F484117

General Info

Members Datasets Scaffolds Average Seq Length
869 282 1738 206

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10165459|Ga0157370_101654592
Length 203
Sequence MTMTKTTAAKALKVRTGTVKRDTTETQIALKLVIDGQGVYKVSTGIRFFDHMLELFTRHGGFDLTLKCTGDLDVDQHHTVEDVGIALGEAFDKKGIMRAGYFVMAMDETLAVAAVDLSGRVAYVVDDKVKVRLVGDFQSELLADFFDGFARGAKANVHVKTMYGRSNHHKIEAIFKAFARALRGACSRDERMREMLPSTKGLL

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
137 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
138 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
139 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
147 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
183 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
184 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
196 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
197 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
198 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
202 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
205 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
213 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
214 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
230 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
231 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
238 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
239 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
240 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
241 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
242 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
256 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
270 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
271 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
278 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
279 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
280 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
281 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
282 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 3.11
Rhizosphere 94.02
Stem 0
Stem Tuber 0
Unclassified 4.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10165459 3300013104 Bacteria 2057
2 JGI25165J46597_1013739 3300003214 Bacteria 1109
3 rootH2_10009426 3300003320 Bacteria 39179
4 Ga0065712_10479514 3300005290 Bacteria 664
5 Ga0070658_10000121 3300005327 Bacteria 70439
6 Ga0070658_10021582 3300005327 Bacteria 5160
7 Ga0070658_10071707 3300005327 Bacteria 2837
8 Ga0070658_10112053 3300005327 Bacteria 2261
9 Ga0070658_10196354 3300005327 Bacteria 1702
10 Ga0070658_10205977 3300005327 Bacteria 1661
11 Ga0070658_10272828 3300005327 Unclassified 1439
12 Ga0070676_10067377 3300005328 Bacteria 2140
13 Ga0070683_100002041 3300005329 Bacteria 15901
14 Ga0070683_100028772 3300005329 Bacteria 5025
15 Ga0070683_100060569 3300005329 Bacteria 3518
16 Ga0070683_100062351 3300005329 Bacteria 3467
17 Ga0070683_100221096 3300005329 Bacteria 1800
18 Ga0070683_100285059 3300005329 Bacteria 1571
19 Ga0070670_100079127 3300005331 Bacteria 2825
20 Ga0068869_100095013 3300005334 Bacteria 2248
21 Ga0068869_100247235 3300005334 Bacteria 1423
22 Ga0070666_10055265 3300005335 Bacteria 2680
23 Ga0070666_10070170 3300005335 Bacteria 2383
24 Ga0070682_100242035 3300005337 Bacteria 1295
25 Ga0068868_100000066 3300005338 Bacteria 59945
26 Ga0068868_100065060 3300005338 Bacteria 2896
27 Ga0068868_100081115 3300005338 Bacteria 2600
28 Ga0068868_100488108 3300005338 Bacteria 1077
29 Ga0070660_100008313 3300005339 Bacteria 7255
30 Ga0070660_100155643 3300005339 Bacteria 1839
31 Ga0070660_100232314 3300005339 Unclassified 1501
32 Ga0070660_100637198 3300005339 Unclassified 892
33 Ga0070660_100663456 3300005339 Bacteria 874
34 Ga0070661_100019981 3300005344 Bacteria 4774
35 Ga0070661_100050615 3300005344 Bacteria 3040
36 Ga0070661_100066000 3300005344 Bacteria 2659
37 Ga0070661_100153801 3300005344 Bacteria 1740
38 Ga0070661_100701045 3300005344 Unclassified 825
39 Ga0070668_100695790 3300005347 Bacteria 896
40 Ga0070671_100003123 3300005355 Bacteria 12901
41 Ga0070671_100050619 3300005355 Bacteria 3455
42 Ga0070671_100117926 3300005355 Bacteria 2232
43 Ga0070671_100446435 3300005355 Bacteria 1109
44 Ga0070673_100070243 3300005364 Bacteria 2809
45 Ga0070673_100191444 3300005364 Bacteria 1757
46 Ga0070659_100004580 3300005366 Bacteria 9889
47 Ga0070659_100138892 3300005366 Bacteria 1978
48 Ga0070659_100234782 3300005366 Bacteria 1516
49 Ga0070659_100689205 3300005366 Bacteria 883
50 Ga0070667_100046288 3300005367 Bacteria 3659
51 Ga0070667_100246795 3300005367 Bacteria 1595
52 Ga0070709_10166887 3300005434 Unclassified 1535
53 Ga0070709_10356466 3300005434 Bacteria 1082
54 Ga0070709_10501912 3300005434 Unclassified 922
55 Ga0070714_100002654 3300005435 Bacteria 13178
56 Ga0070714_100091602 3300005435 Bacteria 2664
57 Ga0070714_100105232 3300005435 Unclassified 2491
58 Ga0070714_100116911 3300005435 Bacteria 2368
59 Ga0070714_100154671 3300005435 Bacteria 2069
60 Ga0070714_100161553 3300005435 Bacteria 2027
61 Ga0070714_100188384 3300005435 Bacteria 1881
62 Ga0070714_100200420 3300005435 Bacteria 1825
63 Ga0070713_100003005 3300005436 Bacteria 11079
64 Ga0070713_100023543 3300005436 Bacteria 4780
65 Ga0070713_100082409 3300005436 Bacteria 2747
66 Ga0070713_100162511 3300005436 Bacteria 1994
67 Ga0070713_100196366 3300005436 Bacteria 1820
68 Ga0070713_100257582 3300005436 Bacteria 1593
69 Ga0070713_100433308 3300005436 Bacteria 1232
70 Ga0070713_100631919 3300005436 Unclassified 1019
71 Ga0070713_101077027 3300005436 Bacteria 776
72 Ga0070710_10032530 3300005437 Bacteria 2826
73 Ga0070710_10192885 3300005437 Bacteria 1282
74 Ga0070710_10266048 3300005437 Bacteria 1107
75 Ga0070711_100019179 3300005439 Bacteria 4384
76 Ga0070711_100022563 3300005439 Bacteria 4081
77 Ga0070711_100775332 3300005439 Bacteria 812
78 Ga0070663_100053467 3300005455 Bacteria 2883
79 Ga0070663_100130863 3300005455 Bacteria 1905
80 Ga0070663_100182632 3300005455 Bacteria 1628
81 Ga0070663_100321159 3300005455 Bacteria 1245
82 Ga0070663_100479477 3300005455 Bacteria 1029
83 Ga0070663_100498539 3300005455 Bacteria 1011
84 Ga0070678_100600428 3300005456 Bacteria 983
85 Ga0070662_100215752 3300005457 Bacteria 1529
86 Ga0070681_10001050 3300005458 Bacteria 23493
87 Ga0070681_10095557 3300005458 Bacteria 2920
88 Ga0070681_10589316 3300005458 Bacteria 1026
89 Ga0070681_10966872 3300005458 Bacteria 771
90 Ga0068867_100354254 3300005459 Bacteria 1226
91 Ga0070679_100003993 3300005530 Bacteria 13587
92 Ga0070679_100006128 3300005530 Bacteria 11185
93 Ga0070679_100135818 3300005530 Bacteria 2440
94 Ga0070679_100162327 3300005530 Bacteria 2209
95 Ga0070679_100369870 3300005530 Bacteria 1381
96 Ga0070679_100468964 3300005530 Bacteria 1203
97 Ga0070679_100515342 3300005530 Bacteria 1140
98 Ga0070679_100987841 3300005530 Bacteria 786
99 Ga0070679_101067564 3300005530 Bacteria 752
100 Ga0070684_100011551 3300005535 Bacteria 7035
101 Ga0070684_100107048 3300005535 Bacteria 2504
102 Ga0070684_100165684 3300005535 Bacteria 2006
103 Ga0070684_100273521 3300005535 Bacteria 1547
104 Ga0070684_100312272 3300005535 Bacteria 1443
105 Ga0070684_100393724 3300005535 Bacteria 1277
106 Ga0070684_100696362 3300005535 Bacteria 947
107 Ga0068853_100000222 3300005539 Bacteria 40206
108 Ga0068853_100000367 3300005539 Bacteria 31060
109 Ga0068853_100043702 3300005539 Bacteria 3833
110 Ga0068853_100070755 3300005539 Bacteria 3037
111 Ga0068853_100130644 3300005539 Bacteria 2248
112 Ga0068853_100237710 3300005539 Bacteria 1669
113 Ga0068853_100327147 3300005539 Bacteria 1422
114 Ga0068853_100336512 3300005539 Bacteria 1402
115 Ga0068853_100960524 3300005539 Bacteria 822
116 Ga0070665_100005637 3300005548 Bacteria 12872
117 Ga0070665_100041617 3300005548 Bacteria 4619
118 Ga0070665_100158518 3300005548 Bacteria 2265
119 Ga0070665_100181688 3300005548 Bacteria 2104
120 Ga0070665_100403581 3300005548 Bacteria 1375
121 Ga0068855_100000277 3300005563 Bacteria 63213
122 Ga0068855_100002688 3300005563 Bacteria 21925
123 Ga0068855_100003653 3300005563 Bacteria 18822
124 Ga0068855_100010384 3300005563 Bacteria 11233
125 Ga0068855_100035334 3300005563 Bacteria 5953
126 Ga0068855_100060121 3300005563 Bacteria 4444
127 Ga0068855_100092013 3300005563 Bacteria 3498
128 Ga0068855_100169055 3300005563 Bacteria 2477
129 Ga0068855_100181173 3300005563 Bacteria 2381
130 Ga0068855_100218171 3300005563 Bacteria 2140
131 Ga0068855_100278975 3300005563 Bacteria 1856
132 Ga0068855_100301117 3300005563 Bacteria 1775
133 Ga0068855_100468401 3300005563 Bacteria 1373
134 Ga0068855_100584895 3300005563 Bacteria 1205
135 Ga0068855_101193853 3300005563 Bacteria 791
136 Ga0070664_100124085 3300005564 Bacteria 2263
137 Ga0070664_100592049 3300005564 Bacteria 1028
138 Ga0070664_100734426 3300005564 Bacteria 921
139 Ga0068857_100003191 3300005577 Bacteria 13595
140 Ga0068857_100015817 3300005577 Bacteria 6601
141 Ga0068857_100306068 3300005577 Bacteria 1466
142 Ga0068857_100355705 3300005577 Bacteria 1357
143 Ga0068857_101079678 3300005577 Bacteria 775
144 Ga0068854_100000019 3300005578 Bacteria 134145
145 Ga0068854_100034075 3300005578 Bacteria 3554
146 Ga0068854_100044343 3300005578 Bacteria 3156
147 Ga0068856_100003529 3300005614 Bacteria 15773
148 Ga0068856_100033069 3300005614 Bacteria 5063
149 Ga0068856_100050428 3300005614 Bacteria 4103
150 Ga0068856_100057606 3300005614 Bacteria 3836
151 Ga0068856_100085887 3300005614 Bacteria 3126
152 Ga0068856_100227971 3300005614 Bacteria 1878
153 Ga0068856_100413541 3300005614 Bacteria 1369
154 Ga0068856_100509145 3300005614 Bacteria 1225
155 Ga0068856_100709163 3300005614 Bacteria 1026
156 Ga0068852_100000019 3300005616 Bacteria 129021
157 Ga0068852_100000097 3300005616 Bacteria 59430
158 Ga0068852_100001535 3300005616 Bacteria 15668
159 Ga0068852_100097697 3300005616 Bacteria 2642
160 Ga0068852_100103163 3300005616 Bacteria 2579
161 Ga0068852_100113488 3300005616 Bacteria 2468
162 Ga0068852_100161107 3300005616 Bacteria 2095
163 Ga0068852_100168947 3300005616 Bacteria 2048
164 Ga0068859_100120087 3300005617 Bacteria 2695
165 Ga0068864_100000625 3300005618 Bacteria 29830
166 Ga0068864_100012167 3300005618 Bacteria 7112
167 Ga0068864_100092202 3300005618 Bacteria 2674
168 Ga0068851_10016393 3300005834 Bacteria 3544
169 Ga0068851_10041070 3300005834 Bacteria 2326
170 Ga0068851_10051580 3300005834 Bacteria 2090
171 Ga0068851_10058980 3300005834 Bacteria 1963
172 Ga0068851_10167950 3300005834 Bacteria 1209
173 Ga0068851_10306247 3300005834 Unclassified 915
174 Ga0068863_100001753 3300005841 Bacteria 21524
175 Ga0068863_100001814 3300005841 Bacteria 21208
176 Ga0068863_100007046 3300005841 Bacteria 11016
177 Ga0068858_100014586 3300005842 Bacteria 7404
178 Ga0068858_100015914 3300005842 Bacteria 7067
179 Ga0068860_100000689 3300005843 Bacteria 38878
180 Ga0068860_100510378 3300005843 Bacteria 1201
181 Ga0068862_100293795 3300005844 Bacteria 1493
182 Ga0070717_10011247 3300006028 Bacteria 6789
183 Ga0070717_10011904 3300006028 Bacteria 6620
184 Ga0070717_10342393 3300006028 Bacteria 1335
185 Ga0070715_10002310 3300006163 Bacteria 5819
186 Ga0070716_100059060 3300006173 Bacteria 2210
187 Ga0070712_100012762 3300006175 Bacteria 5347
188 Ga0070712_100044876 3300006175 Bacteria 3049
189 Ga0070712_100340838 3300006175 Bacteria 1224
190 Ga0070712_100610888 3300006175 Bacteria 924
191 Ga0097621_100000349 3300006237 Bacteria 31779
192 Ga0097621_100360082 3300006237 Bacteria 1296
193 Ga0097621_100505098 3300006237 Bacteria 1095
194 Ga0068871_100002325 3300006358 Bacteria 12946
195 Ga0068871_100788000 3300006358 Bacteria 875
196 Ga0068865_100136913 3300006881 Bacteria 1842
197 Ga0075436_100648537 3300006914 Bacteria 780
198 Ga0097620_100120081 3300006931 Bacteria 2695
199 Ga0105240_10000372 3300009093 Bacteria 84325
200 Ga0105240_10000496 3300009093 Bacteria 72575
201 Ga0105240_10001875 3300009093 Bacteria 34957
202 Ga0105240_10009346 3300009093 Bacteria 13895
203 Ga0105240_10010838 3300009093 Bacteria 12767
204 Ga0105240_10030875 3300009093 Bacteria 6960
205 Ga0105240_10039085 3300009093 Bacteria 6080
206 Ga0105240_10087131 3300009093 Bacteria 3824
207 Ga0105240_10097071 3300009093 Bacteria 3591
208 Ga0105240_10120373 3300009093 Bacteria 3161
209 Ga0105240_10122860 3300009093 Bacteria 3124
210 Ga0105240_10152229 3300009093 Bacteria 2754
211 Ga0105240_11390657 3300009093 Bacteria 738
212 Ga0105245_10000486 3300009098 Bacteria 36378
213 Ga0105245_10021587 3300009098 Bacteria 5650
214 Ga0105245_10085606 3300009098 Bacteria 2889
215 Ga0105245_10443589 3300009098 Bacteria 1305
216 Ga0105245_10513291 3300009098 Bacteria 1216
217 Ga0105247_10002346 3300009101 Bacteria 12922
218 Ga0105247_10292438 3300009101 Bacteria 1127
219 Ga0114129_11396355 3300009147 Bacteria 864
220 Ga0105241_10000026 3300009174 Bacteria 132695
221 Ga0105241_10000121 3300009174 Bacteria 57041
222 Ga0105241_10002032 3300009174 Bacteria 15308
223 Ga0105241_10213745 3300009174 Bacteria 1617
224 Ga0105241_10232573 3300009174 Unclassified 1554
225 Ga0105242_10298302 3300009176 Unclassified 1470
226 Ga0105248_10000019 3300009177 Bacteria 285766
227 Ga0105248_10007017 3300009177 Bacteria 12337
228 Ga0105248_10016372 3300009177 Bacteria 8160
229 Ga0105248_10022327 3300009177 Bacteria 7018
230 Ga0105248_10029618 3300009177 Bacteria 6107
231 Ga0105248_10042895 3300009177 Bacteria 5072
232 Ga0105248_10094941 3300009177 Bacteria 3358
233 Ga0105248_10477210 3300009177 Bacteria 1406
234 Ga0105248_10578479 3300009177 Bacteria 1267
235 Ga0105248_10765535 3300009177 Bacteria 1089
236 Ga0105248_10796820 3300009177 Bacteria 1066
237 Ga0105237_10000590 3300009545 Bacteria 50564
238 Ga0105237_10006331 3300009545 Bacteria 13155
239 Ga0105237_10063825 3300009545 Bacteria 3680
240 Ga0105237_10137842 3300009545 Bacteria 2434
241 Ga0105237_10212808 3300009545 Bacteria 1932
242 Ga0105237_10248368 3300009545 Bacteria 1781
243 Ga0105237_10575017 3300009545 Bacteria 1134
244 Ga0105237_10627141 3300009545 Bacteria 1082
245 Ga0105237_10812540 3300009545 Bacteria 942
246 Ga0105238_10000197 3300009551 Bacteria 66637
247 Ga0105238_10000509 3300009551 Bacteria 40868
248 Ga0105238_10008072 3300009551 Bacteria 10529
249 Ga0105238_10023794 3300009551 Bacteria 6244
250 Ga0105238_10026652 3300009551 Bacteria 5892
251 Ga0105238_10054460 3300009551 Bacteria 4017
252 Ga0105238_10078759 3300009551 Bacteria 3286
253 Ga0105238_10201945 3300009551 Bacteria 1963
254 Ga0105238_10251055 3300009551 Bacteria 1747
255 Ga0105238_10314767 3300009551 Bacteria 1550
256 Ga0105238_10355224 3300009551 Bacteria 1455
257 Ga0105249_10003449 3300009553 Bacteria 13698
258 Ga0105249_10081598 3300009553 Bacteria 3006
259 Ga0105249_11113285 3300009553 Unclassified 860
260 Ga0105249_11268700 3300009553 Bacteria 808
261 Ga0105239_10001533 3300010375 Bacteria 30534
262 Ga0105239_10003046 3300010375 Bacteria 20836
263 Ga0105239_10105415 3300010375 Bacteria 3122
264 Ga0105239_10246339 3300010375 Bacteria 2007
265 Ga0105239_10857536 3300010375 Bacteria 1042
266 Ga0105246_10001192 3300011119 Bacteria 15150
267 Ga0105246_10119528 3300011119 Bacteria 1950
268 Ga0157373_10225234 3300013100 Bacteria 1323
269 Ga0157370_10000170 3300013104 Bacteria 80529
270 Ga0157370_10010160 3300013104 Bacteria 9939
271 Ga0157370_10012988 3300013104 Bacteria 8605
272 Ga0157370_10013763 3300013104 Bacteria 8313
273 Ga0157370_10046758 3300013104 Unclassified 4149
274 Ga0157370_10171680 3300013104 Bacteria 2016
275 Ga0157370_10752683 3300013104 Bacteria 888
276 Ga0157369_10000085 3300013105 Bacteria 129025
277 Ga0157369_10000430 3300013105 Bacteria 55736
278 Ga0157369_10009218 3300013105 Bacteria 11289
279 Ga0157369_10012659 3300013105 Bacteria 9566
280 Ga0157369_10028989 3300013105 Bacteria 6121
281 Ga0157369_10040085 3300013105 Bacteria 5115
282 Ga0157369_10042189 3300013105 Bacteria 4977
283 Ga0157369_10054976 3300013105 Bacteria 4298
284 Ga0157369_10096566 3300013105 Bacteria 3153
285 Ga0157369_10098891 3300013105 Bacteria 3110
286 Ga0157369_10115794 3300013105 Bacteria 2847
287 Ga0157369_10172157 3300013105 Bacteria 2281
288 Ga0157369_10192237 3300013105 Bacteria 2144
289 Ga0157369_10206790 3300013105 Bacteria 2058
290 Ga0157369_10344813 3300013105 Unclassified 1547
291 Ga0157369_10371511 3300013105 Bacteria 1484
292 Ga0157369_10540699 3300013105 Bacteria 1204
293 Ga0157369_10729791 3300013105 Bacteria 1020
294 Ga0157369_11101743 3300013105 Bacteria 812
295 Ga0157374_10023020 3300013296 Bacteria 5565
296 Ga0157374_10042034 3300013296 Bacteria 4215
297 Ga0157374_10084229 3300013296 Bacteria 3022
298 Ga0157374_10238777 3300013296 Bacteria 1787
299 Ga0157374_10325896 3300013296 Bacteria 1523
300 Ga0157374_10447875 3300013296 Bacteria 1292
301 Ga0157374_10498754 3300013296 Bacteria 1222
302 Ga0157374_10827694 3300013296 Bacteria 942
303 Ga0157378_10023973 3300013297 Bacteria 5367
304 Ga0157378_10131240 3300013297 Bacteria 2319
305 Ga0163162_10027442 3300013306 Bacteria 5631
306 Ga0163162_10158863 3300013306 Bacteria 2382
307 Ga0163162_11275508 3300013306 Bacteria 834
308 Ga0157372_10000217 3300013307 Bacteria 63667
309 Ga0157372_10002601 3300013307 Bacteria 19543
310 Ga0157372_10002611 3300013307 Bacteria 19494
311 Ga0157372_10010870 3300013307 Bacteria 9688
312 Ga0157372_10063864 3300013307 Bacteria 4130
313 Ga0157372_10204729 3300013307 Bacteria 2286
314 Ga0157372_10206180 3300013307 Bacteria 2278
315 Ga0157372_10348925 3300013307 Bacteria 1724
316 Ga0157372_10403380 3300013307 Bacteria 1593
317 Ga0157372_10569693 3300013307 Bacteria 1320
318 Ga0157375_10057497 3300013308 Bacteria 3845
319 Ga0157375_10066677 3300013308 Bacteria 3595
320 Ga0157375_10069334 3300013308 Bacteria 3532
321 Ga0163163_10001161 3300014325 Bacteria 22403
322 Ga0163163_10017757 3300014325 Bacteria 6641
323 Ga0163163_10062243 3300014325 Bacteria 3697
324 Ga0163163_10580801 3300014325 Bacteria 1184
325 Ga0157377_10199620 3300014745 Bacteria 1269
326 Ga0157379_10002312 3300014968 Bacteria 15882
327 Ga0157379_10048162 3300014968 Bacteria 3804
328 Ga0157379_10161237 3300014968 Bacteria 2024
329 Ga0157379_10287290 3300014968 Bacteria 1497
330 Ga0157379_10308107 3300014968 Bacteria 1444
331 Ga0157376_10004372 3300014969 Bacteria 9831
332 Ga0157376_10737860 3300014969 Bacteria 993
333 Ga0157376_11689302 3300014969 Bacteria 668
334 Ga0163161_10044573 3300017792 Bacteria 3195
335 Ga0213872_10002341 3300021361 Bacteria 11261
336 Ga0213872_10034756 3300021361 Bacteria 2306
337 Ga0213872_10051363 3300021361 Bacteria 1871
338 Ga0213872_10054105 3300021361 Bacteria 1820
339 Ga0213875_10000108 3300021388 Bacteria 94421
340 Ga0213875_10219442 3300021388 Bacteria 896
341 Ga0213871_10006004 3300021441 Bacteria 2545
342 Ga0224572_1008454 3300024225 Bacteria 1903
343 Ga0209233_1001442 3300025261 Bacteria 9385
344 Ga0207656_10031201 3300025321 Bacteria 2206
345 Ga0207656_10031615 3300025321 Bacteria 2194
346 Ga0207656_10048760 3300025321 Bacteria 1824
347 Ga0207656_10196195 3300025321 Bacteria 974
348 Ga0207656_10364668 3300025321 Bacteria 722
349 Ga0207692_10438543 3300025898 Bacteria 820
350 Ga0207692_10444087 3300025898 Bacteria 815
351 Ga0207710_10317441 3300025900 Bacteria 789
352 Ga0207680_10030474 3300025903 Bacteria 3043
353 Ga0207680_10204305 3300025903 Bacteria 1348
354 Ga0207647_10078008 3300025904 Bacteria 1990
355 Ga0207647_10125849 3300025904 Bacteria 1508
356 Ga0207699_10125619 3300025906 Bacteria 1665
357 Ga0207699_10680378 3300025906 Bacteria 752
358 Ga0207645_10116005 3300025907 Bacteria 1736
359 Ga0207705_10000021 3300025909 Bacteria 309436
360 Ga0207705_10002125 3300025909 Bacteria 15376
361 Ga0207705_10002923 3300025909 Bacteria 13059
362 Ga0207705_10012875 3300025909 Bacteria 6038
363 Ga0207705_10021055 3300025909 Bacteria 4651
364 Ga0207705_10027435 3300025909 Bacteria 4060
365 Ga0207705_10028574 3300025909 Bacteria 3976
366 Ga0207705_10107321 3300025909 Bacteria 2060
367 Ga0207705_10282735 3300025909 Bacteria 1270
368 Ga0207705_10294604 3300025909 Bacteria 1243
369 Ga0207705_10332471 3300025909 Bacteria 1169
370 Ga0207654_10000054 3300025911 Bacteria 82347
371 Ga0207654_10000281 3300025911 Bacteria 30979
372 Ga0207654_10000808 3300025911 Bacteria 17242
373 Ga0207654_10083730 3300025911 Bacteria 1926
374 Ga0207654_10233283 3300025911 Bacteria 1226
375 Ga0207654_10251596 3300025911 Bacteria 1185
376 Ga0207707_10003864 3300025912 Bacteria 13285
377 Ga0207707_10142923 3300025912 Unclassified 2092
378 Ga0207707_10322003 3300025912 Bacteria 1335
379 Ga0207707_10465465 3300025912 Bacteria 1081
380 Ga0207707_10659207 3300025912 Bacteria 881
381 Ga0207695_10000080 3300025913 Bacteria 287868
382 Ga0207695_10000113 3300025913 Bacteria 247240
383 Ga0207695_10000167 3300025913 Bacteria 194371
384 Ga0207695_10000263 3300025913 Bacteria 132894
385 Ga0207695_10001106 3300025913 Bacteria 46871
386 Ga0207695_10001762 3300025913 Bacteria 34278
387 Ga0207695_10033351 3300025913 Bacteria 5617
388 Ga0207695_10072087 3300025913 Bacteria 3526
389 Ga0207695_10083832 3300025913 Bacteria 3219
390 Ga0207695_10090502 3300025913 Bacteria 3075
391 Ga0207695_10125292 3300025913 Bacteria 2532
392 Ga0207695_10464491 3300025913 Bacteria 1149
393 Ga0207695_10723985 3300025913 Bacteria 875
394 Ga0207671_10000065 3300025914 Bacteria 166743
395 Ga0207671_10000123 3300025914 Bacteria 119385
396 Ga0207671_10000139 3300025914 Bacteria 111786
397 Ga0207671_10086096 3300025914 Bacteria 2362
398 Ga0207671_10218141 3300025914 Bacteria 1494
399 Ga0207693_10002600 3300025915 Bacteria 15685
400 Ga0207693_10059168 3300025915 Bacteria 3001
401 Ga0207693_10405560 3300025915 Bacteria 1065
402 Ga0207663_10016822 3300025916 Bacteria 4066
403 Ga0207663_10023940 3300025916 Bacteria 3512
404 Ga0207663_10519219 3300025916 Bacteria 927
405 Ga0207660_10111242 3300025917 Bacteria 2061
406 Ga0207660_10271414 3300025917 Bacteria 1344
407 Ga0207660_10304040 3300025917 Bacteria 1270
408 Ga0207657_10004623 3300025919 Bacteria 14538
409 Ga0207657_10019482 3300025919 Bacteria 6442
410 Ga0207657_10036579 3300025919 Bacteria 4393
411 Ga0207657_10205754 3300025919 Bacteria 1581
412 Ga0207657_10347439 3300025919 Unclassified 1170
413 Ga0207657_10565120 3300025919 Bacteria 889
414 Ga0207649_10031894 3300025920 Bacteria 3135
415 Ga0207649_10051782 3300025920 Bacteria 2544
416 Ga0207652_10001535 3300025921 Bacteria 20348
417 Ga0207652_10036402 3300025921 Bacteria 4160
418 Ga0207652_10547214 3300025921 Bacteria 1040
419 Ga0207694_10000248 3300025924 Bacteria 51461
420 Ga0207694_10000711 3300025924 Bacteria 29920
421 Ga0207694_10048093 3300025924 Bacteria 3300
422 Ga0207694_10062538 3300025924 Bacteria 2898
423 Ga0207694_10078380 3300025924 Bacteria 2590
424 Ga0207694_10139468 3300025924 Bacteria 1949
425 Ga0207694_10273841 3300025924 Bacteria 1385
426 Ga0207694_10522820 3300025924 Bacteria 994
427 Ga0207650_10003582 3300025925 Bacteria 10655
428 Ga0207650_10213491 3300025925 Bacteria 1550
429 Ga0207687_10000978 3300025927 Bacteria 19404
430 Ga0207687_10002372 3300025927 Bacteria 12792
431 Ga0207687_10130110 3300025927 Bacteria 1896
432 Ga0207687_10350078 3300025927 Bacteria 1203
433 Ga0207700_10003745 3300025928 Bacteria 8878
434 Ga0207700_10021300 3300025928 Bacteria 4424
435 Ga0207700_10058092 3300025928 Bacteria 2921
436 Ga0207700_10062682 3300025928 Bacteria 2824
437 Ga0207700_10393013 3300025928 Bacteria 1214
438 Ga0207700_10394546 3300025928 Bacteria 1212
439 Ga0207700_10452458 3300025928 Bacteria 1132
440 Ga0207700_10552917 3300025928 Unclassified 1022
441 Ga0207700_10678905 3300025928 Bacteria 919
442 Ga0207700_11068310 3300025928 Bacteria 722
443 Ga0207664_10017916 3300025929 Bacteria 5203
444 Ga0207664_10071842 3300025929 Unclassified 2789
445 Ga0207664_10105160 3300025929 Bacteria 2339
446 Ga0207664_10128766 3300025929 Bacteria 2128
447 Ga0207664_10205846 3300025929 Bacteria 1700
448 Ga0207664_10234262 3300025929 Bacteria 1597
449 Ga0207664_10420967 3300025929 Bacteria 1190
450 Ga0207664_10527307 3300025929 Bacteria 1059
451 Ga0207644_10017923 3300025931 Bacteria 4788
452 Ga0207644_10266848 3300025931 Bacteria 1370
453 Ga0207690_10050737 3300025932 Bacteria 2771
454 Ga0207690_10175486 3300025932 Bacteria 1609
455 Ga0207706_10243219 3300025933 Bacteria 1573
456 Ga0207686_10373242 3300025934 Bacteria 1080
457 Ga0207665_10022539 3300025939 Bacteria 4144
458 Ga0207665_10044340 3300025939 Bacteria 2976
459 Ga0207665_10052779 3300025939 Bacteria 2739
460 Ga0207691_10039961 3300025940 Bacteria 4338
461 Ga0207711_10000014 3300025941 Bacteria 506753
462 Ga0207711_10004781 3300025941 Bacteria 11494
463 Ga0207711_10033255 3300025941 Bacteria 4362
464 Ga0207711_10044398 3300025941 Bacteria 3794
465 Ga0207711_10065518 3300025941 Bacteria 3141
466 Ga0207711_10093223 3300025941 Bacteria 2652
467 Ga0207689_11050014 3300025942 Unclassified 687
468 Ga0207661_10001283 3300025944 Bacteria 16799
469 Ga0207661_10055710 3300025944 Bacteria 3172
470 Ga0207661_10077968 3300025944 Bacteria 2726
471 Ga0207661_10078225 3300025944 Bacteria 2722
472 Ga0207661_10104793 3300025944 Bacteria 2382
473 Ga0207661_10179079 3300025944 Bacteria 1850
474 Ga0207661_10475948 3300025944 Bacteria 1140
475 Ga0207679_10137102 3300025945 Bacteria 1972
476 Ga0207679_10616612 3300025945 Bacteria 979
477 Ga0207667_10000468 3300025949 Bacteria 53974
478 Ga0207667_10006194 3300025949 Bacteria 14522
479 Ga0207667_10007633 3300025949 Bacteria 12958
480 Ga0207667_10009516 3300025949 Bacteria 11434
481 Ga0207667_10012818 3300025949 Bacteria 9632
482 Ga0207667_10030921 3300025949 Bacteria 5786
483 Ga0207667_10035816 3300025949 Bacteria 5323
484 Ga0207667_10098554 3300025949 Bacteria 3016
485 Ga0207667_10176714 3300025949 Bacteria 2193
486 Ga0207667_10198277 3300025949 Bacteria 2059
487 Ga0207667_10243021 3300025949 Bacteria 1842
488 Ga0207667_10249710 3300025949 Bacteria 1815
489 Ga0207667_10294967 3300025949 Bacteria 1656
490 Ga0207667_10321631 3300025949 Bacteria 1580
491 Ga0207667_10373279 3300025949 Bacteria 1453
492 Ga0207667_10979643 3300025949 Bacteria 834
493 Ga0207712_10043097 3300025961 Bacteria 3111
494 Ga0207640_10000028 3300025981 Bacteria 135727
495 Ga0207640_10024137 3300025981 Bacteria 3664
496 Ga0207640_10034716 3300025981 Bacteria 3150
497 Ga0207640_10092985 3300025981 Bacteria 2094
498 Ga0207640_10286155 3300025981 Bacteria 1297
499 Ga0207640_10677227 3300025981 Bacteria 882
500 Ga0207658_10003428 3300025986 Bacteria 11222
501 Ga0207677_10000143 3300026023 Bacteria 58337
502 Ga0207677_10154976 3300026023 Bacteria 1773
503 Ga0207677_10192193 3300026023 Bacteria 1615
504 Ga0207677_10322859 3300026023 Bacteria 1283
505 Ga0207703_10004820 3300026035 Bacteria 10980
506 Ga0207703_10123186 3300026035 Bacteria 2228
507 Ga0207639_10000088 3300026041 Bacteria 78742
508 Ga0207639_10000371 3300026041 Bacteria 31074
509 Ga0207639_10014115 3300026041 Bacteria 5610
510 Ga0207639_10016992 3300026041 Bacteria 5155
511 Ga0207639_10054301 3300026041 Bacteria 3061
512 Ga0207639_10129182 3300026041 Bacteria 2089
513 Ga0207639_10154385 3300026041 Bacteria 1927
514 Ga0207639_10211214 3300026041 Bacteria 1671
515 Ga0207639_10520451 3300026041 Bacteria 1089
516 Ga0207639_10748403 3300026041 Bacteria 909
517 Ga0207678_10006398 3300026067 Bacteria 10461
518 Ga0207678_10229059 3300026067 Bacteria 1591
519 Ga0207678_10336767 3300026067 Bacteria 1300
520 Ga0207678_10500580 3300026067 Bacteria 1059
521 Ga0207678_10575718 3300026067 Bacteria 986
522 Ga0207702_10001334 3300026078 Bacteria 24682
523 Ga0207702_10005816 3300026078 Bacteria 10726
524 Ga0207702_10017932 3300026078 Bacteria 5856
525 Ga0207702_10034912 3300026078 Bacteria 4205
526 Ga0207702_10070171 3300026078 Bacteria 3013
527 Ga0207702_10306913 3300026078 Bacteria 1507
528 Ga0207702_10888883 3300026078 Bacteria 883
529 Ga0207702_10989030 3300026078 Bacteria 834
530 Ga0207702_11043759 3300026078 Bacteria 811
531 Ga0207641_10005346 3300026088 Bacteria 10965
532 Ga0207641_10021590 3300026088 Bacteria 5290
533 Ga0207641_10037049 3300026088 Bacteria 4072
534 Ga0207641_10306612 3300026088 Bacteria 1501
535 Ga0207676_10055374 3300026095 Bacteria 3113
536 Ga0207676_10159038 3300026095 Bacteria 1955
537 Ga0207676_10508123 3300026095 Bacteria 1145
538 Ga0207674_10000669 3300026116 Bacteria 44573
539 Ga0207674_10142769 3300026116 Bacteria 2353
540 Ga0207674_10148285 3300026116 Bacteria 2303
541 Ga0207674_10201213 3300026116 Bacteria 1941
542 Ga0207674_10293248 3300026116 Bacteria 1575
543 Ga0207674_10294723 3300026116 Bacteria 1571
544 Ga0207674_10305491 3300026116 Bacteria 1540
545 Ga0207683_10028240 3300026121 Bacteria 4851
546 Ga0207683_10262222 3300026121 Bacteria 1578
547 Ga0207698_10000003 3300026142 Bacteria 321303
548 Ga0207698_10000708 3300026142 Bacteria 19330
549 Ga0207698_10003525 3300026142 Bacteria 9436
550 Ga0207698_10031875 3300026142 Bacteria 3811
551 Ga0207698_10036682 3300026142 Bacteria 3601
552 Ga0207698_10059852 3300026142 Unclassified 2959
553 Ga0207698_10215710 3300026142 Bacteria 1730
554 Ga0207698_10464681 3300026142 Bacteria 1224
555 Ga0265356_1004445 3300028017 Bacteria 1714
556 Ga0268266_10005265 3300028379 Bacteria 12146
557 Ga0268266_10006399 3300028379 Bacteria 10792
558 Ga0268266_10008807 3300028379 Bacteria 8937
559 Ga0268266_10078240 3300028379 Bacteria 2877
560 Ga0268266_10188892 3300028379 Bacteria 1880
561 Ga0268265_10562240 3300028380 Bacteria 1084
562 Ga0268264_10000598 3300028381 Bacteria 43640
563 Ga0265319_1044472 3300028563 Bacteria 1488
564 Ga0265334_10130983 3300028573 Bacteria 892
565 Ga0265318_10011054 3300028577 Bacteria 3903
566 Ga0265318_10076123 3300028577 Bacteria 1242
567 Ga0265336_10001048 3300028666 Bacteria 13512
568 Ga0265336_10005708 3300028666 Bacteria 4561
569 Ga0265338_10004495 3300028800 Bacteria 18805
570 Ga0265338_10005157 3300028800 Bacteria 17175
571 Ga0265338_10009284 3300028800 Bacteria 11764
572 Ga0265338_10017734 3300028800 Bacteria 7656
573 Ga0265338_10040619 3300028800 Bacteria 4367
574 Ga0265338_10099138 3300028800 Bacteria 2381
575 Ga0265338_10259829 3300028800 Bacteria 1277
576 Ga0265338_10268771 3300028800 Bacteria 1250
577 Ga0265338_10527691 3300028800 Bacteria 829
578 Ga0265338_10610317 3300028800 Bacteria 759
579 Ga0265324_10009104 3300029957 Bacteria 3896
580 Ga0265324_10026321 3300029957 Bacteria 2059
581 Ga0265330_10000273 3300031235 Bacteria 38107
582 Ga0265330_10001219 3300031235 Bacteria 15180
583 Ga0265330_10011435 3300031235 Bacteria 4163
584 Ga0265330_10030656 3300031235 Bacteria 2413
585 Ga0265330_10072643 3300031235 Bacteria 1488
586 Ga0265330_10120309 3300031235 Bacteria 1119
587 Ga0265330_10126058 3300031235 Bacteria 1090
588 Ga0265332_10054533 3300031238 Unclassified 1715
589 Ga0265332_10280342 3300031238 Bacteria 689
590 Ga0265328_10001272 3300031239 Bacteria 11639
591 Ga0265328_10005053 3300031239 Bacteria 5684
592 Ga0265328_10011186 3300031239 Bacteria 3591
593 Ga0265320_10003664 3300031240 Bacteria 10255
594 Ga0265325_10000266 3300031241 Bacteria 37071
595 Ga0265325_10000695 3300031241 Bacteria 24506
596 Ga0265325_10005858 3300031241 Bacteria 7531
597 Ga0265325_10087985 3300031241 Bacteria 1535
598 Ga0265325_10098913 3300031241 Bacteria 1430
599 Ga0265329_10011153 3300031242 Bacteria 3272
600 Ga0265329_10011996 3300031242 Bacteria 3132
601 Ga0265340_10001072 3300031247 Bacteria 15563
602 Ga0265340_10012505 3300031247 Bacteria 4481
603 Ga0265340_10015610 3300031247 Bacteria 3945
604 Ga0265340_10096350 3300031247 Bacteria 1378
605 Ga0265340_10171805 3300031247 Bacteria 982
606 Ga0265339_10000114 3300031249 Bacteria 65609
607 Ga0265339_10000124 3300031249 Bacteria 64124
608 Ga0265339_10000194 3300031249 Bacteria 50375
609 Ga0265339_10003213 3300031249 Bacteria 11471
610 Ga0265339_10009288 3300031249 Bacteria 6193
611 Ga0265339_10021882 3300031249 Bacteria 3711
612 Ga0265339_10028825 3300031249 Bacteria 3154
613 Ga0265339_10165558 3300031249 Bacteria 1110
614 Ga0265331_10073017 3300031250 Bacteria 1602
615 Ga0265331_10111778 3300031250 Bacteria 1253
616 Ga0265327_10267568 3300031251 Bacteria 758
617 Ga0265316_10000352 3300031344 Bacteria 51670
618 Ga0265316_10000712 3300031344 Bacteria 36687
619 Ga0265316_10003105 3300031344 Bacteria 16919
620 Ga0265316_10006699 3300031344 Bacteria 10976
621 Ga0265316_10008382 3300031344 Bacteria 9600
622 Ga0265316_10018630 3300031344 Bacteria 5963
623 Ga0265316_10022409 3300031344 Bacteria 5325
624 Ga0265316_10129073 3300031344 Bacteria 1905
625 Ga0265316_10136596 3300031344 Bacteria 1844
626 Ga0265316_10177577 3300031344 Bacteria 1586
627 Ga0265313_10002216 3300031595 Bacteria 17122
628 Ga0265313_10004714 3300031595 Bacteria 10288
629 Ga0265313_10046248 3300031595 Bacteria 2113
630 Ga0265313_10068916 3300031595 Bacteria 1633
631 Ga0265313_10137519 3300031595 Bacteria 1053
632 Ga0265313_10187633 3300031595 Bacteria 866
633 Ga0265313_10227340 3300031595 Bacteria 767
634 Ga0265314_10000504 3300031711 Bacteria 50376
635 Ga0265314_10002987 3300031711 Bacteria 16745
636 Ga0265314_10034859 3300031711 Bacteria 3672
637 Ga0265314_10117019 3300031711 Bacteria 1685
638 Ga0265342_10000225 3300031712 Bacteria 63822
639 Ga0265342_10001536 3300031712 Bacteria 21355
640 Ga0265342_10002164 3300031712 Bacteria 17314
641 Ga0265342_10002441 3300031712 Bacteria 16049
642 Ga0265342_10014061 3300031712 Bacteria 5326
643 Ga0265342_10027916 3300031712 Bacteria 3520
644 Ga0265342_10029908 3300031712 Bacteria 3379
645 Ga0265342_10045350 3300031712 Bacteria 2646
646 Ga0265342_10069670 3300031712 Bacteria 2053
647 Ga0265342_10136398 3300031712 Bacteria 1371
648 Ga0265342_10188592 3300031712 Bacteria 1126
649 Ga0265342_10332508 3300031712 Bacteria 794
650 Ga0316583_10095825 3300032133 Bacteria 1035
651 Ga0307510_10010774 3300033180 Bacteria 10874
652 Ga0307510_10212472 3300033180 Bacteria 1455
653 Ga0307510_10223248 3300033180 Bacteria 1393
654 Ga0316215_1003489 3300033544 Bacteria 1498
655 Ga0373926_0000675 3300035083 Bacteria 9381
656 Ga0373954_0036836 3300035118 Bacteria 2272
657 Ga0373954_0294562 3300035118 Bacteria 800
658 Ga0373956_0061195 3300035119 Bacteria 1705
659 Ga0373956_0153569 3300035119 Unclassified 1083
660 Ga0373943_0001291 3300035170 Bacteria 11240
661 Ga0373946_0000821 3300035171 Bacteria 10594
662 Ga0373955_0149693 3300035172 Bacteria 1373
663 Ga0373924_0000243 3300035410 Bacteria 16627
664 Ga0373924_0093250 3300035410 Bacteria 1290
665 Ga0373935_0012297 3300035692 Bacteria 5149
666 Ga0373935_0829003 3300035692 Bacteria 683
667 Ga0373927_0004411 3300035695 Bacteria 9864
668 Ga0373947_0112424 3300035725 Unclassified 1722
669 Ga0373937_0007405 3300036401 Bacteria 9499
670 Ga0373937_0065583 3300036401 Bacteria 3343
671 Ga0373925_0060693 3300037068 Unclassified 2839
672 Ga0395900_0025848 3300037418 Bacteria 6011
673 Ga0395900_0389492 3300037418 Bacteria 1360
674 Ga0395898_0027814 3300037466 Bacteria 5670
675 Ga0395898_0117975 3300037466 Bacteria 2542
676 Ga0395898_0546082 3300037466 Bacteria 1101
677 Ga0436364_0115933 3300037853 Bacteria 94405
678 Ga0436364_0147107 3300037853 Unclassified 2317
679 Ga0436364_0354157 3300037853 Bacteria 1857
680 Ga0395901_0310997 3300038443 Bacteria 1632
681 Ga0395901_0513053 3300038443 Bacteria 1219
682 Ga0436365_0590507 3300039437 Bacteria 1029
683 Ga0436360_1067871 3300039438 Archaea 894
684 Ga0436360_1280163 3300039438 Bacteria 848
685 Ga0436361_0318263 3300039447 Bacteria 10520
686 Ga0436361_0387230 3300039447 Bacteria 1246
687 Ga0436361_0497072 3300039447 Bacteria 714
688 Ga0436361_0500168 3300039447 Bacteria 41610
689 Ga0436361_0732319 3300039447 Bacteria 1755
690 Ga0436361_1103679 3300039447 Bacteria 1360
691 Ga0436363_0331024 3300039450 Unclassified 1311
692 Ga0466966_0149285 3300044684 Bacteria 1426
693 Ga0466961_0055286 3300044693 Bacteria 2531
694 Ga0466963_0000494 3300044694 Bacteria 18341
695 Ga0466963_0107210 3300044694 Bacteria 1916
696 Ga0466970_0244720 3300044765 Bacteria 1004
697 Ga0466957_0026837 3300044842 Bacteria 3419
698 Ga0466959_0382284 3300045049 Bacteria 958
699 Ga0451576_0873383 3300045051 Bacteria 944
700 Ga0466967_0001401 3300045976 Bacteria 13938
701 Ga0466967_0046813 3300045976 Bacteria 3768
702 Ga0466967_0111253 3300045976 Bacteria 2517
703 Ga0495617_026479 3300046452 Bacteria 1953
704 Ga0495603_0039419 3300046455 Bacteria 2830
705 Ga0495629_0029674 3300046459 Bacteria 3878
706 Ga0495629_0049585 3300046459 Bacteria 2942
707 Ga0495629_0060065 3300046459 Bacteria 2657
708 Ga0495629_0137756 3300046459 Bacteria 1699
709 Ga0495638_0445383 3300046460 Bacteria 662
710 Ga0495651_0053044 3300046462 Bacteria 3123
711 Ga0495653_0010749 3300046463 Bacteria 7495
712 Ga0495650_0000038 3300046471 Bacteria 377530
713 Ga0495580_0120910 3300046472 Bacteria 1818
714 Ga0495580_0156212 3300046472 Unclassified 1579
715 Ga0495580_0326733 3300046472 Bacteria 1042
716 Ga0495580_0497340 3300046472 Bacteria 814
717 Ga0495582_0001853 3300046473 Bacteria 11921
718 Ga0495582_0095987 3300046473 Bacteria 1657
719 Ga0495639_0004538 3300046475 Bacteria 5952
720 Ga0495662_0005660 3300046476 Bacteria 6246
721 Ga0495664_0001348 3300046477 Bacteria 12929
722 Ga0495664_0057856 3300046477 Bacteria 2306
723 Ga0495585_0085882 3300046492 Bacteria 1700
724 Ga0495594_0000388 3300046499 Bacteria 22139
725 Ga0495594_0001190 3300046499 Bacteria 13614
726 Ga0495594_0004431 3300046499 Bacteria 7222
727 Ga0495583_0033822 3300046506 Bacteria 2455
728 Ga0495606_0044975 3300046507 Bacteria 2931
729 Ga0495606_0067569 3300046507 Bacteria 2263
730 Ga0495630_0270870 3300046517 Bacteria 1297
731 Ga0495644_0000048 3300046523 Bacteria 57696
732 Ga0495666_0001196 3300046526 Bacteria 12524
733 Ga0495642_0019216 3300046528 Bacteria 2678
734 Ga0495652_0006640 3300046529 Bacteria 10742
735 Ga0495652_0043862 3300046529 Bacteria 3853
736 Ga0495665_0001828 3300046531 Bacteria 11486
737 Ga0495665_0243362 3300046531 Bacteria 927
738 Ga0495640_0004801 3300046533 Bacteria 10760
739 Ga0495640_0112414 3300046533 Bacteria 1778
740 Ga0495586_0019711 3300046535 Bacteria 3591
741 Ga0495586_0197397 3300046535 Unclassified 1140
742 Ga0495587_0093692 3300046536 Bacteria 1734
743 Ga0495609_0011141 3300046538 Bacteria 4292
744 Ga0495609_0080699 3300046538 Bacteria 1422
745 Ga0495645_0053835 3300046543 Unclassified 2924
746 Ga0495645_0213338 3300046543 Archaea 1302
747 Ga0495633_0051416 3300046558 Bacteria 1942
748 Ga0495667_0150787 3300046559 Bacteria 1497
749 Ga0495668_0128921 3300046616 Bacteria 1385
750 Ga0495634_0006225 3300046642 Bacteria 9093
751 Ga0495611_0005877 3300046648 Bacteria 5236
752 Ga0495625_0000985 3300046660 Bacteria 37750
753 Ga0495625_0007833 3300046660 Bacteria 9208
754 Ga0495625_0026175 3300046660 Bacteria 4411
755 Ga0495625_0034121 3300046660 Bacteria 3757
756 Ga0495625_0089152 3300046660 Bacteria 2136
757 Ga0495625_0381016 3300046660 Bacteria 885
758 Ga0495625_0434634 3300046660 Bacteria 814
759 Ga0495635_0002836 3300046663 Bacteria 11904
760 Ga0495659_0114237 3300046664 Bacteria 1057
761 Ga0495661_0026784 3300046665 Bacteria 3708
762 Ga0495657_0277857 3300046675 Bacteria 1003
763 Ga0495599_0242663 3300046678 Bacteria 1098
764 Ga0495599_0548749 3300046678 Bacteria 677
765 Ga0495623_0008357 3300046679 Bacteria 6733
766 Ga0495623_0410809 3300046679 Bacteria 727
767 Ga0495646_0013211 3300046680 Bacteria 5247
768 Ga0495646_0023225 3300046680 Bacteria 3904
769 Ga0495646_0222729 3300046680 Bacteria 1019
770 Ga0495669_0004252 3300046684 Bacteria 5901
771 Ga0495669_0370251 3300046684 Unclassified 693
772 Ga0495613_0003966 3300046689 Bacteria 11081
773 Ga0495613_0018773 3300046689 Bacteria 5152
774 Ga0495613_0038534 3300046689 Unclassified 3543
775 Ga0495613_0109799 3300046689 Bacteria 1988
776 Ga0495624_0007524 3300046690 Bacteria 7641
777 Ga0495624_0174027 3300046690 Bacteria 1313
778 Ga0495671_0095768 3300046692 Bacteria 1452
779 Ga0495649_0012107 3300046694 Bacteria 5035
780 Ga0495600_0012858 3300046809 Bacteria 5243
781 Ga0495600_0172644 3300046809 Unclassified 1395
782 Ga0495581_0001976 3300047315 Bacteria 11495
783 Ga0495604_0002834 3300047317 Bacteria 13912
784 Ga0495674_0014334 3300047319 Bacteria 7423
785 Ga0495672_0021506 3300047320 Bacteria 4206
786 Ga0495672_0063127 3300047320 Bacteria 2127
787 Ga0495676_0008961 3300047321 Bacteria 9134
788 Ga0495683_0174509 3300047323 Bacteria 986
789 Ga0495675_0012974 3300047444 Bacteria 5253
790 Ga0495673_0231467 3300047469 Bacteria 680
791 Ga0495684_0099043 3300047471 Bacteria 2204
792 Ga0495686_0000178 3300047472 Bacteria 121468
793 Ga0495686_0001621 3300047472 Bacteria 23566
794 Ga0495686_0008419 3300047472 Bacteria 7568
795 Ga0495686_0047439 3300047472 Bacteria 2712
796 Ga0495686_0085891 3300047472 Bacteria 1915
797 Ga0495602_0081301 3300048088 Archaea 2725
798 Ga0495602_0236738 3300048088 Bacteria 1368
799 Ga0495614_0000972 3300048089 Bacteria 12208
800 Ga0496100_0314419 3300048903 Bacteria 1175
801 Ga0496100_0725168 3300048903 Bacteria 776
802 Ga0496102_0344146 3300048905 Bacteria 1404
803 Ga0496102_0851610 3300048905 Bacteria 834
804 Ga0496104_0000053 3300048907 Bacteria 135895
805 Ga0496104_0056645 3300048907 Bacteria 3708
806 Ga0496104_0071299 3300048907 Unclassified 3303
807 Ga0496104_0438058 3300048907 Bacteria 1219
808 Ga0496104_0659933 3300048907 Bacteria 955
809 Ga0496104_0726557 3300048907 Bacteria 900
810 Ga0496104_0798050 3300048907 Bacteria 850
811 Ga0496105_0001615 3300048908 Bacteria 15999
812 Ga0496105_0057832 3300048908 Bacteria 3201
813 Ga0496106_0042478 3300048909 Bacteria 3410
814 Ga0496108_0134232 3300048911 Bacteria 2128
815 Ga0496109_0316949 3300048912 Bacteria 1471
816 Ga0496111_0044511 3300048914 Bacteria 3191
817 Ga0496111_0158175 3300048914 Bacteria 1682
818 Ga0496111_0303736 3300048914 Bacteria 1183
819 Ga0496112_0021005 3300048915 Bacteria 6201
820 Ga0496112_0150505 3300048915 Bacteria 2294
821 Ga0496112_0467738 3300048915 Bacteria 1198
822 Ga0496113_0084737 3300048916 Bacteria 2434
823 Ga0496115_0085005 3300048918 Bacteria 2580
824 Ga0496115_0091617 3300048918 Bacteria 2484
825 Ga0496115_0273258 3300048918 Bacteria 1388
826 Ga0496115_0373480 3300048918 Unclassified 1160
827 Ga0496121_0365824 3300048924 Bacteria 956
828 Ga0496126_0000100 3300048929 Bacteria 203706
829 Ga0496126_0000154 3300048929 Bacteria 159983
830 Ga0496126_0078490 3300048929 Bacteria 2925
831 Ga0501032_0001912 3300049569 Bacteria 16446
832 Ga0501033_0028282 3300049570 Bacteria 4213
833 Ga0501033_0115308 3300049570 Bacteria 1952
834 Ga0501033_0637612 3300049570 Bacteria 729
835 Ga0501034_0148520 3300049571 Bacteria 2320
836 Ga0501036_0076344 3300049572 Bacteria 2834
837 Ga0501037_0391740 3300049573 Bacteria 954
838 Ga0501037_0492477 3300049573 Bacteria 832
839 Ga0501038_0048143 3300049574 Bacteria 3690
840 Ga0501038_0085946 3300049574 Bacteria 2644
841 Ga0501043_0003983 3300049579 Bacteria 12094
842 Ga0501046_0000056 3300049580 Bacteria 129342
843 Ga0501047_0008947 3300049581 Bacteria 9454
844 Ga0501047_0066914 3300049581 Bacteria 3463
845 Ga0501073_0110559 3300049589 Bacteria 1906
846 Ga0501073_0110594 3300049589 Bacteria 1906
847 Ga0501074_0196241 3300049590 Bacteria 1439
848 Ga0501080_0188110 3300049742 Bacteria 1898
849 Ga0501083_0147296 3300049744 Bacteria 1541
850 Ga0501035_0044540 3300049822 Bacteria 3995
851 Ga0501035_0377603 3300049822 Bacteria 1182
852 Ga0501035_0469538 3300049822 Bacteria 1039
853 Ga0501044_0027240 3300049823 Bacteria 6042
854 Ga0501044_0095095 3300049823 Bacteria 3003
855 Ga0501044_0417372 3300049823 Bacteria 1252
856 Ga0501044_0690521 3300049823 Bacteria 907
857 nmdc:mga06r32_320162_c1 3300050510 Bacteria 1536
858 Ga0495601_0167705 3300053077 Bacteria 1435
859 Ga0495619_0140913 3300053085 Unclassified 1660
860 Ga0500643_109394 3300053087 Bacteria 747
861 Ga0500651_0000005 3300053093 Bacteria 384761
862 Ga0500595_000004 3300053119 Bacteria 410922
863 Ga0500595_007997 3300053119 Bacteria 4343
864 Ga0500595_058334 3300053119 Bacteria 1173
865 Ga0500595_079031 3300053119 Bacteria 965
866 Ga0500661_003309 3300055283 Bacteria 3030
867 Ga0501082_0213946 3300060353 Bacteria 1677
868 Ga0530510_0265842 3300061734 Bacteria 1280
869 2884217798 2884215851 Bacteria 4554841
870 Ga0157370_10165459
871 JGI25165J46597_1013739
872 rootH2_10009426
873 Ga0065712_10479514
874 Ga0070658_10000121
875 Ga0070658_10021582
876 Ga0070658_10071707
877 Ga0070658_10112053
878 Ga0070658_10196354
879 Ga0070658_10205977
880 Ga0070658_10272828
881 Ga0070676_10067377
882 Ga0070683_100002041
883 Ga0070683_100028772
884 Ga0070683_100060569
885 Ga0070683_100062351
886 Ga0070683_100221096
887 Ga0070683_100285059
888 Ga0070670_100079127
889 Ga0068869_100095013
890 Ga0068869_100247235
891 Ga0070666_10055265
892 Ga0070666_10070170
893 Ga0070682_100242035
894 Ga0068868_100000066
895 Ga0068868_100065060
896 Ga0068868_100081115
897 Ga0068868_100488108
898 Ga0070660_100008313
899 Ga0070660_100155643
900 Ga0070660_100232314
901 Ga0070660_100637198
902 Ga0070660_100663456
903 Ga0070661_100019981
904 Ga0070661_100050615
905 Ga0070661_100066000
906 Ga0070661_100153801
907 Ga0070661_100701045
908 Ga0070668_100695790
909 Ga0070671_100003123
910 Ga0070671_100050619
911 Ga0070671_100117926
912 Ga0070671_100446435
913 Ga0070673_100070243
914 Ga0070673_100191444
915 Ga0070659_100004580
916 Ga0070659_100138892
917 Ga0070659_100234782
918 Ga0070659_100689205
919 Ga0070667_100046288
920 Ga0070667_100246795
921 Ga0070709_10166887
922 Ga0070709_10356466
923 Ga0070709_10501912
924 Ga0070714_100002654
925 Ga0070714_100091602
926 Ga0070714_100105232
927 Ga0070714_100116911
928 Ga0070714_100154671
929 Ga0070714_100161553
930 Ga0070714_100188384
931 Ga0070714_100200420
932 Ga0070713_100003005
933 Ga0070713_100023543
934 Ga0070713_100082409
935 Ga0070713_100162511
936 Ga0070713_100196366
937 Ga0070713_100257582
938 Ga0070713_100433308
939 Ga0070713_100631919
940 Ga0070713_101077027
941 Ga0070710_10032530
942 Ga0070710_10192885
943 Ga0070710_10266048
944 Ga0070711_100019179
945 Ga0070711_100022563
946 Ga0070711_100775332
947 Ga0070663_100053467
948 Ga0070663_100130863
949 Ga0070663_100182632
950 Ga0070663_100321159
951 Ga0070663_100479477
952 Ga0070663_100498539
953 Ga0070678_100600428
954 Ga0070662_100215752
955 Ga0070681_10001050
956 Ga0070681_10095557
957 Ga0070681_10589316
958 Ga0070681_10966872
959 Ga0068867_100354254
960 Ga0070679_100003993
961 Ga0070679_100006128
962 Ga0070679_100135818
963 Ga0070679_100162327
964 Ga0070679_100369870
965 Ga0070679_100468964
966 Ga0070679_100515342
967 Ga0070679_100987841
968 Ga0070679_101067564
969 Ga0070684_100011551
970 Ga0070684_100107048
971 Ga0070684_100165684
972 Ga0070684_100273521
973 Ga0070684_100312272
974 Ga0070684_100393724
975 Ga0070684_100696362
976 Ga0068853_100000222
977 Ga0068853_100000367
978 Ga0068853_100043702
979 Ga0068853_100070755
980 Ga0068853_100130644
981 Ga0068853_100237710
982 Ga0068853_100327147
983 Ga0068853_100336512
984 Ga0068853_100960524
985 Ga0070665_100005637
986 Ga0070665_100041617
987 Ga0070665_100158518
988 Ga0070665_100181688
989 Ga0070665_100403581
990 Ga0068855_100000277
991 Ga0068855_100002688
992 Ga0068855_100003653
993 Ga0068855_100010384
994 Ga0068855_100035334
995 Ga0068855_100060121
996 Ga0068855_100092013
997 Ga0068855_100169055
998 Ga0068855_100181173
999 Ga0068855_100218171
1000 Ga0068855_100278975
1001 Ga0068855_100301117
1002 Ga0068855_100468401
1003 Ga0068855_100584895
1004 Ga0068855_101193853
1005 Ga0070664_100124085
1006 Ga0070664_100592049
1007 Ga0070664_100734426
1008 Ga0068857_100003191
1009 Ga0068857_100015817
1010 Ga0068857_100306068
1011 Ga0068857_100355705
1012 Ga0068857_101079678
1013 Ga0068854_100000019
1014 Ga0068854_100034075
1015 Ga0068854_100044343
1016 Ga0068856_100003529
1017 Ga0068856_100033069
1018 Ga0068856_100050428
1019 Ga0068856_100057606
1020 Ga0068856_100085887
1021 Ga0068856_100227971
1022 Ga0068856_100413541
1023 Ga0068856_100509145
1024 Ga0068856_100709163
1025 Ga0068852_100000019
1026 Ga0068852_100000097
1027 Ga0068852_100001535
1028 Ga0068852_100097697
1029 Ga0068852_100103163
1030 Ga0068852_100113488
1031 Ga0068852_100161107
1032 Ga0068852_100168947
1033 Ga0068859_100120087
1034 Ga0068864_100000625
1035 Ga0068864_100012167
1036 Ga0068864_100092202
1037 Ga0068851_10016393
1038 Ga0068851_10041070
1039 Ga0068851_10051580
1040 Ga0068851_10058980
1041 Ga0068851_10167950
1042 Ga0068851_10306247
1043 Ga0068863_100001753
1044 Ga0068863_100001814
1045 Ga0068863_100007046
1046 Ga0068858_100014586
1047 Ga0068858_100015914
1048 Ga0068860_100000689
1049 Ga0068860_100510378
1050 Ga0068862_100293795
1051 Ga0070717_10011247
1052 Ga0070717_10011904
1053 Ga0070717_10342393
1054 Ga0070715_10002310
1055 Ga0070716_100059060
1056 Ga0070712_100012762
1057 Ga0070712_100044876
1058 Ga0070712_100340838
1059 Ga0070712_100610888
1060 Ga0097621_100000349
1061 Ga0097621_100360082
1062 Ga0097621_100505098
1063 Ga0068871_100002325
1064 Ga0068871_100788000
1065 Ga0068865_100136913
1066 Ga0075436_100648537
1067 Ga0097620_100120081
1068 Ga0105240_10000372
1069 Ga0105240_10000496
1070 Ga0105240_10001875
1071 Ga0105240_10009346
1072 Ga0105240_10010838
1073 Ga0105240_10030875
1074 Ga0105240_10039085
1075 Ga0105240_10087131
1076 Ga0105240_10097071
1077 Ga0105240_10120373
1078 Ga0105240_10122860
1079 Ga0105240_10152229
1080 Ga0105240_11390657
1081 Ga0105245_10000486
1082 Ga0105245_10021587
1083 Ga0105245_10085606
1084 Ga0105245_10443589
1085 Ga0105245_10513291
1086 Ga0105247_10002346
1087 Ga0105247_10292438
1088 Ga0114129_11396355
1089 Ga0105241_10000026
1090 Ga0105241_10000121
1091 Ga0105241_10002032
1092 Ga0105241_10213745
1093 Ga0105241_10232573
1094 Ga0105242_10298302
1095 Ga0105248_10000019
1096 Ga0105248_10007017
1097 Ga0105248_10016372
1098 Ga0105248_10022327
1099 Ga0105248_10029618
1100 Ga0105248_10042895
1101 Ga0105248_10094941
1102 Ga0105248_10477210
1103 Ga0105248_10578479
1104 Ga0105248_10765535
1105 Ga0105248_10796820
1106 Ga0105237_10000590
1107 Ga0105237_10006331
1108 Ga0105237_10063825
1109 Ga0105237_10137842
1110 Ga0105237_10212808
1111 Ga0105237_10248368
1112 Ga0105237_10575017
1113 Ga0105237_10627141
1114 Ga0105237_10812540
1115 Ga0105238_10000197
1116 Ga0105238_10000509
1117 Ga0105238_10008072
1118 Ga0105238_10023794
1119 Ga0105238_10026652
1120 Ga0105238_10054460
1121 Ga0105238_10078759
1122 Ga0105238_10201945
1123 Ga0105238_10251055
1124 Ga0105238_10314767
1125 Ga0105238_10355224
1126 Ga0105249_10003449
1127 Ga0105249_10081598
1128 Ga0105249_11113285
1129 Ga0105249_11268700
1130 Ga0105239_10001533
1131 Ga0105239_10003046
1132 Ga0105239_10105415
1133 Ga0105239_10246339
1134 Ga0105239_10857536
1135 Ga0105246_10001192
1136 Ga0105246_10119528
1137 Ga0157373_10225234
1138 Ga0157370_10000170
1139 Ga0157370_10010160
1140 Ga0157370_10012988
1141 Ga0157370_10013763
1142 Ga0157370_10046758
1143 Ga0157370_10171680
1144 Ga0157370_10752683
1145 Ga0157369_10000085
1146 Ga0157369_10000430
1147 Ga0157369_10009218
1148 Ga0157369_10012659
1149 Ga0157369_10028989
1150 Ga0157369_10040085
1151 Ga0157369_10042189
1152 Ga0157369_10054976
1153 Ga0157369_10096566
1154 Ga0157369_10098891
1155 Ga0157369_10115794
1156 Ga0157369_10172157
1157 Ga0157369_10192237
1158 Ga0157369_10206790
1159 Ga0157369_10344813
1160 Ga0157369_10371511
1161 Ga0157369_10540699
1162 Ga0157369_10729791
1163 Ga0157369_11101743
1164 Ga0157374_10023020
1165 Ga0157374_10042034
1166 Ga0157374_10084229
1167 Ga0157374_10238777
1168 Ga0157374_10325896
1169 Ga0157374_10447875
1170 Ga0157374_10498754
1171 Ga0157374_10827694
1172 Ga0157378_10023973
1173 Ga0157378_10131240
1174 Ga0163162_10027442
1175 Ga0163162_10158863
1176 Ga0163162_11275508
1177 Ga0157372_10000217
1178 Ga0157372_10002601
1179 Ga0157372_10002611
1180 Ga0157372_10010870
1181 Ga0157372_10063864
1182 Ga0157372_10204729
1183 Ga0157372_10206180
1184 Ga0157372_10348925
1185 Ga0157372_10403380
1186 Ga0157372_10569693
1187 Ga0157375_10057497
1188 Ga0157375_10066677
1189 Ga0157375_10069334
1190 Ga0163163_10001161
1191 Ga0163163_10017757
1192 Ga0163163_10062243
1193 Ga0163163_10580801
1194 Ga0157377_10199620
1195 Ga0157379_10002312
1196 Ga0157379_10048162
1197 Ga0157379_10161237
1198 Ga0157379_10287290
1199 Ga0157379_10308107
1200 Ga0157376_10004372
1201 Ga0157376_10737860
1202 Ga0157376_11689302
1203 Ga0163161_10044573
1204 Ga0213872_10002341
1205 Ga0213872_10034756
1206 Ga0213872_10051363
1207 Ga0213872_10054105
1208 Ga0213875_10000108
1209 Ga0213875_10219442
1210 Ga0213871_10006004
1211 Ga0224572_1008454
1212 Ga0209233_1001442
1213 Ga0207656_10031201
1214 Ga0207656_10031615
1215 Ga0207656_10048760
1216 Ga0207656_10196195
1217 Ga0207656_10364668
1218 Ga0207692_10438543
1219 Ga0207692_10444087
1220 Ga0207710_10317441
1221 Ga0207680_10030474
1222 Ga0207680_10204305
1223 Ga0207647_10078008
1224 Ga0207647_10125849
1225 Ga0207699_10125619
1226 Ga0207699_10680378
1227 Ga0207645_10116005
1228 Ga0207705_10000021
1229 Ga0207705_10002125
1230 Ga0207705_10002923
1231 Ga0207705_10012875
1232 Ga0207705_10021055
1233 Ga0207705_10027435
1234 Ga0207705_10028574
1235 Ga0207705_10107321
1236 Ga0207705_10282735
1237 Ga0207705_10294604
1238 Ga0207705_10332471
1239 Ga0207654_10000054
1240 Ga0207654_10000281
1241 Ga0207654_10000808
1242 Ga0207654_10083730
1243 Ga0207654_10233283
1244 Ga0207654_10251596
1245 Ga0207707_10003864
1246 Ga0207707_10142923
1247 Ga0207707_10322003
1248 Ga0207707_10465465
1249 Ga0207707_10659207
1250 Ga0207695_10000080
1251 Ga0207695_10000113
1252 Ga0207695_10000167
1253 Ga0207695_10000263
1254 Ga0207695_10001106
1255 Ga0207695_10001762
1256 Ga0207695_10033351
1257 Ga0207695_10072087
1258 Ga0207695_10083832
1259 Ga0207695_10090502
1260 Ga0207695_10125292
1261 Ga0207695_10464491
1262 Ga0207695_10723985
1263 Ga0207671_10000065
1264 Ga0207671_10000123
1265 Ga0207671_10000139
1266 Ga0207671_10086096
1267 Ga0207671_10218141
1268 Ga0207693_10002600
1269 Ga0207693_10059168
1270 Ga0207693_10405560
1271 Ga0207663_10016822
1272 Ga0207663_10023940
1273 Ga0207663_10519219
1274 Ga0207660_10111242
1275 Ga0207660_10271414
1276 Ga0207660_10304040
1277 Ga0207657_10004623
1278 Ga0207657_10019482
1279 Ga0207657_10036579
1280 Ga0207657_10205754
1281 Ga0207657_10347439
1282 Ga0207657_10565120
1283 Ga0207649_10031894
1284 Ga0207649_10051782
1285 Ga0207652_10001535
1286 Ga0207652_10036402
1287 Ga0207652_10547214
1288 Ga0207694_10000248
1289 Ga0207694_10000711
1290 Ga0207694_10048093
1291 Ga0207694_10062538
1292 Ga0207694_10078380
1293 Ga0207694_10139468
1294 Ga0207694_10273841
1295 Ga0207694_10522820
1296 Ga0207650_10003582
1297 Ga0207650_10213491
1298 Ga0207687_10000978
1299 Ga0207687_10002372
1300 Ga0207687_10130110
1301 Ga0207687_10350078
1302 Ga0207700_10003745
1303 Ga0207700_10021300
1304 Ga0207700_10058092
1305 Ga0207700_10062682
1306 Ga0207700_10393013
1307 Ga0207700_10394546
1308 Ga0207700_10452458
1309 Ga0207700_10552917
1310 Ga0207700_10678905
1311 Ga0207700_11068310
1312 Ga0207664_10017916
1313 Ga0207664_10071842
1314 Ga0207664_10105160
1315 Ga0207664_10128766
1316 Ga0207664_10205846
1317 Ga0207664_10234262
1318 Ga0207664_10420967
1319 Ga0207664_10527307
1320 Ga0207644_10017923
1321 Ga0207644_10266848
1322 Ga0207690_10050737
1323 Ga0207690_10175486
1324 Ga0207706_10243219
1325 Ga0207686_10373242
1326 Ga0207665_10022539
1327 Ga0207665_10044340
1328 Ga0207665_10052779
1329 Ga0207691_10039961
1330 Ga0207711_10000014
1331 Ga0207711_10004781
1332 Ga0207711_10033255
1333 Ga0207711_10044398
1334 Ga0207711_10065518
1335 Ga0207711_10093223
1336 Ga0207689_11050014
1337 Ga0207661_10001283
1338 Ga0207661_10055710
1339 Ga0207661_10077968
1340 Ga0207661_10078225
1341 Ga0207661_10104793
1342 Ga0207661_10179079
1343 Ga0207661_10475948
1344 Ga0207679_10137102
1345 Ga0207679_10616612
1346 Ga0207667_10000468
1347 Ga0207667_10006194
1348 Ga0207667_10007633
1349 Ga0207667_10009516
1350 Ga0207667_10012818
1351 Ga0207667_10030921
1352 Ga0207667_10035816
1353 Ga0207667_10098554
1354 Ga0207667_10176714
1355 Ga0207667_10198277
1356 Ga0207667_10243021
1357 Ga0207667_10249710
1358 Ga0207667_10294967
1359 Ga0207667_10321631
1360 Ga0207667_10373279
1361 Ga0207667_10979643
1362 Ga0207712_10043097
1363 Ga0207640_10000028
1364 Ga0207640_10024137
1365 Ga0207640_10034716
1366 Ga0207640_10092985
1367 Ga0207640_10286155
1368 Ga0207640_10677227
1369 Ga0207658_10003428
1370 Ga0207677_10000143
1371 Ga0207677_10154976
1372 Ga0207677_10192193
1373 Ga0207677_10322859
1374 Ga0207703_10004820
1375 Ga0207703_10123186
1376 Ga0207639_10000088
1377 Ga0207639_10000371
1378 Ga0207639_10014115
1379 Ga0207639_10016992
1380 Ga0207639_10054301
1381 Ga0207639_10129182
1382 Ga0207639_10154385
1383 Ga0207639_10211214
1384 Ga0207639_10520451
1385 Ga0207639_10748403
1386 Ga0207678_10006398
1387 Ga0207678_10229059
1388 Ga0207678_10336767
1389 Ga0207678_10500580
1390 Ga0207678_10575718
1391 Ga0207702_10001334
1392 Ga0207702_10005816
1393 Ga0207702_10017932
1394 Ga0207702_10034912
1395 Ga0207702_10070171
1396 Ga0207702_10306913
1397 Ga0207702_10888883
1398 Ga0207702_10989030
1399 Ga0207702_11043759
1400 Ga0207641_10005346
1401 Ga0207641_10021590
1402 Ga0207641_10037049
1403 Ga0207641_10306612
1404 Ga0207676_10055374
1405 Ga0207676_10159038
1406 Ga0207676_10508123
1407 Ga0207674_10000669
1408 Ga0207674_10142769
1409 Ga0207674_10148285
1410 Ga0207674_10201213
1411 Ga0207674_10293248
1412 Ga0207674_10294723
1413 Ga0207674_10305491
1414 Ga0207683_10028240
1415 Ga0207683_10262222
1416 Ga0207698_10000003
1417 Ga0207698_10000708
1418 Ga0207698_10003525
1419 Ga0207698_10031875
1420 Ga0207698_10036682
1421 Ga0207698_10059852
1422 Ga0207698_10215710
1423 Ga0207698_10464681
1424 Ga0265356_1004445
1425 Ga0268266_10005265
1426 Ga0268266_10006399
1427 Ga0268266_10008807
1428 Ga0268266_10078240
1429 Ga0268266_10188892
1430 Ga0268265_10562240
1431 Ga0268264_10000598
1432 Ga0265319_1044472
1433 Ga0265334_10130983
1434 Ga0265318_10011054
1435 Ga0265318_10076123
1436 Ga0265336_10001048
1437 Ga0265336_10005708
1438 Ga0265338_10004495
1439 Ga0265338_10005157
1440 Ga0265338_10009284
1441 Ga0265338_10017734
1442 Ga0265338_10040619
1443 Ga0265338_10099138
1444 Ga0265338_10259829
1445 Ga0265338_10268771
1446 Ga0265338_10527691
1447 Ga0265338_10610317
1448 Ga0265324_10009104
1449 Ga0265324_10026321
1450 Ga0265330_10000273
1451 Ga0265330_10001219
1452 Ga0265330_10011435
1453 Ga0265330_10030656
1454 Ga0265330_10072643
1455 Ga0265330_10120309
1456 Ga0265330_10126058
1457 Ga0265332_10054533
1458 Ga0265332_10280342
1459 Ga0265328_10001272
1460 Ga0265328_10005053
1461 Ga0265328_10011186
1462 Ga0265320_10003664
1463 Ga0265325_10000266
1464 Ga0265325_10000695
1465 Ga0265325_10005858
1466 Ga0265325_10087985
1467 Ga0265325_10098913
1468 Ga0265329_10011153
1469 Ga0265329_10011996
1470 Ga0265340_10001072
1471 Ga0265340_10012505
1472 Ga0265340_10015610
1473 Ga0265340_10096350
1474 Ga0265340_10171805
1475 Ga0265339_10000114
1476 Ga0265339_10000124
1477 Ga0265339_10000194
1478 Ga0265339_10003213
1479 Ga0265339_10009288
1480 Ga0265339_10021882
1481 Ga0265339_10028825
1482 Ga0265339_10165558
1483 Ga0265331_10073017
1484 Ga0265331_10111778
1485 Ga0265327_10267568
1486 Ga0265316_10000352
1487 Ga0265316_10000712
1488 Ga0265316_10003105
1489 Ga0265316_10006699
1490 Ga0265316_10008382
1491 Ga0265316_10018630
1492 Ga0265316_10022409
1493 Ga0265316_10129073
1494 Ga0265316_10136596
1495 Ga0265316_10177577
1496 Ga0265313_10002216
1497 Ga0265313_10004714
1498 Ga0265313_10046248
1499 Ga0265313_10068916
1500 Ga0265313_10137519
1501 Ga0265313_10187633
1502 Ga0265313_10227340
1503 Ga0265314_10000504
1504 Ga0265314_10002987
1505 Ga0265314_10034859
1506 Ga0265314_10117019
1507 Ga0265342_10000225
1508 Ga0265342_10001536
1509 Ga0265342_10002164
1510 Ga0265342_10002441
1511 Ga0265342_10014061
1512 Ga0265342_10027916
1513 Ga0265342_10029908
1514 Ga0265342_10045350
1515 Ga0265342_10069670
1516 Ga0265342_10136398
1517 Ga0265342_10188592
1518 Ga0265342_10332508
1519 Ga0316583_10095825
1520 Ga0307510_10010774
1521 Ga0307510_10212472
1522 Ga0307510_10223248
1523 Ga0316215_1003489
1524 Ga0373926_0000675
1525 Ga0373954_0036836
1526 Ga0373954_0294562
1527 Ga0373956_0061195
1528 Ga0373956_0153569
1529 Ga0373943_0001291
1530 Ga0373946_0000821
1531 Ga0373955_0149693
1532 Ga0373924_0000243
1533 Ga0373924_0093250
1534 Ga0373935_0012297
1535 Ga0373935_0829003
1536 Ga0373927_0004411
1537 Ga0373947_0112424
1538 Ga0373937_0007405
1539 Ga0373937_0065583
1540 Ga0373925_0060693
1541 Ga0395900_0025848
1542 Ga0395900_0389492
1543 Ga0395898_0027814
1544 Ga0395898_0117975
1545 Ga0395898_0546082
1546 Ga0436364_0115933
1547 Ga0436364_0147107
1548 Ga0436364_0354157
1549 Ga0395901_0310997
1550 Ga0395901_0513053
1551 Ga0436365_0590507
1552 Ga0436360_1067871
1553 Ga0436360_1280163
1554 Ga0436361_0318263
1555 Ga0436361_0387230
1556 Ga0436361_0497072
1557 Ga0436361_0500168
1558 Ga0436361_0732319
1559 Ga0436361_1103679
1560 Ga0436363_0331024
1561 Ga0466966_0149285
1562 Ga0466961_0055286
1563 Ga0466963_0000494
1564 Ga0466963_0107210
1565 Ga0466970_0244720
1566 Ga0466957_0026837
1567 Ga0466959_0382284
1568 Ga0451576_0873383
1569 Ga0466967_0001401
1570 Ga0466967_0046813
1571 Ga0466967_0111253
1572 Ga0495617_026479
1573 Ga0495603_0039419
1574 Ga0495629_0029674
1575 Ga0495629_0049585
1576 Ga0495629_0060065
1577 Ga0495629_0137756
1578 Ga0495638_0445383
1579 Ga0495651_0053044
1580 Ga0495653_0010749
1581 Ga0495650_0000038
1582 Ga0495580_0120910
1583 Ga0495580_0156212
1584 Ga0495580_0326733
1585 Ga0495580_0497340
1586 Ga0495582_0001853
1587 Ga0495582_0095987
1588 Ga0495639_0004538
1589 Ga0495662_0005660
1590 Ga0495664_0001348
1591 Ga0495664_0057856
1592 Ga0495585_0085882
1593 Ga0495594_0000388
1594 Ga0495594_0001190
1595 Ga0495594_0004431
1596 Ga0495583_0033822
1597 Ga0495606_0044975
1598 Ga0495606_0067569
1599 Ga0495630_0270870
1600 Ga0495644_0000048
1601 Ga0495666_0001196
1602 Ga0495642_0019216
1603 Ga0495652_0006640
1604 Ga0495652_0043862
1605 Ga0495665_0001828
1606 Ga0495665_0243362
1607 Ga0495640_0004801
1608 Ga0495640_0112414
1609 Ga0495586_0019711
1610 Ga0495586_0197397
1611 Ga0495587_0093692
1612 Ga0495609_0011141
1613 Ga0495609_0080699
1614 Ga0495645_0053835
1615 Ga0495645_0213338
1616 Ga0495633_0051416
1617 Ga0495667_0150787
1618 Ga0495668_0128921
1619 Ga0495634_0006225
1620 Ga0495611_0005877
1621 Ga0495625_0000985
1622 Ga0495625_0007833
1623 Ga0495625_0026175
1624 Ga0495625_0034121
1625 Ga0495625_0089152
1626 Ga0495625_0381016
1627 Ga0495625_0434634
1628 Ga0495635_0002836
1629 Ga0495659_0114237
1630 Ga0495661_0026784
1631 Ga0495657_0277857
1632 Ga0495599_0242663
1633 Ga0495599_0548749
1634 Ga0495623_0008357
1635 Ga0495623_0410809
1636 Ga0495646_0013211
1637 Ga0495646_0023225
1638 Ga0495646_0222729
1639 Ga0495669_0004252
1640 Ga0495669_0370251
1641 Ga0495613_0003966
1642 Ga0495613_0018773
1643 Ga0495613_0038534
1644 Ga0495613_0109799
1645 Ga0495624_0007524
1646 Ga0495624_0174027
1647 Ga0495671_0095768
1648 Ga0495649_0012107
1649 Ga0495600_0012858
1650 Ga0495600_0172644
1651 Ga0495581_0001976
1652 Ga0495604_0002834
1653 Ga0495674_0014334
1654 Ga0495672_0021506
1655 Ga0495672_0063127
1656 Ga0495676_0008961
1657 Ga0495683_0174509
1658 Ga0495675_0012974
1659 Ga0495673_0231467
1660 Ga0495684_0099043
1661 Ga0495686_0000178
1662 Ga0495686_0001621
1663 Ga0495686_0008419
1664 Ga0495686_0047439
1665 Ga0495686_0085891
1666 Ga0495602_0081301
1667 Ga0495602_0236738
1668 Ga0495614_0000972
1669 Ga0496100_0314419
1670 Ga0496100_0725168
1671 Ga0496102_0344146
1672 Ga0496102_0851610
1673 Ga0496104_0000053
1674 Ga0496104_0056645
1675 Ga0496104_0071299
1676 Ga0496104_0438058
1677 Ga0496104_0659933
1678 Ga0496104_0726557
1679 Ga0496104_0798050
1680 Ga0496105_0001615
1681 Ga0496105_0057832
1682 Ga0496106_0042478
1683 Ga0496108_0134232
1684 Ga0496109_0316949
1685 Ga0496111_0044511
1686 Ga0496111_0158175
1687 Ga0496111_0303736
1688 Ga0496112_0021005
1689 Ga0496112_0150505
1690 Ga0496112_0467738
1691 Ga0496113_0084737
1692 Ga0496115_0085005
1693 Ga0496115_0091617
1694 Ga0496115_0273258
1695 Ga0496115_0373480
1696 Ga0496121_0365824
1697 Ga0496126_0000100
1698 Ga0496126_0000154
1699 Ga0496126_0078490
1700 Ga0501032_0001912
1701 Ga0501033_0028282
1702 Ga0501033_0115308
1703 Ga0501033_0637612
1704 Ga0501034_0148520
1705 Ga0501036_0076344
1706 Ga0501037_0391740
1707 Ga0501037_0492477
1708 Ga0501038_0048143
1709 Ga0501038_0085946
1710 Ga0501043_0003983
1711 Ga0501046_0000056
1712 Ga0501047_0008947
1713 Ga0501047_0066914
1714 Ga0501073_0110559
1715 Ga0501073_0110594
1716 Ga0501074_0196241
1717 Ga0501080_0188110
1718 Ga0501083_0147296
1719 Ga0501035_0044540
1720 Ga0501035_0377603
1721 Ga0501035_0469538
1722 Ga0501044_0027240
1723 Ga0501044_0095095
1724 Ga0501044_0417372
1725 Ga0501044_0690521
1726 nmdc:mga06r32_320162_c1
1727 Ga0495601_0167705
1728 Ga0495619_0140913
1729 Ga0500643_109394
1730 Ga0500651_0000005
1731 Ga0500595_000004
1732 Ga0500595_007997
1733 Ga0500595_058334
1734 Ga0500595_079031
1735 Ga0500661_003309
1736 Ga0501082_0213946
1737 Ga0530510_0265842
1738 2884217798

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

44

182

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9463 34 217
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9437 36 217
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9435 36 217
4mu3-assembly1.cif.gz_A the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution 0.9416 34 218
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9364 34 217
ID Description Score Start End Superfamily
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9662 124 214 3.30.230.40
4qnkD01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9607 34 121 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9561 124 214 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9531 124 217 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9434 124 217 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A850D107-F1-model_v4 deleted 1 35 95
AF-A0A7X6NPR2-F1-model_v4 deleted 0.9949 36 114
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9937 37 111 GO:0000105
GO:0004424
AF-A0A7V8WEL3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9936 37 100 GO:0000105
GO:0004424
AF-A0A257PNR5-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9928 35 114 GO:0000105
GO:0004424

Map