F484117
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 869 | 282 | 1738 | 206 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10165459|Ga0157370_101654592 |
| Length | 203 |
| Sequence | MTMTKTTAAKALKVRTGTVKRDTTETQIALKLVIDGQGVYKVSTGIRFFDHMLELFTRHGGFDLTLKCTGDLDVDQHHTVEDVGIALGEAFDKKGIMRAGYFVMAMDETLAVAAVDLSGRVAYVVDDKVKVRLVGDFQSELLADFFDGFARGAKANVHVKTMYGRSNHHKIEAIFKAFARALRGACSRDERMREMLPSTKGLL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 35 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 55 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 81 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 82 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 83 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 84 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 137 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 138 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 139 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 147 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 148 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 149 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 153 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 179 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 180 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 181 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 182 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 183 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 184 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 256 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 277 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 278 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 279 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 280 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 282 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 0 |
| Rhizoplane | 3.11 |
| Rhizosphere | 94.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10165459 | 3300013104 | Bacteria | 2057 |
| 2 | JGI25165J46597_1013739 | 3300003214 | Bacteria | 1109 |
| 3 | rootH2_10009426 | 3300003320 | Bacteria | 39179 |
| 4 | Ga0065712_10479514 | 3300005290 | Bacteria | 664 |
| 5 | Ga0070658_10000121 | 3300005327 | Bacteria | 70439 |
| 6 | Ga0070658_10021582 | 3300005327 | Bacteria | 5160 |
| 7 | Ga0070658_10071707 | 3300005327 | Bacteria | 2837 |
| 8 | Ga0070658_10112053 | 3300005327 | Bacteria | 2261 |
| 9 | Ga0070658_10196354 | 3300005327 | Bacteria | 1702 |
| 10 | Ga0070658_10205977 | 3300005327 | Bacteria | 1661 |
| 11 | Ga0070658_10272828 | 3300005327 | Unclassified | 1439 |
| 12 | Ga0070676_10067377 | 3300005328 | Bacteria | 2140 |
| 13 | Ga0070683_100002041 | 3300005329 | Bacteria | 15901 |
| 14 | Ga0070683_100028772 | 3300005329 | Bacteria | 5025 |
| 15 | Ga0070683_100060569 | 3300005329 | Bacteria | 3518 |
| 16 | Ga0070683_100062351 | 3300005329 | Bacteria | 3467 |
| 17 | Ga0070683_100221096 | 3300005329 | Bacteria | 1800 |
| 18 | Ga0070683_100285059 | 3300005329 | Bacteria | 1571 |
| 19 | Ga0070670_100079127 | 3300005331 | Bacteria | 2825 |
| 20 | Ga0068869_100095013 | 3300005334 | Bacteria | 2248 |
| 21 | Ga0068869_100247235 | 3300005334 | Bacteria | 1423 |
| 22 | Ga0070666_10055265 | 3300005335 | Bacteria | 2680 |
| 23 | Ga0070666_10070170 | 3300005335 | Bacteria | 2383 |
| 24 | Ga0070682_100242035 | 3300005337 | Bacteria | 1295 |
| 25 | Ga0068868_100000066 | 3300005338 | Bacteria | 59945 |
| 26 | Ga0068868_100065060 | 3300005338 | Bacteria | 2896 |
| 27 | Ga0068868_100081115 | 3300005338 | Bacteria | 2600 |
| 28 | Ga0068868_100488108 | 3300005338 | Bacteria | 1077 |
| 29 | Ga0070660_100008313 | 3300005339 | Bacteria | 7255 |
| 30 | Ga0070660_100155643 | 3300005339 | Bacteria | 1839 |
| 31 | Ga0070660_100232314 | 3300005339 | Unclassified | 1501 |
| 32 | Ga0070660_100637198 | 3300005339 | Unclassified | 892 |
| 33 | Ga0070660_100663456 | 3300005339 | Bacteria | 874 |
| 34 | Ga0070661_100019981 | 3300005344 | Bacteria | 4774 |
| 35 | Ga0070661_100050615 | 3300005344 | Bacteria | 3040 |
| 36 | Ga0070661_100066000 | 3300005344 | Bacteria | 2659 |
| 37 | Ga0070661_100153801 | 3300005344 | Bacteria | 1740 |
| 38 | Ga0070661_100701045 | 3300005344 | Unclassified | 825 |
| 39 | Ga0070668_100695790 | 3300005347 | Bacteria | 896 |
| 40 | Ga0070671_100003123 | 3300005355 | Bacteria | 12901 |
| 41 | Ga0070671_100050619 | 3300005355 | Bacteria | 3455 |
| 42 | Ga0070671_100117926 | 3300005355 | Bacteria | 2232 |
| 43 | Ga0070671_100446435 | 3300005355 | Bacteria | 1109 |
| 44 | Ga0070673_100070243 | 3300005364 | Bacteria | 2809 |
| 45 | Ga0070673_100191444 | 3300005364 | Bacteria | 1757 |
| 46 | Ga0070659_100004580 | 3300005366 | Bacteria | 9889 |
| 47 | Ga0070659_100138892 | 3300005366 | Bacteria | 1978 |
| 48 | Ga0070659_100234782 | 3300005366 | Bacteria | 1516 |
| 49 | Ga0070659_100689205 | 3300005366 | Bacteria | 883 |
| 50 | Ga0070667_100046288 | 3300005367 | Bacteria | 3659 |
| 51 | Ga0070667_100246795 | 3300005367 | Bacteria | 1595 |
| 52 | Ga0070709_10166887 | 3300005434 | Unclassified | 1535 |
| 53 | Ga0070709_10356466 | 3300005434 | Bacteria | 1082 |
| 54 | Ga0070709_10501912 | 3300005434 | Unclassified | 922 |
| 55 | Ga0070714_100002654 | 3300005435 | Bacteria | 13178 |
| 56 | Ga0070714_100091602 | 3300005435 | Bacteria | 2664 |
| 57 | Ga0070714_100105232 | 3300005435 | Unclassified | 2491 |
| 58 | Ga0070714_100116911 | 3300005435 | Bacteria | 2368 |
| 59 | Ga0070714_100154671 | 3300005435 | Bacteria | 2069 |
| 60 | Ga0070714_100161553 | 3300005435 | Bacteria | 2027 |
| 61 | Ga0070714_100188384 | 3300005435 | Bacteria | 1881 |
| 62 | Ga0070714_100200420 | 3300005435 | Bacteria | 1825 |
| 63 | Ga0070713_100003005 | 3300005436 | Bacteria | 11079 |
| 64 | Ga0070713_100023543 | 3300005436 | Bacteria | 4780 |
| 65 | Ga0070713_100082409 | 3300005436 | Bacteria | 2747 |
| 66 | Ga0070713_100162511 | 3300005436 | Bacteria | 1994 |
| 67 | Ga0070713_100196366 | 3300005436 | Bacteria | 1820 |
| 68 | Ga0070713_100257582 | 3300005436 | Bacteria | 1593 |
| 69 | Ga0070713_100433308 | 3300005436 | Bacteria | 1232 |
| 70 | Ga0070713_100631919 | 3300005436 | Unclassified | 1019 |
| 71 | Ga0070713_101077027 | 3300005436 | Bacteria | 776 |
| 72 | Ga0070710_10032530 | 3300005437 | Bacteria | 2826 |
| 73 | Ga0070710_10192885 | 3300005437 | Bacteria | 1282 |
| 74 | Ga0070710_10266048 | 3300005437 | Bacteria | 1107 |
| 75 | Ga0070711_100019179 | 3300005439 | Bacteria | 4384 |
| 76 | Ga0070711_100022563 | 3300005439 | Bacteria | 4081 |
| 77 | Ga0070711_100775332 | 3300005439 | Bacteria | 812 |
| 78 | Ga0070663_100053467 | 3300005455 | Bacteria | 2883 |
| 79 | Ga0070663_100130863 | 3300005455 | Bacteria | 1905 |
| 80 | Ga0070663_100182632 | 3300005455 | Bacteria | 1628 |
| 81 | Ga0070663_100321159 | 3300005455 | Bacteria | 1245 |
| 82 | Ga0070663_100479477 | 3300005455 | Bacteria | 1029 |
| 83 | Ga0070663_100498539 | 3300005455 | Bacteria | 1011 |
| 84 | Ga0070678_100600428 | 3300005456 | Bacteria | 983 |
| 85 | Ga0070662_100215752 | 3300005457 | Bacteria | 1529 |
| 86 | Ga0070681_10001050 | 3300005458 | Bacteria | 23493 |
| 87 | Ga0070681_10095557 | 3300005458 | Bacteria | 2920 |
| 88 | Ga0070681_10589316 | 3300005458 | Bacteria | 1026 |
| 89 | Ga0070681_10966872 | 3300005458 | Bacteria | 771 |
| 90 | Ga0068867_100354254 | 3300005459 | Bacteria | 1226 |
| 91 | Ga0070679_100003993 | 3300005530 | Bacteria | 13587 |
| 92 | Ga0070679_100006128 | 3300005530 | Bacteria | 11185 |
| 93 | Ga0070679_100135818 | 3300005530 | Bacteria | 2440 |
| 94 | Ga0070679_100162327 | 3300005530 | Bacteria | 2209 |
| 95 | Ga0070679_100369870 | 3300005530 | Bacteria | 1381 |
| 96 | Ga0070679_100468964 | 3300005530 | Bacteria | 1203 |
| 97 | Ga0070679_100515342 | 3300005530 | Bacteria | 1140 |
| 98 | Ga0070679_100987841 | 3300005530 | Bacteria | 786 |
| 99 | Ga0070679_101067564 | 3300005530 | Bacteria | 752 |
| 100 | Ga0070684_100011551 | 3300005535 | Bacteria | 7035 |
| 101 | Ga0070684_100107048 | 3300005535 | Bacteria | 2504 |
| 102 | Ga0070684_100165684 | 3300005535 | Bacteria | 2006 |
| 103 | Ga0070684_100273521 | 3300005535 | Bacteria | 1547 |
| 104 | Ga0070684_100312272 | 3300005535 | Bacteria | 1443 |
| 105 | Ga0070684_100393724 | 3300005535 | Bacteria | 1277 |
| 106 | Ga0070684_100696362 | 3300005535 | Bacteria | 947 |
| 107 | Ga0068853_100000222 | 3300005539 | Bacteria | 40206 |
| 108 | Ga0068853_100000367 | 3300005539 | Bacteria | 31060 |
| 109 | Ga0068853_100043702 | 3300005539 | Bacteria | 3833 |
| 110 | Ga0068853_100070755 | 3300005539 | Bacteria | 3037 |
| 111 | Ga0068853_100130644 | 3300005539 | Bacteria | 2248 |
| 112 | Ga0068853_100237710 | 3300005539 | Bacteria | 1669 |
| 113 | Ga0068853_100327147 | 3300005539 | Bacteria | 1422 |
| 114 | Ga0068853_100336512 | 3300005539 | Bacteria | 1402 |
| 115 | Ga0068853_100960524 | 3300005539 | Bacteria | 822 |
| 116 | Ga0070665_100005637 | 3300005548 | Bacteria | 12872 |
| 117 | Ga0070665_100041617 | 3300005548 | Bacteria | 4619 |
| 118 | Ga0070665_100158518 | 3300005548 | Bacteria | 2265 |
| 119 | Ga0070665_100181688 | 3300005548 | Bacteria | 2104 |
| 120 | Ga0070665_100403581 | 3300005548 | Bacteria | 1375 |
| 121 | Ga0068855_100000277 | 3300005563 | Bacteria | 63213 |
| 122 | Ga0068855_100002688 | 3300005563 | Bacteria | 21925 |
| 123 | Ga0068855_100003653 | 3300005563 | Bacteria | 18822 |
| 124 | Ga0068855_100010384 | 3300005563 | Bacteria | 11233 |
| 125 | Ga0068855_100035334 | 3300005563 | Bacteria | 5953 |
| 126 | Ga0068855_100060121 | 3300005563 | Bacteria | 4444 |
| 127 | Ga0068855_100092013 | 3300005563 | Bacteria | 3498 |
| 128 | Ga0068855_100169055 | 3300005563 | Bacteria | 2477 |
| 129 | Ga0068855_100181173 | 3300005563 | Bacteria | 2381 |
| 130 | Ga0068855_100218171 | 3300005563 | Bacteria | 2140 |
| 131 | Ga0068855_100278975 | 3300005563 | Bacteria | 1856 |
| 132 | Ga0068855_100301117 | 3300005563 | Bacteria | 1775 |
| 133 | Ga0068855_100468401 | 3300005563 | Bacteria | 1373 |
| 134 | Ga0068855_100584895 | 3300005563 | Bacteria | 1205 |
| 135 | Ga0068855_101193853 | 3300005563 | Bacteria | 791 |
| 136 | Ga0070664_100124085 | 3300005564 | Bacteria | 2263 |
| 137 | Ga0070664_100592049 | 3300005564 | Bacteria | 1028 |
| 138 | Ga0070664_100734426 | 3300005564 | Bacteria | 921 |
| 139 | Ga0068857_100003191 | 3300005577 | Bacteria | 13595 |
| 140 | Ga0068857_100015817 | 3300005577 | Bacteria | 6601 |
| 141 | Ga0068857_100306068 | 3300005577 | Bacteria | 1466 |
| 142 | Ga0068857_100355705 | 3300005577 | Bacteria | 1357 |
| 143 | Ga0068857_101079678 | 3300005577 | Bacteria | 775 |
| 144 | Ga0068854_100000019 | 3300005578 | Bacteria | 134145 |
| 145 | Ga0068854_100034075 | 3300005578 | Bacteria | 3554 |
| 146 | Ga0068854_100044343 | 3300005578 | Bacteria | 3156 |
| 147 | Ga0068856_100003529 | 3300005614 | Bacteria | 15773 |
| 148 | Ga0068856_100033069 | 3300005614 | Bacteria | 5063 |
| 149 | Ga0068856_100050428 | 3300005614 | Bacteria | 4103 |
| 150 | Ga0068856_100057606 | 3300005614 | Bacteria | 3836 |
| 151 | Ga0068856_100085887 | 3300005614 | Bacteria | 3126 |
| 152 | Ga0068856_100227971 | 3300005614 | Bacteria | 1878 |
| 153 | Ga0068856_100413541 | 3300005614 | Bacteria | 1369 |
| 154 | Ga0068856_100509145 | 3300005614 | Bacteria | 1225 |
| 155 | Ga0068856_100709163 | 3300005614 | Bacteria | 1026 |
| 156 | Ga0068852_100000019 | 3300005616 | Bacteria | 129021 |
| 157 | Ga0068852_100000097 | 3300005616 | Bacteria | 59430 |
| 158 | Ga0068852_100001535 | 3300005616 | Bacteria | 15668 |
| 159 | Ga0068852_100097697 | 3300005616 | Bacteria | 2642 |
| 160 | Ga0068852_100103163 | 3300005616 | Bacteria | 2579 |
| 161 | Ga0068852_100113488 | 3300005616 | Bacteria | 2468 |
| 162 | Ga0068852_100161107 | 3300005616 | Bacteria | 2095 |
| 163 | Ga0068852_100168947 | 3300005616 | Bacteria | 2048 |
| 164 | Ga0068859_100120087 | 3300005617 | Bacteria | 2695 |
| 165 | Ga0068864_100000625 | 3300005618 | Bacteria | 29830 |
| 166 | Ga0068864_100012167 | 3300005618 | Bacteria | 7112 |
| 167 | Ga0068864_100092202 | 3300005618 | Bacteria | 2674 |
| 168 | Ga0068851_10016393 | 3300005834 | Bacteria | 3544 |
| 169 | Ga0068851_10041070 | 3300005834 | Bacteria | 2326 |
| 170 | Ga0068851_10051580 | 3300005834 | Bacteria | 2090 |
| 171 | Ga0068851_10058980 | 3300005834 | Bacteria | 1963 |
| 172 | Ga0068851_10167950 | 3300005834 | Bacteria | 1209 |
| 173 | Ga0068851_10306247 | 3300005834 | Unclassified | 915 |
| 174 | Ga0068863_100001753 | 3300005841 | Bacteria | 21524 |
| 175 | Ga0068863_100001814 | 3300005841 | Bacteria | 21208 |
| 176 | Ga0068863_100007046 | 3300005841 | Bacteria | 11016 |
| 177 | Ga0068858_100014586 | 3300005842 | Bacteria | 7404 |
| 178 | Ga0068858_100015914 | 3300005842 | Bacteria | 7067 |
| 179 | Ga0068860_100000689 | 3300005843 | Bacteria | 38878 |
| 180 | Ga0068860_100510378 | 3300005843 | Bacteria | 1201 |
| 181 | Ga0068862_100293795 | 3300005844 | Bacteria | 1493 |
| 182 | Ga0070717_10011247 | 3300006028 | Bacteria | 6789 |
| 183 | Ga0070717_10011904 | 3300006028 | Bacteria | 6620 |
| 184 | Ga0070717_10342393 | 3300006028 | Bacteria | 1335 |
| 185 | Ga0070715_10002310 | 3300006163 | Bacteria | 5819 |
| 186 | Ga0070716_100059060 | 3300006173 | Bacteria | 2210 |
| 187 | Ga0070712_100012762 | 3300006175 | Bacteria | 5347 |
| 188 | Ga0070712_100044876 | 3300006175 | Bacteria | 3049 |
| 189 | Ga0070712_100340838 | 3300006175 | Bacteria | 1224 |
| 190 | Ga0070712_100610888 | 3300006175 | Bacteria | 924 |
| 191 | Ga0097621_100000349 | 3300006237 | Bacteria | 31779 |
| 192 | Ga0097621_100360082 | 3300006237 | Bacteria | 1296 |
| 193 | Ga0097621_100505098 | 3300006237 | Bacteria | 1095 |
| 194 | Ga0068871_100002325 | 3300006358 | Bacteria | 12946 |
| 195 | Ga0068871_100788000 | 3300006358 | Bacteria | 875 |
| 196 | Ga0068865_100136913 | 3300006881 | Bacteria | 1842 |
| 197 | Ga0075436_100648537 | 3300006914 | Bacteria | 780 |
| 198 | Ga0097620_100120081 | 3300006931 | Bacteria | 2695 |
| 199 | Ga0105240_10000372 | 3300009093 | Bacteria | 84325 |
| 200 | Ga0105240_10000496 | 3300009093 | Bacteria | 72575 |
| 201 | Ga0105240_10001875 | 3300009093 | Bacteria | 34957 |
| 202 | Ga0105240_10009346 | 3300009093 | Bacteria | 13895 |
| 203 | Ga0105240_10010838 | 3300009093 | Bacteria | 12767 |
| 204 | Ga0105240_10030875 | 3300009093 | Bacteria | 6960 |
| 205 | Ga0105240_10039085 | 3300009093 | Bacteria | 6080 |
| 206 | Ga0105240_10087131 | 3300009093 | Bacteria | 3824 |
| 207 | Ga0105240_10097071 | 3300009093 | Bacteria | 3591 |
| 208 | Ga0105240_10120373 | 3300009093 | Bacteria | 3161 |
| 209 | Ga0105240_10122860 | 3300009093 | Bacteria | 3124 |
| 210 | Ga0105240_10152229 | 3300009093 | Bacteria | 2754 |
| 211 | Ga0105240_11390657 | 3300009093 | Bacteria | 738 |
| 212 | Ga0105245_10000486 | 3300009098 | Bacteria | 36378 |
| 213 | Ga0105245_10021587 | 3300009098 | Bacteria | 5650 |
| 214 | Ga0105245_10085606 | 3300009098 | Bacteria | 2889 |
| 215 | Ga0105245_10443589 | 3300009098 | Bacteria | 1305 |
| 216 | Ga0105245_10513291 | 3300009098 | Bacteria | 1216 |
| 217 | Ga0105247_10002346 | 3300009101 | Bacteria | 12922 |
| 218 | Ga0105247_10292438 | 3300009101 | Bacteria | 1127 |
| 219 | Ga0114129_11396355 | 3300009147 | Bacteria | 864 |
| 220 | Ga0105241_10000026 | 3300009174 | Bacteria | 132695 |
| 221 | Ga0105241_10000121 | 3300009174 | Bacteria | 57041 |
| 222 | Ga0105241_10002032 | 3300009174 | Bacteria | 15308 |
| 223 | Ga0105241_10213745 | 3300009174 | Bacteria | 1617 |
| 224 | Ga0105241_10232573 | 3300009174 | Unclassified | 1554 |
| 225 | Ga0105242_10298302 | 3300009176 | Unclassified | 1470 |
| 226 | Ga0105248_10000019 | 3300009177 | Bacteria | 285766 |
| 227 | Ga0105248_10007017 | 3300009177 | Bacteria | 12337 |
| 228 | Ga0105248_10016372 | 3300009177 | Bacteria | 8160 |
| 229 | Ga0105248_10022327 | 3300009177 | Bacteria | 7018 |
| 230 | Ga0105248_10029618 | 3300009177 | Bacteria | 6107 |
| 231 | Ga0105248_10042895 | 3300009177 | Bacteria | 5072 |
| 232 | Ga0105248_10094941 | 3300009177 | Bacteria | 3358 |
| 233 | Ga0105248_10477210 | 3300009177 | Bacteria | 1406 |
| 234 | Ga0105248_10578479 | 3300009177 | Bacteria | 1267 |
| 235 | Ga0105248_10765535 | 3300009177 | Bacteria | 1089 |
| 236 | Ga0105248_10796820 | 3300009177 | Bacteria | 1066 |
| 237 | Ga0105237_10000590 | 3300009545 | Bacteria | 50564 |
| 238 | Ga0105237_10006331 | 3300009545 | Bacteria | 13155 |
| 239 | Ga0105237_10063825 | 3300009545 | Bacteria | 3680 |
| 240 | Ga0105237_10137842 | 3300009545 | Bacteria | 2434 |
| 241 | Ga0105237_10212808 | 3300009545 | Bacteria | 1932 |
| 242 | Ga0105237_10248368 | 3300009545 | Bacteria | 1781 |
| 243 | Ga0105237_10575017 | 3300009545 | Bacteria | 1134 |
| 244 | Ga0105237_10627141 | 3300009545 | Bacteria | 1082 |
| 245 | Ga0105237_10812540 | 3300009545 | Bacteria | 942 |
| 246 | Ga0105238_10000197 | 3300009551 | Bacteria | 66637 |
| 247 | Ga0105238_10000509 | 3300009551 | Bacteria | 40868 |
| 248 | Ga0105238_10008072 | 3300009551 | Bacteria | 10529 |
| 249 | Ga0105238_10023794 | 3300009551 | Bacteria | 6244 |
| 250 | Ga0105238_10026652 | 3300009551 | Bacteria | 5892 |
| 251 | Ga0105238_10054460 | 3300009551 | Bacteria | 4017 |
| 252 | Ga0105238_10078759 | 3300009551 | Bacteria | 3286 |
| 253 | Ga0105238_10201945 | 3300009551 | Bacteria | 1963 |
| 254 | Ga0105238_10251055 | 3300009551 | Bacteria | 1747 |
| 255 | Ga0105238_10314767 | 3300009551 | Bacteria | 1550 |
| 256 | Ga0105238_10355224 | 3300009551 | Bacteria | 1455 |
| 257 | Ga0105249_10003449 | 3300009553 | Bacteria | 13698 |
| 258 | Ga0105249_10081598 | 3300009553 | Bacteria | 3006 |
| 259 | Ga0105249_11113285 | 3300009553 | Unclassified | 860 |
| 260 | Ga0105249_11268700 | 3300009553 | Bacteria | 808 |
| 261 | Ga0105239_10001533 | 3300010375 | Bacteria | 30534 |
| 262 | Ga0105239_10003046 | 3300010375 | Bacteria | 20836 |
| 263 | Ga0105239_10105415 | 3300010375 | Bacteria | 3122 |
| 264 | Ga0105239_10246339 | 3300010375 | Bacteria | 2007 |
| 265 | Ga0105239_10857536 | 3300010375 | Bacteria | 1042 |
| 266 | Ga0105246_10001192 | 3300011119 | Bacteria | 15150 |
| 267 | Ga0105246_10119528 | 3300011119 | Bacteria | 1950 |
| 268 | Ga0157373_10225234 | 3300013100 | Bacteria | 1323 |
| 269 | Ga0157370_10000170 | 3300013104 | Bacteria | 80529 |
| 270 | Ga0157370_10010160 | 3300013104 | Bacteria | 9939 |
| 271 | Ga0157370_10012988 | 3300013104 | Bacteria | 8605 |
| 272 | Ga0157370_10013763 | 3300013104 | Bacteria | 8313 |
| 273 | Ga0157370_10046758 | 3300013104 | Unclassified | 4149 |
| 274 | Ga0157370_10171680 | 3300013104 | Bacteria | 2016 |
| 275 | Ga0157370_10752683 | 3300013104 | Bacteria | 888 |
| 276 | Ga0157369_10000085 | 3300013105 | Bacteria | 129025 |
| 277 | Ga0157369_10000430 | 3300013105 | Bacteria | 55736 |
| 278 | Ga0157369_10009218 | 3300013105 | Bacteria | 11289 |
| 279 | Ga0157369_10012659 | 3300013105 | Bacteria | 9566 |
| 280 | Ga0157369_10028989 | 3300013105 | Bacteria | 6121 |
| 281 | Ga0157369_10040085 | 3300013105 | Bacteria | 5115 |
| 282 | Ga0157369_10042189 | 3300013105 | Bacteria | 4977 |
| 283 | Ga0157369_10054976 | 3300013105 | Bacteria | 4298 |
| 284 | Ga0157369_10096566 | 3300013105 | Bacteria | 3153 |
| 285 | Ga0157369_10098891 | 3300013105 | Bacteria | 3110 |
| 286 | Ga0157369_10115794 | 3300013105 | Bacteria | 2847 |
| 287 | Ga0157369_10172157 | 3300013105 | Bacteria | 2281 |
| 288 | Ga0157369_10192237 | 3300013105 | Bacteria | 2144 |
| 289 | Ga0157369_10206790 | 3300013105 | Bacteria | 2058 |
| 290 | Ga0157369_10344813 | 3300013105 | Unclassified | 1547 |
| 291 | Ga0157369_10371511 | 3300013105 | Bacteria | 1484 |
| 292 | Ga0157369_10540699 | 3300013105 | Bacteria | 1204 |
| 293 | Ga0157369_10729791 | 3300013105 | Bacteria | 1020 |
| 294 | Ga0157369_11101743 | 3300013105 | Bacteria | 812 |
| 295 | Ga0157374_10023020 | 3300013296 | Bacteria | 5565 |
| 296 | Ga0157374_10042034 | 3300013296 | Bacteria | 4215 |
| 297 | Ga0157374_10084229 | 3300013296 | Bacteria | 3022 |
| 298 | Ga0157374_10238777 | 3300013296 | Bacteria | 1787 |
| 299 | Ga0157374_10325896 | 3300013296 | Bacteria | 1523 |
| 300 | Ga0157374_10447875 | 3300013296 | Bacteria | 1292 |
| 301 | Ga0157374_10498754 | 3300013296 | Bacteria | 1222 |
| 302 | Ga0157374_10827694 | 3300013296 | Bacteria | 942 |
| 303 | Ga0157378_10023973 | 3300013297 | Bacteria | 5367 |
| 304 | Ga0157378_10131240 | 3300013297 | Bacteria | 2319 |
| 305 | Ga0163162_10027442 | 3300013306 | Bacteria | 5631 |
| 306 | Ga0163162_10158863 | 3300013306 | Bacteria | 2382 |
| 307 | Ga0163162_11275508 | 3300013306 | Bacteria | 834 |
| 308 | Ga0157372_10000217 | 3300013307 | Bacteria | 63667 |
| 309 | Ga0157372_10002601 | 3300013307 | Bacteria | 19543 |
| 310 | Ga0157372_10002611 | 3300013307 | Bacteria | 19494 |
| 311 | Ga0157372_10010870 | 3300013307 | Bacteria | 9688 |
| 312 | Ga0157372_10063864 | 3300013307 | Bacteria | 4130 |
| 313 | Ga0157372_10204729 | 3300013307 | Bacteria | 2286 |
| 314 | Ga0157372_10206180 | 3300013307 | Bacteria | 2278 |
| 315 | Ga0157372_10348925 | 3300013307 | Bacteria | 1724 |
| 316 | Ga0157372_10403380 | 3300013307 | Bacteria | 1593 |
| 317 | Ga0157372_10569693 | 3300013307 | Bacteria | 1320 |
| 318 | Ga0157375_10057497 | 3300013308 | Bacteria | 3845 |
| 319 | Ga0157375_10066677 | 3300013308 | Bacteria | 3595 |
| 320 | Ga0157375_10069334 | 3300013308 | Bacteria | 3532 |
| 321 | Ga0163163_10001161 | 3300014325 | Bacteria | 22403 |
| 322 | Ga0163163_10017757 | 3300014325 | Bacteria | 6641 |
| 323 | Ga0163163_10062243 | 3300014325 | Bacteria | 3697 |
| 324 | Ga0163163_10580801 | 3300014325 | Bacteria | 1184 |
| 325 | Ga0157377_10199620 | 3300014745 | Bacteria | 1269 |
| 326 | Ga0157379_10002312 | 3300014968 | Bacteria | 15882 |
| 327 | Ga0157379_10048162 | 3300014968 | Bacteria | 3804 |
| 328 | Ga0157379_10161237 | 3300014968 | Bacteria | 2024 |
| 329 | Ga0157379_10287290 | 3300014968 | Bacteria | 1497 |
| 330 | Ga0157379_10308107 | 3300014968 | Bacteria | 1444 |
| 331 | Ga0157376_10004372 | 3300014969 | Bacteria | 9831 |
| 332 | Ga0157376_10737860 | 3300014969 | Bacteria | 993 |
| 333 | Ga0157376_11689302 | 3300014969 | Bacteria | 668 |
| 334 | Ga0163161_10044573 | 3300017792 | Bacteria | 3195 |
| 335 | Ga0213872_10002341 | 3300021361 | Bacteria | 11261 |
| 336 | Ga0213872_10034756 | 3300021361 | Bacteria | 2306 |
| 337 | Ga0213872_10051363 | 3300021361 | Bacteria | 1871 |
| 338 | Ga0213872_10054105 | 3300021361 | Bacteria | 1820 |
| 339 | Ga0213875_10000108 | 3300021388 | Bacteria | 94421 |
| 340 | Ga0213875_10219442 | 3300021388 | Bacteria | 896 |
| 341 | Ga0213871_10006004 | 3300021441 | Bacteria | 2545 |
| 342 | Ga0224572_1008454 | 3300024225 | Bacteria | 1903 |
| 343 | Ga0209233_1001442 | 3300025261 | Bacteria | 9385 |
| 344 | Ga0207656_10031201 | 3300025321 | Bacteria | 2206 |
| 345 | Ga0207656_10031615 | 3300025321 | Bacteria | 2194 |
| 346 | Ga0207656_10048760 | 3300025321 | Bacteria | 1824 |
| 347 | Ga0207656_10196195 | 3300025321 | Bacteria | 974 |
| 348 | Ga0207656_10364668 | 3300025321 | Bacteria | 722 |
| 349 | Ga0207692_10438543 | 3300025898 | Bacteria | 820 |
| 350 | Ga0207692_10444087 | 3300025898 | Bacteria | 815 |
| 351 | Ga0207710_10317441 | 3300025900 | Bacteria | 789 |
| 352 | Ga0207680_10030474 | 3300025903 | Bacteria | 3043 |
| 353 | Ga0207680_10204305 | 3300025903 | Bacteria | 1348 |
| 354 | Ga0207647_10078008 | 3300025904 | Bacteria | 1990 |
| 355 | Ga0207647_10125849 | 3300025904 | Bacteria | 1508 |
| 356 | Ga0207699_10125619 | 3300025906 | Bacteria | 1665 |
| 357 | Ga0207699_10680378 | 3300025906 | Bacteria | 752 |
| 358 | Ga0207645_10116005 | 3300025907 | Bacteria | 1736 |
| 359 | Ga0207705_10000021 | 3300025909 | Bacteria | 309436 |
| 360 | Ga0207705_10002125 | 3300025909 | Bacteria | 15376 |
| 361 | Ga0207705_10002923 | 3300025909 | Bacteria | 13059 |
| 362 | Ga0207705_10012875 | 3300025909 | Bacteria | 6038 |
| 363 | Ga0207705_10021055 | 3300025909 | Bacteria | 4651 |
| 364 | Ga0207705_10027435 | 3300025909 | Bacteria | 4060 |
| 365 | Ga0207705_10028574 | 3300025909 | Bacteria | 3976 |
| 366 | Ga0207705_10107321 | 3300025909 | Bacteria | 2060 |
| 367 | Ga0207705_10282735 | 3300025909 | Bacteria | 1270 |
| 368 | Ga0207705_10294604 | 3300025909 | Bacteria | 1243 |
| 369 | Ga0207705_10332471 | 3300025909 | Bacteria | 1169 |
| 370 | Ga0207654_10000054 | 3300025911 | Bacteria | 82347 |
| 371 | Ga0207654_10000281 | 3300025911 | Bacteria | 30979 |
| 372 | Ga0207654_10000808 | 3300025911 | Bacteria | 17242 |
| 373 | Ga0207654_10083730 | 3300025911 | Bacteria | 1926 |
| 374 | Ga0207654_10233283 | 3300025911 | Bacteria | 1226 |
| 375 | Ga0207654_10251596 | 3300025911 | Bacteria | 1185 |
| 376 | Ga0207707_10003864 | 3300025912 | Bacteria | 13285 |
| 377 | Ga0207707_10142923 | 3300025912 | Unclassified | 2092 |
| 378 | Ga0207707_10322003 | 3300025912 | Bacteria | 1335 |
| 379 | Ga0207707_10465465 | 3300025912 | Bacteria | 1081 |
| 380 | Ga0207707_10659207 | 3300025912 | Bacteria | 881 |
| 381 | Ga0207695_10000080 | 3300025913 | Bacteria | 287868 |
| 382 | Ga0207695_10000113 | 3300025913 | Bacteria | 247240 |
| 383 | Ga0207695_10000167 | 3300025913 | Bacteria | 194371 |
| 384 | Ga0207695_10000263 | 3300025913 | Bacteria | 132894 |
| 385 | Ga0207695_10001106 | 3300025913 | Bacteria | 46871 |
| 386 | Ga0207695_10001762 | 3300025913 | Bacteria | 34278 |
| 387 | Ga0207695_10033351 | 3300025913 | Bacteria | 5617 |
| 388 | Ga0207695_10072087 | 3300025913 | Bacteria | 3526 |
| 389 | Ga0207695_10083832 | 3300025913 | Bacteria | 3219 |
| 390 | Ga0207695_10090502 | 3300025913 | Bacteria | 3075 |
| 391 | Ga0207695_10125292 | 3300025913 | Bacteria | 2532 |
| 392 | Ga0207695_10464491 | 3300025913 | Bacteria | 1149 |
| 393 | Ga0207695_10723985 | 3300025913 | Bacteria | 875 |
| 394 | Ga0207671_10000065 | 3300025914 | Bacteria | 166743 |
| 395 | Ga0207671_10000123 | 3300025914 | Bacteria | 119385 |
| 396 | Ga0207671_10000139 | 3300025914 | Bacteria | 111786 |
| 397 | Ga0207671_10086096 | 3300025914 | Bacteria | 2362 |
| 398 | Ga0207671_10218141 | 3300025914 | Bacteria | 1494 |
| 399 | Ga0207693_10002600 | 3300025915 | Bacteria | 15685 |
| 400 | Ga0207693_10059168 | 3300025915 | Bacteria | 3001 |
| 401 | Ga0207693_10405560 | 3300025915 | Bacteria | 1065 |
| 402 | Ga0207663_10016822 | 3300025916 | Bacteria | 4066 |
| 403 | Ga0207663_10023940 | 3300025916 | Bacteria | 3512 |
| 404 | Ga0207663_10519219 | 3300025916 | Bacteria | 927 |
| 405 | Ga0207660_10111242 | 3300025917 | Bacteria | 2061 |
| 406 | Ga0207660_10271414 | 3300025917 | Bacteria | 1344 |
| 407 | Ga0207660_10304040 | 3300025917 | Bacteria | 1270 |
| 408 | Ga0207657_10004623 | 3300025919 | Bacteria | 14538 |
| 409 | Ga0207657_10019482 | 3300025919 | Bacteria | 6442 |
| 410 | Ga0207657_10036579 | 3300025919 | Bacteria | 4393 |
| 411 | Ga0207657_10205754 | 3300025919 | Bacteria | 1581 |
| 412 | Ga0207657_10347439 | 3300025919 | Unclassified | 1170 |
| 413 | Ga0207657_10565120 | 3300025919 | Bacteria | 889 |
| 414 | Ga0207649_10031894 | 3300025920 | Bacteria | 3135 |
| 415 | Ga0207649_10051782 | 3300025920 | Bacteria | 2544 |
| 416 | Ga0207652_10001535 | 3300025921 | Bacteria | 20348 |
| 417 | Ga0207652_10036402 | 3300025921 | Bacteria | 4160 |
| 418 | Ga0207652_10547214 | 3300025921 | Bacteria | 1040 |
| 419 | Ga0207694_10000248 | 3300025924 | Bacteria | 51461 |
| 420 | Ga0207694_10000711 | 3300025924 | Bacteria | 29920 |
| 421 | Ga0207694_10048093 | 3300025924 | Bacteria | 3300 |
| 422 | Ga0207694_10062538 | 3300025924 | Bacteria | 2898 |
| 423 | Ga0207694_10078380 | 3300025924 | Bacteria | 2590 |
| 424 | Ga0207694_10139468 | 3300025924 | Bacteria | 1949 |
| 425 | Ga0207694_10273841 | 3300025924 | Bacteria | 1385 |
| 426 | Ga0207694_10522820 | 3300025924 | Bacteria | 994 |
| 427 | Ga0207650_10003582 | 3300025925 | Bacteria | 10655 |
| 428 | Ga0207650_10213491 | 3300025925 | Bacteria | 1550 |
| 429 | Ga0207687_10000978 | 3300025927 | Bacteria | 19404 |
| 430 | Ga0207687_10002372 | 3300025927 | Bacteria | 12792 |
| 431 | Ga0207687_10130110 | 3300025927 | Bacteria | 1896 |
| 432 | Ga0207687_10350078 | 3300025927 | Bacteria | 1203 |
| 433 | Ga0207700_10003745 | 3300025928 | Bacteria | 8878 |
| 434 | Ga0207700_10021300 | 3300025928 | Bacteria | 4424 |
| 435 | Ga0207700_10058092 | 3300025928 | Bacteria | 2921 |
| 436 | Ga0207700_10062682 | 3300025928 | Bacteria | 2824 |
| 437 | Ga0207700_10393013 | 3300025928 | Bacteria | 1214 |
| 438 | Ga0207700_10394546 | 3300025928 | Bacteria | 1212 |
| 439 | Ga0207700_10452458 | 3300025928 | Bacteria | 1132 |
| 440 | Ga0207700_10552917 | 3300025928 | Unclassified | 1022 |
| 441 | Ga0207700_10678905 | 3300025928 | Bacteria | 919 |
| 442 | Ga0207700_11068310 | 3300025928 | Bacteria | 722 |
| 443 | Ga0207664_10017916 | 3300025929 | Bacteria | 5203 |
| 444 | Ga0207664_10071842 | 3300025929 | Unclassified | 2789 |
| 445 | Ga0207664_10105160 | 3300025929 | Bacteria | 2339 |
| 446 | Ga0207664_10128766 | 3300025929 | Bacteria | 2128 |
| 447 | Ga0207664_10205846 | 3300025929 | Bacteria | 1700 |
| 448 | Ga0207664_10234262 | 3300025929 | Bacteria | 1597 |
| 449 | Ga0207664_10420967 | 3300025929 | Bacteria | 1190 |
| 450 | Ga0207664_10527307 | 3300025929 | Bacteria | 1059 |
| 451 | Ga0207644_10017923 | 3300025931 | Bacteria | 4788 |
| 452 | Ga0207644_10266848 | 3300025931 | Bacteria | 1370 |
| 453 | Ga0207690_10050737 | 3300025932 | Bacteria | 2771 |
| 454 | Ga0207690_10175486 | 3300025932 | Bacteria | 1609 |
| 455 | Ga0207706_10243219 | 3300025933 | Bacteria | 1573 |
| 456 | Ga0207686_10373242 | 3300025934 | Bacteria | 1080 |
| 457 | Ga0207665_10022539 | 3300025939 | Bacteria | 4144 |
| 458 | Ga0207665_10044340 | 3300025939 | Bacteria | 2976 |
| 459 | Ga0207665_10052779 | 3300025939 | Bacteria | 2739 |
| 460 | Ga0207691_10039961 | 3300025940 | Bacteria | 4338 |
| 461 | Ga0207711_10000014 | 3300025941 | Bacteria | 506753 |
| 462 | Ga0207711_10004781 | 3300025941 | Bacteria | 11494 |
| 463 | Ga0207711_10033255 | 3300025941 | Bacteria | 4362 |
| 464 | Ga0207711_10044398 | 3300025941 | Bacteria | 3794 |
| 465 | Ga0207711_10065518 | 3300025941 | Bacteria | 3141 |
| 466 | Ga0207711_10093223 | 3300025941 | Bacteria | 2652 |
| 467 | Ga0207689_11050014 | 3300025942 | Unclassified | 687 |
| 468 | Ga0207661_10001283 | 3300025944 | Bacteria | 16799 |
| 469 | Ga0207661_10055710 | 3300025944 | Bacteria | 3172 |
| 470 | Ga0207661_10077968 | 3300025944 | Bacteria | 2726 |
| 471 | Ga0207661_10078225 | 3300025944 | Bacteria | 2722 |
| 472 | Ga0207661_10104793 | 3300025944 | Bacteria | 2382 |
| 473 | Ga0207661_10179079 | 3300025944 | Bacteria | 1850 |
| 474 | Ga0207661_10475948 | 3300025944 | Bacteria | 1140 |
| 475 | Ga0207679_10137102 | 3300025945 | Bacteria | 1972 |
| 476 | Ga0207679_10616612 | 3300025945 | Bacteria | 979 |
| 477 | Ga0207667_10000468 | 3300025949 | Bacteria | 53974 |
| 478 | Ga0207667_10006194 | 3300025949 | Bacteria | 14522 |
| 479 | Ga0207667_10007633 | 3300025949 | Bacteria | 12958 |
| 480 | Ga0207667_10009516 | 3300025949 | Bacteria | 11434 |
| 481 | Ga0207667_10012818 | 3300025949 | Bacteria | 9632 |
| 482 | Ga0207667_10030921 | 3300025949 | Bacteria | 5786 |
| 483 | Ga0207667_10035816 | 3300025949 | Bacteria | 5323 |
| 484 | Ga0207667_10098554 | 3300025949 | Bacteria | 3016 |
| 485 | Ga0207667_10176714 | 3300025949 | Bacteria | 2193 |
| 486 | Ga0207667_10198277 | 3300025949 | Bacteria | 2059 |
| 487 | Ga0207667_10243021 | 3300025949 | Bacteria | 1842 |
| 488 | Ga0207667_10249710 | 3300025949 | Bacteria | 1815 |
| 489 | Ga0207667_10294967 | 3300025949 | Bacteria | 1656 |
| 490 | Ga0207667_10321631 | 3300025949 | Bacteria | 1580 |
| 491 | Ga0207667_10373279 | 3300025949 | Bacteria | 1453 |
| 492 | Ga0207667_10979643 | 3300025949 | Bacteria | 834 |
| 493 | Ga0207712_10043097 | 3300025961 | Bacteria | 3111 |
| 494 | Ga0207640_10000028 | 3300025981 | Bacteria | 135727 |
| 495 | Ga0207640_10024137 | 3300025981 | Bacteria | 3664 |
| 496 | Ga0207640_10034716 | 3300025981 | Bacteria | 3150 |
| 497 | Ga0207640_10092985 | 3300025981 | Bacteria | 2094 |
| 498 | Ga0207640_10286155 | 3300025981 | Bacteria | 1297 |
| 499 | Ga0207640_10677227 | 3300025981 | Bacteria | 882 |
| 500 | Ga0207658_10003428 | 3300025986 | Bacteria | 11222 |
| 501 | Ga0207677_10000143 | 3300026023 | Bacteria | 58337 |
| 502 | Ga0207677_10154976 | 3300026023 | Bacteria | 1773 |
| 503 | Ga0207677_10192193 | 3300026023 | Bacteria | 1615 |
| 504 | Ga0207677_10322859 | 3300026023 | Bacteria | 1283 |
| 505 | Ga0207703_10004820 | 3300026035 | Bacteria | 10980 |
| 506 | Ga0207703_10123186 | 3300026035 | Bacteria | 2228 |
| 507 | Ga0207639_10000088 | 3300026041 | Bacteria | 78742 |
| 508 | Ga0207639_10000371 | 3300026041 | Bacteria | 31074 |
| 509 | Ga0207639_10014115 | 3300026041 | Bacteria | 5610 |
| 510 | Ga0207639_10016992 | 3300026041 | Bacteria | 5155 |
| 511 | Ga0207639_10054301 | 3300026041 | Bacteria | 3061 |
| 512 | Ga0207639_10129182 | 3300026041 | Bacteria | 2089 |
| 513 | Ga0207639_10154385 | 3300026041 | Bacteria | 1927 |
| 514 | Ga0207639_10211214 | 3300026041 | Bacteria | 1671 |
| 515 | Ga0207639_10520451 | 3300026041 | Bacteria | 1089 |
| 516 | Ga0207639_10748403 | 3300026041 | Bacteria | 909 |
| 517 | Ga0207678_10006398 | 3300026067 | Bacteria | 10461 |
| 518 | Ga0207678_10229059 | 3300026067 | Bacteria | 1591 |
| 519 | Ga0207678_10336767 | 3300026067 | Bacteria | 1300 |
| 520 | Ga0207678_10500580 | 3300026067 | Bacteria | 1059 |
| 521 | Ga0207678_10575718 | 3300026067 | Bacteria | 986 |
| 522 | Ga0207702_10001334 | 3300026078 | Bacteria | 24682 |
| 523 | Ga0207702_10005816 | 3300026078 | Bacteria | 10726 |
| 524 | Ga0207702_10017932 | 3300026078 | Bacteria | 5856 |
| 525 | Ga0207702_10034912 | 3300026078 | Bacteria | 4205 |
| 526 | Ga0207702_10070171 | 3300026078 | Bacteria | 3013 |
| 527 | Ga0207702_10306913 | 3300026078 | Bacteria | 1507 |
| 528 | Ga0207702_10888883 | 3300026078 | Bacteria | 883 |
| 529 | Ga0207702_10989030 | 3300026078 | Bacteria | 834 |
| 530 | Ga0207702_11043759 | 3300026078 | Bacteria | 811 |
| 531 | Ga0207641_10005346 | 3300026088 | Bacteria | 10965 |
| 532 | Ga0207641_10021590 | 3300026088 | Bacteria | 5290 |
| 533 | Ga0207641_10037049 | 3300026088 | Bacteria | 4072 |
| 534 | Ga0207641_10306612 | 3300026088 | Bacteria | 1501 |
| 535 | Ga0207676_10055374 | 3300026095 | Bacteria | 3113 |
| 536 | Ga0207676_10159038 | 3300026095 | Bacteria | 1955 |
| 537 | Ga0207676_10508123 | 3300026095 | Bacteria | 1145 |
| 538 | Ga0207674_10000669 | 3300026116 | Bacteria | 44573 |
| 539 | Ga0207674_10142769 | 3300026116 | Bacteria | 2353 |
| 540 | Ga0207674_10148285 | 3300026116 | Bacteria | 2303 |
| 541 | Ga0207674_10201213 | 3300026116 | Bacteria | 1941 |
| 542 | Ga0207674_10293248 | 3300026116 | Bacteria | 1575 |
| 543 | Ga0207674_10294723 | 3300026116 | Bacteria | 1571 |
| 544 | Ga0207674_10305491 | 3300026116 | Bacteria | 1540 |
| 545 | Ga0207683_10028240 | 3300026121 | Bacteria | 4851 |
| 546 | Ga0207683_10262222 | 3300026121 | Bacteria | 1578 |
| 547 | Ga0207698_10000003 | 3300026142 | Bacteria | 321303 |
| 548 | Ga0207698_10000708 | 3300026142 | Bacteria | 19330 |
| 549 | Ga0207698_10003525 | 3300026142 | Bacteria | 9436 |
| 550 | Ga0207698_10031875 | 3300026142 | Bacteria | 3811 |
| 551 | Ga0207698_10036682 | 3300026142 | Bacteria | 3601 |
| 552 | Ga0207698_10059852 | 3300026142 | Unclassified | 2959 |
| 553 | Ga0207698_10215710 | 3300026142 | Bacteria | 1730 |
| 554 | Ga0207698_10464681 | 3300026142 | Bacteria | 1224 |
| 555 | Ga0265356_1004445 | 3300028017 | Bacteria | 1714 |
| 556 | Ga0268266_10005265 | 3300028379 | Bacteria | 12146 |
| 557 | Ga0268266_10006399 | 3300028379 | Bacteria | 10792 |
| 558 | Ga0268266_10008807 | 3300028379 | Bacteria | 8937 |
| 559 | Ga0268266_10078240 | 3300028379 | Bacteria | 2877 |
| 560 | Ga0268266_10188892 | 3300028379 | Bacteria | 1880 |
| 561 | Ga0268265_10562240 | 3300028380 | Bacteria | 1084 |
| 562 | Ga0268264_10000598 | 3300028381 | Bacteria | 43640 |
| 563 | Ga0265319_1044472 | 3300028563 | Bacteria | 1488 |
| 564 | Ga0265334_10130983 | 3300028573 | Bacteria | 892 |
| 565 | Ga0265318_10011054 | 3300028577 | Bacteria | 3903 |
| 566 | Ga0265318_10076123 | 3300028577 | Bacteria | 1242 |
| 567 | Ga0265336_10001048 | 3300028666 | Bacteria | 13512 |
| 568 | Ga0265336_10005708 | 3300028666 | Bacteria | 4561 |
| 569 | Ga0265338_10004495 | 3300028800 | Bacteria | 18805 |
| 570 | Ga0265338_10005157 | 3300028800 | Bacteria | 17175 |
| 571 | Ga0265338_10009284 | 3300028800 | Bacteria | 11764 |
| 572 | Ga0265338_10017734 | 3300028800 | Bacteria | 7656 |
| 573 | Ga0265338_10040619 | 3300028800 | Bacteria | 4367 |
| 574 | Ga0265338_10099138 | 3300028800 | Bacteria | 2381 |
| 575 | Ga0265338_10259829 | 3300028800 | Bacteria | 1277 |
| 576 | Ga0265338_10268771 | 3300028800 | Bacteria | 1250 |
| 577 | Ga0265338_10527691 | 3300028800 | Bacteria | 829 |
| 578 | Ga0265338_10610317 | 3300028800 | Bacteria | 759 |
| 579 | Ga0265324_10009104 | 3300029957 | Bacteria | 3896 |
| 580 | Ga0265324_10026321 | 3300029957 | Bacteria | 2059 |
| 581 | Ga0265330_10000273 | 3300031235 | Bacteria | 38107 |
| 582 | Ga0265330_10001219 | 3300031235 | Bacteria | 15180 |
| 583 | Ga0265330_10011435 | 3300031235 | Bacteria | 4163 |
| 584 | Ga0265330_10030656 | 3300031235 | Bacteria | 2413 |
| 585 | Ga0265330_10072643 | 3300031235 | Bacteria | 1488 |
| 586 | Ga0265330_10120309 | 3300031235 | Bacteria | 1119 |
| 587 | Ga0265330_10126058 | 3300031235 | Bacteria | 1090 |
| 588 | Ga0265332_10054533 | 3300031238 | Unclassified | 1715 |
| 589 | Ga0265332_10280342 | 3300031238 | Bacteria | 689 |
| 590 | Ga0265328_10001272 | 3300031239 | Bacteria | 11639 |
| 591 | Ga0265328_10005053 | 3300031239 | Bacteria | 5684 |
| 592 | Ga0265328_10011186 | 3300031239 | Bacteria | 3591 |
| 593 | Ga0265320_10003664 | 3300031240 | Bacteria | 10255 |
| 594 | Ga0265325_10000266 | 3300031241 | Bacteria | 37071 |
| 595 | Ga0265325_10000695 | 3300031241 | Bacteria | 24506 |
| 596 | Ga0265325_10005858 | 3300031241 | Bacteria | 7531 |
| 597 | Ga0265325_10087985 | 3300031241 | Bacteria | 1535 |
| 598 | Ga0265325_10098913 | 3300031241 | Bacteria | 1430 |
| 599 | Ga0265329_10011153 | 3300031242 | Bacteria | 3272 |
| 600 | Ga0265329_10011996 | 3300031242 | Bacteria | 3132 |
| 601 | Ga0265340_10001072 | 3300031247 | Bacteria | 15563 |
| 602 | Ga0265340_10012505 | 3300031247 | Bacteria | 4481 |
| 603 | Ga0265340_10015610 | 3300031247 | Bacteria | 3945 |
| 604 | Ga0265340_10096350 | 3300031247 | Bacteria | 1378 |
| 605 | Ga0265340_10171805 | 3300031247 | Bacteria | 982 |
| 606 | Ga0265339_10000114 | 3300031249 | Bacteria | 65609 |
| 607 | Ga0265339_10000124 | 3300031249 | Bacteria | 64124 |
| 608 | Ga0265339_10000194 | 3300031249 | Bacteria | 50375 |
| 609 | Ga0265339_10003213 | 3300031249 | Bacteria | 11471 |
| 610 | Ga0265339_10009288 | 3300031249 | Bacteria | 6193 |
| 611 | Ga0265339_10021882 | 3300031249 | Bacteria | 3711 |
| 612 | Ga0265339_10028825 | 3300031249 | Bacteria | 3154 |
| 613 | Ga0265339_10165558 | 3300031249 | Bacteria | 1110 |
| 614 | Ga0265331_10073017 | 3300031250 | Bacteria | 1602 |
| 615 | Ga0265331_10111778 | 3300031250 | Bacteria | 1253 |
| 616 | Ga0265327_10267568 | 3300031251 | Bacteria | 758 |
| 617 | Ga0265316_10000352 | 3300031344 | Bacteria | 51670 |
| 618 | Ga0265316_10000712 | 3300031344 | Bacteria | 36687 |
| 619 | Ga0265316_10003105 | 3300031344 | Bacteria | 16919 |
| 620 | Ga0265316_10006699 | 3300031344 | Bacteria | 10976 |
| 621 | Ga0265316_10008382 | 3300031344 | Bacteria | 9600 |
| 622 | Ga0265316_10018630 | 3300031344 | Bacteria | 5963 |
| 623 | Ga0265316_10022409 | 3300031344 | Bacteria | 5325 |
| 624 | Ga0265316_10129073 | 3300031344 | Bacteria | 1905 |
| 625 | Ga0265316_10136596 | 3300031344 | Bacteria | 1844 |
| 626 | Ga0265316_10177577 | 3300031344 | Bacteria | 1586 |
| 627 | Ga0265313_10002216 | 3300031595 | Bacteria | 17122 |
| 628 | Ga0265313_10004714 | 3300031595 | Bacteria | 10288 |
| 629 | Ga0265313_10046248 | 3300031595 | Bacteria | 2113 |
| 630 | Ga0265313_10068916 | 3300031595 | Bacteria | 1633 |
| 631 | Ga0265313_10137519 | 3300031595 | Bacteria | 1053 |
| 632 | Ga0265313_10187633 | 3300031595 | Bacteria | 866 |
| 633 | Ga0265313_10227340 | 3300031595 | Bacteria | 767 |
| 634 | Ga0265314_10000504 | 3300031711 | Bacteria | 50376 |
| 635 | Ga0265314_10002987 | 3300031711 | Bacteria | 16745 |
| 636 | Ga0265314_10034859 | 3300031711 | Bacteria | 3672 |
| 637 | Ga0265314_10117019 | 3300031711 | Bacteria | 1685 |
| 638 | Ga0265342_10000225 | 3300031712 | Bacteria | 63822 |
| 639 | Ga0265342_10001536 | 3300031712 | Bacteria | 21355 |
| 640 | Ga0265342_10002164 | 3300031712 | Bacteria | 17314 |
| 641 | Ga0265342_10002441 | 3300031712 | Bacteria | 16049 |
| 642 | Ga0265342_10014061 | 3300031712 | Bacteria | 5326 |
| 643 | Ga0265342_10027916 | 3300031712 | Bacteria | 3520 |
| 644 | Ga0265342_10029908 | 3300031712 | Bacteria | 3379 |
| 645 | Ga0265342_10045350 | 3300031712 | Bacteria | 2646 |
| 646 | Ga0265342_10069670 | 3300031712 | Bacteria | 2053 |
| 647 | Ga0265342_10136398 | 3300031712 | Bacteria | 1371 |
| 648 | Ga0265342_10188592 | 3300031712 | Bacteria | 1126 |
| 649 | Ga0265342_10332508 | 3300031712 | Bacteria | 794 |
| 650 | Ga0316583_10095825 | 3300032133 | Bacteria | 1035 |
| 651 | Ga0307510_10010774 | 3300033180 | Bacteria | 10874 |
| 652 | Ga0307510_10212472 | 3300033180 | Bacteria | 1455 |
| 653 | Ga0307510_10223248 | 3300033180 | Bacteria | 1393 |
| 654 | Ga0316215_1003489 | 3300033544 | Bacteria | 1498 |
| 655 | Ga0373926_0000675 | 3300035083 | Bacteria | 9381 |
| 656 | Ga0373954_0036836 | 3300035118 | Bacteria | 2272 |
| 657 | Ga0373954_0294562 | 3300035118 | Bacteria | 800 |
| 658 | Ga0373956_0061195 | 3300035119 | Bacteria | 1705 |
| 659 | Ga0373956_0153569 | 3300035119 | Unclassified | 1083 |
| 660 | Ga0373943_0001291 | 3300035170 | Bacteria | 11240 |
| 661 | Ga0373946_0000821 | 3300035171 | Bacteria | 10594 |
| 662 | Ga0373955_0149693 | 3300035172 | Bacteria | 1373 |
| 663 | Ga0373924_0000243 | 3300035410 | Bacteria | 16627 |
| 664 | Ga0373924_0093250 | 3300035410 | Bacteria | 1290 |
| 665 | Ga0373935_0012297 | 3300035692 | Bacteria | 5149 |
| 666 | Ga0373935_0829003 | 3300035692 | Bacteria | 683 |
| 667 | Ga0373927_0004411 | 3300035695 | Bacteria | 9864 |
| 668 | Ga0373947_0112424 | 3300035725 | Unclassified | 1722 |
| 669 | Ga0373937_0007405 | 3300036401 | Bacteria | 9499 |
| 670 | Ga0373937_0065583 | 3300036401 | Bacteria | 3343 |
| 671 | Ga0373925_0060693 | 3300037068 | Unclassified | 2839 |
| 672 | Ga0395900_0025848 | 3300037418 | Bacteria | 6011 |
| 673 | Ga0395900_0389492 | 3300037418 | Bacteria | 1360 |
| 674 | Ga0395898_0027814 | 3300037466 | Bacteria | 5670 |
| 675 | Ga0395898_0117975 | 3300037466 | Bacteria | 2542 |
| 676 | Ga0395898_0546082 | 3300037466 | Bacteria | 1101 |
| 677 | Ga0436364_0115933 | 3300037853 | Bacteria | 94405 |
| 678 | Ga0436364_0147107 | 3300037853 | Unclassified | 2317 |
| 679 | Ga0436364_0354157 | 3300037853 | Bacteria | 1857 |
| 680 | Ga0395901_0310997 | 3300038443 | Bacteria | 1632 |
| 681 | Ga0395901_0513053 | 3300038443 | Bacteria | 1219 |
| 682 | Ga0436365_0590507 | 3300039437 | Bacteria | 1029 |
| 683 | Ga0436360_1067871 | 3300039438 | Archaea | 894 |
| 684 | Ga0436360_1280163 | 3300039438 | Bacteria | 848 |
| 685 | Ga0436361_0318263 | 3300039447 | Bacteria | 10520 |
| 686 | Ga0436361_0387230 | 3300039447 | Bacteria | 1246 |
| 687 | Ga0436361_0497072 | 3300039447 | Bacteria | 714 |
| 688 | Ga0436361_0500168 | 3300039447 | Bacteria | 41610 |
| 689 | Ga0436361_0732319 | 3300039447 | Bacteria | 1755 |
| 690 | Ga0436361_1103679 | 3300039447 | Bacteria | 1360 |
| 691 | Ga0436363_0331024 | 3300039450 | Unclassified | 1311 |
| 692 | Ga0466966_0149285 | 3300044684 | Bacteria | 1426 |
| 693 | Ga0466961_0055286 | 3300044693 | Bacteria | 2531 |
| 694 | Ga0466963_0000494 | 3300044694 | Bacteria | 18341 |
| 695 | Ga0466963_0107210 | 3300044694 | Bacteria | 1916 |
| 696 | Ga0466970_0244720 | 3300044765 | Bacteria | 1004 |
| 697 | Ga0466957_0026837 | 3300044842 | Bacteria | 3419 |
| 698 | Ga0466959_0382284 | 3300045049 | Bacteria | 958 |
| 699 | Ga0451576_0873383 | 3300045051 | Bacteria | 944 |
| 700 | Ga0466967_0001401 | 3300045976 | Bacteria | 13938 |
| 701 | Ga0466967_0046813 | 3300045976 | Bacteria | 3768 |
| 702 | Ga0466967_0111253 | 3300045976 | Bacteria | 2517 |
| 703 | Ga0495617_026479 | 3300046452 | Bacteria | 1953 |
| 704 | Ga0495603_0039419 | 3300046455 | Bacteria | 2830 |
| 705 | Ga0495629_0029674 | 3300046459 | Bacteria | 3878 |
| 706 | Ga0495629_0049585 | 3300046459 | Bacteria | 2942 |
| 707 | Ga0495629_0060065 | 3300046459 | Bacteria | 2657 |
| 708 | Ga0495629_0137756 | 3300046459 | Bacteria | 1699 |
| 709 | Ga0495638_0445383 | 3300046460 | Bacteria | 662 |
| 710 | Ga0495651_0053044 | 3300046462 | Bacteria | 3123 |
| 711 | Ga0495653_0010749 | 3300046463 | Bacteria | 7495 |
| 712 | Ga0495650_0000038 | 3300046471 | Bacteria | 377530 |
| 713 | Ga0495580_0120910 | 3300046472 | Bacteria | 1818 |
| 714 | Ga0495580_0156212 | 3300046472 | Unclassified | 1579 |
| 715 | Ga0495580_0326733 | 3300046472 | Bacteria | 1042 |
| 716 | Ga0495580_0497340 | 3300046472 | Bacteria | 814 |
| 717 | Ga0495582_0001853 | 3300046473 | Bacteria | 11921 |
| 718 | Ga0495582_0095987 | 3300046473 | Bacteria | 1657 |
| 719 | Ga0495639_0004538 | 3300046475 | Bacteria | 5952 |
| 720 | Ga0495662_0005660 | 3300046476 | Bacteria | 6246 |
| 721 | Ga0495664_0001348 | 3300046477 | Bacteria | 12929 |
| 722 | Ga0495664_0057856 | 3300046477 | Bacteria | 2306 |
| 723 | Ga0495585_0085882 | 3300046492 | Bacteria | 1700 |
| 724 | Ga0495594_0000388 | 3300046499 | Bacteria | 22139 |
| 725 | Ga0495594_0001190 | 3300046499 | Bacteria | 13614 |
| 726 | Ga0495594_0004431 | 3300046499 | Bacteria | 7222 |
| 727 | Ga0495583_0033822 | 3300046506 | Bacteria | 2455 |
| 728 | Ga0495606_0044975 | 3300046507 | Bacteria | 2931 |
| 729 | Ga0495606_0067569 | 3300046507 | Bacteria | 2263 |
| 730 | Ga0495630_0270870 | 3300046517 | Bacteria | 1297 |
| 731 | Ga0495644_0000048 | 3300046523 | Bacteria | 57696 |
| 732 | Ga0495666_0001196 | 3300046526 | Bacteria | 12524 |
| 733 | Ga0495642_0019216 | 3300046528 | Bacteria | 2678 |
| 734 | Ga0495652_0006640 | 3300046529 | Bacteria | 10742 |
| 735 | Ga0495652_0043862 | 3300046529 | Bacteria | 3853 |
| 736 | Ga0495665_0001828 | 3300046531 | Bacteria | 11486 |
| 737 | Ga0495665_0243362 | 3300046531 | Bacteria | 927 |
| 738 | Ga0495640_0004801 | 3300046533 | Bacteria | 10760 |
| 739 | Ga0495640_0112414 | 3300046533 | Bacteria | 1778 |
| 740 | Ga0495586_0019711 | 3300046535 | Bacteria | 3591 |
| 741 | Ga0495586_0197397 | 3300046535 | Unclassified | 1140 |
| 742 | Ga0495587_0093692 | 3300046536 | Bacteria | 1734 |
| 743 | Ga0495609_0011141 | 3300046538 | Bacteria | 4292 |
| 744 | Ga0495609_0080699 | 3300046538 | Bacteria | 1422 |
| 745 | Ga0495645_0053835 | 3300046543 | Unclassified | 2924 |
| 746 | Ga0495645_0213338 | 3300046543 | Archaea | 1302 |
| 747 | Ga0495633_0051416 | 3300046558 | Bacteria | 1942 |
| 748 | Ga0495667_0150787 | 3300046559 | Bacteria | 1497 |
| 749 | Ga0495668_0128921 | 3300046616 | Bacteria | 1385 |
| 750 | Ga0495634_0006225 | 3300046642 | Bacteria | 9093 |
| 751 | Ga0495611_0005877 | 3300046648 | Bacteria | 5236 |
| 752 | Ga0495625_0000985 | 3300046660 | Bacteria | 37750 |
| 753 | Ga0495625_0007833 | 3300046660 | Bacteria | 9208 |
| 754 | Ga0495625_0026175 | 3300046660 | Bacteria | 4411 |
| 755 | Ga0495625_0034121 | 3300046660 | Bacteria | 3757 |
| 756 | Ga0495625_0089152 | 3300046660 | Bacteria | 2136 |
| 757 | Ga0495625_0381016 | 3300046660 | Bacteria | 885 |
| 758 | Ga0495625_0434634 | 3300046660 | Bacteria | 814 |
| 759 | Ga0495635_0002836 | 3300046663 | Bacteria | 11904 |
| 760 | Ga0495659_0114237 | 3300046664 | Bacteria | 1057 |
| 761 | Ga0495661_0026784 | 3300046665 | Bacteria | 3708 |
| 762 | Ga0495657_0277857 | 3300046675 | Bacteria | 1003 |
| 763 | Ga0495599_0242663 | 3300046678 | Bacteria | 1098 |
| 764 | Ga0495599_0548749 | 3300046678 | Bacteria | 677 |
| 765 | Ga0495623_0008357 | 3300046679 | Bacteria | 6733 |
| 766 | Ga0495623_0410809 | 3300046679 | Bacteria | 727 |
| 767 | Ga0495646_0013211 | 3300046680 | Bacteria | 5247 |
| 768 | Ga0495646_0023225 | 3300046680 | Bacteria | 3904 |
| 769 | Ga0495646_0222729 | 3300046680 | Bacteria | 1019 |
| 770 | Ga0495669_0004252 | 3300046684 | Bacteria | 5901 |
| 771 | Ga0495669_0370251 | 3300046684 | Unclassified | 693 |
| 772 | Ga0495613_0003966 | 3300046689 | Bacteria | 11081 |
| 773 | Ga0495613_0018773 | 3300046689 | Bacteria | 5152 |
| 774 | Ga0495613_0038534 | 3300046689 | Unclassified | 3543 |
| 775 | Ga0495613_0109799 | 3300046689 | Bacteria | 1988 |
| 776 | Ga0495624_0007524 | 3300046690 | Bacteria | 7641 |
| 777 | Ga0495624_0174027 | 3300046690 | Bacteria | 1313 |
| 778 | Ga0495671_0095768 | 3300046692 | Bacteria | 1452 |
| 779 | Ga0495649_0012107 | 3300046694 | Bacteria | 5035 |
| 780 | Ga0495600_0012858 | 3300046809 | Bacteria | 5243 |
| 781 | Ga0495600_0172644 | 3300046809 | Unclassified | 1395 |
| 782 | Ga0495581_0001976 | 3300047315 | Bacteria | 11495 |
| 783 | Ga0495604_0002834 | 3300047317 | Bacteria | 13912 |
| 784 | Ga0495674_0014334 | 3300047319 | Bacteria | 7423 |
| 785 | Ga0495672_0021506 | 3300047320 | Bacteria | 4206 |
| 786 | Ga0495672_0063127 | 3300047320 | Bacteria | 2127 |
| 787 | Ga0495676_0008961 | 3300047321 | Bacteria | 9134 |
| 788 | Ga0495683_0174509 | 3300047323 | Bacteria | 986 |
| 789 | Ga0495675_0012974 | 3300047444 | Bacteria | 5253 |
| 790 | Ga0495673_0231467 | 3300047469 | Bacteria | 680 |
| 791 | Ga0495684_0099043 | 3300047471 | Bacteria | 2204 |
| 792 | Ga0495686_0000178 | 3300047472 | Bacteria | 121468 |
| 793 | Ga0495686_0001621 | 3300047472 | Bacteria | 23566 |
| 794 | Ga0495686_0008419 | 3300047472 | Bacteria | 7568 |
| 795 | Ga0495686_0047439 | 3300047472 | Bacteria | 2712 |
| 796 | Ga0495686_0085891 | 3300047472 | Bacteria | 1915 |
| 797 | Ga0495602_0081301 | 3300048088 | Archaea | 2725 |
| 798 | Ga0495602_0236738 | 3300048088 | Bacteria | 1368 |
| 799 | Ga0495614_0000972 | 3300048089 | Bacteria | 12208 |
| 800 | Ga0496100_0314419 | 3300048903 | Bacteria | 1175 |
| 801 | Ga0496100_0725168 | 3300048903 | Bacteria | 776 |
| 802 | Ga0496102_0344146 | 3300048905 | Bacteria | 1404 |
| 803 | Ga0496102_0851610 | 3300048905 | Bacteria | 834 |
| 804 | Ga0496104_0000053 | 3300048907 | Bacteria | 135895 |
| 805 | Ga0496104_0056645 | 3300048907 | Bacteria | 3708 |
| 806 | Ga0496104_0071299 | 3300048907 | Unclassified | 3303 |
| 807 | Ga0496104_0438058 | 3300048907 | Bacteria | 1219 |
| 808 | Ga0496104_0659933 | 3300048907 | Bacteria | 955 |
| 809 | Ga0496104_0726557 | 3300048907 | Bacteria | 900 |
| 810 | Ga0496104_0798050 | 3300048907 | Bacteria | 850 |
| 811 | Ga0496105_0001615 | 3300048908 | Bacteria | 15999 |
| 812 | Ga0496105_0057832 | 3300048908 | Bacteria | 3201 |
| 813 | Ga0496106_0042478 | 3300048909 | Bacteria | 3410 |
| 814 | Ga0496108_0134232 | 3300048911 | Bacteria | 2128 |
| 815 | Ga0496109_0316949 | 3300048912 | Bacteria | 1471 |
| 816 | Ga0496111_0044511 | 3300048914 | Bacteria | 3191 |
| 817 | Ga0496111_0158175 | 3300048914 | Bacteria | 1682 |
| 818 | Ga0496111_0303736 | 3300048914 | Bacteria | 1183 |
| 819 | Ga0496112_0021005 | 3300048915 | Bacteria | 6201 |
| 820 | Ga0496112_0150505 | 3300048915 | Bacteria | 2294 |
| 821 | Ga0496112_0467738 | 3300048915 | Bacteria | 1198 |
| 822 | Ga0496113_0084737 | 3300048916 | Bacteria | 2434 |
| 823 | Ga0496115_0085005 | 3300048918 | Bacteria | 2580 |
| 824 | Ga0496115_0091617 | 3300048918 | Bacteria | 2484 |
| 825 | Ga0496115_0273258 | 3300048918 | Bacteria | 1388 |
| 826 | Ga0496115_0373480 | 3300048918 | Unclassified | 1160 |
| 827 | Ga0496121_0365824 | 3300048924 | Bacteria | 956 |
| 828 | Ga0496126_0000100 | 3300048929 | Bacteria | 203706 |
| 829 | Ga0496126_0000154 | 3300048929 | Bacteria | 159983 |
| 830 | Ga0496126_0078490 | 3300048929 | Bacteria | 2925 |
| 831 | Ga0501032_0001912 | 3300049569 | Bacteria | 16446 |
| 832 | Ga0501033_0028282 | 3300049570 | Bacteria | 4213 |
| 833 | Ga0501033_0115308 | 3300049570 | Bacteria | 1952 |
| 834 | Ga0501033_0637612 | 3300049570 | Bacteria | 729 |
| 835 | Ga0501034_0148520 | 3300049571 | Bacteria | 2320 |
| 836 | Ga0501036_0076344 | 3300049572 | Bacteria | 2834 |
| 837 | Ga0501037_0391740 | 3300049573 | Bacteria | 954 |
| 838 | Ga0501037_0492477 | 3300049573 | Bacteria | 832 |
| 839 | Ga0501038_0048143 | 3300049574 | Bacteria | 3690 |
| 840 | Ga0501038_0085946 | 3300049574 | Bacteria | 2644 |
| 841 | Ga0501043_0003983 | 3300049579 | Bacteria | 12094 |
| 842 | Ga0501046_0000056 | 3300049580 | Bacteria | 129342 |
| 843 | Ga0501047_0008947 | 3300049581 | Bacteria | 9454 |
| 844 | Ga0501047_0066914 | 3300049581 | Bacteria | 3463 |
| 845 | Ga0501073_0110559 | 3300049589 | Bacteria | 1906 |
| 846 | Ga0501073_0110594 | 3300049589 | Bacteria | 1906 |
| 847 | Ga0501074_0196241 | 3300049590 | Bacteria | 1439 |
| 848 | Ga0501080_0188110 | 3300049742 | Bacteria | 1898 |
| 849 | Ga0501083_0147296 | 3300049744 | Bacteria | 1541 |
| 850 | Ga0501035_0044540 | 3300049822 | Bacteria | 3995 |
| 851 | Ga0501035_0377603 | 3300049822 | Bacteria | 1182 |
| 852 | Ga0501035_0469538 | 3300049822 | Bacteria | 1039 |
| 853 | Ga0501044_0027240 | 3300049823 | Bacteria | 6042 |
| 854 | Ga0501044_0095095 | 3300049823 | Bacteria | 3003 |
| 855 | Ga0501044_0417372 | 3300049823 | Bacteria | 1252 |
| 856 | Ga0501044_0690521 | 3300049823 | Bacteria | 907 |
| 857 | nmdc:mga06r32_320162_c1 | 3300050510 | Bacteria | 1536 |
| 858 | Ga0495601_0167705 | 3300053077 | Bacteria | 1435 |
| 859 | Ga0495619_0140913 | 3300053085 | Unclassified | 1660 |
| 860 | Ga0500643_109394 | 3300053087 | Bacteria | 747 |
| 861 | Ga0500651_0000005 | 3300053093 | Bacteria | 384761 |
| 862 | Ga0500595_000004 | 3300053119 | Bacteria | 410922 |
| 863 | Ga0500595_007997 | 3300053119 | Bacteria | 4343 |
| 864 | Ga0500595_058334 | 3300053119 | Bacteria | 1173 |
| 865 | Ga0500595_079031 | 3300053119 | Bacteria | 965 |
| 866 | Ga0500661_003309 | 3300055283 | Bacteria | 3030 |
| 867 | Ga0501082_0213946 | 3300060353 | Bacteria | 1677 |
| 868 | Ga0530510_0265842 | 3300061734 | Bacteria | 1280 |
| 869 | 2884217798 | 2884215851 | Bacteria | 4554841 |
| 870 | Ga0157370_10165459 | |||
| 871 | JGI25165J46597_1013739 | |||
| 872 | rootH2_10009426 | |||
| 873 | Ga0065712_10479514 | |||
| 874 | Ga0070658_10000121 | |||
| 875 | Ga0070658_10021582 | |||
| 876 | Ga0070658_10071707 | |||
| 877 | Ga0070658_10112053 | |||
| 878 | Ga0070658_10196354 | |||
| 879 | Ga0070658_10205977 | |||
| 880 | Ga0070658_10272828 | |||
| 881 | Ga0070676_10067377 | |||
| 882 | Ga0070683_100002041 | |||
| 883 | Ga0070683_100028772 | |||
| 884 | Ga0070683_100060569 | |||
| 885 | Ga0070683_100062351 | |||
| 886 | Ga0070683_100221096 | |||
| 887 | Ga0070683_100285059 | |||
| 888 | Ga0070670_100079127 | |||
| 889 | Ga0068869_100095013 | |||
| 890 | Ga0068869_100247235 | |||
| 891 | Ga0070666_10055265 | |||
| 892 | Ga0070666_10070170 | |||
| 893 | Ga0070682_100242035 | |||
| 894 | Ga0068868_100000066 | |||
| 895 | Ga0068868_100065060 | |||
| 896 | Ga0068868_100081115 | |||
| 897 | Ga0068868_100488108 | |||
| 898 | Ga0070660_100008313 | |||
| 899 | Ga0070660_100155643 | |||
| 900 | Ga0070660_100232314 | |||
| 901 | Ga0070660_100637198 | |||
| 902 | Ga0070660_100663456 | |||
| 903 | Ga0070661_100019981 | |||
| 904 | Ga0070661_100050615 | |||
| 905 | Ga0070661_100066000 | |||
| 906 | Ga0070661_100153801 | |||
| 907 | Ga0070661_100701045 | |||
| 908 | Ga0070668_100695790 | |||
| 909 | Ga0070671_100003123 | |||
| 910 | Ga0070671_100050619 | |||
| 911 | Ga0070671_100117926 | |||
| 912 | Ga0070671_100446435 | |||
| 913 | Ga0070673_100070243 | |||
| 914 | Ga0070673_100191444 | |||
| 915 | Ga0070659_100004580 | |||
| 916 | Ga0070659_100138892 | |||
| 917 | Ga0070659_100234782 | |||
| 918 | Ga0070659_100689205 | |||
| 919 | Ga0070667_100046288 | |||
| 920 | Ga0070667_100246795 | |||
| 921 | Ga0070709_10166887 | |||
| 922 | Ga0070709_10356466 | |||
| 923 | Ga0070709_10501912 | |||
| 924 | Ga0070714_100002654 | |||
| 925 | Ga0070714_100091602 | |||
| 926 | Ga0070714_100105232 | |||
| 927 | Ga0070714_100116911 | |||
| 928 | Ga0070714_100154671 | |||
| 929 | Ga0070714_100161553 | |||
| 930 | Ga0070714_100188384 | |||
| 931 | Ga0070714_100200420 | |||
| 932 | Ga0070713_100003005 | |||
| 933 | Ga0070713_100023543 | |||
| 934 | Ga0070713_100082409 | |||
| 935 | Ga0070713_100162511 | |||
| 936 | Ga0070713_100196366 | |||
| 937 | Ga0070713_100257582 | |||
| 938 | Ga0070713_100433308 | |||
| 939 | Ga0070713_100631919 | |||
| 940 | Ga0070713_101077027 | |||
| 941 | Ga0070710_10032530 | |||
| 942 | Ga0070710_10192885 | |||
| 943 | Ga0070710_10266048 | |||
| 944 | Ga0070711_100019179 | |||
| 945 | Ga0070711_100022563 | |||
| 946 | Ga0070711_100775332 | |||
| 947 | Ga0070663_100053467 | |||
| 948 | Ga0070663_100130863 | |||
| 949 | Ga0070663_100182632 | |||
| 950 | Ga0070663_100321159 | |||
| 951 | Ga0070663_100479477 | |||
| 952 | Ga0070663_100498539 | |||
| 953 | Ga0070678_100600428 | |||
| 954 | Ga0070662_100215752 | |||
| 955 | Ga0070681_10001050 | |||
| 956 | Ga0070681_10095557 | |||
| 957 | Ga0070681_10589316 | |||
| 958 | Ga0070681_10966872 | |||
| 959 | Ga0068867_100354254 | |||
| 960 | Ga0070679_100003993 | |||
| 961 | Ga0070679_100006128 | |||
| 962 | Ga0070679_100135818 | |||
| 963 | Ga0070679_100162327 | |||
| 964 | Ga0070679_100369870 | |||
| 965 | Ga0070679_100468964 | |||
| 966 | Ga0070679_100515342 | |||
| 967 | Ga0070679_100987841 | |||
| 968 | Ga0070679_101067564 | |||
| 969 | Ga0070684_100011551 | |||
| 970 | Ga0070684_100107048 | |||
| 971 | Ga0070684_100165684 | |||
| 972 | Ga0070684_100273521 | |||
| 973 | Ga0070684_100312272 | |||
| 974 | Ga0070684_100393724 | |||
| 975 | Ga0070684_100696362 | |||
| 976 | Ga0068853_100000222 | |||
| 977 | Ga0068853_100000367 | |||
| 978 | Ga0068853_100043702 | |||
| 979 | Ga0068853_100070755 | |||
| 980 | Ga0068853_100130644 | |||
| 981 | Ga0068853_100237710 | |||
| 982 | Ga0068853_100327147 | |||
| 983 | Ga0068853_100336512 | |||
| 984 | Ga0068853_100960524 | |||
| 985 | Ga0070665_100005637 | |||
| 986 | Ga0070665_100041617 | |||
| 987 | Ga0070665_100158518 | |||
| 988 | Ga0070665_100181688 | |||
| 989 | Ga0070665_100403581 | |||
| 990 | Ga0068855_100000277 | |||
| 991 | Ga0068855_100002688 | |||
| 992 | Ga0068855_100003653 | |||
| 993 | Ga0068855_100010384 | |||
| 994 | Ga0068855_100035334 | |||
| 995 | Ga0068855_100060121 | |||
| 996 | Ga0068855_100092013 | |||
| 997 | Ga0068855_100169055 | |||
| 998 | Ga0068855_100181173 | |||
| 999 | Ga0068855_100218171 | |||
| 1000 | Ga0068855_100278975 | |||
| 1001 | Ga0068855_100301117 | |||
| 1002 | Ga0068855_100468401 | |||
| 1003 | Ga0068855_100584895 | |||
| 1004 | Ga0068855_101193853 | |||
| 1005 | Ga0070664_100124085 | |||
| 1006 | Ga0070664_100592049 | |||
| 1007 | Ga0070664_100734426 | |||
| 1008 | Ga0068857_100003191 | |||
| 1009 | Ga0068857_100015817 | |||
| 1010 | Ga0068857_100306068 | |||
| 1011 | Ga0068857_100355705 | |||
| 1012 | Ga0068857_101079678 | |||
| 1013 | Ga0068854_100000019 | |||
| 1014 | Ga0068854_100034075 | |||
| 1015 | Ga0068854_100044343 | |||
| 1016 | Ga0068856_100003529 | |||
| 1017 | Ga0068856_100033069 | |||
| 1018 | Ga0068856_100050428 | |||
| 1019 | Ga0068856_100057606 | |||
| 1020 | Ga0068856_100085887 | |||
| 1021 | Ga0068856_100227971 | |||
| 1022 | Ga0068856_100413541 | |||
| 1023 | Ga0068856_100509145 | |||
| 1024 | Ga0068856_100709163 | |||
| 1025 | Ga0068852_100000019 | |||
| 1026 | Ga0068852_100000097 | |||
| 1027 | Ga0068852_100001535 | |||
| 1028 | Ga0068852_100097697 | |||
| 1029 | Ga0068852_100103163 | |||
| 1030 | Ga0068852_100113488 | |||
| 1031 | Ga0068852_100161107 | |||
| 1032 | Ga0068852_100168947 | |||
| 1033 | Ga0068859_100120087 | |||
| 1034 | Ga0068864_100000625 | |||
| 1035 | Ga0068864_100012167 | |||
| 1036 | Ga0068864_100092202 | |||
| 1037 | Ga0068851_10016393 | |||
| 1038 | Ga0068851_10041070 | |||
| 1039 | Ga0068851_10051580 | |||
| 1040 | Ga0068851_10058980 | |||
| 1041 | Ga0068851_10167950 | |||
| 1042 | Ga0068851_10306247 | |||
| 1043 | Ga0068863_100001753 | |||
| 1044 | Ga0068863_100001814 | |||
| 1045 | Ga0068863_100007046 | |||
| 1046 | Ga0068858_100014586 | |||
| 1047 | Ga0068858_100015914 | |||
| 1048 | Ga0068860_100000689 | |||
| 1049 | Ga0068860_100510378 | |||
| 1050 | Ga0068862_100293795 | |||
| 1051 | Ga0070717_10011247 | |||
| 1052 | Ga0070717_10011904 | |||
| 1053 | Ga0070717_10342393 | |||
| 1054 | Ga0070715_10002310 | |||
| 1055 | Ga0070716_100059060 | |||
| 1056 | Ga0070712_100012762 | |||
| 1057 | Ga0070712_100044876 | |||
| 1058 | Ga0070712_100340838 | |||
| 1059 | Ga0070712_100610888 | |||
| 1060 | Ga0097621_100000349 | |||
| 1061 | Ga0097621_100360082 | |||
| 1062 | Ga0097621_100505098 | |||
| 1063 | Ga0068871_100002325 | |||
| 1064 | Ga0068871_100788000 | |||
| 1065 | Ga0068865_100136913 | |||
| 1066 | Ga0075436_100648537 | |||
| 1067 | Ga0097620_100120081 | |||
| 1068 | Ga0105240_10000372 | |||
| 1069 | Ga0105240_10000496 | |||
| 1070 | Ga0105240_10001875 | |||
| 1071 | Ga0105240_10009346 | |||
| 1072 | Ga0105240_10010838 | |||
| 1073 | Ga0105240_10030875 | |||
| 1074 | Ga0105240_10039085 | |||
| 1075 | Ga0105240_10087131 | |||
| 1076 | Ga0105240_10097071 | |||
| 1077 | Ga0105240_10120373 | |||
| 1078 | Ga0105240_10122860 | |||
| 1079 | Ga0105240_10152229 | |||
| 1080 | Ga0105240_11390657 | |||
| 1081 | Ga0105245_10000486 | |||
| 1082 | Ga0105245_10021587 | |||
| 1083 | Ga0105245_10085606 | |||
| 1084 | Ga0105245_10443589 | |||
| 1085 | Ga0105245_10513291 | |||
| 1086 | Ga0105247_10002346 | |||
| 1087 | Ga0105247_10292438 | |||
| 1088 | Ga0114129_11396355 | |||
| 1089 | Ga0105241_10000026 | |||
| 1090 | Ga0105241_10000121 | |||
| 1091 | Ga0105241_10002032 | |||
| 1092 | Ga0105241_10213745 | |||
| 1093 | Ga0105241_10232573 | |||
| 1094 | Ga0105242_10298302 | |||
| 1095 | Ga0105248_10000019 | |||
| 1096 | Ga0105248_10007017 | |||
| 1097 | Ga0105248_10016372 | |||
| 1098 | Ga0105248_10022327 | |||
| 1099 | Ga0105248_10029618 | |||
| 1100 | Ga0105248_10042895 | |||
| 1101 | Ga0105248_10094941 | |||
| 1102 | Ga0105248_10477210 | |||
| 1103 | Ga0105248_10578479 | |||
| 1104 | Ga0105248_10765535 | |||
| 1105 | Ga0105248_10796820 | |||
| 1106 | Ga0105237_10000590 | |||
| 1107 | Ga0105237_10006331 | |||
| 1108 | Ga0105237_10063825 | |||
| 1109 | Ga0105237_10137842 | |||
| 1110 | Ga0105237_10212808 | |||
| 1111 | Ga0105237_10248368 | |||
| 1112 | Ga0105237_10575017 | |||
| 1113 | Ga0105237_10627141 | |||
| 1114 | Ga0105237_10812540 | |||
| 1115 | Ga0105238_10000197 | |||
| 1116 | Ga0105238_10000509 | |||
| 1117 | Ga0105238_10008072 | |||
| 1118 | Ga0105238_10023794 | |||
| 1119 | Ga0105238_10026652 | |||
| 1120 | Ga0105238_10054460 | |||
| 1121 | Ga0105238_10078759 | |||
| 1122 | Ga0105238_10201945 | |||
| 1123 | Ga0105238_10251055 | |||
| 1124 | Ga0105238_10314767 | |||
| 1125 | Ga0105238_10355224 | |||
| 1126 | Ga0105249_10003449 | |||
| 1127 | Ga0105249_10081598 | |||
| 1128 | Ga0105249_11113285 | |||
| 1129 | Ga0105249_11268700 | |||
| 1130 | Ga0105239_10001533 | |||
| 1131 | Ga0105239_10003046 | |||
| 1132 | Ga0105239_10105415 | |||
| 1133 | Ga0105239_10246339 | |||
| 1134 | Ga0105239_10857536 | |||
| 1135 | Ga0105246_10001192 | |||
| 1136 | Ga0105246_10119528 | |||
| 1137 | Ga0157373_10225234 | |||
| 1138 | Ga0157370_10000170 | |||
| 1139 | Ga0157370_10010160 | |||
| 1140 | Ga0157370_10012988 | |||
| 1141 | Ga0157370_10013763 | |||
| 1142 | Ga0157370_10046758 | |||
| 1143 | Ga0157370_10171680 | |||
| 1144 | Ga0157370_10752683 | |||
| 1145 | Ga0157369_10000085 | |||
| 1146 | Ga0157369_10000430 | |||
| 1147 | Ga0157369_10009218 | |||
| 1148 | Ga0157369_10012659 | |||
| 1149 | Ga0157369_10028989 | |||
| 1150 | Ga0157369_10040085 | |||
| 1151 | Ga0157369_10042189 | |||
| 1152 | Ga0157369_10054976 | |||
| 1153 | Ga0157369_10096566 | |||
| 1154 | Ga0157369_10098891 | |||
| 1155 | Ga0157369_10115794 | |||
| 1156 | Ga0157369_10172157 | |||
| 1157 | Ga0157369_10192237 | |||
| 1158 | Ga0157369_10206790 | |||
| 1159 | Ga0157369_10344813 | |||
| 1160 | Ga0157369_10371511 | |||
| 1161 | Ga0157369_10540699 | |||
| 1162 | Ga0157369_10729791 | |||
| 1163 | Ga0157369_11101743 | |||
| 1164 | Ga0157374_10023020 | |||
| 1165 | Ga0157374_10042034 | |||
| 1166 | Ga0157374_10084229 | |||
| 1167 | Ga0157374_10238777 | |||
| 1168 | Ga0157374_10325896 | |||
| 1169 | Ga0157374_10447875 | |||
| 1170 | Ga0157374_10498754 | |||
| 1171 | Ga0157374_10827694 | |||
| 1172 | Ga0157378_10023973 | |||
| 1173 | Ga0157378_10131240 | |||
| 1174 | Ga0163162_10027442 | |||
| 1175 | Ga0163162_10158863 | |||
| 1176 | Ga0163162_11275508 | |||
| 1177 | Ga0157372_10000217 | |||
| 1178 | Ga0157372_10002601 | |||
| 1179 | Ga0157372_10002611 | |||
| 1180 | Ga0157372_10010870 | |||
| 1181 | Ga0157372_10063864 | |||
| 1182 | Ga0157372_10204729 | |||
| 1183 | Ga0157372_10206180 | |||
| 1184 | Ga0157372_10348925 | |||
| 1185 | Ga0157372_10403380 | |||
| 1186 | Ga0157372_10569693 | |||
| 1187 | Ga0157375_10057497 | |||
| 1188 | Ga0157375_10066677 | |||
| 1189 | Ga0157375_10069334 | |||
| 1190 | Ga0163163_10001161 | |||
| 1191 | Ga0163163_10017757 | |||
| 1192 | Ga0163163_10062243 | |||
| 1193 | Ga0163163_10580801 | |||
| 1194 | Ga0157377_10199620 | |||
| 1195 | Ga0157379_10002312 | |||
| 1196 | Ga0157379_10048162 | |||
| 1197 | Ga0157379_10161237 | |||
| 1198 | Ga0157379_10287290 | |||
| 1199 | Ga0157379_10308107 | |||
| 1200 | Ga0157376_10004372 | |||
| 1201 | Ga0157376_10737860 | |||
| 1202 | Ga0157376_11689302 | |||
| 1203 | Ga0163161_10044573 | |||
| 1204 | Ga0213872_10002341 | |||
| 1205 | Ga0213872_10034756 | |||
| 1206 | Ga0213872_10051363 | |||
| 1207 | Ga0213872_10054105 | |||
| 1208 | Ga0213875_10000108 | |||
| 1209 | Ga0213875_10219442 | |||
| 1210 | Ga0213871_10006004 | |||
| 1211 | Ga0224572_1008454 | |||
| 1212 | Ga0209233_1001442 | |||
| 1213 | Ga0207656_10031201 | |||
| 1214 | Ga0207656_10031615 | |||
| 1215 | Ga0207656_10048760 | |||
| 1216 | Ga0207656_10196195 | |||
| 1217 | Ga0207656_10364668 | |||
| 1218 | Ga0207692_10438543 | |||
| 1219 | Ga0207692_10444087 | |||
| 1220 | Ga0207710_10317441 | |||
| 1221 | Ga0207680_10030474 | |||
| 1222 | Ga0207680_10204305 | |||
| 1223 | Ga0207647_10078008 | |||
| 1224 | Ga0207647_10125849 | |||
| 1225 | Ga0207699_10125619 | |||
| 1226 | Ga0207699_10680378 | |||
| 1227 | Ga0207645_10116005 | |||
| 1228 | Ga0207705_10000021 | |||
| 1229 | Ga0207705_10002125 | |||
| 1230 | Ga0207705_10002923 | |||
| 1231 | Ga0207705_10012875 | |||
| 1232 | Ga0207705_10021055 | |||
| 1233 | Ga0207705_10027435 | |||
| 1234 | Ga0207705_10028574 | |||
| 1235 | Ga0207705_10107321 | |||
| 1236 | Ga0207705_10282735 | |||
| 1237 | Ga0207705_10294604 | |||
| 1238 | Ga0207705_10332471 | |||
| 1239 | Ga0207654_10000054 | |||
| 1240 | Ga0207654_10000281 | |||
| 1241 | Ga0207654_10000808 | |||
| 1242 | Ga0207654_10083730 | |||
| 1243 | Ga0207654_10233283 | |||
| 1244 | Ga0207654_10251596 | |||
| 1245 | Ga0207707_10003864 | |||
| 1246 | Ga0207707_10142923 | |||
| 1247 | Ga0207707_10322003 | |||
| 1248 | Ga0207707_10465465 | |||
| 1249 | Ga0207707_10659207 | |||
| 1250 | Ga0207695_10000080 | |||
| 1251 | Ga0207695_10000113 | |||
| 1252 | Ga0207695_10000167 | |||
| 1253 | Ga0207695_10000263 | |||
| 1254 | Ga0207695_10001106 | |||
| 1255 | Ga0207695_10001762 | |||
| 1256 | Ga0207695_10033351 | |||
| 1257 | Ga0207695_10072087 | |||
| 1258 | Ga0207695_10083832 | |||
| 1259 | Ga0207695_10090502 | |||
| 1260 | Ga0207695_10125292 | |||
| 1261 | Ga0207695_10464491 | |||
| 1262 | Ga0207695_10723985 | |||
| 1263 | Ga0207671_10000065 | |||
| 1264 | Ga0207671_10000123 | |||
| 1265 | Ga0207671_10000139 | |||
| 1266 | Ga0207671_10086096 | |||
| 1267 | Ga0207671_10218141 | |||
| 1268 | Ga0207693_10002600 | |||
| 1269 | Ga0207693_10059168 | |||
| 1270 | Ga0207693_10405560 | |||
| 1271 | Ga0207663_10016822 | |||
| 1272 | Ga0207663_10023940 | |||
| 1273 | Ga0207663_10519219 | |||
| 1274 | Ga0207660_10111242 | |||
| 1275 | Ga0207660_10271414 | |||
| 1276 | Ga0207660_10304040 | |||
| 1277 | Ga0207657_10004623 | |||
| 1278 | Ga0207657_10019482 | |||
| 1279 | Ga0207657_10036579 | |||
| 1280 | Ga0207657_10205754 | |||
| 1281 | Ga0207657_10347439 | |||
| 1282 | Ga0207657_10565120 | |||
| 1283 | Ga0207649_10031894 | |||
| 1284 | Ga0207649_10051782 | |||
| 1285 | Ga0207652_10001535 | |||
| 1286 | Ga0207652_10036402 | |||
| 1287 | Ga0207652_10547214 | |||
| 1288 | Ga0207694_10000248 | |||
| 1289 | Ga0207694_10000711 | |||
| 1290 | Ga0207694_10048093 | |||
| 1291 | Ga0207694_10062538 | |||
| 1292 | Ga0207694_10078380 | |||
| 1293 | Ga0207694_10139468 | |||
| 1294 | Ga0207694_10273841 | |||
| 1295 | Ga0207694_10522820 | |||
| 1296 | Ga0207650_10003582 | |||
| 1297 | Ga0207650_10213491 | |||
| 1298 | Ga0207687_10000978 | |||
| 1299 | Ga0207687_10002372 | |||
| 1300 | Ga0207687_10130110 | |||
| 1301 | Ga0207687_10350078 | |||
| 1302 | Ga0207700_10003745 | |||
| 1303 | Ga0207700_10021300 | |||
| 1304 | Ga0207700_10058092 | |||
| 1305 | Ga0207700_10062682 | |||
| 1306 | Ga0207700_10393013 | |||
| 1307 | Ga0207700_10394546 | |||
| 1308 | Ga0207700_10452458 | |||
| 1309 | Ga0207700_10552917 | |||
| 1310 | Ga0207700_10678905 | |||
| 1311 | Ga0207700_11068310 | |||
| 1312 | Ga0207664_10017916 | |||
| 1313 | Ga0207664_10071842 | |||
| 1314 | Ga0207664_10105160 | |||
| 1315 | Ga0207664_10128766 | |||
| 1316 | Ga0207664_10205846 | |||
| 1317 | Ga0207664_10234262 | |||
| 1318 | Ga0207664_10420967 | |||
| 1319 | Ga0207664_10527307 | |||
| 1320 | Ga0207644_10017923 | |||
| 1321 | Ga0207644_10266848 | |||
| 1322 | Ga0207690_10050737 | |||
| 1323 | Ga0207690_10175486 | |||
| 1324 | Ga0207706_10243219 | |||
| 1325 | Ga0207686_10373242 | |||
| 1326 | Ga0207665_10022539 | |||
| 1327 | Ga0207665_10044340 | |||
| 1328 | Ga0207665_10052779 | |||
| 1329 | Ga0207691_10039961 | |||
| 1330 | Ga0207711_10000014 | |||
| 1331 | Ga0207711_10004781 | |||
| 1332 | Ga0207711_10033255 | |||
| 1333 | Ga0207711_10044398 | |||
| 1334 | Ga0207711_10065518 | |||
| 1335 | Ga0207711_10093223 | |||
| 1336 | Ga0207689_11050014 | |||
| 1337 | Ga0207661_10001283 | |||
| 1338 | Ga0207661_10055710 | |||
| 1339 | Ga0207661_10077968 | |||
| 1340 | Ga0207661_10078225 | |||
| 1341 | Ga0207661_10104793 | |||
| 1342 | Ga0207661_10179079 | |||
| 1343 | Ga0207661_10475948 | |||
| 1344 | Ga0207679_10137102 | |||
| 1345 | Ga0207679_10616612 | |||
| 1346 | Ga0207667_10000468 | |||
| 1347 | Ga0207667_10006194 | |||
| 1348 | Ga0207667_10007633 | |||
| 1349 | Ga0207667_10009516 | |||
| 1350 | Ga0207667_10012818 | |||
| 1351 | Ga0207667_10030921 | |||
| 1352 | Ga0207667_10035816 | |||
| 1353 | Ga0207667_10098554 | |||
| 1354 | Ga0207667_10176714 | |||
| 1355 | Ga0207667_10198277 | |||
| 1356 | Ga0207667_10243021 | |||
| 1357 | Ga0207667_10249710 | |||
| 1358 | Ga0207667_10294967 | |||
| 1359 | Ga0207667_10321631 | |||
| 1360 | Ga0207667_10373279 | |||
| 1361 | Ga0207667_10979643 | |||
| 1362 | Ga0207712_10043097 | |||
| 1363 | Ga0207640_10000028 | |||
| 1364 | Ga0207640_10024137 | |||
| 1365 | Ga0207640_10034716 | |||
| 1366 | Ga0207640_10092985 | |||
| 1367 | Ga0207640_10286155 | |||
| 1368 | Ga0207640_10677227 | |||
| 1369 | Ga0207658_10003428 | |||
| 1370 | Ga0207677_10000143 | |||
| 1371 | Ga0207677_10154976 | |||
| 1372 | Ga0207677_10192193 | |||
| 1373 | Ga0207677_10322859 | |||
| 1374 | Ga0207703_10004820 | |||
| 1375 | Ga0207703_10123186 | |||
| 1376 | Ga0207639_10000088 | |||
| 1377 | Ga0207639_10000371 | |||
| 1378 | Ga0207639_10014115 | |||
| 1379 | Ga0207639_10016992 | |||
| 1380 | Ga0207639_10054301 | |||
| 1381 | Ga0207639_10129182 | |||
| 1382 | Ga0207639_10154385 | |||
| 1383 | Ga0207639_10211214 | |||
| 1384 | Ga0207639_10520451 | |||
| 1385 | Ga0207639_10748403 | |||
| 1386 | Ga0207678_10006398 | |||
| 1387 | Ga0207678_10229059 | |||
| 1388 | Ga0207678_10336767 | |||
| 1389 | Ga0207678_10500580 | |||
| 1390 | Ga0207678_10575718 | |||
| 1391 | Ga0207702_10001334 | |||
| 1392 | Ga0207702_10005816 | |||
| 1393 | Ga0207702_10017932 | |||
| 1394 | Ga0207702_10034912 | |||
| 1395 | Ga0207702_10070171 | |||
| 1396 | Ga0207702_10306913 | |||
| 1397 | Ga0207702_10888883 | |||
| 1398 | Ga0207702_10989030 | |||
| 1399 | Ga0207702_11043759 | |||
| 1400 | Ga0207641_10005346 | |||
| 1401 | Ga0207641_10021590 | |||
| 1402 | Ga0207641_10037049 | |||
| 1403 | Ga0207641_10306612 | |||
| 1404 | Ga0207676_10055374 | |||
| 1405 | Ga0207676_10159038 | |||
| 1406 | Ga0207676_10508123 | |||
| 1407 | Ga0207674_10000669 | |||
| 1408 | Ga0207674_10142769 | |||
| 1409 | Ga0207674_10148285 | |||
| 1410 | Ga0207674_10201213 | |||
| 1411 | Ga0207674_10293248 | |||
| 1412 | Ga0207674_10294723 | |||
| 1413 | Ga0207674_10305491 | |||
| 1414 | Ga0207683_10028240 | |||
| 1415 | Ga0207683_10262222 | |||
| 1416 | Ga0207698_10000003 | |||
| 1417 | Ga0207698_10000708 | |||
| 1418 | Ga0207698_10003525 | |||
| 1419 | Ga0207698_10031875 | |||
| 1420 | Ga0207698_10036682 | |||
| 1421 | Ga0207698_10059852 | |||
| 1422 | Ga0207698_10215710 | |||
| 1423 | Ga0207698_10464681 | |||
| 1424 | Ga0265356_1004445 | |||
| 1425 | Ga0268266_10005265 | |||
| 1426 | Ga0268266_10006399 | |||
| 1427 | Ga0268266_10008807 | |||
| 1428 | Ga0268266_10078240 | |||
| 1429 | Ga0268266_10188892 | |||
| 1430 | Ga0268265_10562240 | |||
| 1431 | Ga0268264_10000598 | |||
| 1432 | Ga0265319_1044472 | |||
| 1433 | Ga0265334_10130983 | |||
| 1434 | Ga0265318_10011054 | |||
| 1435 | Ga0265318_10076123 | |||
| 1436 | Ga0265336_10001048 | |||
| 1437 | Ga0265336_10005708 | |||
| 1438 | Ga0265338_10004495 | |||
| 1439 | Ga0265338_10005157 | |||
| 1440 | Ga0265338_10009284 | |||
| 1441 | Ga0265338_10017734 | |||
| 1442 | Ga0265338_10040619 | |||
| 1443 | Ga0265338_10099138 | |||
| 1444 | Ga0265338_10259829 | |||
| 1445 | Ga0265338_10268771 | |||
| 1446 | Ga0265338_10527691 | |||
| 1447 | Ga0265338_10610317 | |||
| 1448 | Ga0265324_10009104 | |||
| 1449 | Ga0265324_10026321 | |||
| 1450 | Ga0265330_10000273 | |||
| 1451 | Ga0265330_10001219 | |||
| 1452 | Ga0265330_10011435 | |||
| 1453 | Ga0265330_10030656 | |||
| 1454 | Ga0265330_10072643 | |||
| 1455 | Ga0265330_10120309 | |||
| 1456 | Ga0265330_10126058 | |||
| 1457 | Ga0265332_10054533 | |||
| 1458 | Ga0265332_10280342 | |||
| 1459 | Ga0265328_10001272 | |||
| 1460 | Ga0265328_10005053 | |||
| 1461 | Ga0265328_10011186 | |||
| 1462 | Ga0265320_10003664 | |||
| 1463 | Ga0265325_10000266 | |||
| 1464 | Ga0265325_10000695 | |||
| 1465 | Ga0265325_10005858 | |||
| 1466 | Ga0265325_10087985 | |||
| 1467 | Ga0265325_10098913 | |||
| 1468 | Ga0265329_10011153 | |||
| 1469 | Ga0265329_10011996 | |||
| 1470 | Ga0265340_10001072 | |||
| 1471 | Ga0265340_10012505 | |||
| 1472 | Ga0265340_10015610 | |||
| 1473 | Ga0265340_10096350 | |||
| 1474 | Ga0265340_10171805 | |||
| 1475 | Ga0265339_10000114 | |||
| 1476 | Ga0265339_10000124 | |||
| 1477 | Ga0265339_10000194 | |||
| 1478 | Ga0265339_10003213 | |||
| 1479 | Ga0265339_10009288 | |||
| 1480 | Ga0265339_10021882 | |||
| 1481 | Ga0265339_10028825 | |||
| 1482 | Ga0265339_10165558 | |||
| 1483 | Ga0265331_10073017 | |||
| 1484 | Ga0265331_10111778 | |||
| 1485 | Ga0265327_10267568 | |||
| 1486 | Ga0265316_10000352 | |||
| 1487 | Ga0265316_10000712 | |||
| 1488 | Ga0265316_10003105 | |||
| 1489 | Ga0265316_10006699 | |||
| 1490 | Ga0265316_10008382 | |||
| 1491 | Ga0265316_10018630 | |||
| 1492 | Ga0265316_10022409 | |||
| 1493 | Ga0265316_10129073 | |||
| 1494 | Ga0265316_10136596 | |||
| 1495 | Ga0265316_10177577 | |||
| 1496 | Ga0265313_10002216 | |||
| 1497 | Ga0265313_10004714 | |||
| 1498 | Ga0265313_10046248 | |||
| 1499 | Ga0265313_10068916 | |||
| 1500 | Ga0265313_10137519 | |||
| 1501 | Ga0265313_10187633 | |||
| 1502 | Ga0265313_10227340 | |||
| 1503 | Ga0265314_10000504 | |||
| 1504 | Ga0265314_10002987 | |||
| 1505 | Ga0265314_10034859 | |||
| 1506 | Ga0265314_10117019 | |||
| 1507 | Ga0265342_10000225 | |||
| 1508 | Ga0265342_10001536 | |||
| 1509 | Ga0265342_10002164 | |||
| 1510 | Ga0265342_10002441 | |||
| 1511 | Ga0265342_10014061 | |||
| 1512 | Ga0265342_10027916 | |||
| 1513 | Ga0265342_10029908 | |||
| 1514 | Ga0265342_10045350 | |||
| 1515 | Ga0265342_10069670 | |||
| 1516 | Ga0265342_10136398 | |||
| 1517 | Ga0265342_10188592 | |||
| 1518 | Ga0265342_10332508 | |||
| 1519 | Ga0316583_10095825 | |||
| 1520 | Ga0307510_10010774 | |||
| 1521 | Ga0307510_10212472 | |||
| 1522 | Ga0307510_10223248 | |||
| 1523 | Ga0316215_1003489 | |||
| 1524 | Ga0373926_0000675 | |||
| 1525 | Ga0373954_0036836 | |||
| 1526 | Ga0373954_0294562 | |||
| 1527 | Ga0373956_0061195 | |||
| 1528 | Ga0373956_0153569 | |||
| 1529 | Ga0373943_0001291 | |||
| 1530 | Ga0373946_0000821 | |||
| 1531 | Ga0373955_0149693 | |||
| 1532 | Ga0373924_0000243 | |||
| 1533 | Ga0373924_0093250 | |||
| 1534 | Ga0373935_0012297 | |||
| 1535 | Ga0373935_0829003 | |||
| 1536 | Ga0373927_0004411 | |||
| 1537 | Ga0373947_0112424 | |||
| 1538 | Ga0373937_0007405 | |||
| 1539 | Ga0373937_0065583 | |||
| 1540 | Ga0373925_0060693 | |||
| 1541 | Ga0395900_0025848 | |||
| 1542 | Ga0395900_0389492 | |||
| 1543 | Ga0395898_0027814 | |||
| 1544 | Ga0395898_0117975 | |||
| 1545 | Ga0395898_0546082 | |||
| 1546 | Ga0436364_0115933 | |||
| 1547 | Ga0436364_0147107 | |||
| 1548 | Ga0436364_0354157 | |||
| 1549 | Ga0395901_0310997 | |||
| 1550 | Ga0395901_0513053 | |||
| 1551 | Ga0436365_0590507 | |||
| 1552 | Ga0436360_1067871 | |||
| 1553 | Ga0436360_1280163 | |||
| 1554 | Ga0436361_0318263 | |||
| 1555 | Ga0436361_0387230 | |||
| 1556 | Ga0436361_0497072 | |||
| 1557 | Ga0436361_0500168 | |||
| 1558 | Ga0436361_0732319 | |||
| 1559 | Ga0436361_1103679 | |||
| 1560 | Ga0436363_0331024 | |||
| 1561 | Ga0466966_0149285 | |||
| 1562 | Ga0466961_0055286 | |||
| 1563 | Ga0466963_0000494 | |||
| 1564 | Ga0466963_0107210 | |||
| 1565 | Ga0466970_0244720 | |||
| 1566 | Ga0466957_0026837 | |||
| 1567 | Ga0466959_0382284 | |||
| 1568 | Ga0451576_0873383 | |||
| 1569 | Ga0466967_0001401 | |||
| 1570 | Ga0466967_0046813 | |||
| 1571 | Ga0466967_0111253 | |||
| 1572 | Ga0495617_026479 | |||
| 1573 | Ga0495603_0039419 | |||
| 1574 | Ga0495629_0029674 | |||
| 1575 | Ga0495629_0049585 | |||
| 1576 | Ga0495629_0060065 | |||
| 1577 | Ga0495629_0137756 | |||
| 1578 | Ga0495638_0445383 | |||
| 1579 | Ga0495651_0053044 | |||
| 1580 | Ga0495653_0010749 | |||
| 1581 | Ga0495650_0000038 | |||
| 1582 | Ga0495580_0120910 | |||
| 1583 | Ga0495580_0156212 | |||
| 1584 | Ga0495580_0326733 | |||
| 1585 | Ga0495580_0497340 | |||
| 1586 | Ga0495582_0001853 | |||
| 1587 | Ga0495582_0095987 | |||
| 1588 | Ga0495639_0004538 | |||
| 1589 | Ga0495662_0005660 | |||
| 1590 | Ga0495664_0001348 | |||
| 1591 | Ga0495664_0057856 | |||
| 1592 | Ga0495585_0085882 | |||
| 1593 | Ga0495594_0000388 | |||
| 1594 | Ga0495594_0001190 | |||
| 1595 | Ga0495594_0004431 | |||
| 1596 | Ga0495583_0033822 | |||
| 1597 | Ga0495606_0044975 | |||
| 1598 | Ga0495606_0067569 | |||
| 1599 | Ga0495630_0270870 | |||
| 1600 | Ga0495644_0000048 | |||
| 1601 | Ga0495666_0001196 | |||
| 1602 | Ga0495642_0019216 | |||
| 1603 | Ga0495652_0006640 | |||
| 1604 | Ga0495652_0043862 | |||
| 1605 | Ga0495665_0001828 | |||
| 1606 | Ga0495665_0243362 | |||
| 1607 | Ga0495640_0004801 | |||
| 1608 | Ga0495640_0112414 | |||
| 1609 | Ga0495586_0019711 | |||
| 1610 | Ga0495586_0197397 | |||
| 1611 | Ga0495587_0093692 | |||
| 1612 | Ga0495609_0011141 | |||
| 1613 | Ga0495609_0080699 | |||
| 1614 | Ga0495645_0053835 | |||
| 1615 | Ga0495645_0213338 | |||
| 1616 | Ga0495633_0051416 | |||
| 1617 | Ga0495667_0150787 | |||
| 1618 | Ga0495668_0128921 | |||
| 1619 | Ga0495634_0006225 | |||
| 1620 | Ga0495611_0005877 | |||
| 1621 | Ga0495625_0000985 | |||
| 1622 | Ga0495625_0007833 | |||
| 1623 | Ga0495625_0026175 | |||
| 1624 | Ga0495625_0034121 | |||
| 1625 | Ga0495625_0089152 | |||
| 1626 | Ga0495625_0381016 | |||
| 1627 | Ga0495625_0434634 | |||
| 1628 | Ga0495635_0002836 | |||
| 1629 | Ga0495659_0114237 | |||
| 1630 | Ga0495661_0026784 | |||
| 1631 | Ga0495657_0277857 | |||
| 1632 | Ga0495599_0242663 | |||
| 1633 | Ga0495599_0548749 | |||
| 1634 | Ga0495623_0008357 | |||
| 1635 | Ga0495623_0410809 | |||
| 1636 | Ga0495646_0013211 | |||
| 1637 | Ga0495646_0023225 | |||
| 1638 | Ga0495646_0222729 | |||
| 1639 | Ga0495669_0004252 | |||
| 1640 | Ga0495669_0370251 | |||
| 1641 | Ga0495613_0003966 | |||
| 1642 | Ga0495613_0018773 | |||
| 1643 | Ga0495613_0038534 | |||
| 1644 | Ga0495613_0109799 | |||
| 1645 | Ga0495624_0007524 | |||
| 1646 | Ga0495624_0174027 | |||
| 1647 | Ga0495671_0095768 | |||
| 1648 | Ga0495649_0012107 | |||
| 1649 | Ga0495600_0012858 | |||
| 1650 | Ga0495600_0172644 | |||
| 1651 | Ga0495581_0001976 | |||
| 1652 | Ga0495604_0002834 | |||
| 1653 | Ga0495674_0014334 | |||
| 1654 | Ga0495672_0021506 | |||
| 1655 | Ga0495672_0063127 | |||
| 1656 | Ga0495676_0008961 | |||
| 1657 | Ga0495683_0174509 | |||
| 1658 | Ga0495675_0012974 | |||
| 1659 | Ga0495673_0231467 | |||
| 1660 | Ga0495684_0099043 | |||
| 1661 | Ga0495686_0000178 | |||
| 1662 | Ga0495686_0001621 | |||
| 1663 | Ga0495686_0008419 | |||
| 1664 | Ga0495686_0047439 | |||
| 1665 | Ga0495686_0085891 | |||
| 1666 | Ga0495602_0081301 | |||
| 1667 | Ga0495602_0236738 | |||
| 1668 | Ga0495614_0000972 | |||
| 1669 | Ga0496100_0314419 | |||
| 1670 | Ga0496100_0725168 | |||
| 1671 | Ga0496102_0344146 | |||
| 1672 | Ga0496102_0851610 | |||
| 1673 | Ga0496104_0000053 | |||
| 1674 | Ga0496104_0056645 | |||
| 1675 | Ga0496104_0071299 | |||
| 1676 | Ga0496104_0438058 | |||
| 1677 | Ga0496104_0659933 | |||
| 1678 | Ga0496104_0726557 | |||
| 1679 | Ga0496104_0798050 | |||
| 1680 | Ga0496105_0001615 | |||
| 1681 | Ga0496105_0057832 | |||
| 1682 | Ga0496106_0042478 | |||
| 1683 | Ga0496108_0134232 | |||
| 1684 | Ga0496109_0316949 | |||
| 1685 | Ga0496111_0044511 | |||
| 1686 | Ga0496111_0158175 | |||
| 1687 | Ga0496111_0303736 | |||
| 1688 | Ga0496112_0021005 | |||
| 1689 | Ga0496112_0150505 | |||
| 1690 | Ga0496112_0467738 | |||
| 1691 | Ga0496113_0084737 | |||
| 1692 | Ga0496115_0085005 | |||
| 1693 | Ga0496115_0091617 | |||
| 1694 | Ga0496115_0273258 | |||
| 1695 | Ga0496115_0373480 | |||
| 1696 | Ga0496121_0365824 | |||
| 1697 | Ga0496126_0000100 | |||
| 1698 | Ga0496126_0000154 | |||
| 1699 | Ga0496126_0078490 | |||
| 1700 | Ga0501032_0001912 | |||
| 1701 | Ga0501033_0028282 | |||
| 1702 | Ga0501033_0115308 | |||
| 1703 | Ga0501033_0637612 | |||
| 1704 | Ga0501034_0148520 | |||
| 1705 | Ga0501036_0076344 | |||
| 1706 | Ga0501037_0391740 | |||
| 1707 | Ga0501037_0492477 | |||
| 1708 | Ga0501038_0048143 | |||
| 1709 | Ga0501038_0085946 | |||
| 1710 | Ga0501043_0003983 | |||
| 1711 | Ga0501046_0000056 | |||
| 1712 | Ga0501047_0008947 | |||
| 1713 | Ga0501047_0066914 | |||
| 1714 | Ga0501073_0110559 | |||
| 1715 | Ga0501073_0110594 | |||
| 1716 | Ga0501074_0196241 | |||
| 1717 | Ga0501080_0188110 | |||
| 1718 | Ga0501083_0147296 | |||
| 1719 | Ga0501035_0044540 | |||
| 1720 | Ga0501035_0377603 | |||
| 1721 | Ga0501035_0469538 | |||
| 1722 | Ga0501044_0027240 | |||
| 1723 | Ga0501044_0095095 | |||
| 1724 | Ga0501044_0417372 | |||
| 1725 | Ga0501044_0690521 | |||
| 1726 | nmdc:mga06r32_320162_c1 | |||
| 1727 | Ga0495601_0167705 | |||
| 1728 | Ga0495619_0140913 | |||
| 1729 | Ga0500643_109394 | |||
| 1730 | Ga0500651_0000005 | |||
| 1731 | Ga0500595_000004 | |||
| 1732 | Ga0500595_007997 | |||
| 1733 | Ga0500595_058334 | |||
| 1734 | Ga0500595_079031 | |||
| 1735 | Ga0500661_003309 | |||
| 1736 | Ga0501082_0213946 | |||
| 1737 | Ga0530510_0265842 | |||
| 1738 | 2884217798 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.9463 | 34 | 217 |
| 7oj5-assembly1.cif.gz_A | cryo-em structure of medicago truncatula hisn5 protein | 0.9437 | 36 | 217 |
| 2f1d-assembly1.cif.gz_D | x-ray structure of imidazoleglycerol-phosphate dehydratase | 0.9435 | 36 | 217 |
| 4mu3-assembly1.cif.gz_A | the form a structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and a mixture of its substrate, 2r3s-igp, and an inhibitor, 2s3s-igp, to 1.12 a resolution | 0.9416 | 34 | 218 |
| 4mu0-assembly1.cif.gz_A | the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution | 0.9364 | 34 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9662 | 124 | 214 | 3.30.230.40 |
| 4qnkD01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9607 | 34 | 121 | 3.30.230.40 |
| 1rhyA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9561 | 124 | 214 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9531 | 124 | 217 | 3.30.230.40 |
| 2f1dA02 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 | 0.9434 | 124 | 217 | 3.30.230.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A850D107-F1-model_v4 | deleted | 1 | 35 | 95 |
|
| AF-A0A7X6NPR2-F1-model_v4 | deleted | 0.9949 | 36 | 114 |
|
| AF-A0A522GSK4-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9937 | 37 | 111 |
GO:0000105
GO:0004424 |
| AF-A0A7V8WEL3-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9936 | 37 | 100 |
GO:0000105
GO:0004424 |
| AF-A0A257PNR5-F1-model_v4 | Imidazoleglycerol-phosphate dehydratase | 0.9928 | 35 | 114 |
GO:0000105
GO:0004424 |