacteria 818
267 Ga0466957_0000018 3300044842 Bacteria 64818
268 Ga0466957_0009127 3300044842 Bacteria 5656
269 Ga0466957_0077957 3300044842 Bacteria 2059
270 Ga0466957_0232738 3300044842 Bacteria 1220
271 Ga0466957_0545654 3300044842 Bacteria 807
272 Ga0466957_0545748 3300044842 Bacteria 807
273 Ga0466960_0085094 3300044901 Bacteria 1601
274 Ga0466960_0459356 3300044901 Bacteria 741
275 Ga0466960_0898372 3300044901 Bacteria 540
276 Ga0466959_0019022 3300045049 Bacteria 5048
277 Ga0466959_0203561 3300045049 Bacteria 1377
278 Ga0466959_0679828 3300045049 Bacteria 690
279 Ga0466959_0731712 3300045049 Bacteria 662
280 Ga0466958_0133420 3300045836 Bacteria 1560
281 Ga0466958_0186176 3300045836 Bacteria 1318
282 Ga0466958_0211977 3300045836 Bacteria 1234
283 Ga0466958_0749854 3300045836 Bacteria 636
284 Ga0466967_0007401 3300045976 Bacteria 7916
285 Ga0466967_0009956 3300045976 Bacteria 7095
286 Ga0466967_0125566 3300045976 Bacteria 2376
287 Ga0466967_0685495 3300045976 Bacteria 1014
288 Ga0495617_001267 3300046452 Bacteria 11292
289 Ga0495617_170867 3300046452 Bacteria 687
290 Ga0495627_005503 3300046453 Bacteria 5092
291 Ga0495603_0122714 3300046455 Bacteria 1513
292 Ga0495603_0150794 3300046455 Bacteria 1350
293 Ga0495590_0013283 3300046457 Bacteria 3032
294 Ga0495590_0016068 3300046457 Bacteria 2706
295 Ga0495590_0032822 3300046457 Bacteria 1816
296 Ga0495591_011667 3300046458 Bacteria 3311
297 Ga0495629_0074581 3300046459 Bacteria 2368
298 Ga0495638_0002770 3300046460 Bacteria 14090
299 Ga0495638_0021376 3300046460 Bacteria 4266
300 Ga0495638_0021841 3300046460 Bacteria 4207
301 Ga0495638_0070609 3300046460 Bacteria 2138
302 Ga0495638_0463791 3300046460 Bacteria 644
303 Ga0495653_0047143 3300046463 Bacteria 3334
304 Ga0495653_0114226 3300046463 Bacteria 1935
305 Ga0495650_0020521 3300046471 Bacteria 3219
306 Ga0495650_0143760 3300046471 Bacteria 861
307 Ga0495582_0130159 3300046473 Bacteria 1421
308 Ga0495605_0000399 3300046474 Bacteria 39905
309 Ga0495605_0000400 3300046474 Bacteria 39776
310 Ga0495605_0008907 3300046474 Bacteria 5657
311 Ga0495605_0017334 3300046474 Bacteria 3881
312 Ga0495605_0018421 3300046474 Bacteria 3742
313 Ga0495605_0020374 3300046474 Bacteria 3525
314 Ga0495605_0098596 3300046474 Bacteria 1346
315 Ga0495605_0106367 3300046474 Bacteria 1284
316 Ga0495605_0118256 3300046474 Bacteria 1203
317 Ga0495605_0151273 3300046474 Bacteria 1035
318 Ga0495584_0000004 3300046491 Bacteria 314714
319 Ga0495584_0000177 3300046491 Bacteria 45004
320 Ga0495584_0001006 3300046491 Bacteria 17636
321 Ga0495584_0003403 3300046491 Bacteria 8775
322 Ga0495584_0005287 3300046491 Bacteria 6838
323 Ga0495584_0012304 3300046491 Bacteria 4370
324 Ga0495584_0020894 3300046491 Bacteria 3323
325 Ga0495584_0025324 3300046491 Bacteria 3008
326 Ga0495584_0033832 3300046491 Bacteria 2586
327 Ga0495584_0068895 3300046491 Bacteria 1777
328 Ga0495584_0173052 3300046491 Bacteria 1097
329 Ga0495584_0459406 3300046491 Bacteria 648
330 Ga0495585_0000050 3300046492 Bacteria 119283
331 Ga0495585_0000624 3300046492 Bacteria 32878
332 Ga0495585_0004780 3300046492 Bacteria 8714
333 Ga0495585_0006144 3300046492 Bacteria 7493
334 Ga0495585_0014189 3300046492 Bacteria 4648
335 Ga0495585_0018506 3300046492 Bacteria 4017
336 Ga0495585_0020150 3300046492 Bacteria 3837
337 Ga0495585_0038005 3300046492 Bacteria 2710
338 Ga0495585_0043901 3300046492 Bacteria 2498
339 Ga0495585_0060112 3300046492 Bacteria 2092
340 Ga0495585_0072443 3300046492 Bacteria 1877
341 Ga0495585_0146814 3300046492 Bacteria 1232
342 Ga0495585_0370525 3300046492 Bacteria 693
343 Ga0495585_0392083 3300046492 Bacteria 669
344 Ga0495594_0026192 3300046499 Bacteria 3136
345 Ga0495594_0318787 3300046499 Bacteria 885
346 Ga0495596_0000606 3300046500 Bacteria 22493
347 Ga0495596_0001967 3300046500 Bacteria 11339
348 Ga0495596_0003014 3300046500 Bacteria 8726
349 Ga0495596_0018074 3300046500 Bacteria 2909
350 Ga0495596_0022029 3300046500 Bacteria 2596
351 Ga0495596_0026272 3300046500 Bacteria 2347
352 Ga0495596_0052844 3300046500 Bacteria 1590
353 Ga0495596_0067195 3300046500 Bacteria 1393
354 Ga0495596_0079696 3300046500 Bacteria 1271
355 Ga0495596_0152515 3300046500 Bacteria 897
356 Ga0495596_0277094 3300046500 Bacteria 651
357 Ga0495607_0000638 3300046501 Bacteria 34024
358 Ga0495607_0003256 3300046501 Bacteria 12490
359 Ga0495607_0008425 3300046501 Bacteria 7047
360 Ga0495607_0016300 3300046501 Bacteria 4797
361 Ga0495607_0024611 3300046501 Bacteria 3750
362 Ga0495607_0047826 3300046501 Bacteria 2503
363 Ga0495607_0055945 3300046501 Bacteria 2266
364 Ga0495607_0056187 3300046501 Bacteria 2260
365 Ga0495607_0144237 3300046501 Bacteria 1225
366 Ga0495583_0000862 3300046506 Bacteria 36867
367 Ga0495583_0000926 3300046506 Bacteria 34454
368 Ga0495583_0001605 3300046506 Bacteria 22200
369 Ga0495583_0001771 3300046506 Bacteria 20584
370 Ga0495583_0002720 3300046506 Bacteria 14640
371 Ga0495583_0010647 3300046506 Bacteria 5346
372 Ga0495583_0025456 3300046506 Bacteria 2955
373 Ga0495583_0034508 3300046506 Bacteria 2422
374 Ga0495583_0048406 3300046506 Bacteria 1951
375 Ga0495583_0050073 3300046506 Bacteria 1910
376 Ga0495583_0143188 3300046506 Bacteria 994
377 Ga0495606_0000101 3300046507 Bacteria 146752
378 Ga0495606_0000201 3300046507 Bacteria 103926
379 Ga0495606_0018476 3300046507 Bacteria 5224
380 Ga0495606_0019789 3300046507 Bacteria 4988
381 Ga0495606_0045476 3300046507 Bacteria 2909
382 Ga0495606_0080067 3300046507 Bacteria 2033
383 Ga0495606_0153848 3300046507 Bacteria 1347
384 Ga0495606_0259313 3300046507 Bacteria 960
385 Ga0495610_0000293 3300046512 Bacteria 52547
386 Ga0495610_0000381 3300046512 Bacteria 45780
387 Ga0495610_0001648 3300046512 Bacteria 19631
388 Ga0495610_0116281 3300046512 Bacteria 1178
389 Ga0495616_0000092 3300046513 Bacteria 76353
390 Ga0495616_0000313 3300046513 Bacteria 38775
391 Ga0495616_0000349 3300046513 Bacteria 36367
392 Ga0495616_0003361 3300046513 Bacteria 10266
393 Ga0495616_0008094 3300046513 Bacteria 6259
394 Ga0495616_0017601 3300046513 Bacteria 3939
395 Ga0495616_0020341 3300046513 Bacteria 3613
396 Ga0495616_0023487 3300046513 Bacteria 3316
397 Ga0495616_0027599 3300046513 Bacteria 3011
398 Ga0495616_0037584 3300046513 Bacteria 2490
399 Ga0495616_0071349 3300046513 Bacteria 1679
400 Ga0495616_0086101 3300046513 Bacteria 1495
401 Ga0495616_0125879 3300046513 Bacteria 1178
402 Ga0495616_0233464 3300046513 Bacteria 796
403 Ga0495616_0248290 3300046513 Bacteria 765
404 Ga0495620_0037229 3300046515 Bacteria 2169
405 Ga0495620_0057513 3300046515 Bacteria 1631
406 Ga0495631_0000261 3300046518 Bacteria 36733
407 Ga0495631_0008223 3300046518 Bacteria 5260
408 Ga0495631_0009478 3300046518 Bacteria 4863
409 Ga0495631_0020737 3300046518 Bacteria 3067
410 Ga0495631_0034179 3300046518 Bacteria 2280
411 Ga0495631_0035539 3300046518 Bacteria 2228
412 Ga0495631_0040683 3300046518 Bacteria 2058
413 Ga0495631_0044016 3300046518 Bacteria 1968
414 Ga0495631_0046183 3300046518 Bacteria 1915
415 Ga0495631_0054985 3300046518 Bacteria 1734
416 Ga0495632_0000447 3300046519 Bacteria 39298
417 Ga0495632_0000523 3300046519 Bacteria 36220
418 Ga0495632_0000632 3300046519 Bacteria 32427
419 Ga0495632_0020996 3300046519 Bacteria 3526
420 Ga0495632_0057086 3300046519 Bacteria 1906
421 Ga0495632_0058304 3300046519 Bacteria 1882
422 Ga0495632_0319397 3300046519 Bacteria 686
423 Ga0495632_0320837 3300046519 Bacteria 684
424 Ga0495637_0041303 3300046520 Bacteria 1979
425 Ga0495637_0101438 3300046520 Bacteria 1124
426 Ga0495637_0127036 3300046520 Bacteria 976
427 Ga0495643_0000235 3300046522 Bacteria 83550
428 Ga0495643_0000827 3300046522 Bacteria 33751
429 Ga0495643_0000871 3300046522 Bacteria 32222
430 Ga0495643_0020883 3300046522 Bacteria 3767
431 Ga0495643_0078284 3300046522 Bacteria 1726
432 Ga0495643_0108145 3300046522 Bacteria 1416
433 Ga0495643_0121216 3300046522 Bacteria 1321
434 Ga0495643_0194102 3300046522 Bacteria 979
435 Ga0495643_0258188 3300046522 Bacteria 810
436 Ga0495643_0275168 3300046522 Bacteria 776
437 Ga0495643_0292408 3300046522 Bacteria 745
438 Ga0495643_0388175 3300046522 Bacteria 618
439 Ga0495644_0000986 3300046523 Bacteria 11826
440 Ga0495644_0012447 3300046523 Bacteria 3270
441 Ga0495644_0024528 3300046523 Bacteria 2294
442 Ga0495644_0027101 3300046523 Bacteria 2172
443 Ga0495644_0091661 3300046523 Bacteria 1147
444 Ga0495644_0095930 3300046523 Bacteria 1120
445 Ga0495644_0104572 3300046523 Bacteria 1072
446 Ga0495644_0121304 3300046523 Bacteria 994
447 Ga0495644_0132431 3300046523 Bacteria 950
448 Ga0495644_0324144 3300046523 Bacteria 605
449 Ga0495648_0000451 3300046524 Bacteria 44465
450 Ga0495648_0000716 3300046524 Bacteria 35380
451 Ga0495648_0009701 3300046524 Bacteria 7419
452 Ga0495648_0015684 3300046524 Bacteria 5488
453 Ga0495648_0019629 3300046524 Bacteria 4743
454 Ga0495648_0019659 3300046524 Bacteria 4737
455 Ga0495648_0040229 3300046524 Bacteria 2966
456 Ga0495648_0074505 3300046524 Bacteria 1955
457 Ga0495648_0142603 3300046524 Bacteria 1259
458 Ga0495648_0309641 3300046524 Bacteria 736
459 Ga0495663_0010651 3300046525 Bacteria 2558
460 Ga0495663_0028856 3300046525 Bacteria 1635
461 Ga0495666_0006421 3300046526 Bacteria 5919
462 Ga0495642_0000197 3300046528 Bacteria 35507
463 Ga0495642_0007624 3300046528 Bacteria 4149
464 Ga0495642_0012535 3300046528 Bacteria 3267
465 Ga0495642_0017075 3300046528 Bacteria 2833
466 Ga0495642_0017615 3300046528 Bacteria 2791
467 Ga0495642_0019749 3300046528 Bacteria 2641
468 Ga0495642_0025094 3300046528 Bacteria 2361
469 Ga0495642_0040971 3300046528 Bacteria 1883
470 Ga0495642_0089378 3300046528 Bacteria 1303
471 Ga0495642_0129083 3300046528 Bacteria 1087
472 Ga0495642_0192695 3300046528 Bacteria 888
473 Ga0495654_0002707 3300046530 Bacteria 11206
474 Ga0495654_0017559 3300046530 Bacteria 3758
475 Ga0495654_0018742 3300046530 Bacteria 3623
476 Ga0495654_0065573 3300046530 Bacteria 1733
477 Ga0495654_0134268 3300046530 Bacteria 1108
478 Ga0495654_0225601 3300046530 Bacteria 790
479 Ga0495640_0052185 3300046533 Bacteria 2809
480 Ga0495640_0239659 3300046533 Bacteria 1139
481 Ga0495586_0017239 3300046535 Bacteria 3838
482 Ga0495609_0000117 3300046538 Bacteria 92147
483 Ga0495609_0000127 3300046538 Bacteria 82467
484 Ga0495609_0002244 3300046538 Bacteria 12070
485 Ga0495609_0006373 3300046538 Bacteria 6022
486 Ga0495609_0006764 3300046538 Bacteria 5804
487 Ga0495609_0041431 3300046538 Bacteria 2070
488 Ga0495609_0049554 3300046538 Bacteria 1874
489 Ga0495609_0067780 3300046538 Bacteria 1571
490 Ga0495609_0120868 3300046538 Bacteria 1126
491 Ga0495609_0122424 3300046538 Bacteria 1117
492 Ga0495609_0132448 3300046538 Bacteria 1067
493 Ga0495597_0000247 3300046542 Bacteria 49379
494 Ga0495597_0032022 3300046542 Bacteria 2388
495 Ga0495597_0041944 3300046542 Bacteria 2042
496 Ga0495597_0053433 3300046542 Bacteria 1776
497 Ga0495597_0054148 3300046542 Bacteria 1763
498 Ga0495597_0061364 3300046542 Bacteria 1637
499 Ga0495597_0096799 3300046542 Bacteria 1247
500 Ga0495597_0123705 3300046542 Bacteria 1077
501 Ga0495597_0125439 3300046542 Bacteria 1067
502 Ga0495597_0135742 3300046542 Bacteria 1017
503 Ga0495597_0219060 3300046542 Bacteria 756
504 Ga0495645_0303555 3300046543 Bacteria 1042
505 Ga0495622_0037077 3300046557 Bacteria 2271
506 Ga0495622_0050355 3300046557 Bacteria 1932
507 Ga0495633_0000489 3300046558 Bacteria 39984
508 Ga0495633_0011259 3300046558 Bacteria 4832
509 Ga0495633_0016567 3300046558 Bacteria 3796
510 Ga0495633_0023451 3300046558 Bacteria 3058
511 Ga0495633_0024724 3300046558 Bacteria 2964
512 Ga0495633_0056896 3300046558 Bacteria 1837
513 Ga0495633_0068647 3300046558 Bacteria 1654
514 Ga0495633_0103316 3300046558 Bacteria 1322
515 Ga0495633_0111865 3300046558 Bacteria 1266
516 Ga0495633_0119923 3300046558 Bacteria 1218
517 Ga0495633_0129086 3300046558 Bacteria 1170
518 Ga0495633_0302573 3300046558 Bacteria 726
519 Ga0495633_0385164 3300046558 Bacteria 634
520 Ga0495633_0403986 3300046558 Bacteria 618
521 Ga0495656_0014757 3300046615 Bacteria 2936
522 Ga0495656_0052263 3300046615 Bacteria 1751
523 Ga0495656_0059896 3300046615 Bacteria 1658
524 Ga0495656_0295007 3300046615 Bacteria 830
525 Ga0495668_0000066 3300046616 Bacteria 178533
526 Ga0495668_0000398 3300046616 Bacteria 57103
527 Ga0495668_0000496 3300046616 Bacteria 49112
528 Ga0495668_0000712 3300046616 Bacteria 40090
529 Ga0495668_0001137 3300046616 Bacteria 27257
530 Ga0495668_0001559 3300046616 Bacteria 21734
531 Ga0495668_0007882 3300046616 Bacteria 6731
532 Ga0495668_0018125 3300046616 Bacteria 4072
533 Ga0495668_0037166 3300046616 Bacteria 2725
534 Ga0495668_0041724 3300046616 Bacteria 2555
535 Ga0495668_0053645 3300046616 Bacteria 2228
536 Ga0495668_0079045 3300046616 Bacteria 1805
537 Ga0495668_0081023 3300046616 Bacteria 1781
538 Ga0495668_0083277 3300046616 Bacteria 1754
539 Ga0495668_0243583 3300046616 Bacteria 984
540 Ga0495668_0266701 3300046616 Bacteria 937
541 Ga0495668_0482556 3300046616 Bacteria 683
542 Ga0495634_0704683 3300046642 Bacteria 580
543 Ga0495611_0001606 3300046648 Bacteria 11014
544 Ga0495611_0031448 3300046648 Bacteria 2336
545 Ga0495611_0049201 3300046648 Bacteria 1896
546 Ga0495611_0083225 3300046648 Bacteria 1473
547 Ga0495611_0134078 3300046648 Bacteria 1156
548 Ga0495611_0214885 3300046648 Bacteria 895
549 Ga0495625_0000824 3300046660 Bacteria 42730
550 Ga0495625_0004198 3300046660 Bacteria 13728
551 Ga0495625_0134800 3300046660 Bacteria 1670
552 Ga0495625_0160737 3300046660 Bacteria 1505
553 Ga0495625_0189730 3300046660 Bacteria 1362
554 Ga0495625_0535161 3300046660 Bacteria 711
555 Ga0495635_0016821 3300046663 Bacteria 5108
556 Ga0495635_0210206 3300046663 Bacteria 1318
557 Ga0495659_0000093 3300046664 Bacteria 39219
558 Ga0495659_0000963 3300046664 Bacteria 10138
559 Ga0495659_0032037 3300046664 Bacteria 1837
560 Ga0495661_0000454 3300046665 Bacteria 43387
561 Ga0495661_0000650 3300046665 Bacteria 35187
562 Ga0495661_0001854 3300046665 Bacteria 16896
563 Ga0495661_0004436 3300046665 Bacteria 10127
564 Ga0495661_0006398 3300046665 Bacteria 8283
565 Ga0495661_0011498 3300046665 Bacteria 6005
566 Ga0495661_0017051 3300046665 Bacteria 4798
567 Ga0495661_0034911 3300046665 Bacteria 3160
568 Ga0495661_0038123 3300046665 Bacteria 2996
569 Ga0495661_0045335 3300046665 Bacteria 2690
570 Ga0495661_0049360 3300046665 Bacteria 2552
571 Ga0495661_0058061 3300046665 Bacteria 2307
572 Ga0495661_0059025 3300046665 Bacteria 2285
573 Ga0495661_0079140 3300046665 Bacteria 1899
574 Ga0495661_0148743 3300046665 Bacteria 1267
575 Ga0495661_0186521 3300046665 Bacteria 1095
576 Ga0495661_0195876 3300046665 Bacteria 1061
577 Ga0495661_0218479 3300046665 Bacteria 989
578 Ga0495661_0288577 3300046665 Bacteria 825
579 Ga0495661_0395692 3300046665 Bacteria 672
580 Ga0495661_0520359 3300046665 Bacteria 565
581 Ga0495588_0000094 3300046674 Bacteria 176169
582 Ga0495588_0016064 3300046674 Bacteria 3612
583 Ga0495588_0053901 3300046674 Bacteria 2074
584 Ga0495588_0071924 3300046674 Bacteria 1799
585 Ga0495588_0076595 3300046674 Bacteria 1743
586 Ga0495588_0106729 3300046674 Bacteria 1474
587 Ga0495588_0163180 3300046674 Bacteria 1178
588 Ga0495588_0230400 3300046674 Bacteria 977
589 Ga0495623_0097257 3300046679 Bacteria 1798
590 Ga0495669_0000015 3300046684 Bacteria 140309
591 Ga0495669_0001098 3300046684 Bacteria 11198
592 Ga0495669_0007277 3300046684 Bacteria 4635
593 Ga0495669_0028184 3300046684 Bacteria 2458
594 Ga0495669_0099226 3300046684 Bacteria 1351
595 Ga0495669_0133312 3300046684 Bacteria 1170
596 Ga0495669_0464820 3300046684 Bacteria 614
597 Ga0495613_0236089 3300046689 Bacteria 1279
598 Ga0495670_0000314 3300046691 Bacteria 23002
599 Ga0495670_0008998 3300046691 Bacteria 4912
600 Ga0495670_0014316 3300046691 Bacteria 3900
601 Ga0495670_0037183 3300046691 Bacteria 2426
602 Ga0495670_0062801 3300046691 Bacteria 1869
603 Ga0495670_0075984 3300046691 Bacteria 1706
604 Ga0495670_0120529 3300046691 Bacteria 1362
605 Ga0495670_0221512 3300046691 Bacteria 1005
606 Ga0495671_0000301 3300046692 Bacteria 41678
607 Ga0495671_0000407 3300046692 Bacteria 34599
608 Ga0495671_0003196 3300046692 Bacteria 10176
609 Ga0495671_0024721 3300046692 Bacteria 3125
610 Ga0495671_0027174 3300046692 Bacteria 2957
611 Ga0495671_0029764 3300046692 Bacteria 2801
612 Ga0495671_0039208 3300046692 Bacteria 2393
613 Ga0495649_0000268 3300046694 Bacteria 46424
614 Ga0495649_0001236 3300046694 Bacteria 19664
615 Ga0495649_0003559 3300046694 Bacteria 10462
616 Ga0495649_0021678 3300046694 Bacteria 3599
617 Ga0495649_0028314 3300046694 Bacteria 3105
618 Ga0495649_0029827 3300046694 Bacteria 3014
619 Ga0495649_0041174 3300046694 Bacteria 2527
620 Ga0495649_0091730 3300046694 Bacteria 1618
621 Ga0495589_0000096 3300046794 Bacteria 84521
622 Ga0495589_0000351 3300046794 Bacteria 35944
623 Ga0495589_0000994 3300046794 Bacteria 17205
624 Ga0495589_0023862 3300046794 Bacteria 3112
625 Ga0495589_0031852 3300046794 Bacteria 2653
626 Ga0495589_0045477 3300046794 Bacteria 2180
627 Ga0495589_0130267 3300046794 Bacteria 1208
628 Ga0495589_0248463 3300046794 Bacteria 831
629 Ga0495660_0016503 3300046810 Bacteria 4257
630 Ga0495660_0020360 3300046810 Bacteria 3802
631 Ga0495660_0022525 3300046810 Bacteria 3596
632 Ga0495660_0024239 3300046810 Bacteria 3456
633 Ga0495660_0047107 3300046810 Bacteria 2362
634 Ga0495660_0101078 3300046810 Bacteria 1484
635 Ga0495660_0141335 3300046810 Bacteria 1197
636 Ga0495660_0221696 3300046810 Bacteria 891
637 Ga0495660_0247933 3300046810 Bacteria 827
638 Ga0495581_0086607 3300047315 Bacteria 1816
639 Ga0495604_0013961 3300047317 Bacteria 6406
640 Ga0495636_0000919 3300047318 Bacteria 10946
641 Ga0495636_0218629 3300047318 Bacteria 874
642 Ga0495672_0000026 3300047320 Bacteria 340319
643 Ga0495672_0000376 3300047320 Bacteria 55334
644 Ga0495672_0000391 3300047320 Bacteria 53759
645 Ga0495672_0005133 3300047320 Bacteria 10448
646 Ga0495672_0023707 3300047320 Bacteria 3966
647 Ga0495672_0116035 3300047320 Bacteria 1430
648 Ga0495676_0000281 3300047321 Bacteria 41181
649 Ga0495683_0000061 3300047323 Bacteria 114589
650 Ga0495683_0010017 3300047323 Bacteria 5027
651 Ga0495683_0016660 3300047323 Bacteria 3813
652 Ga0495683_0025705 3300047323 Bacteria 3016
653 Ga0495683_0048091 3300047323 Bacteria 2139
654 Ga0495683_0111498 3300047323 Bacteria 1305
655 Ga0495683_0125284 3300047323 Bacteria 1216
656 Ga0495683_0133357 3300047323 Bacteria 1169
657 Ga0495683_0241121 3300047323 Bacteria 797
658 Ga0495687_000110 3300047443 Bacteria 125363
659 Ga0495687_000117 3300047443 Bacteria 122591
660 Ga0495687_000203 3300047443 Bacteria 84774
661 Ga0495687_000522 3300047443 Bacteria 46048
662 Ga0495687_000772 3300047443 Bacteria 34667
663 Ga0495687_001354 3300047443 Bacteria 22750
664 Ga0495687_009685 3300047443 Bacteria 5358
665 Ga0495687_010025 3300047443 Bacteria 5234
666 Ga0495687_121503 3300047443 Bacteria 941
667 Ga0495687_127958 3300047443 Bacteria 904
668 Ga0495687_141689 3300047443 Bacteria 835
669 Ga0495687_175752 3300047443 Bacteria 704
670 Ga0495675_0046141 3300047444 Bacteria 2774
671 Ga0495677_0000036 3300047445 Bacteria 81332
672 Ga0495677_0001259 3300047445 Bacteria 10146
673 Ga0495677_0001886 3300047445 Bacteria 8373
674 Ga0495677_0006702 3300047445 Bacteria 4335
675 Ga0495677_0015614 3300047445 Bacteria 2758
676 Ga0495677_0018995 3300047445 Bacteria 2492
677 Ga0495677_0027277 3300047445 Bacteria 2072
678 Ga0495677_0041034 3300047445 Bacteria 1692
679 Ga0495677_0047660 3300047445 Bacteria 1573
680 Ga0495677_0080758 3300047445 Bacteria 1218
681 Ga0495677_0106158 3300047445 Bacteria 1065
682 Ga0495677_0141452 3300047445 Bacteria 924
683 Ga0495677_0188436 3300047445 Bacteria 800
684 Ga0495677_0235938 3300047445 Bacteria 714
685 Ga0495679_004255 3300047446 Bacteria 6643
686 Ga0495679_006300 3300047446 Bacteria 5131
687 Ga0495679_029236 3300047446 Bacteria 1799
688 Ga0495679_036789 3300047446 Bacteria 1544
689 Ga0495685_003627 3300047447 Bacteria 4938
690 Ga0495685_018911 3300047447 Bacteria 2365
691 Ga0495685_021265 3300047447 Bacteria 2232
692 Ga0495685_042936 3300047447 Bacteria 1543
693 Ga0495685_094709 3300047447 Bacteria 988
694 Ga0495685_124463 3300047447 Bacteria 845
695 Ga0495685_193170 3300047447 Bacteria 654
696 Ga0495673_0345550 3300047469 Bacteria 526
697 Ga0495681_0000429 3300047470 Bacteria 32218
698 Ga0495681_0003418 3300047470 Bacteria 11053
699 Ga0495681_0009302 3300047470 Bacteria 6068
700 Ga0495681_0019882 3300047470 Bacteria 3654
701 Ga0495681_0031941 3300047470 Bacteria 2656
702 Ga0495681_0039807 3300047470 Bacteria 2292
703 Ga0495681_0058725 3300047470 Bacteria 1781
704 Ga0495681_0061906 3300047470 Bacteria 1722
705 Ga0495681_0070940 3300047470 Bacteria 1578
706 Ga0495681_0155398 3300047470 Bacteria 956
707 Ga0495681_0366085 3300047470 Bacteria 545
708 Ga0495686_0000211 3300047472 Bacteria 107517
709 Ga0495686_0002384 3300047472 Bacteria 17849
710 Ga0495686_0057055 3300047472 Bacteria 2438
711 Ga0495686_0061325 3300047472 Bacteria 2336
712 Ga0495593_0002604 3300047673 Bacteria 10842
713 Ga0495614_0009594 3300048089 Bacteria 4277
714 Ga0495626_0000248 3300048091 Bacteria 62661
715 Ga0495626_0001446 3300048091 Bacteria 18813
716 Ga0495626_0002372 3300048091 Bacteria 13178
717 Ga0495626_0004585 3300048091 Bacteria 8428
718 Ga0495626_0005118 3300048091 Bacteria 7805
719 Ga0495626_0006270 3300048091 Bacteria 6790
720 Ga0495626_0017566 3300048091 Bacteria 3609
721 Ga0495626_0027387 3300048091 Bacteria 2772
722 Ga0495626_0046796 3300048091 Bacteria 2013
723 Ga0495626_0056788 3300048091 Bacteria 1791
724 Ga0495626_0085523 3300048091 Bacteria 1394
725 Ga0495626_0110556 3300048091 Bacteria 1190
726 Ga0495626_0114896 3300048091 Bacteria 1162
727 Ga0495626_0115021 3300048091 Bacteria 1161
728 Ga0495626_0115540 3300048091 Bacteria 1158
729 Ga0495626_0135356 3300048091 Bacteria 1048
730 Ga0495626_0140406 3300048091 Bacteria 1025
731 Ga0496100_0714392 3300048903 Bacteria 782
732 Ga0496100_1215346 3300048903 Bacteria 595
733 Ga0496101_0021234 3300048904 Bacteria 4458
734 Ga0496102_0008289 3300048905 Bacteria 8901
735 Ga0496102_0054742 3300048905 Bacteria 3638
736 Ga0496102_0150931 3300048905 Bacteria 2183
737 Ga0496102_0493515 3300048905 Bacteria 1146
738 Ga0496102_0631732 3300048905 Bacteria 994
739 Ga0496103_0001512 3300048906 Bacteria 15549
740 Ga0496103_0033458 3300048906 Bacteria 3141
741 Ga0496103_0057760 3300048906 Bacteria 2409
742 Ga0496103_1027602 3300048906 Bacteria 512
743 Ga0496104_0505181 3300048907 Bacteria 1120
744 Ga0496105_0569837 3300048908 Bacteria 882
745 Ga0496105_1165559 3300048908 Bacteria 569
746 Ga0496106_0029179 3300048909 Bacteria 4110
747 Ga0496107_0210111 3300048910 Bacteria 1447
748 Ga0496107_0226753 3300048910 Bacteria 1390
749 Ga0496107_0967220 3300048910 Bacteria 619
750 Ga0496109_0034046 3300048912 Bacteria 4585
751 Ga0496109_1382763 3300048912 Bacteria 639
752 Ga0496110_0024137 3300048913 Bacteria 5179
753 Ga0496110_0046293 3300048913 Bacteria 3805
754 Ga0496110_0908218 3300048913 Bacteria 787
755 Ga0496113_0023269 3300048916 Bacteria 4393
756 Ga0496113_0539660 3300048916 Bacteria 936
757 Ga0496115_0090683 3300048918 Bacteria 2497
758 Ga0496115_0109859 3300048918 Bacteria 2265
759 Ga0496115_0846957 3300048918 Bacteria 708
760 Ga0496116_0005927 3300048919 Bacteria 11208
761 Ga0496116_0036002 3300048919 Bacteria 3471
762 Ga0496116_0126546 3300048919 Bacteria 1466
763 Ga0496117_0139491 3300048920 Bacteria 1455
764 Ga0496117_0179810 3300048920 Bacteria 1217
765 Ga0496117_0450837 3300048920 Bacteria 636
766 Ga0496119_0024995 3300048922 Bacteria 4181
767 Ga0496120_0145180 3300048923 Bacteria 1199
768 Ga0496121_0000444 3300048924 Bacteria 81596
769 Ga0496121_0009535 3300048924 Bacteria 11122
770 Ga0496121_0200202 3300048924 Bacteria 1424
771 Ga0496122_0000232 3300048925 Bacteria 125326
772 Ga0496122_0000483 3300048925 Bacteria 82763
773 Ga0496122_0007785 3300048925 Bacteria 11783
774 Ga0496122_0102463 3300048925 Bacteria 1908
775 Ga0496122_0344466 3300048925 Bacteria 781
776 Ga0496123_0000194 3300048926 Bacteria 123528
777 Ga0496123_0000904 3300048926 Bacteria 46774
778 Ga0496123_0032504 3300048926 Bacteria 3776
779 Ga0496123_0053931 3300048926 Bacteria 2652
780 Ga0496123_0257506 3300048926 Bacteria 857
781 Ga0496124_0000013 3300048927 Bacteria 484884
782 Ga0496124_0016891 3300048927 Bacteria 6916
783 Ga0496124_0042724 3300048927 Bacteria 3901
784 Ga0496124_0047118 3300048927 Bacteria 3689
785 Ga0496124_0052033 3300048927 Bacteria 3481
786 Ga0496124_0097148 3300048927 Bacteria 2392
787 Ga0496124_0134627 3300048927 Bacteria 1958
788 Ga0496124_0180582 3300048927 Bacteria 1624
789 Ga0496124_0202292 3300048927 Bacteria 1509
790 Ga0496124_0340456 3300048927 Bacteria 1065
791 Ga0496125_0000051 3300048928 Bacteria 285754
792 Ga0496125_0003465 3300048928 Bacteria 19100
793 Ga0496125_0015724 3300048928 Bacteria 7296
794 Ga0496125_0038720 3300048928 Bacteria 4119
795 Ga0496125_0106503 3300048928 Bacteria 2046
796 Ga0496126_0025984 3300048929 Bacteria 5622
797 Ga0496126_0115238 3300048929 Bacteria 2337
798 Ga0495678_000227 3300049459 Bacteria 64986
799 Ga0495678_001769 3300049459 Bacteria 16004
800 Ga0495678_010629 3300049459 Bacteria 4459
801 Ga0495678_018448 3300049459 Bacteria 3136
802 Ga0495678_076415 3300049459 Bacteria 1213
803 Ga0495678_104071 3300049459 Bacteria 979
804 Ga0495678_135087 3300049459 Bacteria 813
805 Ga0495682_0000286 3300049460 Bacteria 39332
806 Ga0495682_0008933 3300049460 Bacteria 3930
807 Ga0495682_0041954 3300049460 Bacteria 1677
808 Ga0495682_0112128 3300049460 Bacteria 977
809 Ga0501301_003617 3300049524 Bacteria 1069
810 Ga0501034_0169641 3300049571 Bacteria 2150
811 Ga0501036_0337557 3300049572 Bacteria 1259
812 Ga0501043_0303681 3300049579 Bacteria 1219
813 Ga0501047_0006177 3300049581 Bacteria 11265
814 Ga0501207_060443 3300049654 Bacteria 693
815 Ga0501211_003298 3300049658 Bacteria 1667
816 Ga0501214_002716 3300049659 Bacteria 1513
817 Ga0501222_004483 3300049662 Bacteria 1897
818 Ga0501227_009878 3300049665 Bacteria 2063
819 Ga0501227_110127 3300049665 Bacteria 737
820 Ga0501240_015555 3300049673 Bacteria 1083
821 Ga0501248_042668 3300049678 Bacteria 560
822 Ga0501249_001865 3300049679 Bacteria 4298
823 Ga0501221_085329 3300049704 Bacteria 765
824 Ga0501241_043556 3300049758 Bacteria 874
825 Ga0501263_002382 3300049760 Bacteria 1908
826 Ga0501269_000016 3300049766 Bacteria 58863
827 Ga0501279_000214 3300049775 Bacteria 8080
828 Ga0501279_002528 3300049775 Bacteria 2398
829 Ga0501279_009397 3300049775 Bacteria 1309
830 Ga0501035_0006115 3300049822 Bacteria 11332
831 Ga0501035_0012618 3300049822 Bacteria 7808
832 Ga0501035_0024919 3300049822 Bacteria 5486
833 Ga0501035_1466863 3300049822 Bacteria 521
834 Ga0501044_0001216 3300049823 Bacteria 30550
835 Ga0501044_1143230 3300049823 Bacteria 647
836 Ga0501226_026593 3300049853 Bacteria 650
837 nmdc:mga03683_160500_c1 3300050489 Bacteria 1018
838 nmdc:mga00v17_128193_c1 3300050491 Bacteria 1620
839 nmdc:mga00v17_142480_c1 3300050491 Bacteria 1537
840 nmdc:mga00v17_16534_c1 3300050491 Bacteria 4157
841 Ga0500618_008302 3300053125 Bacteria 2905
842 Ga0500634_0077778 3300053161 Bacteria 1718
843 Ga0587083_0080394 3300059505 Bacteria 775
844 Ga0466962_0049428 3300061719 Bacteria 2010

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046615 Ga0495656_0059896 Ga0495656_0059896_296_724 142
2 3300049704 Ga0501221_085329 Ga0501221_085329_14_442 142
3 iso_pu_bacteria 2904424332 2904428195 146
4 3300037418 Ga0395900_1370422 Ga0395900_1370422_25_468 147
5 3300044706 Ga0466964_0763822 Ga0466964_0763822_27_470 147
6 3300047323 Ga0495683_0241121 Ga0495683_0241121_335_778 147
7 iso_pu_bacteria 2643221554 2643790062 148
8 iso_pu_bacteria 2643221638 2644217083 148
9 3300003215 JGI25153J46596_10007800 JGI25153J46596_100078002 150
10 3300003775 Ga0055524_1000038 Ga0055524_1000038131 150
11 3300005262 Ga0065165_1012767 Ga0065165_10127672 150
12 3300005455 Ga0070663_100505741 Ga0070663_1005057412 150
13 3300006177 Ga0075362_10168836 Ga0075362_101688362 150
14 3300006948 Ga0099826_10000008 Ga0099826_10000008193 150
15 3300009036 Ga0105244_10003553 Ga0105244_100035535 150
16 3300013104 Ga0157370_10448132 Ga0157370_104481321 150
17 3300025245 Ga0207425_1000257 Ga0207425_100025718 150
18 3300025263 Ga0209565_1032621 Ga0209565_10326212 150
19 3300025291 Ga0209675_1040020 Ga0209675_10400201 150
20 3300025294 Ga0209025_1026873 Ga0209025_10268731 150
21 3300025295 Ga0209564_1031656 Ga0209564_10316562 150
22 3300025297 Ga0209758_1000379 Ga0209758_100037938 150
23 3300025299 Ga0209256_1000018 Ga0209256_1000018206 150
24 3300025728 Ga0207655_1003797 Ga0207655_10037976 150
25 3300026067 Ga0207678_10196412 Ga0207678_101964121 150
26 3300027666 Ga0209282_1000005 Ga0209282_1000005192 150
27 3300030744 Ga0316181_1270997 Ga0316181_12709972 150
28 3300046463 Ga0495653_0114226 Ga0495653_0114226_606_1061 150
29 3300046507 Ga0495606_0000101 Ga0495606_0000101_33923_34375 150
30 3300046507 Ga0495606_0153848 Ga0495606_0153848_878_1330 150
31 3300046512 Ga0495610_0000293 Ga0495610_0000293_17310_17762 150
32 3300046512 Ga0495610_0000381 Ga0495610_0000381_36959_37414 150
33 3300046512 Ga0495610_0001648 Ga0495610_0001648_1722_2174 150
34 3300046512 Ga0495610_0116281 Ga0495610_0116281_485_937 150
35 3300046522 Ga0495643_0292408 Ga0495643_0292408_41_493 150
36 3300046524 Ga0495648_0074505 Ga0495648_0074505_907_1359 150
37 3300046542 Ga0495597_0041944 Ga0495597_0041944_1348_1800 150
38 3300046558 Ga0495633_0000489 Ga0495633_0000489_38662_39114 150
39 3300046558 Ga0495633_0119923 Ga0495633_0119923_31_483 150
40 3300046558 Ga0495633_0302573 Ga0495633_0302573_263_715 150
41 3300046616 Ga0495668_0000712 Ga0495668_0000712_11554_12006 150
42 3300046660 Ga0495625_0189730 Ga0495625_0189730_85_537 150
43 3300046694 Ga0495649_0021678 Ga0495649_0021678_760_1224 150
44 3300047443 Ga0495687_001354 Ga0495687_001354_2431_2883 150
45 3300047443 Ga0495687_010025 Ga0495687_010025_2099_2551 150
46 3300047447 Ga0495685_094709 Ga0495685_094709_288_740 150
47 3300047470 Ga0495681_0366085 Ga0495681_0366085_72_524 150
48 3300047472 Ga0495686_0000211 Ga0495686_0000211_81715_82167 150
49 3300047472 Ga0495686_0057055 Ga0495686_0057055_479_931 150
50 3300048906 Ga0496103_0001512 Ga0496103_0001512_7941_8393 150
51 3300048918 Ga0496115_0109859 Ga0496115_0109859_971_1432 150
52 3300048919 Ga0496116_0036002 Ga0496116_0036002_1366_1818 150
53 3300048927 Ga0496124_0042724 Ga0496124_0042724_2919_3371 150
54 3300048927 Ga0496124_0340456 Ga0496124_0340456_539_991 150
55 3300049571 Ga0501034_0169641 Ga0501034_0169641_1415_1870 150
56 3300049579 Ga0501043_0303681 Ga0501043_0303681_494_949 150
57 3300049581 Ga0501047_0006177 Ga0501047_0006177_1330_1785 150
58 3300049679 Ga0501249_001865 Ga0501249_001865_744_1196 150
59 3300049758 Ga0501241_043556 Ga0501241_043556_324_788 150
60 3300049766 Ga0501269_000016 Ga0501269_000016_16716_17168 150
61 3300049822 Ga0501035_0012618 Ga0501035_0012618_4438_4893 150
62 3300050489 nmdc:mga03683_160500_c1 nmdc:mga03683_160500_c1_432_884 150
63 3300003322 rootL2_10271811 rootL2_102718113 151
64 3300005344 Ga0070661_100051185 Ga0070661_1000511852 151
65 3300005366 Ga0070659_100183538 Ga0070659_1001835382 151
66 3300005457 Ga0070662_100119361 Ga0070662_1001193612 151
67 3300005539 Ga0068853_101156634 Ga0068853_1011566341 151
68 3300005616 Ga0068852_100729038 Ga0068852_1007290382 151
69 3300006051 Ga0075364_10007806 Ga0075364_100078062 151
70 3300006051 Ga0075364_10161940 Ga0075364_101619402 151
71 3300006358 Ga0068871_100677623 Ga0068871_1006776231 151
72 3300009036 Ga0105244_10041854 Ga0105244_100418542 151
73 3300009098 Ga0105245_10846549 Ga0105245_108465491 151
74 3300009148 Ga0105243_10074704 Ga0105243_100747042 151
75 3300009176 Ga0105242_10000856 Ga0105242_100008562 151
76 3300014969 Ga0157376_11112608 Ga0157376_111126081 151
77 3300025728 Ga0207655_1019168 Ga0207655_10191682 151
78 3300025919 Ga0207657_10076231 Ga0207657_100762311 151
79 3300025920 Ga0207649_10029886 Ga0207649_100298862 151
80 3300025924 Ga0207694_10399624 Ga0207694_103996242 151
81 3300025933 Ga0207706_10076717 Ga0207706_100767172 151
82 3300025934 Ga0207686_10000388 Ga0207686_1000038819 151
83 3300025935 Ga0207709_10010359 Ga0207709_100103593 151
84 3300025942 Ga0207689_10574443 Ga0207689_105744431 151
85 3300026041 Ga0207639_10691664 Ga0207639_106916641 151
86 3300026089 Ga0207648_10522445 Ga0207648_105224452 151
87 3300037312 Ga0395899_0096207 Ga0395899_0096207_1570_2025 151
88 3300037471 Ga0395905_0153810 Ga0395905_0153810_923_1378 151
89 3300041453 Ga0451797_0898951 Ga0451797_0898951_12_467 151
90 3300044656 Ga0466969_0082535 Ga0466969_0082535_725_1180 151
91 3300044683 Ga0466965_0299943 Ga0466965_0299943_355_810 151
92 3300044684 Ga0466966_0028396 Ga0466966_0028396_1275_1730 151
93 3300044706 Ga0466964_0002005 Ga0466964_0002005_5061_5516 151
94 3300044735 Ga0466968_0068736 Ga0466968_0068736_77_532 151
95 3300044765 Ga0466970_0083422 Ga0466970_0083422_125_580 151
96 3300044842 Ga0466957_0232738 Ga0466957_0232738_211_666 151
97 3300045049 Ga0466959_0019022 Ga0466959_0019022_2930_3385 151
98 3300045049 Ga0466959_0679828 Ga0466959_0679828_222_677 151
99 3300045836 Ga0466958_0211977 Ga0466958_0211977_708_1163 151
100 3300046457 Ga0495590_0032822 Ga0495590_0032822_366_830 151
101 3300046460 Ga0495638_0021841 Ga0495638_0021841_1161_1625 151
102 3300046474 Ga0495605_0098596 Ga0495605_0098596_838_1302 151
103 3300046491 Ga0495584_0005287 Ga0495584_0005287_1010_1474 151
104 3300046501 Ga0495607_0024611 Ga0495607_0024611_2406_2870 151
105 3300046506 Ga0495583_0034508 Ga0495583_0034508_1077_1541 151
106 3300046522 Ga0495643_0388175 Ga0495643_0388175_140_604 151
107 3300046528 Ga0495642_0040971 Ga0495642_0040971_604_1068 151
108 3300046538 Ga0495609_0000127 Ga0495609_0000127_40845_41309 151
109 3300046616 Ga0495668_0000066 Ga0495668_0000066_143168_143632 151
110 3300046616 Ga0495668_0001137 Ga0495668_0001137_955_1419 151
111 3300046648 Ga0495611_0134078 Ga0495611_0134078_682_1146 151
112 3300046660 Ga0495625_0000824 Ga0495625_0000824_24523_24987 151
113 3300046664 Ga0495659_0000963 Ga0495659_0000963_8921_9385 151
114 3300046665 Ga0495661_0034911 Ga0495661_0034911_2072_2536 151
115 3300046684 Ga0495669_0464820 Ga0495669_0464820_98_562 151
116 3300046692 Ga0495671_0039208 Ga0495671_0039208_680_1144 151
117 3300046694 Ga0495649_0003559 Ga0495649_0003559_5896_6360 151
118 3300047443 Ga0495687_127958 Ga0495687_127958_322_786 151
119 3300047445 Ga0495677_0001886 Ga0495677_0001886_1110_1574 151
120 3300047445 Ga0495677_0015614 Ga0495677_0015614_36_491 151
121 3300047447 Ga0495685_018911 Ga0495685_018911_1236_1700 151
122 3300047470 Ga0495681_0003418 Ga0495681_0003418_10408_10872 151
123 3300047472 Ga0495686_0002384 Ga0495686_0002384_216_680 151
124 3300048905 Ga0496102_0493515 Ga0496102_0493515_224_679 151
125 3300048906 Ga0496103_1027602 Ga0496103_1027602_26_481 151
126 3300048907 Ga0496104_0505181 Ga0496104_0505181_153_608 151
127 3300048910 Ga0496107_0210111 Ga0496107_0210111_980_1435 151
128 3300049459 Ga0495678_076415 Ga0495678_076415_305_769 151
129 3300050491 nmdc:mga00v17_142480_c1 nmdc:mga00v17_142480_c1_419_925 151
130 3300050491 nmdc:mga00v17_16534_c1 nmdc:mga00v17_16534_c1_917_1438 151
131 3300061719 Ga0466962_0049428 Ga0466962_0049428_753_1208 151
132 iso_pu_bacteria 2643221645 2644250699 151
133 iso_pu_bacteria 2738541280 2738738559 151
134 iso_pu_bacteria 2738541300 2738842639 151
135 iso_pu_bacteria 2738543018 2739273386 151
136 iso_pu_bacteria 2738543030 2739342430 151
137 iso_pu_bacteria 2895511927 2895517995 151
138 iso_pu_bacteria 8055225921 8055228489 151
139 3300002739 JGI25158J39367_1014859 JGI25158J39367_10148592 152
140 3300002773 JGI25152J39213_1000167 JGI25152J39213_100016739 152
141 3300002774 JGI25150J39212_1003873 JGI25150J39212_10038734 152
142 3300002987 JGI25159J45721_1001390 JGI25159J45721_10013907 152
143 3300002987 JGI25159J45721_1025954 JGI25159J45721_10259541 152
144 3300002987 JGI25159J45721_1025965 JGI25159J45721_10259651 152
145 3300003187 JGI25151J46595_10000121 JGI25151J46595_1000012192 152
146 3300003354 JGI25160J50197_1043176 JGI25160J50197_10431761 152
147 3300003354 JGI25160J50197_1043192 JGI25160J50197_10431921 152
148 3300003374 JGI25161J50226_1001036 JGI25161J50226_10010363 152
149 3300003374 JGI25161J50226_1011032 JGI25161J50226_10110322 152
150 3300003374 JGI25161J50226_1016535 JGI25161J50226_10165351 152
151 3300003759 Ga0055525_1000023 Ga0055525_100002333 152
152 3300003762 Ga0055542_1020354 Ga0055542_10203541 152
153 3300003763 Ga0055529_1004675 Ga0055529_10046752 152
154 3300003771 Ga0055526_1023986 Ga0055526_10239862 152
155 3300003773 Ga0055537_1019145 Ga0055537_10191452 152
156 3300003775 Ga0055524_1000608 Ga0055524_100060819 152
157 3300003775 Ga0055524_1023971 Ga0055524_10239712 152
158 3300003775 Ga0055524_1049207 Ga0055524_10492071 152
159 3300003781 Ga0055536_1039444 Ga0055536_10394442 152
160 3300003784 Ga0055534_1011502 Ga0055534_10115022 152
161 3300003784 Ga0055534_1024600 Ga0055534_10246001 152
162 3300003790 Ga0055528_1008217 Ga0055528_10082171 152
163 3300003791 Ga0055530_10008998 Ga0055530_100089982 152
164 3300003791 Ga0055530_10014933 Ga0055530_100149331 152
165 3300003794 Ga0055531_10006255 Ga0055531_1000625511 152
166 3300003794 Ga0055531_10009487 Ga0055531_100094871 152
167 3300004625 Ga0055543_1004210 Ga0055543_10042103 152
168 3300004625 Ga0055543_1025449 Ga0055543_10254491 152
169 3300005262 Ga0065165_1000495 Ga0065165_100049559 152
170 3300005262 Ga0065165_1059071 Ga0065165_10590711 152
171 3300005293 Ga0065715_10050641 Ga0065715_100506411 152
172 3300005327 Ga0070658_10405392 Ga0070658_104053921 152
173 3300005327 Ga0070658_10428996 Ga0070658_104289962 152
174 3300005327 Ga0070658_10755289 Ga0070658_107552892 152
175 3300005336 Ga0070680_100069973 Ga0070680_1000699733 152
176 3300005337 Ga0070682_100166225 Ga0070682_1001662252 152
177 3300005339 Ga0070660_100515437 Ga0070660_1005154372 152
178 3300005366 Ga0070659_100015332 Ga0070659_1000153322 152
179 3300005367 Ga0070667_100001997 Ga0070667_10000199718 152
180 3300005455 Ga0070663_101283141 Ga0070663_1012831411 152
181 3300005457 Ga0070662_100614532 Ga0070662_1006145321 152
182 3300005539 Ga0068853_100137258 Ga0068853_1001372582 152
183 3300005548 Ga0070665_100121741 Ga0070665_1001217412 152
184 3300005563 Ga0068855_100132767 Ga0068855_1001327672 152
185 3300005563 Ga0068855_100239212 Ga0068855_1002392122 152
186 3300005564 Ga0070664_100507058 Ga0070664_1005070582 152
187 3300006051 Ga0075364_10082872 Ga0075364_100828722 152
188 3300006237 Ga0097621_100990574 Ga0097621_1009905741 152
189 3300006948 Ga0099826_10353032 Ga0099826_103530322 152
190 3300009036 Ga0105244_10038011 Ga0105244_100380112 152
191 3300009093 Ga0105240_10001254 Ga0105240_100012543 152
192 3300009093 Ga0105240_11706671 Ga0105240_117066711 152
193 3300009098 Ga0105245_10026281 Ga0105245_100262814 152
194 3300009098 Ga0105245_10429914 Ga0105245_104299141 152
195 3300009174 Ga0105241_10024835 Ga0105241_100248352 152
196 3300009176 Ga0105242_10406341 Ga0105242_104063412 152
197 3300009545 Ga0105237_10194228 Ga0105237_101942282 152
198 3300009551 Ga0105238_10271302 Ga0105238_102713022 152
199 3300010375 Ga0105239_10294628 Ga0105239_102946282 152
200 3300013100 Ga0157373_10073814 Ga0157373_100738142 152
201 3300013102 Ga0157371_10289658 Ga0157371_102896582 152
202 3300013104 Ga0157370_10479810 Ga0157370_104798101 152
203 3300013296 Ga0157374_10104660 Ga0157374_101046602 152
204 3300013296 Ga0157374_10324838 Ga0157374_103248382 152
205 3300013307 Ga0157372_10349370 Ga0157372_103493702 152
206 3300013307 Ga0157372_10697570 Ga0157372_106975702 152
207 3300013307 Ga0157372_10726086 Ga0157372_107260862 152
208 3300015261 Ga0182006_1085358 Ga0182006_10853582 152
209 3300015262 Ga0182007_10046502 Ga0182007_100465022 152
210 3300025208 Ga0209436_100040 Ga0209436_1000405 152
211 3300025208 Ga0209436_117835 Ga0209436_1178351 152
212 3300025208 Ga0209436_117836 Ga0209436_1178361 152
213 3300025228 Ga0209672_102913 Ga0209672_1029133 152
214 3300025230 Ga0209563_100011 Ga0209563_100011346 152
215 3300025242 Ga0209258_105110 Ga0209258_1051102 152
216 3300025245 Ga0207425_1000009 Ga0207425_1000009238 152
217 3300025245 Ga0207425_1009042 Ga0207425_10090422 152
218 3300025245 Ga0207425_1036925 Ga0207425_10369251 152
219 3300025253 Ga0209677_105405 Ga0209677_1054052 152
220 3300025254 Ga0209148_1000580 Ga0209148_100058016 152
221 3300025258 Ga0209129_1000051 Ga0209129_1000051162 152
222 3300025258 Ga0209129_1006067 Ga0209129_10060671 152
223 3300025263 Ga0209565_1001480 Ga0209565_100148011 152
224 3300025263 Ga0209565_1002538 Ga0209565_100253810 152
225 3300025263 Ga0209565_1004936 Ga0209565_10049363 152
226 3300025263 Ga0209565_1005910 Ga0209565_10059102 152
227 3300025263 Ga0209565_1029299 Ga0209565_10292991 152
228 3300025263 Ga0209565_1031673 Ga0209565_10316731 152
229 3300025272 Ga0209455_1003081 Ga0209455_10030814 152
230 3300025273 Ga0209673_1021734 Ga0209673_10217342 152
231 3300025284 Ga0209130_1000217 Ga0209130_100021772 152
232 3300025284 Ga0209130_1006188 Ga0209130_10061883 152
233 3300025291 Ga0209675_1001533 Ga0209675_10015338 152
234 3300025291 Ga0209675_1020283 Ga0209675_10202831 152
235 3300025292 Ga0209676_1005251 Ga0209676_10052512 152
236 3300025294 Ga0209025_1000019 Ga0209025_1000019156 152
237 3300025295 Ga0209564_1004433 Ga0209564_10044339 152
238 3300025295 Ga0209564_1005893 Ga0209564_10058934 152
239 3300025295 Ga0209564_1050090 Ga0209564_10500901 152
240 3300025297 Ga0209758_1000054 Ga0209758_1000054239 152
241 3300025298 Ga0209050_1000040 Ga0209050_100004081 152
242 3300025298 Ga0209050_1001052 Ga0209050_100105227 152
243 3300025298 Ga0209050_1006080 Ga0209050_10060802 152
244 3300025299 Ga0209256_1000307 Ga0209256_100030755 152
245 3300025299 Ga0209256_1003794 Ga0209256_10037948 152
246 3300025299 Ga0209256_1006054 Ga0209256_10060542 152
247 3300025299 Ga0209256_1111938 Ga0209256_11119381 152
248 3300025302 Ga0207426_1012456 Ga0207426_10124563 152
249 3300025303 Ga0209051_1033870 Ga0209051_10338703 152
250 3300025303 Ga0209051_1034706 Ga0209051_10347061 152
251 3300025304 Ga0209257_1000054 Ga0209257_1000054317 152
252 3300025304 Ga0209257_1002267 Ga0209257_10022673 152
253 3300025728 Ga0207655_1038594 Ga0207655_10385942 152
254 3300025909 Ga0207705_10017793 Ga0207705_100177932 152
255 3300025909 Ga0207705_10908233 Ga0207705_109082331 152
256 3300025913 Ga0207695_10075242 Ga0207695_100752422 152
257 3300025914 Ga0207671_10055267 Ga0207671_100552672 152
258 3300025917 Ga0207660_10057463 Ga0207660_100574633 152
259 3300025919 Ga0207657_10005222 Ga0207657_100052222 152
260 3300025920 Ga0207649_11112317 Ga0207649_111123171 152
261 3300025932 Ga0207690_10018849 Ga0207690_100188492 152
262 3300025938 Ga0207704_10067996 Ga0207704_100679962 152
263 3300025949 Ga0207667_10001574 Ga0207667_100015742 152
264 3300025949 Ga0207667_10105606 Ga0207667_101056061 152
265 3300025981 Ga0207640_10114022 Ga0207640_101140222 152
266 3300025986 Ga0207658_10024757 Ga0207658_100247572 152
267 3300026067 Ga0207678_10075104 Ga0207678_100751043 152
268 3300026067 Ga0207678_10693728 Ga0207678_106937281 152
269 3300026116 Ga0207674_10046745 Ga0207674_100467454 152
270 3300027312 Ga0209371_1019009 Ga0209371_10190092 152
271 3300027312 Ga0209371_1044808 Ga0209371_10448082 152
272 3300028379 Ga0268266_10095208 Ga0268266_100952082 152
273 3300030500 Ga0268256_1011399 Ga0268256_10113992 152
274 3300030500 Ga0268256_1050650 Ga0268256_10506502 152
275 3300031548 Ga0307408_100000281 Ga0307408_1000002817 152
276 3300031548 Ga0307408_100000347 Ga0307408_1000003471 152
277 3300031548 Ga0307408_100000747 Ga0307408_10000074718 152
278 3300031548 Ga0307408_100000803 Ga0307408_1000008032 152
279 3300031548 Ga0307408_100081507 Ga0307408_1000815072 152
280 3300031548 Ga0307408_100935997 Ga0307408_1009359971 152
281 3300031911 Ga0307412_10000109 Ga0307412_1000010943 152
282 3300032002 Ga0307416_100004731 Ga0307416_1000047312 152
283 3300037312 Ga0395899_0000492 Ga0395899_0000492_28616_29086 152
284 3300037312 Ga0395899_0001821 Ga0395899_0001821_13951_14424 152
285 3300037312 Ga0395899_0005599 Ga0395899_0005599_469_942 152
286 3300037312 Ga0395899_0019791 Ga0395899_0019791_1197_1670 152
287 3300037312 Ga0395899_0200356 Ga0395899_0200356_380_853 152
288 3300037418 Ga0395900_0001043 Ga0395900_0001043_3187_3660 152
289 3300037418 Ga0395900_0001113 Ga0395900_0001113_31500_31973 152
290 3300037418 Ga0395900_0001615 Ga0395900_0001615_1063_1536 152
291 3300037418 Ga0395900_0111926 Ga0395900_0111926_494_967 152
292 3300037418 Ga0395900_0181484 Ga0395900_0181484_482_955 152
293 3300037418 Ga0395900_0211437 Ga0395900_0211437_395_868 152
294 3300037418 Ga0395900_0228915 Ga0395900_0228915_14_487 152
295 3300037418 Ga0395900_0294867 Ga0395900_0294867_986_1462 152
296 3300037418 Ga0395900_0315102 Ga0395900_0315102_283_756 152
297 3300037418 Ga0395900_0653861 Ga0395900_0653861_447_920 152
298 3300037418 Ga0395900_0773455 Ga0395900_0773455_347_820 152
299 3300037466 Ga0395898_0256797 Ga0395898_0256797_749_1222 152
300 3300037466 Ga0395898_0373227 Ga0395898_0373227_84_557 152
301 3300037466 Ga0395898_0702172 Ga0395898_0702172_120_593 152
302 3300037466 Ga0395898_0894135 Ga0395898_0894135_148_621 152
303 3300037471 Ga0395905_0048881 Ga0395905_0048881_2488_2961 152
304 3300037471 Ga0395905_0146807 Ga0395905_0146807_1005_1478 152
305 3300037471 Ga0395905_0249987 Ga0395905_0249987_912_1385 152
306 3300037471 Ga0395905_0342299 Ga0395905_0342299_593_1066 152
307 3300037471 Ga0395905_0668160 Ga0395905_0668160_198_671 152
308 3300037471 Ga0395905_1031704 Ga0395905_1031704_173_646 152
309 3300038443 Ga0395901_0000574 Ga0395901_0000574_27241_27711 152
310 3300038443 Ga0395901_0002565 Ga0395901_0002565_7530_8003 152
311 3300038443 Ga0395901_0007658 Ga0395901_0007658_363_836 152
312 3300038443 Ga0395901_0008153 Ga0395901_0008153_6411_6884 152
313 3300038443 Ga0395901_0135267 Ga0395901_0135267_1072_1545 152
314 3300038443 Ga0395901_0200577 Ga0395901_0200577_968_1444 152
315 3300038443 Ga0395901_0437880 Ga0395901_0437880_304_777 152
316 3300038443 Ga0395901_1542236 Ga0395901_1542236_30_503 152
317 3300039447 Ga0436361_0034381 Ga0436361_0034381_122_586 152
318 3300039447 Ga0436361_0234826 Ga0436361_0234826_955_1419 152
319 3300041413 Ga0439465_0162881 Ga0439465_0162881_129_602 152
320 3300041999 Ga0439433_0124244 Ga0439433_0124244_103_576 152
321 3300042005 Ga0439448_0002210 Ga0439448_0002210_1273_1746 152
322 3300042007 Ga0439449_0145472 Ga0439449_0145472_312_785 152
323 3300042008 Ga0439450_010137 Ga0439450_010137_976_1449 152
324 3300042008 Ga0439450_021049 Ga0439450_021049_530_1003 152
325 3300042012 Ga0439455_0041268 Ga0439455_0041268_158_631 152
326 3300042157 Ga0439458_0044384 Ga0439458_0044384_316_789 152
327 3300042532 Ga0450893_0090685 Ga0450893_0090685_87_545 152
328 3300044658 Ga0466972_0008843 Ga0466972_0008843_784_1257 152
329 3300044658 Ga0466972_0010972 Ga0466972_0010972_3182_3655 152
330 3300044683 Ga0466965_0000300 Ga0466965_0000300_1405_1878 152
331 3300044683 Ga0466965_0020707 Ga0466965_0020707_2455_2928 152
332 3300044683 Ga0466965_0068460 Ga0466965_0068460_632_1105 152
333 3300044683 Ga0466965_0118837 Ga0466965_0118837_46_513 152
334 3300044684 Ga0466966_0001847 Ga0466966_0001847_5682_6155 152
335 3300044684 Ga0466966_0131325 Ga0466966_0131325_444_917 152
336 3300044684 Ga0466966_0151271 Ga0466966_0151271_318_791 152
337 3300044684 Ga0466966_0214220 Ga0466966_0214220_649_1122 152
338 3300044684 Ga0466966_0263991 Ga0466966_0263991_234_707 152
339 3300044684 Ga0466966_0287985 Ga0466966_0287985_362_835 152
340 3300044693 Ga0466961_0530630 Ga0466961_0530630_31_504 152
341 3300044693 Ga0466961_0734775 Ga0466961_0734775_97_570 152
342 3300044694 Ga0466963_1016549 Ga0466963_1016549_11_484 152
343 3300044706 Ga0466964_0001905 Ga0466964_0001905_5883_6356 152
344 3300044706 Ga0466964_0143648 Ga0466964_0143648_438_911 152
345 3300044719 Ga0466971_0055217 Ga0466971_0055217_219_692 152
346 3300044735 Ga0466968_0003533 Ga0466968_0003533_1823_2296 152
347 3300044735 Ga0466968_0127106 Ga0466968_0127106_563_1036 152
348 3300044765 Ga0466970_0262012 Ga0466970_0262012_382_864 152
349 3300044765 Ga0466970_0295324 Ga0466970_0295324_67_540 152
350 3300044765 Ga0466970_0366956 Ga0466970_0366956_155_628 152
351 3300044842 Ga0466957_0000018 Ga0466957_0000018_30212_30685 152
352 3300044842 Ga0466957_0009127 Ga0466957_0009127_339_812 152
353 3300044842 Ga0466957_0077957 Ga0466957_0077957_347_820 152
354 3300044842 Ga0466957_0545654 Ga0466957_0545654_134_607 152
355 3300044842 Ga0466957_0545748 Ga0466957_0545748_158_631 152
356 3300044901 Ga0466960_0085094 Ga0466960_0085094_1108_1575 152
357 3300044901 Ga0466960_0459356 Ga0466960_0459356_215_688 152
358 3300044901 Ga0466960_0898372 Ga0466960_0898372_26_499 152
359 3300045049 Ga0466959_0203561 Ga0466959_0203561_493_966 152
360 3300045049 Ga0466959_0731712 Ga0466959_0731712_120_593 152
361 3300045836 Ga0466958_0133420 Ga0466958_0133420_449_922 152
362 3300045836 Ga0466958_0186176 Ga0466958_0186176_389_862 152
363 3300045836 Ga0466958_0749854 Ga0466958_0749854_56_529 152
364 3300045976 Ga0466967_0007401 Ga0466967_0007401_2612_3085 152
365 3300045976 Ga0466967_0009956 Ga0466967_0009956_3430_3903 152
366 3300045976 Ga0466967_0125566 Ga0466967_0125566_1406_1879 152
367 3300045976 Ga0466967_0685495 Ga0466967_0685495_129_602 152
368 3300046452 Ga0495617_001267 Ga0495617_001267_3127_3600 152
369 3300046452 Ga0495617_170867 Ga0495617_170867_75_548 152
370 3300046453 Ga0495627_005503 Ga0495627_005503_1046_1519 152
371 3300046455 Ga0495603_0122714 Ga0495603_0122714_317_790 152
372 3300046455 Ga0495603_0150794 Ga0495603_0150794_317_790 152
373 3300046457 Ga0495590_0013283 Ga0495590_0013283_978_1451 152
374 3300046457 Ga0495590_0016068 Ga0495590_0016068_1757_2230 152
375 3300046458 Ga0495591_011667 Ga0495591_011667_17_490 152
376 3300046459 Ga0495629_0074581 Ga0495629_0074581_274_747 152
377 3300046460 Ga0495638_0002770 Ga0495638_0002770_11948_12424 152
378 3300046460 Ga0495638_0021376 Ga0495638_0021376_708_1181 152
379 3300046460 Ga0495638_0070609 Ga0495638_0070609_1127_1600 152
380 3300046460 Ga0495638_0463791 Ga0495638_0463791_101_610 152
381 3300046463 Ga0495653_0047143 Ga0495653_0047143_806_1279 152
382 3300046471 Ga0495650_0020521 Ga0495650_0020521_988_1461 152
383 3300046471 Ga0495650_0143760 Ga0495650_0143760_249_722 152
384 3300046473 Ga0495582_0130159 Ga0495582_0130159_652_1125 152
385 3300046474 Ga0495605_0000399 Ga0495605_0000399_3073_3546 152
386 3300046474 Ga0495605_0000400 Ga0495605_0000400_35518_35991 152
387 3300046474 Ga0495605_0008907 Ga0495605_0008907_1903_2376 152
388 3300046474 Ga0495605_0017334 Ga0495605_0017334_178_651 152
389 3300046474 Ga0495605_0018421 Ga0495605_0018421_2520_2993 152
390 3300046474 Ga0495605_0020374 Ga0495605_0020374_722_1195 152
391 3300046474 Ga0495605_0106367 Ga0495605_0106367_276_749 152
392 3300046474 Ga0495605_0118256 Ga0495605_0118256_110_583 152
393 3300046474 Ga0495605_0151273 Ga0495605_0151273_30_503 152
394 3300046491 Ga0495584_0000004 Ga0495584_0000004_180463_180936 152
395 3300046491 Ga0495584_0000177 Ga0495584_0000177_6005_6478 152
396 3300046491 Ga0495584_0001006 Ga0495584_0001006_15497_15970 152
397 3300046491 Ga0495584_0003403 Ga0495584_0003403_835_1308 152
398 3300046491 Ga0495584_0012304 Ga0495584_0012304_625_1098 152
399 3300046491 Ga0495584_0020894 Ga0495584_0020894_355_828 152
400 3300046491 Ga0495584_0025324 Ga0495584_0025324_883_1356 152
401 3300046491 Ga0495584_0033832 Ga0495584_0033832_388_897 152
402 3300046491 Ga0495584_0068895 Ga0495584_0068895_483_956 152
403 3300046491 Ga0495584_0173052 Ga0495584_0173052_365_838 152
404 3300046491 Ga0495584_0459406 Ga0495584_0459406_74_547 152
405 3300046492 Ga0495585_0000050 Ga0495585_0000050_33294_33767 152
406 3300046492 Ga0495585_0000624 Ga0495585_0000624_29020_29529 152
407 3300046492 Ga0495585_0004780 Ga0495585_0004780_6459_6932 152
408 3300046492 Ga0495585_0006144 Ga0495585_0006144_1201_1674 152
409 3300046492 Ga0495585_0014189 Ga0495585_0014189_3970_4443 152
410 3300046492 Ga0495585_0018506 Ga0495585_0018506_2321_2800 152
411 3300046492 Ga0495585_0020150 Ga0495585_0020150_1718_2191 152
412 3300046492 Ga0495585_0038005 Ga0495585_0038005_1873_2349 152
413 3300046492 Ga0495585_0043901 Ga0495585_0043901_444_917 152
414 3300046492 Ga0495585_0060112 Ga0495585_0060112_1007_1480 152
415 3300046492 Ga0495585_0072443 Ga0495585_0072443_925_1398 152
416 3300046492 Ga0495585_0146814 Ga0495585_0146814_612_1082 152
417 3300046492 Ga0495585_0370525 Ga0495585_0370525_119_592 152
418 3300046492 Ga0495585_0392083 Ga0495585_0392083_151_624 152
419 3300046499 Ga0495594_0026192 Ga0495594_0026192_1167_1640 152
420 3300046499 Ga0495594_0318787 Ga0495594_0318787_348_821 152
421 3300046500 Ga0495596_0000606 Ga0495596_0000606_6275_6748 152
422 3300046500 Ga0495596_0001967 Ga0495596_0001967_260_733 152
423 3300046500 Ga0495596_0003014 Ga0495596_0003014_6605_7078 152
424 3300046500 Ga0495596_0018074 Ga0495596_0018074_521_994 152
425 3300046500 Ga0495596_0022029 Ga0495596_0022029_1888_2361 152
426 3300046500 Ga0495596_0026272 Ga0495596_0026272_95_568 152
427 3300046500 Ga0495596_0052844 Ga0495596_0052844_748_1221 152
428 3300046500 Ga0495596_0067195 Ga0495596_0067195_674_1147 152
429 3300046500 Ga0495596_0079696 Ga0495596_0079696_207_680 152
430 3300046500 Ga0495596_0152515 Ga0495596_0152515_114_587 152
431 3300046500 Ga0495596_0277094 Ga0495596_0277094_29_502 152
432 3300046501 Ga0495607_0000638 Ga0495607_0000638_1743_2216 152
433 3300046501 Ga0495607_0003256 Ga0495607_0003256_3693_4166 152
434 3300046501 Ga0495607_0008425 Ga0495607_0008425_206_679 152
435 3300046501 Ga0495607_0016300 Ga0495607_0016300_1036_1509 152
436 3300046501 Ga0495607_0047826 Ga0495607_0047826_38_514 152
437 3300046501 Ga0495607_0055945 Ga0495607_0055945_1095_1568 152
438 3300046501 Ga0495607_0056187 Ga0495607_0056187_747_1220 152
439 3300046501 Ga0495607_0144237 Ga0495607_0144237_686_1159 152
440 3300046506 Ga0495583_0000862 Ga0495583_0000862_766_1245 152
441 3300046506 Ga0495583_0000926 Ga0495583_0000926_33231_33704 152
442 3300046506 Ga0495583_0001605 Ga0495583_0001605_1005_1478 152
443 3300046506 Ga0495583_0001771 Ga0495583_0001771_18454_18924 152
444 3300046506 Ga0495583_0002720 Ga0495583_0002720_4642_5115 152
445 3300046506 Ga0495583_0010647 Ga0495583_0010647_3631_4104 152
446 3300046506 Ga0495583_0025456 Ga0495583_0025456_1190_1663 152
447 3300046506 Ga0495583_0048406 Ga0495583_0048406_1117_1590 152
448 3300046506 Ga0495583_0050073 Ga0495583_0050073_666_1139 152
449 3300046506 Ga0495583_0143188 Ga0495583_0143188_74_547 152
450 3300046507 Ga0495606_0000201 Ga0495606_0000201_53795_54268 152
451 3300046507 Ga0495606_0018476 Ga0495606_0018476_458_931 152
452 3300046507 Ga0495606_0019789 Ga0495606_0019789_2564_3037 152
453 3300046507 Ga0495606_0045476 Ga0495606_0045476_1265_1741 152
454 3300046507 Ga0495606_0080067 Ga0495606_0080067_981_1454 152
455 3300046507 Ga0495606_0259313 Ga0495606_0259313_271_744 152
456 3300046513 Ga0495616_0000092 Ga0495616_0000092_72270_72743 152
457 3300046513 Ga0495616_0000313 Ga0495616_0000313_35856_36326 152
458 3300046513 Ga0495616_0000349 Ga0495616_0000349_27838_28311 152
459 3300046513 Ga0495616_0003361 Ga0495616_0003361_4049_4522 152
460 3300046513 Ga0495616_0008094 Ga0495616_0008094_130_603 152
461 3300046513 Ga0495616_0017601 Ga0495616_0017601_2401_2874 152
462 3300046513 Ga0495616_0020341 Ga0495616_0020341_478_951 152
463 3300046513 Ga0495616_0023487 Ga0495616_0023487_421_894 152
464 3300046513 Ga0495616_0027599 Ga0495616_0027599_2091_2564 152
465 3300046513 Ga0495616_0037584 Ga0495616_0037584_957_1430 152
466 3300046513 Ga0495616_0071349 Ga0495616_0071349_228_704 152
467 3300046513 Ga0495616_0086101 Ga0495616_0086101_511_984 152
468 3300046513 Ga0495616_0125879 Ga0495616_0125879_238_711 152
469 3300046513 Ga0495616_0233464 Ga0495616_0233464_217_690 152
470 3300046513 Ga0495616_0248290 Ga0495616_0248290_114_587 152
471 3300046515 Ga0495620_0037229 Ga0495620_0037229_775_1248 152
472 3300046515 Ga0495620_0057513 Ga0495620_0057513_469_942 152
473 3300046518 Ga0495631_0000261 Ga0495631_0000261_32614_33087 152
474 3300046518 Ga0495631_0008223 Ga0495631_0008223_2369_2842 152
475 3300046518 Ga0495631_0009478 Ga0495631_0009478_869_1342 152
476 3300046518 Ga0495631_0020737 Ga0495631_0020737_1631_2104 152
477 3300046518 Ga0495631_0034179 Ga0495631_0034179_219_692 152
478 3300046518 Ga0495631_0035539 Ga0495631_0035539_434_907 152
479 3300046518 Ga0495631_0040683 Ga0495631_0040683_1361_1834 152
480 3300046518 Ga0495631_0044016 Ga0495631_0044016_562_1035 152
481 3300046518 Ga0495631_0046183 Ga0495631_0046183_759_1232 152
482 3300046518 Ga0495631_0054985 Ga0495631_0054985_204_713 152
483 3300046519 Ga0495632_0000447 Ga0495632_0000447_662_1135 152
484 3300046519 Ga0495632_0000523 Ga0495632_0000523_2449_2922 152
485 3300046519 Ga0495632_0000632 Ga0495632_0000632_1069_1542 152
486 3300046519 Ga0495632_0020996 Ga0495632_0020996_2291_2764 152
487 3300046519 Ga0495632_0057086 Ga0495632_0057086_706_1179 152
488 3300046519 Ga0495632_0058304 Ga0495632_0058304_734_1228 152
489 3300046519 Ga0495632_0319397 Ga0495632_0319397_84_557 152
490 3300046519 Ga0495632_0320837 Ga0495632_0320837_91_564 152
491 3300046520 Ga0495637_0041303 Ga0495637_0041303_1124_1597 152
492 3300046520 Ga0495637_0101438 Ga0495637_0101438_208_723 152
493 3300046520 Ga0495637_0127036 Ga0495637_0127036_156_671 152
494 3300046522 Ga0495643_0000235 Ga0495643_0000235_27122_27592 152
495 3300046522 Ga0495643_0000827 Ga0495643_0000827_88_561 152
496 3300046522 Ga0495643_0000871 Ga0495643_0000871_29556_30029 152
497 3300046522 Ga0495643_0020883 Ga0495643_0020883_194_667 152
498 3300046522 Ga0495643_0078284 Ga0495643_0078284_565_1038 152
499 3300046522 Ga0495643_0108145 Ga0495643_0108145_161_634 152
500 3300046522 Ga0495643_0121216 Ga0495643_0121216_21_494 152
501 3300046522 Ga0495643_0194102 Ga0495643_0194102_233_706 152
502 3300046522 Ga0495643_0258188 Ga0495643_0258188_258_737 152
503 3300046522 Ga0495643_0275168 Ga0495643_0275168_126_599 152
504 3300046523 Ga0495644_0000986 Ga0495644_0000986_10954_11427 152
505 3300046523 Ga0495644_0012447 Ga0495644_0012447_907_1380 152
506 3300046523 Ga0495644_0024528 Ga0495644_0024528_1750_2223 152
507 3300046523 Ga0495644_0027101 Ga0495644_0027101_1158_1667 152
508 3300046523 Ga0495644_0091661 Ga0495644_0091661_86_559 152
509 3300046523 Ga0495644_0095930 Ga0495644_0095930_505_978 152
510 3300046523 Ga0495644_0104572 Ga0495644_0104572_185_664 152
511 3300046523 Ga0495644_0121304 Ga0495644_0121304_88_561 152
512 3300046523 Ga0495644_0132431 Ga0495644_0132431_421_897 152
513 3300046523 Ga0495644_0324144 Ga0495644_0324144_76_549 152
514 3300046524 Ga0495648_0000451 Ga0495648_0000451_36382_36855 152
515 3300046524 Ga0495648_0000716 Ga0495648_0000716_3786_4259 152
516 3300046524 Ga0495648_0009701 Ga0495648_0009701_1089_1562 152
517 3300046524 Ga0495648_0015684 Ga0495648_0015684_4207_4680 152
518 3300046524 Ga0495648_0019629 Ga0495648_0019629_3725_4198 152
519 3300046524 Ga0495648_0019659 Ga0495648_0019659_1756_2229 152
520 3300046524 Ga0495648_0040229 Ga0495648_0040229_1757_2230 152
521 3300046524 Ga0495648_0142603 Ga0495648_0142603_95_568 152
522 3300046524 Ga0495648_0309641 Ga0495648_0309641_164_625 152
523 3300046525 Ga0495663_0010651 Ga0495663_0010651_1988_2497 152
524 3300046525 Ga0495663_0028856 Ga0495663_0028856_653_1132 152
525 3300046526 Ga0495666_0006421 Ga0495666_0006421_5388_5861 152
526 3300046528 Ga0495642_0000197 Ga0495642_0000197_31180_31653 152
527 3300046528 Ga0495642_0007624 Ga0495642_0007624_2773_3252 152
528 3300046528 Ga0495642_0012535 Ga0495642_0012535_844_1317 152
529 3300046528 Ga0495642_0017075 Ga0495642_0017075_351_824 152
530 3300046528 Ga0495642_0017615 Ga0495642_0017615_1177_1653 152
531 3300046528 Ga0495642_0019749 Ga0495642_0019749_439_912 152
532 3300046528 Ga0495642_0025094 Ga0495642_0025094_1324_1833 152
533 3300046528 Ga0495642_0089378 Ga0495642_0089378_74_547 152
534 3300046528 Ga0495642_0129083 Ga0495642_0129083_178_651 152
535 3300046528 Ga0495642_0192695 Ga0495642_0192695_25_498 152
536 3300046530 Ga0495654_0002707 Ga0495654_0002707_1030_1503 152
537 3300046530 Ga0495654_0017559 Ga0495654_0017559_1574_2047 152
538 3300046530 Ga0495654_0018742 Ga0495654_0018742_377_850 152
539 3300046530 Ga0495654_0065573 Ga0495654_0065573_951_1424 152
540 3300046530 Ga0495654_0134268 Ga0495654_0134268_507_974 152
541 3300046530 Ga0495654_0225601 Ga0495654_0225601_59_574 152
542 3300046533 Ga0495640_0052185 Ga0495640_0052185_189_662 152
543 3300046533 Ga0495640_0239659 Ga0495640_0239659_277_750 152
544 3300046535 Ga0495586_0017239 Ga0495586_0017239_1574_2047 152
545 3300046538 Ga0495609_0000117 Ga0495609_0000117_45013_45486 152
546 3300046538 Ga0495609_0002244 Ga0495609_0002244_11351_11824 152
547 3300046538 Ga0495609_0006373 Ga0495609_0006373_3193_3669 152
548 3300046538 Ga0495609_0006764 Ga0495609_0006764_1781_2254 152
549 3300046538 Ga0495609_0041431 Ga0495609_0041431_1226_1699 152
550 3300046538 Ga0495609_0049554 Ga0495609_0049554_664_1137 152
551 3300046538 Ga0495609_0067780 Ga0495609_0067780_648_1121 152
552 3300046538 Ga0495609_0120868 Ga0495609_0120868_100_573 152
553 3300046538 Ga0495609_0122424 Ga0495609_0122424_194_673 152
554 3300046538 Ga0495609_0132448 Ga0495609_0132448_178_651 152
555 3300046542 Ga0495597_0000247 Ga0495597_0000247_18182_18655 152
556 3300046542 Ga0495597_0032022 Ga0495597_0032022_705_1214 152
557 3300046542 Ga0495597_0053433 Ga0495597_0053433_485_952 152
558 3300046542 Ga0495597_0054148 Ga0495597_0054148_30_503 152
559 3300046542 Ga0495597_0061364 Ga0495597_0061364_335_811 152
560 3300046542 Ga0495597_0096799 Ga0495597_0096799_513_986 152
561 3300046542 Ga0495597_0123705 Ga0495597_0123705_263_736 152
562 3300046542 Ga0495597_0125439 Ga0495597_0125439_347_820 152
563 3300046542 Ga0495597_0135742 Ga0495597_0135742_505_978 152
564 3300046542 Ga0495597_0219060 Ga0495597_0219060_131_646 152
565 3300046543 Ga0495645_0303555 Ga0495645_0303555_344_817 152
566 3300046557 Ga0495622_0037077 Ga0495622_0037077_51_524 152
567 3300046557 Ga0495622_0050355 Ga0495622_0050355_963_1436 152
568 3300046558 Ga0495633_0011259 Ga0495633_0011259_790_1263 152
569 3300046558 Ga0495633_0016567 Ga0495633_0016567_2719_3192 152
570 3300046558 Ga0495633_0023451 Ga0495633_0023451_669_1142 152
571 3300046558 Ga0495633_0024724 Ga0495633_0024724_1259_1768 152
572 3300046558 Ga0495633_0056896 Ga0495633_0056896_541_1020 152
573 3300046558 Ga0495633_0068647 Ga0495633_0068647_600_1073 152
574 3300046558 Ga0495633_0103316 Ga0495633_0103316_224_697 152
575 3300046558 Ga0495633_0111865 Ga0495633_0111865_591_1064 152
576 3300046558 Ga0495633_0129086 Ga0495633_0129086_262_738 152
577 3300046558 Ga0495633_0385164 Ga0495633_0385164_110_583 152
578 3300046558 Ga0495633_0403986 Ga0495633_0403986_14_487 152
579 3300046615 Ga0495656_0014757 Ga0495656_0014757_2243_2716 152
580 3300046615 Ga0495656_0052263 Ga0495656_0052263_1039_1548 152
581 3300046615 Ga0495656_0295007 Ga0495656_0295007_54_524 152
582 3300046616 Ga0495668_0000398 Ga0495668_0000398_25217_25690 152
583 3300046616 Ga0495668_0000496 Ga0495668_0000496_16542_17015 152
584 3300046616 Ga0495668_0001559 Ga0495668_0001559_19958_20431 152
585 3300046616 Ga0495668_0007882 Ga0495668_0007882_2627_3100 152
586 3300046616 Ga0495668_0018125 Ga0495668_0018125_2359_2832 152
587 3300046616 Ga0495668_0037166 Ga0495668_0037166_1659_2132 152
588 3300046616 Ga0495668_0041724 Ga0495668_0041724_771_1244 152
589 3300046616 Ga0495668_0053645 Ga0495668_0053645_591_1100 152
590 3300046616 Ga0495668_0079045 Ga0495668_0079045_1116_1589 152
591 3300046616 Ga0495668_0081023 Ga0495668_0081023_67_540 152
592 3300046616 Ga0495668_0083277 Ga0495668_0083277_423_899 152
593 3300046616 Ga0495668_0243583 Ga0495668_0243583_43_516 152
594 3300046616 Ga0495668_0266701 Ga0495668_0266701_313_786 152
595 3300046616 Ga0495668_0482556 Ga0495668_0482556_194_661 152
596 3300046642 Ga0495634_0704683 Ga0495634_0704683_88_561 152
597 3300046648 Ga0495611_0001606 Ga0495611_0001606_3956_4429 152
598 3300046648 Ga0495611_0031448 Ga0495611_0031448_1346_1819 152
599 3300046648 Ga0495611_0049201 Ga0495611_0049201_735_1208 152
600 3300046648 Ga0495611_0083225 Ga0495611_0083225_97_570 152
601 3300046648 Ga0495611_0214885 Ga0495611_0214885_210_683 152
602 3300046660 Ga0495625_0004198 Ga0495625_0004198_10375_10848 152
603 3300046660 Ga0495625_0134800 Ga0495625_0134800_439_912 152
604 3300046660 Ga0495625_0160737 Ga0495625_0160737_680_1147 152
605 3300046660 Ga0495625_0535161 Ga0495625_0535161_141_617 152
606 3300046663 Ga0495635_0016821 Ga0495635_0016821_3722_4195 152
607 3300046663 Ga0495635_0210206 Ga0495635_0210206_85_558 152
608 3300046664 Ga0495659_0000093 Ga0495659_0000093_1031_1498 152
609 3300046664 Ga0495659_0032037 Ga0495659_0032037_1063_1542 152
610 3300046665 Ga0495661_0000454 Ga0495661_0000454_32957_33430 152
611 3300046665 Ga0495661_0000650 Ga0495661_0000650_1741_2214 152
612 3300046665 Ga0495661_0001854 Ga0495661_0001854_155_649 152
613 3300046665 Ga0495661_0004436 Ga0495661_0004436_1051_1524 152
614 3300046665 Ga0495661_0006398 Ga0495661_0006398_3359_3832 152
615 3300046665 Ga0495661_0011498 Ga0495661_0011498_5155_5628 152
616 3300046665 Ga0495661_0017051 Ga0495661_0017051_3620_4093 152
617 3300046665 Ga0495661_0038123 Ga0495661_0038123_860_1333 152
618 3300046665 Ga0495661_0045335 Ga0495661_0045335_1136_1609 152
619 3300046665 Ga0495661_0049360 Ga0495661_0049360_86_562 152
620 3300046665 Ga0495661_0058061 Ga0495661_0058061_1190_1663 152
621 3300046665 Ga0495661_0059025 Ga0495661_0059025_1732_2202 152
622 3300046665 Ga0495661_0079140 Ga0495661_0079140_1189_1662 152
623 3300046665 Ga0495661_0148743 Ga0495661_0148743_54_524 152
624 3300046665 Ga0495661_0186521 Ga0495661_0186521_495_968 152
625 3300046665 Ga0495661_0195876 Ga0495661_0195876_304_822 152
626 3300046665 Ga0495661_0218479 Ga0495661_0218479_116_589 152
627 3300046665 Ga0495661_0288577 Ga0495661_0288577_129_602 152
628 3300046665 Ga0495661_0395692 Ga0495661_0395692_174_647 152
629 3300046665 Ga0495661_0520359 Ga0495661_0520359_64_540 152
630 3300046674 Ga0495588_0000094 Ga0495588_0000094_142454_142927 152
631 3300046674 Ga0495588_0016064 Ga0495588_0016064_2091_2564 152
632 3300046674 Ga0495588_0053901 Ga0495588_0053901_851_1324 152
633 3300046674 Ga0495588_0071924 Ga0495588_0071924_395_868 152
634 3300046674 Ga0495588_0076595 Ga0495588_0076595_338_811 152
635 3300046674 Ga0495588_0106729 Ga0495588_0106729_832_1305 152
636 3300046674 Ga0495588_0163180 Ga0495588_0163180_491_964 152
637 3300046674 Ga0495588_0230400 Ga0495588_0230400_421_894 152
638 3300046679 Ga0495623_0097257 Ga0495623_0097257_703_1218 152
639 3300046684 Ga0495669_0000015 Ga0495669_0000015_33631_34104 152
640 3300046684 Ga0495669_0001098 Ga0495669_0001098_10134_10607 152
641 3300046684 Ga0495669_0007277 Ga0495669_0007277_436_909 152
642 3300046684 Ga0495669_0028184 Ga0495669_0028184_1285_1758 152
643 3300046684 Ga0495669_0099226 Ga0495669_0099226_365_838 152
644 3300046684 Ga0495669_0133312 Ga0495669_0133312_510_983 152
645 3300046689 Ga0495613_0236089 Ga0495613_0236089_432_905 152
646 3300046691 Ga0495670_0000314 Ga0495670_0000314_20180_20653 152
647 3300046691 Ga0495670_0008998 Ga0495670_0008998_4143_4652 152
648 3300046691 Ga0495670_0014316 Ga0495670_0014316_1753_2226 152
649 3300046691 Ga0495670_0037183 Ga0495670_0037183_1053_1526 152
650 3300046691 Ga0495670_0062801 Ga0495670_0062801_841_1314 152
651 3300046691 Ga0495670_0075984 Ga0495670_0075984_846_1319 152
652 3300046691 Ga0495670_0120529 Ga0495670_0120529_393_866 152
653 3300046691 Ga0495670_0221512 Ga0495670_0221512_427_945 152
654 3300046692 Ga0495671_0000301 Ga0495671_0000301_20051_20524 152
655 3300046692 Ga0495671_0000407 Ga0495671_0000407_2602_3069 152
656 3300046692 Ga0495671_0003196 Ga0495671_0003196_3574_4053 152
657 3300046692 Ga0495671_0024721 Ga0495671_0024721_1787_2260 152
658 3300046692 Ga0495671_0027174 Ga0495671_0027174_261_734 152
659 3300046692 Ga0495671_0029764 Ga0495671_0029764_2297_2770 152
660 3300046694 Ga0495649_0000268 Ga0495649_0000268_30096_30569 152
661 3300046694 Ga0495649_0001236 Ga0495649_0001236_18785_19258 152
662 3300046694 Ga0495649_0028314 Ga0495649_0028314_1429_1902 152
663 3300046694 Ga0495649_0029827 Ga0495649_0029827_842_1321 152
664 3300046694 Ga0495649_0041174 Ga0495649_0041174_1841_2314 152
665 3300046694 Ga0495649_0091730 Ga0495649_0091730_1042_1515 152
666 3300046794 Ga0495589_0000096 Ga0495589_0000096_46662_47135 152
667 3300046794 Ga0495589_0000351 Ga0495589_0000351_33451_33924 152
668 3300046794 Ga0495589_0000994 Ga0495589_0000994_13035_13508 152
669 3300046794 Ga0495589_0023862 Ga0495589_0023862_1767_2240 152
670 3300046794 Ga0495589_0031852 Ga0495589_0031852_1174_1683 152
671 3300046794 Ga0495589_0045477 Ga0495589_0045477_318_791 152
672 3300046794 Ga0495589_0130267 Ga0495589_0130267_699_1172 152
673 3300046794 Ga0495589_0248463 Ga0495589_0248463_169_645 152
674 3300046810 Ga0495660_0016503 Ga0495660_0016503_213_674 152
675 3300046810 Ga0495660_0020360 Ga0495660_0020360_2312_2785 152
676 3300046810 Ga0495660_0022525 Ga0495660_0022525_1965_2432 152
677 3300046810 Ga0495660_0024239 Ga0495660_0024239_794_1267 152
678 3300046810 Ga0495660_0047107 Ga0495660_0047107_1686_2159 152
679 3300046810 Ga0495660_0101078 Ga0495660_0101078_276_749 152
680 3300046810 Ga0495660_0141335 Ga0495660_0141335_451_924 152
681 3300046810 Ga0495660_0221696 Ga0495660_0221696_15_524 152
682 3300046810 Ga0495660_0247933 Ga0495660_0247933_272_745 152
683 3300047315 Ga0495581_0086607 Ga0495581_0086607_215_688 152
684 3300047317 Ga0495604_0013961 Ga0495604_0013961_3677_4150 152
685 3300047318 Ga0495636_0000919 Ga0495636_0000919_8020_8493 152
686 3300047318 Ga0495636_0218629 Ga0495636_0218629_276_749 152
687 3300047320 Ga0495672_0000026 Ga0495672_0000026_187854_188321 152
688 3300047320 Ga0495672_0000376 Ga0495672_0000376_49194_49667 152
689 3300047320 Ga0495672_0000391 Ga0495672_0000391_24418_24891 152
690 3300047320 Ga0495672_0005133 Ga0495672_0005133_7581_8054 152
691 3300047320 Ga0495672_0023707 Ga0495672_0023707_798_1271 152
692 3300047320 Ga0495672_0116035 Ga0495672_0116035_838_1311 152
693 3300047321 Ga0495676_0000281 Ga0495676_0000281_6983_7456 152
694 3300047323 Ga0495683_0000061 Ga0495683_0000061_107415_107888 152
695 3300047323 Ga0495683_0010017 Ga0495683_0010017_3573_4046 152
696 3300047323 Ga0495683_0016660 Ga0495683_0016660_2382_2858 152
697 3300047323 Ga0495683_0025705 Ga0495683_0025705_224_697 152
698 3300047323 Ga0495683_0048091 Ga0495683_0048091_199_672 152
699 3300047323 Ga0495683_0111498 Ga0495683_0111498_655_1128 152
700 3300047323 Ga0495683_0125284 Ga0495683_0125284_631_1104 152
701 3300047323 Ga0495683_0133357 Ga0495683_0133357_652_1125 152
702 3300047443 Ga0495687_000110 Ga0495687_000110_31454_31927 152
703 3300047443 Ga0495687_000117 Ga0495687_000117_100415_100888 152
704 3300047443 Ga0495687_000203 Ga0495687_000203_37640_38113 152
705 3300047443 Ga0495687_000522 Ga0495687_000522_699_1172 152
706 3300047443 Ga0495687_000772 Ga0495687_000772_1105_1578 152
707 3300047443 Ga0495687_009685 Ga0495687_009685_840_1313 152
708 3300047443 Ga0495687_121503 Ga0495687_121503_251_724 152
709 3300047443 Ga0495687_141689 Ga0495687_141689_187_660 152
710 3300047443 Ga0495687_175752 Ga0495687_175752_132_605 152
711 3300047444 Ga0495675_0046141 Ga0495675_0046141_541_1014 152
712 3300047445 Ga0495677_0000036 Ga0495677_0000036_46521_46994 152
713 3300047445 Ga0495677_0001259 Ga0495677_0001259_8898_9371 152
714 3300047445 Ga0495677_0006702 Ga0495677_0006702_3096_3605 152
715 3300047445 Ga0495677_0018995 Ga0495677_0018995_1824_2297 152
716 3300047445 Ga0495677_0027277 Ga0495677_0027277_22_495 152
717 3300047445 Ga0495677_0041034 Ga0495677_0041034_424_900 152
718 3300047445 Ga0495677_0047660 Ga0495677_0047660_679_1152 152
719 3300047445 Ga0495677_0080758 Ga0495677_0080758_571_1044 152
720 3300047445 Ga0495677_0106158 Ga0495677_0106158_202_681 152
721 3300047445 Ga0495677_0141452 Ga0495677_0141452_178_651 152
722 3300047445 Ga0495677_0188436 Ga0495677_0188436_39_512 152
723 3300047445 Ga0495677_0235938 Ga0495677_0235938_104_583 152
724 3300047446 Ga0495679_004255 Ga0495679_004255_5139_5612 152
725 3300047446 Ga0495679_006300 Ga0495679_006300_1040_1513 152
726 3300047446 Ga0495679_029236 Ga0495679_029236_870_1343 152
727 3300047446 Ga0495679_036789 Ga0495679_036789_899_1372 152
728 3300047447 Ga0495685_003627 Ga0495685_003627_3647_4120 152
729 3300047447 Ga0495685_021265 Ga0495685_021265_721_1194 152
730 3300047447 Ga0495685_042936 Ga0495685_042936_352_825 152
731 3300047447 Ga0495685_124463 Ga0495685_124463_240_716 152
732 3300047447 Ga0495685_193170 Ga0495685_193170_70_540 152
733 3300047469 Ga0495673_0345550 Ga0495673_0345550_25_498 152
734 3300047470 Ga0495681_0000429 Ga0495681_0000429_29990_30463 152
735 3300047470 Ga0495681_0009302 Ga0495681_0009302_1865_2344 152
736 3300047470 Ga0495681_0019882 Ga0495681_0019882_387_860 152
737 3300047470 Ga0495681_0031941 Ga0495681_0031941_1036_1545 152
738 3300047470 Ga0495681_0039807 Ga0495681_0039807_1653_2126 152
739 3300047470 Ga0495681_0058725 Ga0495681_0058725_644_1117 152
740 3300047470 Ga0495681_0061906 Ga0495681_0061906_457_930 152
741 3300047470 Ga0495681_0070940 Ga0495681_0070940_12_485 152
742 3300047470 Ga0495681_0155398 Ga0495681_0155398_472_945 152
743 3300047472 Ga0495686_0061325 Ga0495686_0061325_590_1069 152
744 3300047673 Ga0495593_0002604 Ga0495593_0002604_10202_10675 152
745 3300048089 Ga0495614_0009594 Ga0495614_0009594_2648_3121 152
746 3300048091 Ga0495626_0000248 Ga0495626_0000248_36525_36998 152
747 3300048091 Ga0495626_0001446 Ga0495626_0001446_9046_9519 152
748 3300048091 Ga0495626_0002372 Ga0495626_0002372_8829_9344 152
749 3300048091 Ga0495626_0004585 Ga0495626_0004585_1361_1834 152
750 3300048091 Ga0495626_0005118 Ga0495626_0005118_2905_3378 152
751 3300048091 Ga0495626_0006270 Ga0495626_0006270_5988_6461 152
752 3300048091 Ga0495626_0017566 Ga0495626_0017566_2816_3289 152
753 3300048091 Ga0495626_0027387 Ga0495626_0027387_1567_2040 152
754 3300048091 Ga0495626_0046796 Ga0495626_0046796_756_1232 152
755 3300048091 Ga0495626_0056788 Ga0495626_0056788_403_876 152
756 3300048091 Ga0495626_0085523 Ga0495626_0085523_313_786 152
757 3300048091 Ga0495626_0110556 Ga0495626_0110556_348_821 152
758 3300048091 Ga0495626_0114896 Ga0495626_0114896_445_918 152
759 3300048091 Ga0495626_0115021 Ga0495626_0115021_182_655 152
760 3300048091 Ga0495626_0115540 Ga0495626_0115540_320_793 152
761 3300048091 Ga0495626_0135356 Ga0495626_0135356_488_961 152
762 3300048091 Ga0495626_0140406 Ga0495626_0140406_537_1010 152
763 3300048903 Ga0496100_0714392 Ga0496100_0714392_272_745 152
764 3300048903 Ga0496100_1215346 Ga0496100_1215346_83_556 152
765 3300048904 Ga0496101_0021234 Ga0496101_0021234_749_1222 152
766 3300048905 Ga0496102_0008289 Ga0496102_0008289_1760_2233 152
767 3300048905 Ga0496102_0054742 Ga0496102_0054742_805_1278 152
768 3300048905 Ga0496102_0150931 Ga0496102_0150931_631_1104 152
769 3300048905 Ga0496102_0631732 Ga0496102_0631732_49_522 152
770 3300048906 Ga0496103_0033458 Ga0496103_0033458_2095_2568 152
771 3300048906 Ga0496103_0057760 Ga0496103_0057760_1896_2369 152
772 3300048908 Ga0496105_0569837 Ga0496105_0569837_29_502 152
773 3300048908 Ga0496105_1165559 Ga0496105_1165559_89_553 152
774 3300048909 Ga0496106_0029179 Ga0496106_0029179_771_1244 152
775 3300048910 Ga0496107_0226753 Ga0496107_0226753_715_1188 152
776 3300048910 Ga0496107_0967220 Ga0496107_0967220_110_583 152
777 3300048912 Ga0496109_0034046 Ga0496109_0034046_479_952 152
778 3300048912 Ga0496109_1382763 Ga0496109_1382763_42_515 152
779 3300048913 Ga0496110_0024137 Ga0496110_0024137_342_815 152
780 3300048913 Ga0496110_0046293 Ga0496110_0046293_535_1008 152
781 3300048913 Ga0496110_0908218 Ga0496110_0908218_174_647 152
782 3300048916 Ga0496113_0023269 Ga0496113_0023269_49_522 152
783 3300048916 Ga0496113_0539660 Ga0496113_0539660_355_828 152
784 3300048918 Ga0496115_0090683 Ga0496115_0090683_1690_2160 152
785 3300048918 Ga0496115_0846957 Ga0496115_0846957_235_696 152
786 3300048919 Ga0496116_0005927 Ga0496116_0005927_9697_10185 152
787 3300048919 Ga0496116_0126546 Ga0496116_0126546_230_718 152
788 3300048920 Ga0496117_0139491 Ga0496117_0139491_169_657 152
789 3300048920 Ga0496117_0179810 Ga0496117_0179810_651_1139 152
790 3300048920 Ga0496117_0450837 Ga0496117_0450837_135_623 152
791 3300048922 Ga0496119_0024995 Ga0496119_0024995_3544_4032 152
792 3300048923 Ga0496120_0145180 Ga0496120_0145180_10_498 152
793 3300048924 Ga0496121_0000444 Ga0496121_0000444_59058_59546 152
794 3300048924 Ga0496121_0009535 Ga0496121_0009535_5509_5988 152
795 3300048924 Ga0496121_0200202 Ga0496121_0200202_449_922 152
796 3300048925 Ga0496122_0000232 Ga0496122_0000232_109694_110182 152
797 3300048925 Ga0496122_0000483 Ga0496122_0000483_34050_34523 152
798 3300048925 Ga0496122_0007785 Ga0496122_0007785_10526_10999 152
799 3300048925 Ga0496122_0102463 Ga0496122_0102463_183_671 152
800 3300048925 Ga0496122_0344466 Ga0496122_0344466_236_724 152
801 3300048926 Ga0496123_0000194 Ga0496123_0000194_18359_18847 152
802 3300048926 Ga0496123_0000904 Ga0496123_0000904_35969_36442 152
803 3300048926 Ga0496123_0032504 Ga0496123_0032504_2510_2983 152
804 3300048926 Ga0496123_0053931 Ga0496123_0053931_544_1017 152
805 3300048926 Ga0496123_0257506 Ga0496123_0257506_169_642 152
806 3300048927 Ga0496124_0000013 Ga0496124_0000013_397172_397666 152
807 3300048927 Ga0496124_0016891 Ga0496124_0016891_5512_5985 152
808 3300048927 Ga0496124_0047118 Ga0496124_0047118_1685_2158 152
809 3300048927 Ga0496124_0052033 Ga0496124_0052033_1818_2306 152
810 3300048927 Ga0496124_0097148 Ga0496124_0097148_1663_2136 152
811 3300048927 Ga0496124_0134627 Ga0496124_0134627_67_540 152
812 3300048927 Ga0496124_0180582 Ga0496124_0180582_907_1395 152
813 3300048927 Ga0496124_0202292 Ga0496124_0202292_806_1279 152
814 3300048928 Ga0496125_0000051 Ga0496125_0000051_114247_114735 152
815 3300048928 Ga0496125_0003465 Ga0496125_0003465_1238_1711 152
816 3300048928 Ga0496125_0015724 Ga0496125_0015724_5816_6304 152
817 3300048928 Ga0496125_0038720 Ga0496125_0038720_697_1185 152
818 3300048928 Ga0496125_0106503 Ga0496125_0106503_293_766 152
819 3300048929 Ga0496126_0025984 Ga0496126_0025984_1089_1577 152
820 3300048929 Ga0496126_0115238 Ga0496126_0115238_14_502 152
821 3300049459 Ga0495678_000227 Ga0495678_000227_32512_32985 152
822 3300049459 Ga0495678_001769 Ga0495678_001769_13635_14108 152
823 3300049459 Ga0495678_010629 Ga0495678_010629_1339_1812 152
824 3300049459 Ga0495678_018448 Ga0495678_018448_768_1241 152
825 3300049459 Ga0495678_104071 Ga0495678_104071_214_687 152
826 3300049459 Ga0495678_135087 Ga0495678_135087_257_730 152
827 3300049460 Ga0495682_0000286 Ga0495682_0000286_38031_38504 152
828 3300049460 Ga0495682_0008933 Ga0495682_0008933_1025_1501 152
829 3300049460 Ga0495682_0041954 Ga0495682_0041954_379_852 152
830 3300049460 Ga0495682_0112128 Ga0495682_0112128_447_920 152
831 3300049524 Ga0501301_003617 Ga0501301_003617_337_804 152
832 3300049572 Ga0501036_0337557 Ga0501036_0337557_513_986 152
833 3300049654 Ga0501207_060443 Ga0501207_060443_165_632 152
834 3300049658 Ga0501211_003298 Ga0501211_003298_550_1008 152
835 3300049659 Ga0501214_002716 Ga0501214_002716_284_742 152
836 3300049662 Ga0501222_004483 Ga0501222_004483_344_802 152
837 3300049665 Ga0501227_009878 Ga0501227_009878_924_1382 152
838 3300049665 Ga0501227_110127 Ga0501227_110127_248_706 152
839 3300049673 Ga0501240_015555 Ga0501240_015555_584_1051 152
840 3300049678 Ga0501248_042668 Ga0501248_042668_49_516 152
841 3300049760 Ga0501263_002382 Ga0501263_002382_846_1304 152
842 3300049775 Ga0501279_000214 Ga0501279_000214_649_1107 152
843 3300049775 Ga0501279_002528 Ga0501279_002528_1281_1739 152
844 3300049775 Ga0501279_009397 Ga0501279_009397_644_1111 152
845 3300049822 Ga0501035_0006115 Ga0501035_0006115_3428_3901 152
846 3300049822 Ga0501035_0024919 Ga0501035_0024919_4431_4916 152
847 3300049822 Ga0501035_1466863 Ga0501035_1466863_20_505 152
848 3300049823 Ga0501044_0001216 Ga0501044_0001216_27013_27498 152
849 3300049823 Ga0501044_1143230 Ga0501044_1143230_155_628 152
850 3300049853 Ga0501226_026593 Ga0501226_026593_58_516 152
851 3300050491 nmdc:mga00v17_128193_c1 nmdc:mga00v17_128193_c1_742_1251 152
852 3300053125 Ga0500618_008302 Ga0500618_008302_76_549 152
853 3300053161 Ga0500634_0077778 Ga0500634_0077778_1120_1587 152
854 3300059505 Ga0587083_0080394 Ga0587083_0080394_173_646 152
855 iso_pu_bacteria 2599185292 2599902743 152
856 iso_pu_bacteria 2643221556 2643801900 152
857 iso_pu_bacteria 2643221569 2643861581 152
858 iso_pu_bacteria 2643221594 2643979999 152
859 iso_pu_bacteria 2643221621 2644123653 152
860 iso_pu_bacteria 2643221684 2644474306 152
861 iso_pu_bacteria 2739367655 2739610054 152
862 iso_pu_bacteria 2808606395 2809033082 152
863 iso_pu_bacteria 2855730933 2855732867 152
864 iso_pu_bacteria 2855767633 2855771619 152
865 iso_pu_bacteria 2857537821 2857541621 152
866 iso_pu_bacteria 2857542790 2857543325 152
867 iso_pu_bacteria 2858950400 2858952247 152
868 iso_pu_bacteria 2881412998 2881415660 152
869 iso_pu_bacteria 2941479691 2941482676 152
870 iso_pu_bacteria 8047673197 8047674495 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

16

57

0.99

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

16

63

0.98

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

82

156

0.94

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

17

77

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nyx-assembly1.cif.gz_A crystal structure of rv1404 from mycobacterium tuberculosis 0.9256 2 46
2fxa-assembly3.cif.gz_A structure of the protease production regulatory protein hpr from bacillus subtilis. 0.9199 2 47
5hsm-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis marr family protein rv2887 0.919 3 47
4rgx-assembly1.cif.gz_B-2 crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 3,4-dihydroxy bezoic acid 0.9181 9 47
4kmf-assembly1.cif.gz_A-2 crystal structure of zalpha domain from carassius auratus pkz in complex with z-dna 0.9133 5 47
ID Description Score Start End Superfamily
2cfxF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9752 1 49 1.10.10.10
2p5vF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9727 4 55 1.10.10.10
2p6sE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9724 4 55 1.10.10.10
2cfxE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9724 1 49 1.10.10.10
2p5vE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9724 4 55 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4Z0NS97-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.8274 1 140 GO:0005829
GO:0043200
GO:0043565
AF-A0A0M4CE35-F1-model_v4 HTH asnC-type domain-containing protein 0.8216 1 140 GO:0005829
GO:0043200
GO:0043565
AF-A0A7W9D4X9-F1-model_v4 DNA-binding Lrp family transcriptional regulator 0.8207 3 140 GO:0005829
GO:0006524
GO:0043201
GO:0043565
AF-A0A7W5V8X9-F1-model_v4 DNA-binding Lrp family transcriptional regulator 0.8175 3 140 GO:0005829
GO:0043200
GO:0043565
AF-A0A2A3F290-F1-model_v4 deleted 0.8166 3 140

Feature Viewer

pLDDT pTM Quality
85.04 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map