F483986

General Info

Members Datasets Scaffolds Average Seq Length
865 411 1730 280

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100233175|Ga0070660_1002331751
Length 318
Sequence VPHDGTRSLIGQRADAPIGHAQGFDAGNTTAPAVVGTRMTVPALKLNDGTTIPQLGFGVFQIPPKDTEAAVIQALEVGYRHIDTAQMYGNEKGVGSAVAASGLARDEVFVTSKLNNGFHRPDDARRAFDKTLEALGSDYVDLFLIHWPLPTRYDGDFVSTWETLIEFQADGRARSIGVSNFQVAHLDRLARETSVVPAVNQIEVHPYFGNEDVRAADAAAGIVTEAWSPIAQGDVLGDPTVTAIADRLGRTPSQVVLRWHVQRGDVVFPKTTHVERMRENFAIFDFDLSDEDMAAITALDRGETGRRGPNPDAFDWIP

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
117 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
118 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
188 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
200 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
201 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
204 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
205 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
206 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
207 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
208 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
212 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
213 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
214 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
215 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
218 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
224 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
232 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
233 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
234 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
235 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
242 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
243 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
244 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
245 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
249 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
259 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
260 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
261 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
265 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
266 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
267 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
268 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
269 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
270 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
271 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
272 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
275 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
282 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
283 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
291 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
292 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
293 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
294 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
295 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
296 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
297 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
298 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
299 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
303 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
304 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
305 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
306 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
321 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
322 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
323 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
324 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
325 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
328 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
329 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
332 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
336 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
337 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
338 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
339 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
340 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
341 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
342 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
343 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
344 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
345 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
346 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
347 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
348 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 2501939600 Micromonospora sp. L5 Isolate Unclassified
351 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
352 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
353 2643221561 Nocardioides sp. Root151 Isolate Unclassified
354 2643221613 Oerskovia sp. Root22 Isolate Unclassified
355 2643221615 Nocardioides sp. Root224 Isolate Unclassified
356 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
357 2643221679 Angustibacter sp. Root456 Isolate Unclassified
358 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
359 2643221696 Nocardioides sp. Root140 Isolate Unclassified
360 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
361 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
362 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
363 2739367898 Nocardioides sp. CF479 Isolate Unclassified
364 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
365 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
366 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
367 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
368 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
369 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
370 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
371 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
372 2855683550 Micromonospora sp. RP3T Isolate Unclassified
373 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
374 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
375 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
376 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
377 2858868258 Micromonospora sp. MH33 Isolate Unclassified
378 2858882152 Micromonospora noduli MED15 Isolate Nodule
379 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
380 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
381 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
382 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
383 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
384 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
385 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
386 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
387 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
388 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
389 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
390 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
391 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
392 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
393 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
394 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
395 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
396 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
397 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
398 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
399 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
400 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
401 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
402 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
403 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
404 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
405 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
406 649633069 Micromonospora sp. L5 Isolate Unclassified
407 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
408 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
409 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
410 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
411 8054734606 Micromonospora hortensis NIE111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.25
Metatranscriptomes 0.46
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 4.86
Nodule 0.69
Rhizoplane 9.25
Rhizosphere 75.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100233175 3300005339 Bacteria 1498
2 LJQas_1012794 3300000549 Bacteria 990
3 JGI24737J22298_10023902 3300001990 Bacteria 1936
4 JGI24737J22298_10064182 3300001990 Bacteria 1102
5 JGI24034J26672_10018556 3300002239 Bacteria 1081
6 JGI25407J50210_10042427 3300003373 Bacteria 1164
7 JGI25404J52841_10007807 3300003659 Bacteria 2270
8 Ga0055540_1002731 3300003792 Bacteria 9072
9 Ga0055540_1005641 3300003792 Bacteria 5196
10 Ga0055540_1015867 3300003792 Bacteria 2171
11 Ga0070676_10004509 3300005328 Bacteria 7331
12 Ga0070683_100061774 3300005329 Bacteria 3483
13 Ga0070683_100069891 3300005329 Bacteria 3275
14 Ga0070677_10135226 3300005333 Bacteria 1130
15 Ga0068869_100030664 3300005334 Bacteria 3777
16 Ga0068869_100428163 3300005334 Bacteria 1093
17 Ga0068869_100537444 3300005334 Bacteria 980
18 Ga0070666_10080049 3300005335 Bacteria 2232
19 Ga0070682_100003688 3300005337 Bacteria 8507
20 Ga0070682_100034472 3300005337 Bacteria 3083
21 Ga0070682_100045094 3300005337 Bacteria 2732
22 Ga0068868_100004228 3300005338 Bacteria 10043
23 Ga0068868_100121690 3300005338 Bacteria 2129
24 Ga0070660_100020722 3300005339 Bacteria 4838
25 Ga0070660_100099066 3300005339 Bacteria 2308
26 Ga0070689_100037795 3300005340 Bacteria 3692
27 Ga0070687_100110128 3300005343 Bacteria 1557
28 Ga0070661_100464171 3300005344 Bacteria 1009
29 Ga0070692_10007517 3300005345 Bacteria 4803
30 Ga0070692_10056860 3300005345 Bacteria 2049
31 Ga0070692_10057139 3300005345 Bacteria 2045
32 Ga0070668_100033960 3300005347 Bacteria 3887
33 Ga0070668_100272711 3300005347 Bacteria 1410
34 Ga0070675_100170404 3300005354 Bacteria 1877
35 Ga0070674_100020383 3300005356 Bacteria 4235
36 Ga0070674_100024762 3300005356 Bacteria 3898
37 Ga0070674_100203454 3300005356 Bacteria 1530
38 Ga0070688_100005969 3300005365 Bacteria 6454
39 Ga0070659_100030523 3300005366 Bacteria 4172
40 Ga0070667_100000027 3300005367 Bacteria 181315
41 Ga0070667_100007912 3300005367 Bacteria 8817
42 Ga0070667_100062997 3300005367 Bacteria 3142
43 Ga0070703_10020296 3300005406 Bacteria 1932
44 Ga0070709_10000135 3300005434 Bacteria 49189
45 Ga0070709_10001866 3300005434 Bacteria 11429
46 Ga0070709_10022860 3300005434 Bacteria 3664
47 Ga0070714_100007368 3300005435 Bacteria 8561
48 Ga0070714_100010928 3300005435 Bacteria 7189
49 Ga0070714_100011917 3300005435 Bacteria 6915
50 Ga0070714_100023939 3300005435 Bacteria 5023
51 Ga0070714_100519979 3300005435 Bacteria 1137
52 Ga0070713_100002948 3300005436 Bacteria 11159
53 Ga0070713_100024429 3300005436 Bacteria 4706
54 Ga0070713_100183929 3300005436 Bacteria 1879
55 Ga0070713_100210192 3300005436 Bacteria 1761
56 Ga0070710_10000710 3300005437 Bacteria 15836
57 Ga0070710_10010043 3300005437 Bacteria 4641
58 Ga0070710_10247548 3300005437 Bacteria 1144
59 Ga0070701_10007237 3300005438 Bacteria 4725
60 Ga0070711_100003575 3300005439 Bacteria 9065
61 Ga0070711_100007335 3300005439 Bacteria 6711
62 Ga0070711_100015298 3300005439 Bacteria 4856
63 Ga0070711_100171597 3300005439 Bacteria 1653
64 Ga0070705_100038707 3300005440 Bacteria 2700
65 Ga0070705_100042692 3300005440 Bacteria 2594
66 Ga0070700_100002404 3300005441 Bacteria 9544
67 Ga0070700_100005243 3300005441 Bacteria 6853
68 Ga0070700_100036181 3300005441 Bacteria 2992
69 Ga0070700_100083450 3300005441 Bacteria 2069
70 Ga0070700_100155637 3300005441 Bacteria 1568
71 Ga0070694_100020269 3300005444 Bacteria 4237
72 Ga0070663_100159018 3300005455 Bacteria 1738
73 Ga0070663_100177317 3300005455 Bacteria 1651
74 Ga0070678_100003571 3300005456 Bacteria 8675
75 Ga0070678_100049258 3300005456 Bacteria 3039
76 Ga0070662_100018266 3300005457 Bacteria 4741
77 Ga0070662_100133759 3300005457 Bacteria 1915
78 Ga0068867_100001469 3300005459 Bacteria 16336
79 Ga0070706_100109516 3300005467 Bacteria 2570
80 Ga0070679_100310176 3300005530 Bacteria 1528
81 Ga0070679_100487733 3300005530 Bacteria 1176
82 Ga0070684_100004622 3300005535 Bacteria 10498
83 Ga0070684_100133069 3300005535 Bacteria 2244
84 Ga0070684_100420527 3300005535 Bacteria 1233
85 Ga0068853_100022280 3300005539 Bacteria 5290
86 Ga0070672_100001159 3300005543 Bacteria 16111
87 Ga0070672_100027373 3300005543 Bacteria 4251
88 Ga0070686_100021257 3300005544 Bacteria 3854
89 Ga0070686_100092564 3300005544 Bacteria 2025
90 Ga0070686_100144948 3300005544 Bacteria 1657
91 Ga0070695_100067985 3300005545 Bacteria 2325
92 Ga0070696_100022383 3300005546 Bacteria 4293
93 Ga0070693_100118629 3300005547 Bacteria 1638
94 Ga0070665_100000566 3300005548 Bacteria 51646
95 Ga0070665_100005584 3300005548 Bacteria 12934
96 Ga0070665_100006130 3300005548 Bacteria 12290
97 Ga0070704_100000126 3300005549 Bacteria 27927
98 Ga0068855_100081382 3300005563 Bacteria 3754
99 Ga0070664_100003142 3300005564 Bacteria 13351
100 Ga0068857_100049899 3300005577 Bacteria 3713
101 Ga0068854_100020208 3300005578 Bacteria 4501
102 Ga0068854_100368183 3300005578 Bacteria 1181
103 Ga0068854_100509062 3300005578 Bacteria 1015
104 Ga0068856_100169546 3300005614 Bacteria 2195
105 Ga0068856_100187901 3300005614 Bacteria 2080
106 Ga0070702_100001763 3300005615 Bacteria 9005
107 Ga0070702_100019013 3300005615 Bacteria 3573
108 Ga0070702_100233362 3300005615 Bacteria 1238
109 Ga0070702_100462911 3300005615 Bacteria 922
110 Ga0068852_100004825 3300005616 Bacteria 9580
111 Ga0068852_100227965 3300005616 Bacteria 1775
112 Ga0068852_100551566 3300005616 Bacteria 1153
113 Ga0068859_100001466 3300005617 Bacteria 24023
114 Ga0068859_100073907 3300005617 Bacteria 3447
115 Ga0068866_10023190 3300005718 Bacteria 2883
116 Ga0068866_10061208 3300005718 Bacteria 1954
117 Ga0068866_10067927 3300005718 Bacteria 1873
118 Ga0068861_100004568 3300005719 Bacteria 9295
119 Ga0068861_100034935 3300005719 Bacteria 3720
120 Ga0068861_100042597 3300005719 Bacteria 3403
121 Ga0068861_100381332 3300005719 Bacteria 1246
122 Ga0068861_100429438 3300005719 Bacteria 1179
123 Ga0068870_10016817 3300005840 Bacteria 3505
124 Ga0068863_100000463 3300005841 Bacteria 41401
125 Ga0068863_100006631 3300005841 Bacteria 11362
126 Ga0068863_100160140 3300005841 Bacteria 2156
127 Ga0068863_100418099 3300005841 Bacteria 1313
128 Ga0068858_100023617 3300005842 Bacteria 5728
129 Ga0068858_100026870 3300005842 Bacteria 5347
130 Ga0068858_100046922 3300005842 Bacteria 4005
131 Ga0068858_100162952 3300005842 Bacteria 2100
132 Ga0068860_100000141 3300005843 Bacteria 117843
133 Ga0068860_100004584 3300005843 Bacteria 14106
134 Ga0068860_100060872 3300005843 Bacteria 3587
135 Ga0068862_100000138 3300005844 Bacteria 82578
136 Ga0068862_100189710 3300005844 Bacteria 1849
137 Ga0081455_10011098 3300005937 Bacteria 9069
138 Ga0081455_10142172 3300005937 Bacteria 1862
139 Ga0081540_1000527 3300005983 Bacteria 37363
140 Ga0081540_1062677 3300005983 Bacteria 1764
141 Ga0081539_10001009 3300005985 Bacteria 52009
142 Ga0070717_10011333 3300006028 Bacteria 6765
143 Ga0070717_10062854 3300006028 Bacteria 3079
144 Ga0070717_10076407 3300006028 Bacteria 2803
145 Ga0070717_10128742 3300006028 Bacteria 2175
146 Ga0070717_10195411 3300006028 Bacteria 1770
147 Ga0075365_10002024 3300006038 Bacteria 9622
148 Ga0075365_10012827 3300006038 Bacteria 4992
149 Ga0075365_10021273 3300006038 Bacteria 4043
150 Ga0075365_10023288 3300006038 Bacteria 3893
151 Ga0075365_10042779 3300006038 Bacteria 2963
152 Ga0075365_10134195 3300006038 Bacteria 1715
153 Ga0075365_10150794 3300006038 Bacteria 1617
154 Ga0075363_100003255 3300006048 Bacteria 6871
155 Ga0075363_100011124 3300006048 Bacteria 4301
156 Ga0075364_10002521 3300006051 Bacteria 10257
157 Ga0075364_10010660 3300006051 Bacteria 5558
158 Ga0075364_10060850 3300006051 Bacteria 2476
159 Ga0075364_10075430 3300006051 Bacteria 2225
160 Ga0075364_10247410 3300006051 Bacteria 1212
161 Ga0070715_10001665 3300006163 Bacteria 6591
162 Ga0070716_100000586 3300006173 Bacteria 15288
163 Ga0070716_100013856 3300006173 Bacteria 4119
164 Ga0070716_100038904 3300006173 Bacteria 2636
165 Ga0070716_100080830 3300006173 Bacteria 1939
166 Ga0070716_100190597 3300006173 Bacteria 1354
167 Ga0070712_100001102 3300006175 Bacteria 16265
168 Ga0070712_100013749 3300006175 Bacteria 5178
169 Ga0070712_100064753 3300006175 Bacteria 2593
170 Ga0070712_100253925 3300006175 Bacteria 1406
171 Ga0070712_100503534 3300006175 Bacteria 1015
172 Ga0075369_10001409 3300006186 Bacteria 8187
173 Ga0075369_10003302 3300006186 Bacteria 5860
174 Ga0075369_10006006 3300006186 Bacteria 4570
175 Ga0097621_100139448 3300006237 Bacteria 2071
176 Ga0075370_10022995 3300006353 Bacteria 3429
177 Ga0068871_100079406 3300006358 Bacteria 2715
178 Ga0068871_100108794 3300006358 Bacteria 2330
179 Ga0068871_100652286 3300006358 Bacteria 961
180 Ga0075428_100013075 3300006844 Bacteria 9228
181 Ga0075428_100099616 3300006844 Bacteria 3169
182 Ga0075428_100321842 3300006844 Bacteria 1662
183 Ga0075433_10002223 3300006852 Bacteria 14722
184 Ga0075433_10136272 3300006852 Bacteria 2182
185 Ga0075434_100019351 3300006871 Bacteria 6588
186 Ga0075434_100314954 3300006871 Bacteria 1585
187 Ga0075429_100205791 3300006880 Bacteria 1724
188 Ga0068865_100006922 3300006881 Bacteria 6952
189 Ga0068865_100053113 3300006881 Bacteria 2811
190 Ga0075436_100059575 3300006914 Bacteria 2637
191 Ga0097620_100001464 3300006931 Bacteria 24023
192 Ga0097620_100073903 3300006931 Bacteria 3447
193 Ga0075435_100122107 3300007076 Bacteria 2174
194 Ga0105250_10047541 3300009092 Bacteria 1721
195 Ga0105250_10090253 3300009092 Bacteria 1246
196 Ga0105240_10432224 3300009093 Bacteria 1477
197 Ga0105240_10521035 3300009093 Bacteria 1319
198 Ga0111539_10021223 3300009094 Bacteria 7997
199 Ga0111539_10250278 3300009094 Bacteria 2063
200 Ga0105245_10003386 3300009098 Bacteria 14283
201 Ga0105245_10006044 3300009098 Bacteria 10645
202 Ga0105245_10010406 3300009098 Bacteria 8100
203 Ga0105245_10123773 3300009098 Bacteria 2418
204 Ga0105245_10666262 3300009098 Bacteria 1072
205 Ga0105247_10000237 3300009101 Bacteria 51740
206 Ga0105247_10002143 3300009101 Bacteria 13636
207 Ga0114129_10312441 3300009147 Bacteria 2091
208 Ga0105243_10002465 3300009148 Bacteria 15457
209 Ga0105243_10021157 3300009148 Bacteria 4936
210 Ga0105243_10043828 3300009148 Bacteria 3507
211 Ga0105243_10068861 3300009148 Bacteria 2853
212 Ga0105241_10229784 3300009174 Bacteria 1563
213 Ga0105242_10002038 3300009176 Bacteria 15908
214 Ga0105242_10431694 3300009176 Bacteria 1237
215 Ga0105242_10502774 3300009176 Bacteria 1153
216 Ga0105248_10000337 3300009177 Bacteria 55206
217 Ga0105248_10018735 3300009177 Bacteria 7654
218 Ga0105248_10058498 3300009177 Bacteria 4329
219 Ga0105237_10094293 3300009545 Bacteria 2982
220 Ga0105237_10104022 3300009545 Bacteria 2831
221 Ga0105237_10238262 3300009545 Bacteria 1821
222 Ga0105238_10046372 3300009551 Bacteria 4387
223 Ga0105238_10212329 3300009551 Bacteria 1911
224 Ga0105238_10619003 3300009551 Bacteria 1091
225 Ga0105249_10000013 3300009553 Bacteria 283609
226 Ga0105249_10003606 3300009553 Bacteria 13386
227 Ga0105249_10025176 3300009553 Bacteria 5355
228 Ga0105249_10085627 3300009553 Bacteria 2937
229 Ga0105249_10261712 3300009553 Bacteria 1719
230 Ga0105249_10588974 3300009553 Bacteria 1166
231 Ga0105249_10799060 3300009553 Bacteria 1007
232 Ga0105239_10043688 3300010375 Bacteria 4913
233 Ga0105239_10106355 3300010375 Bacteria 3108
234 Ga0105239_10132670 3300010375 Bacteria 2771
235 Ga0157371_10088622 3300013102 Bacteria 2191
236 Ga0157369_10161138 3300013105 Bacteria 2368
237 Ga0157369_10182133 3300013105 Bacteria 2210
238 Ga0157374_10198395 3300013296 Bacteria 1964
239 Ga0157374_10276920 3300013296 Bacteria 1656
240 Ga0157378_10005230 3300013297 Bacteria 11395
241 Ga0157378_10160056 3300013297 Bacteria 2105
242 Ga0163162_10010461 3300013306 Bacteria 9020
243 Ga0163162_10030527 3300013306 Bacteria 5340
244 Ga0163162_10090867 3300013306 Bacteria 3135
245 Ga0163162_10667979 3300013306 Bacteria 1162
246 Ga0157372_10052599 3300013307 Bacteria 4536
247 Ga0157372_10059668 3300013307 Bacteria 4267
248 Ga0157372_10328832 3300013307 Bacteria 1780
249 Ga0157372_10574719 3300013307 Bacteria 1314
250 Ga0157375_10008041 3300013308 Bacteria 9234
251 Ga0157375_10011802 3300013308 Bacteria 7724
252 Ga0157375_10130619 3300013308 Bacteria 2631
253 Ga0157375_10132594 3300013308 Bacteria 2612
254 Ga0157375_10209838 3300013308 Bacteria 2105
255 Ga0157375_10965022 3300013308 Bacteria 993
256 Ga0163163_10079248 3300014325 Bacteria 3283
257 Ga0163163_10293667 3300014325 Bacteria 1678
258 Ga0163163_10306464 3300014325 Bacteria 1641
259 Ga0157380_10006518 3300014326 Bacteria 8230
260 Ga0157380_10095793 3300014326 Bacteria 2460
261 Ga0157380_10480080 3300014326 Bacteria 1202
262 Ga0157379_10007978 3300014968 Bacteria 9184
263 Ga0157379_10099990 3300014968 Bacteria 2604
264 Ga0157379_10109595 3300014968 Bacteria 2480
265 Ga0157379_10189230 3300014968 Bacteria 1860
266 Ga0157376_10069685 3300014969 Bacteria 2982
267 Ga0157376_10789429 3300014969 Bacteria 961
268 Ga0163161_10004894 3300017792 Bacteria 9331
269 Ga0163161_10048870 3300017792 Bacteria 3056
270 Ga0197907_10042006 3300020069 Bacteria 993
271 Ga0206354_10834257 3300020081 Bacteria 1008
272 Ga0206353_11905460 3300020082 Bacteria 987
273 Ga0213876_10007166 3300021384 Bacteria 6079
274 Ga0213876_10009726 3300021384 Bacteria 5174
275 Ga0213875_10001663 3300021388 Bacteria 14012
276 Ga0213875_10001762 3300021388 Bacteria 13549
277 Ga0213875_10024144 3300021388 Bacteria 2901
278 Ga0213875_10038157 3300021388 Bacteria 2264
279 Ga0224572_1005141 3300024225 Bacteria 2319
280 Ga0224572_1017697 3300024225 Bacteria 1369
281 Ga0209673_1058632 3300025273 Bacteria 973
282 Ga0209051_1000122 3300025303 Bacteria 144507
283 Ga0209051_1001174 3300025303 Bacteria 23776
284 Ga0209051_1005191 3300025303 Bacteria 7707
285 Ga0209051_1018341 3300025303 Bacteria 3098
286 Ga0207696_1046704 3300025711 Bacteria 1249
287 Ga0207682_10074471 3300025893 Bacteria 1444
288 Ga0207692_10000342 3300025898 Bacteria 16158
289 Ga0207692_10015760 3300025898 Bacteria 3333
290 Ga0207642_10032568 3300025899 Bacteria 2196
291 Ga0207642_10159601 3300025899 Bacteria 1209
292 Ga0207710_10000213 3300025900 Bacteria 51731
293 Ga0207688_10000557 3300025901 Bacteria 18190
294 Ga0207688_10006136 3300025901 Bacteria 6541
295 Ga0207688_10030407 3300025901 Bacteria 2977
296 Ga0207688_10045486 3300025901 Bacteria 2449
297 Ga0207688_10073346 3300025901 Bacteria 1945
298 Ga0207688_10128129 3300025901 Bacteria 1486
299 Ga0207680_10147111 3300025903 Bacteria 1567
300 Ga0207647_10014152 3300025904 Bacteria 5508
301 Ga0207647_10242643 3300025904 Bacteria 1034
302 Ga0207685_10005941 3300025905 Bacteria 3275
303 Ga0207699_10000148 3300025906 Bacteria 45232
304 Ga0207645_10005261 3300025907 Bacteria 9425
305 Ga0207643_10024032 3300025908 Bacteria 3363
306 Ga0207705_10024663 3300025909 Bacteria 4291
307 Ga0207705_10107565 3300025909 Bacteria 2058
308 Ga0207705_10128876 3300025909 Bacteria 1882
309 Ga0207695_10330723 3300025913 Bacteria 1412
310 Ga0207695_10397227 3300025913 Bacteria 1263
311 Ga0207671_10020382 3300025914 Bacteria 5046
312 Ga0207693_10000346 3300025915 Bacteria 42778
313 Ga0207693_10002049 3300025915 Bacteria 17626
314 Ga0207693_10002834 3300025915 Bacteria 15019
315 Ga0207663_10026950 3300025916 Bacteria 3343
316 Ga0207662_10016725 3300025918 Bacteria 4142
317 Ga0207657_10045057 3300025919 Bacteria 3874
318 Ga0207657_10185679 3300025919 Bacteria 1679
319 Ga0207657_10239631 3300025919 Bacteria 1448
320 Ga0207652_10324752 3300025921 Bacteria 1389
321 Ga0207681_10000866 3300025923 Bacteria 19891
322 Ga0207694_10146974 3300025924 Bacteria 1897
323 Ga0207687_10005646 3300025927 Bacteria 8276
324 Ga0207687_10070720 3300025927 Bacteria 2492
325 Ga0207687_10328132 3300025927 Bacteria 1241
326 Ga0207700_10000793 3300025928 Bacteria 18260
327 Ga0207700_10009110 3300025928 Bacteria 6183
328 Ga0207700_10009744 3300025928 Bacteria 6022
329 Ga0207700_10013499 3300025928 Bacteria 5318
330 Ga0207664_10000246 3300025929 Bacteria 40614
331 Ga0207664_10014178 3300025929 Bacteria 5748
332 Ga0207664_10024853 3300025929 Bacteria 4504
333 Ga0207664_10049854 3300025929 Bacteria 3298
334 Ga0207664_10111164 3300025929 Bacteria 2279
335 Ga0207644_10045948 3300025931 Bacteria 3108
336 Ga0207690_10239467 3300025932 Bacteria 1397
337 Ga0207706_10000901 3300025933 Bacteria 30536
338 Ga0207706_10006711 3300025933 Bacteria 10639
339 Ga0207706_10140154 3300025933 Bacteria 2127
340 Ga0207686_10045316 3300025934 Bacteria 2705
341 Ga0207709_10003330 3300025935 Bacteria 9625
342 Ga0207709_10009011 3300025935 Bacteria 5501
343 Ga0207709_10018611 3300025935 Bacteria 3893
344 Ga0207670_10052640 3300025936 Bacteria 2738
345 Ga0207670_10135992 3300025936 Bacteria 1807
346 Ga0207669_10015908 3300025937 Bacteria 3807
347 Ga0207669_10228931 3300025937 Bacteria 1370
348 Ga0207704_10007329 3300025938 Bacteria 5205
349 Ga0207704_10127996 3300025938 Bacteria 1752
350 Ga0207665_10000711 3300025939 Bacteria 22571
351 Ga0207665_10001580 3300025939 Bacteria 15361
352 Ga0207665_10006217 3300025939 Bacteria 7931
353 Ga0207691_10002487 3300025940 Bacteria 18018
354 Ga0207711_10000753 3300025941 Bacteria 31755
355 Ga0207711_10079574 3300025941 Bacteria 2861
356 Ga0207689_10055193 3300025942 Bacteria 3270
357 Ga0207689_10407627 3300025942 Bacteria 1134
358 Ga0207661_10334085 3300025944 Bacteria 1365
359 Ga0207679_10001569 3300025945 Bacteria 14281
360 Ga0207667_10089236 3300025949 Bacteria 3187
361 Ga0207667_10715850 3300025949 Bacteria 1003
362 Ga0207712_10000018 3300025961 Bacteria 317921
363 Ga0207712_10036981 3300025961 Bacteria 3328
364 Ga0207668_10000770 3300025972 Bacteria 19610
365 Ga0207668_10060146 3300025972 Bacteria 2665
366 Ga0207668_10068292 3300025972 Bacteria 2526
367 Ga0207668_10084590 3300025972 Bacteria 2312
368 Ga0207668_10107638 3300025972 Bacteria 2085
369 Ga0207640_10013064 3300025981 Bacteria 4749
370 Ga0207640_10052058 3300025981 Bacteria 2665
371 Ga0207640_10424436 3300025981 Bacteria 1089
372 Ga0207658_10000788 3300025986 Bacteria 26993
373 Ga0207658_10006407 3300025986 Bacteria 8035
374 Ga0207658_10057023 3300025986 Bacteria 2901
375 Ga0207658_10070692 3300025986 Bacteria 2641
376 Ga0207703_10039576 3300026035 Bacteria 3768
377 Ga0207703_10066149 3300026035 Bacteria 2973
378 Ga0207703_10097545 3300026035 Bacteria 2483
379 Ga0207639_10027732 3300026041 Bacteria 4129
380 Ga0207639_10082466 3300026041 Bacteria 2549
381 Ga0207639_10265147 3300026041 Bacteria 1504
382 Ga0207678_10075534 3300026067 Bacteria 2887
383 Ga0207708_10000448 3300026075 Bacteria 32061
384 Ga0207708_10001359 3300026075 Bacteria 18383
385 Ga0207708_10107496 3300026075 Bacteria 2163
386 Ga0207708_10139643 3300026075 Bacteria 1899
387 Ga0207702_10108937 3300026078 Bacteria 2459
388 Ga0207641_10000953 3300026088 Bacteria 29732
389 Ga0207641_10214209 3300026088 Bacteria 1783
390 Ga0207648_10000550 3300026089 Bacteria 42009
391 Ga0207648_10003999 3300026089 Bacteria 15298
392 Ga0207676_10167996 3300026095 Bacteria 1908
393 Ga0207676_10372557 3300026095 Bacteria 1327
394 Ga0207674_10061967 3300026116 Bacteria 3778
395 Ga0207675_100001369 3300026118 Bacteria 24433
396 Ga0207675_100003501 3300026118 Bacteria 15316
397 Ga0207675_100017246 3300026118 Bacteria 6742
398 Ga0207675_100062669 3300026118 Bacteria 3474
399 Ga0207675_100082776 3300026118 Bacteria 3010
400 Ga0207675_100162811 3300026118 Bacteria 2129
401 Ga0207675_100262685 3300026118 Bacteria 1674
402 Ga0207675_100547846 3300026118 Bacteria 1156
403 Ga0207683_10000569 3300026121 Bacteria 34187
404 Ga0207683_10167066 3300026121 Bacteria 1991
405 Ga0207698_10039000 3300026142 Bacteria 3515
406 Ga0207698_10202041 3300026142 Bacteria 1780
407 Ga0207698_10386661 3300026142 Bacteria 1333
408 Ga0265357_1003356 3300028023 Bacteria 1384
409 Ga0268266_10000596 3300028379 Bacteria 49462
410 Ga0268266_10004635 3300028379 Bacteria 13108
411 Ga0268266_10084589 3300028379 Bacteria 2770
412 Ga0268266_10387824 3300028379 Bacteria 1319
413 Ga0268265_10000159 3300028380 Bacteria 82592
414 Ga0268265_10012251 3300028380 Bacteria 5810
415 Ga0268265_10415390 3300028380 Bacteria 1248
416 Ga0268264_10000005 3300028381 Bacteria 934972
417 Ga0268264_10000249 3300028381 Bacteria 101309
418 Ga0268264_10302852 3300028381 Bacteria 1505
419 Ga0265338_10118493 3300028800 Bacteria 2115
420 Ga0265340_10098011 3300031247 Bacteria 1364
421 Ga0265327_10113557 3300031251 Bacteria 1291
422 Ga0307509_10077196 3300031507 Bacteria 3454
423 Ga0307408_100039076 3300031548 Bacteria 3352
424 Ga0265313_10100267 3300031595 Bacteria 1286
425 Ga0265314_10076871 3300031711 Bacteria 2216
426 Ga0316576_10012638 3300031727 Bacteria 5584
427 Ga0316576_10021323 3300031727 Bacteria 4479
428 Ga0316576_10091864 3300031727 Bacteria 2262
429 Ga0307516_10000690 3300031730 Bacteria 45875
430 Ga0307405_10016614 3300031731 Bacteria 4018
431 Ga0307405_10249901 3300031731 Bacteria 1319
432 Ga0316577_10008319 3300031733 Bacteria 5557
433 Ga0316577_10118271 3300031733 Bacteria 1489
434 Ga0307413_10106243 3300031824 Bacteria 1868
435 Ga0307410_10013152 3300031852 Bacteria 4817
436 Ga0307410_10071306 3300031852 Bacteria 2409
437 Ga0307410_10121908 3300031852 Bacteria 1903
438 Ga0307410_10130739 3300031852 Bacteria 1844
439 Ga0307410_10168023 3300031852 Bacteria 1650
440 Ga0307410_10455581 3300031852 Bacteria 1044
441 Ga0307407_10047079 3300031903 Bacteria 2445
442 Ga0307407_10083836 3300031903 Bacteria 1935
443 Ga0307407_10094830 3300031903 Bacteria 1838
444 Ga0307409_100033438 3300031995 Bacteria 3742
445 Ga0307409_100075186 3300031995 Bacteria 2703
446 Ga0307409_100161414 3300031995 Bacteria 1960
447 Ga0307409_100165680 3300031995 Bacteria 1939
448 Ga0307409_100193836 3300031995 Bacteria 1811
449 Ga0307409_100199854 3300031995 Bacteria 1787
450 Ga0307409_100254697 3300031995 Bacteria 1607
451 Ga0307409_100697164 3300031995 Bacteria 1014
452 Ga0307416_100040283 3300032002 Bacteria 3627
453 Ga0307416_100044453 3300032002 Bacteria 3488
454 Ga0307416_100176956 3300032002 Bacteria 1994
455 Ga0307411_10152938 3300032005 Bacteria 1717
456 Ga0307411_10196746 3300032005 Bacteria 1544
457 Ga0307415_100107877 3300032126 Bacteria 2059
458 Ga0307415_100204301 3300032126 Bacteria 1570
459 Ga0307415_100397542 3300032126 Bacteria 1175
460 Ga0316585_10094951 3300032137 Bacteria 976
461 Ga0373934_0013610 3300035086 Bacteria 3078
462 Ga0373923_0000819 3300035111 Bacteria 8143
463 Ga0373923_0031167 3300035111 Bacteria 2148
464 Ga0373936_0029846 3300035113 Bacteria 2148
465 Ga0373939_0008509 3300035114 Bacteria 2518
466 Ga0373956_0016105 3300035119 Bacteria 3135
467 Ga0373957_0002669 3300035120 Bacteria 5118
468 Ga0373957_0064510 3300035120 Bacteria 1424
469 Ga0373946_0029573 3300035171 Bacteria 2182
470 Ga0373955_0042103 3300035172 Bacteria 2451
471 Ga0373955_0086873 3300035172 Bacteria 1776
472 Ga0316574_0070099 3300035398 Bacteria 2213
473 Ga0373924_0001912 3300035410 Bacteria 6923
474 Ga0373931_0008008 3300035691 Bacteria 5000
475 Ga0373933_0009517 3300035724 Bacteria 5306
476 Ga0373933_0094027 3300035724 Bacteria 1853
477 Ga0373947_0119643 3300035725 Bacteria 1672
478 Ga0373937_0697678 3300036401 Bacteria 961
479 Ga0372808_000117 3300036459 Bacteria 4184
480 Ga0316582_0095694 3300036647 Bacteria 1960
481 Ga0316584_0024109 3300036712 Bacteria 4450
482 Ga0316584_0041308 3300036712 Bacteria 3437
483 Ga0373925_0008092 3300037068 Bacteria 7656
484 Ga0373925_0069650 3300037068 Bacteria 2657
485 Ga0395900_0007441 3300037418 Bacteria 11314
486 Ga0395900_0068195 3300037418 Bacteria 3655
487 Ga0395900_0133963 3300037418 Bacteria 2538
488 Ga0395900_0603533 3300037418 Bacteria 1038
489 Ga0395898_0123001 3300037466 Bacteria 2486
490 Ga0395898_0528836 3300037466 Bacteria 1121
491 Ga0395898_0576919 3300037466 Bacteria 1067
492 Ga0436364_0003227 3300037853 Bacteria 16956
493 Ga0436364_0201210 3300037853 Bacteria 60188
494 Ga0436364_0337262 3300037853 Bacteria 2445
495 Ga0436364_0348454 3300037853 Bacteria 2060
496 Ga0436364_0425968 3300037853 Bacteria 1783
497 Ga0436364_0693075 3300037853 Bacteria 1730
498 Ga0436364_1265507 3300037853 Bacteria 48294
499 Ga0395901_0009441 3300038443 Bacteria 9898
500 Ga0395901_0204101 3300038443 Bacteria 2071
501 Ga0395901_0452109 3300038443 Bacteria 1314
502 Ga0436365_0174550 3300039437 Bacteria 6140
503 Ga0436365_0576629 3300039437 Bacteria 3153
504 Ga0436365_0641890 3300039437 Bacteria 23847
505 Ga0436363_1646938 3300039450 Bacteria 1141
506 Ga0436362_0601122 3300039453 Bacteria 1185
507 Ga0439461_0000484 3300041410 Bacteria 5740
508 Ga0439466_0006739 3300041411 Bacteria 4357
509 Ga0439465_0000300 3300041413 Bacteria 13940
510 Ga0451835_1090130 3300041492 Bacteria 1187
511 Ga0451853_3221077 3300041512 Bacteria 1348
512 Ga0439431_0005136 3300041997 Bacteria 2887
513 Ga0439442_001876 3300042002 Bacteria 4121
514 Ga0439434_0015578 3300042435 Bacteria 2267
515 Ga0439460_0017904 3300042461 Bacteria 1903
516 Ga0439440_0005469 3300042993 Bacteria 2525
517 Ga0466966_0008251 3300044684 Bacteria 6907
518 Ga0466966_0014087 3300044684 Bacteria 5294
519 Ga0466963_0008588 3300044694 Bacteria 6131
520 Ga0466963_0010397 3300044694 Bacteria 5633
521 Ga0466963_0014995 3300044694 Bacteria 4790
522 Ga0466963_0032178 3300044694 Bacteria 3395
523 Ga0466963_0056016 3300044694 Bacteria 2623
524 Ga0466963_0200391 3300044694 Bacteria 1396
525 Ga0466963_0255910 3300044694 Bacteria 1229
526 Ga0466963_0275066 3300044694 Bacteria 1183
527 Ga0466963_0379756 3300044694 Bacteria 996
528 Ga0466964_0018190 3300044706 Bacteria 2695
529 Ga0466964_0072718 3300044706 Bacteria 1458
530 Ga0466964_0125298 3300044706 Bacteria 1163
531 Ga0466971_0006420 3300044719 Bacteria 5108
532 Ga0466971_0031768 3300044719 Bacteria 2364
533 Ga0466971_0073135 3300044719 Bacteria 1558
534 Ga0466970_0050470 3300044765 Bacteria 2219
535 Ga0466957_0075664 3300044842 Bacteria 2089
536 Ga0466957_0123888 3300044842 Bacteria 1650
537 Ga0466960_0003456 3300044901 Bacteria 6078
538 Ga0466960_0032528 3300044901 Bacteria 2416
539 Ga0466960_0082639 3300044901 Bacteria 1622
540 Ga0451576_0149904 3300045051 Bacteria 2432
541 Ga0466958_0011794 3300045836 Bacteria 4934
542 Ga0466958_0020030 3300045836 Bacteria 3898
543 Ga0466958_0205292 3300045836 Bacteria 1254
544 Ga0466967_0000413 3300045976 Bacteria 20236
545 Ga0466967_0006573 3300045976 Bacteria 8252
546 Ga0466967_0021792 3300045976 Bacteria 5213
547 Ga0466967_0036958 3300045976 Bacteria 4174
548 Ga0466967_0078347 3300045976 Bacteria 2977
549 Ga0466967_0102247 3300045976 Bacteria 2621
550 Ga0466967_0103215 3300045976 Bacteria 2609
551 Ga0466967_0111687 3300045976 Bacteria 2512
552 Ga0466967_0120496 3300045976 Bacteria 2423
553 Ga0466967_0157437 3300045976 Bacteria 2129
554 Ga0466967_0190081 3300045976 Bacteria 1940
555 Ga0466967_0230675 3300045976 Bacteria 1762
556 Ga0466967_0257782 3300045976 Bacteria 1668
557 Ga0466967_0359320 3300045976 Bacteria 1411
558 Ga0466967_0733847 3300045976 Bacteria 979
559 Ga0495592_0009192 3300046454 Bacteria 7436
560 Ga0495592_0022237 3300046454 Bacteria 4823
561 Ga0495629_0008179 3300046459 Bacteria 7691
562 Ga0495629_0191486 3300046459 Bacteria 1415
563 Ga0495641_0017837 3300046461 Bacteria 3683
564 Ga0495641_0209540 3300046461 Bacteria 874
565 Ga0495651_0003795 3300046462 Bacteria 11559
566 Ga0495651_0003978 3300046462 Bacteria 11298
567 Ga0495651_0197370 3300046462 Bacteria 1411
568 Ga0495653_0010354 3300046463 Bacteria 7627
569 Ga0495653_0070695 3300046463 Bacteria 2611
570 Ga0495582_0006180 3300046473 Bacteria 6666
571 Ga0495639_0023898 3300046475 Bacteria 2688
572 Ga0495662_0088243 3300046476 Bacteria 1511
573 Ga0495664_0051583 3300046477 Bacteria 2442
574 Ga0495664_0106173 3300046477 Bacteria 1693
575 Ga0495608_0003288 3300046511 Bacteria 11548
576 Ga0495618_0036687 3300046514 Bacteria 3076
577 Ga0495618_0071785 3300046514 Bacteria 2203
578 Ga0495628_0011984 3300046516 Bacteria 7312
579 Ga0495628_0111124 3300046516 Bacteria 2107
580 Ga0495630_0012219 3300046517 Bacteria 6228
581 Ga0495652_0007754 3300046529 Bacteria 9869
582 Ga0495652_0052582 3300046529 Bacteria 3473
583 Ga0495665_0008176 3300046531 Bacteria 5673
584 Ga0495587_0014721 3300046536 Bacteria 4899
585 Ga0495645_0043783 3300046543 Bacteria 3266
586 Ga0495667_0001844 3300046559 Bacteria 14067
587 Ga0495667_0110766 3300046559 Bacteria 1773
588 Ga0495656_0026889 3300046615 Bacteria 2294
589 Ga0495634_0022563 3300046642 Bacteria 4434
590 Ga0495635_0073351 3300046663 Bacteria 2344
591 Ga0495635_0151184 3300046663 Bacteria 1580
592 Ga0495657_0012258 3300046675 Bacteria 6370
593 Ga0495657_0040679 3300046675 Bacteria 3186
594 Ga0495657_0162887 3300046675 Bacteria 1379
595 Ga0495599_0186381 3300046678 Bacteria 1277
596 Ga0495646_0108510 3300046680 Bacteria 1582
597 Ga0495647_0063558 3300046681 Bacteria 1462
598 Ga0495658_0021465 3300046683 Bacteria 3404
599 Ga0495613_0328413 3300046689 Bacteria 1054
600 Ga0495624_0018493 3300046690 Bacteria 4661
601 Ga0495600_0011368 3300046809 Bacteria 5545
602 Ga0495600_0039572 3300046809 Bacteria 3070
603 Ga0495581_0030864 3300047315 Bacteria 3104
604 Ga0495604_0134483 3300047317 Bacteria 1773
605 Ga0495604_0383917 3300047317 Bacteria 927
606 Ga0495674_0012863 3300047319 Bacteria 7882
607 Ga0495674_0065965 3300047319 Bacteria 3142
608 Ga0495674_0198376 3300047319 Bacteria 1666
609 Ga0495674_0249676 3300047319 Bacteria 1460
610 Ga0495674_0459226 3300047319 Bacteria 1022
611 Ga0495676_0309591 3300047321 Bacteria 1063
612 Ga0495680_0020203 3300047322 Bacteria 5609
613 Ga0495680_0225679 3300047322 Bacteria 1335
614 Ga0495675_0004710 3300047444 Bacteria 8286
615 Ga0495684_0073375 3300047471 Bacteria 2599
616 Ga0495593_0031702 3300047673 Bacteria 2885
617 Ga0495602_0039054 3300048088 Bacteria 4377
618 Ga0495602_0081562 3300048088 Bacteria 2719
619 Ga0495614_0008296 3300048089 Bacteria 4625
620 Ga0495614_0105509 3300048089 Bacteria 1235
621 Ga0496100_0001064 3300048903 Bacteria 13233
622 Ga0496100_0006542 3300048903 Bacteria 6360
623 Ga0496100_0046405 3300048903 Bacteria 2793
624 Ga0496100_0146694 3300048903 Bacteria 1679
625 Ga0496100_0161341 3300048903 Bacteria 1607
626 Ga0496100_0169157 3300048903 Bacteria 1572
627 Ga0496100_0437117 3300048903 Bacteria 1001
628 Ga0496101_0000270 3300048904 Bacteria 36620
629 Ga0496101_0003856 3300048904 Bacteria 9375
630 Ga0496101_0006630 3300048904 Bacteria 7461
631 Ga0496101_0235662 3300048904 Bacteria 1423
632 Ga0496102_0000257 3300048905 Bacteria 69091
633 Ga0496102_0020959 3300048905 Bacteria 5780
634 Ga0496102_0043584 3300048905 Bacteria 4069
635 Ga0496102_0088100 3300048905 Bacteria 2869
636 Ga0496102_0105729 3300048905 Bacteria 2619
637 Ga0496102_0247755 3300048905 Bacteria 1680
638 Ga0496102_0257242 3300048905 Bacteria 1646
639 Ga0496102_0501258 3300048905 Bacteria 1136
640 Ga0496103_0000354 3300048906 Bacteria 41815
641 Ga0496103_0002147 3300048906 Bacteria 12550
642 Ga0496104_0011779 3300048907 Bacteria 7846
643 Ga0496104_0177468 3300048907 Bacteria 2040
644 Ga0496104_0574986 3300048907 Bacteria 1037
645 Ga0496105_0001698 3300048908 Bacteria 15705
646 Ga0496105_0143746 3300048908 Bacteria 1963
647 Ga0496105_0175302 3300048908 Bacteria 1757
648 Ga0496106_0026365 3300048909 Bacteria 4327
649 Ga0496106_0062872 3300048909 Bacteria 2819
650 Ga0496106_0092483 3300048909 Bacteria 2336
651 Ga0496106_0140860 3300048909 Bacteria 1897
652 Ga0496107_0000927 3300048910 Bacteria 17302
653 Ga0496107_0024867 3300048910 Bacteria 4238
654 Ga0496107_0101511 3300048910 Bacteria 2109
655 Ga0496108_0020828 3300048911 Bacteria 5392
656 Ga0496108_0032018 3300048911 Bacteria 4365
657 Ga0496108_0037578 3300048911 Bacteria 4034
658 Ga0496108_0047157 3300048911 Bacteria 3602
659 Ga0496108_0124859 3300048911 Bacteria 2209
660 Ga0496108_0304355 3300048911 Bacteria 1389
661 Ga0496108_0342993 3300048911 Bacteria 1303
662 Ga0496109_0004963 3300048912 Bacteria 11113
663 Ga0496109_0014983 3300048912 Bacteria 6748
664 Ga0496109_0028605 3300048912 Bacteria 4986
665 Ga0496109_0062929 3300048912 Bacteria 3393
666 Ga0496109_0083192 3300048912 Bacteria 2951
667 Ga0496109_0093331 3300048912 Bacteria 2785
668 Ga0496109_0137834 3300048912 Bacteria 2281
669 Ga0496109_0219649 3300048912 Bacteria 1787
670 Ga0496109_0252933 3300048912 Bacteria 1659
671 Ga0496109_0562591 3300048912 Bacteria 1075
672 Ga0496109_0630392 3300048912 Bacteria 1009
673 Ga0496109_0682668 3300048912 Bacteria 964
674 Ga0496110_0023499 3300048913 Bacteria 5244
675 Ga0496110_0036138 3300048913 Bacteria 4289
676 Ga0496110_0062681 3300048913 Bacteria 3284
677 Ga0496110_0109693 3300048913 Bacteria 2479
678 Ga0496110_0216424 3300048913 Bacteria 1742
679 Ga0496110_0298222 3300048913 Bacteria 1468
680 Ga0496111_0006116 3300048914 Bacteria 7788
681 Ga0496111_0067016 3300048914 Bacteria 2608
682 Ga0496111_0201791 3300048914 Bacteria 1478
683 Ga0496112_0001231 3300048915 Bacteria 19312
684 Ga0496112_0007191 3300048915 Bacteria 9862
685 Ga0496112_0012590 3300048915 Bacteria 7773
686 Ga0496112_0275546 3300048915 Bacteria 1630
687 Ga0496113_0022727 3300048916 Bacteria 4440
688 Ga0496113_0056139 3300048916 Bacteria 2955
689 Ga0496113_0058370 3300048916 Bacteria 2903
690 Ga0496113_0104696 3300048916 Bacteria 2196
691 Ga0496113_0197649 3300048916 Bacteria 1598
692 Ga0496113_0341618 3300048916 Bacteria 1201
693 Ga0496113_0437350 3300048916 Bacteria 1051
694 Ga0496114_0003138 3300048917 Bacteria 12682
695 Ga0496114_0011726 3300048917 Bacteria 7010
696 Ga0496114_0030631 3300048917 Bacteria 4427
697 Ga0496114_0051583 3300048917 Bacteria 3425
698 Ga0496115_0001434 3300048918 Bacteria 17065
699 Ga0496115_0012191 3300048918 Bacteria 6465
700 Ga0496115_0467252 3300048918 Bacteria 1017
701 Ga0496117_0000390 3300048920 Bacteria 75361
702 Ga0496117_0042319 3300048920 Bacteria 3325
703 Ga0496118_0000730 3300048921 Bacteria 53095
704 Ga0496118_0001095 3300048921 Bacteria 42156
705 Ga0496119_0000067 3300048922 Bacteria 162404
706 Ga0496119_0047751 3300048922 Bacteria 2660
707 Ga0496120_0004229 3300048923 Bacteria 12248
708 Ga0496120_0037503 3300048923 Bacteria 2876
709 Ga0496120_0096888 3300048923 Bacteria 1566
710 Ga0496121_0002203 3300048924 Bacteria 30428
711 Ga0496125_0010200 3300048928 Bacteria 9523
712 Ga0496125_0198844 3300048928 Bacteria 1315
713 Ga0496126_0008227 3300048929 Bacteria 11275
714 Ga0501031_0063390 3300049568 Bacteria 2408
715 Ga0501031_0185807 3300049568 Bacteria 1357
716 Ga0501031_0397211 3300049568 Bacteria 892
717 Ga0501032_0006399 3300049569 Bacteria 8668
718 Ga0501032_0013140 3300049569 Bacteria 5894
719 Ga0501032_0400642 3300049569 Bacteria 881
720 Ga0501033_0013121 3300049570 Bacteria 6313
721 Ga0501034_0001743 3300049571 Bacteria 27930
722 Ga0501034_0003840 3300049571 Bacteria 16933
723 Ga0501034_0005429 3300049571 Bacteria 13939
724 Ga0501034_0154320 3300049571 Bacteria 2271
725 Ga0501034_0362488 3300049571 Bacteria 1376
726 Ga0501036_0029370 3300049572 Bacteria 4645
727 Ga0501036_0054358 3300049572 Bacteria 3391
728 Ga0501037_0018584 3300049573 Bacteria 5123
729 Ga0501038_0057814 3300049574 Bacteria 3328
730 Ga0501038_0344822 3300049574 Bacteria 1161
731 Ga0501039_0017004 3300049575 Bacteria 5575
732 Ga0501039_0250489 3300049575 Bacteria 1393
733 Ga0501039_0286692 3300049575 Bacteria 1294
734 Ga0501041_0166236 3300049577 Bacteria 1380
735 Ga0501043_0005380 3300049579 Bacteria 10338
736 Ga0501043_0014911 3300049579 Bacteria 6084
737 Ga0501046_0000382 3300049580 Bacteria 44315
738 Ga0501047_0000405 3300049581 Bacteria 48286
739 Ga0501047_0018051 3300049581 Bacteria 6761
740 Ga0501047_0021914 3300049581 Bacteria 6135
741 Ga0501047_0033122 3300049581 Bacteria 4989
742 Ga0501048_0001972 3300049582 Bacteria 15610
743 Ga0501048_0015494 3300049582 Bacteria 5631
744 Ga0501068_0196515 3300049584 Bacteria 1279
745 Ga0501069_0016908 3300049585 Bacteria 3920
746 Ga0501069_0031764 3300049585 Bacteria 2906
747 Ga0501070_0001555 3300049586 Bacteria 20409
748 Ga0501070_0011557 3300049586 Bacteria 7453
749 Ga0501070_0033073 3300049586 Bacteria 4325
750 Ga0501070_0066052 3300049586 Bacteria 2995
751 Ga0501070_0479492 3300049586 Bacteria 1001
752 Ga0501071_0122290 3300049587 Bacteria 1930
753 Ga0501073_0140900 3300049589 Bacteria 1671
754 Ga0501074_0007580 3300049590 Bacteria 7853
755 Ga0501076_0134081 3300049592 Bacteria 2010
756 Ga0501080_0030063 3300049742 Bacteria 5059
757 Ga0501080_0051132 3300049742 Bacteria 3845
758 Ga0501080_0292515 3300049742 Bacteria 1479
759 Ga0501080_0419534 3300049742 Bacteria 1202
760 Ga0501083_0050328 3300049744 Bacteria 2805
761 Ga0501035_0000279 3300049822 Bacteria 60584
762 Ga0501035_0000283 3300049822 Bacteria 60218
763 Ga0501035_0118462 3300049822 Bacteria 2316
764 Ga0501044_0014060 3300049823 Bacteria 8643
765 Ga0501044_0025961 3300049823 Bacteria 6206
766 Ga0501044_0033281 3300049823 Bacteria 5418
767 Ga0501044_0058985 3300049823 Bacteria 3933
768 Ga0501045_0033694 3300049824 Bacteria 3714
769 nmdc:mga03n38_646_c1 3300050490 Bacteria 8937
770 nmdc:mga00v17_104811_c1 3300050491 Bacteria 1788
771 nmdc:mga00v17_7932_c1 3300050491 Bacteria 5691
772 nmdc:mga0yw44_150561_c1 3300050492 Bacteria 1517
773 nmdc:mga0yw44_15581_c2 3300050492 Bacteria 2852
774 nmdc:mga0yw44_164497_c1 3300050492 Bacteria 1454
775 nmdc:mga0yw44_25619_c1 3300050492 Bacteria 3357
776 nmdc:mga07m45_149780_c1 3300050496 Bacteria 1353
777 nmdc:mga07m45_21681_c1 3300050496 Bacteria 3500
778 nmdc:mga07m45_40685_c2 3300050496 Bacteria 2002
779 nmdc:mga07m45_45751_c1 3300050496 Bacteria 2457
780 nmdc:mga05p37_119852_c1 3300050507 Bacteria 3233
781 nmdc:mga08y16_227788_c1 3300050511 Bacteria 1928
782 nmdc:mga08y16_48385_c1 3300050511 Bacteria 4451
783 nmdc:mga0a205_18056_c1 3300050515 Bacteria 6627
784 nmdc:mga0a205_387343_c1 3300050515 Bacteria 1263
785 nmdc:mga0sz30_12916_c1 3300050516 Bacteria 3259
786 nmdc:mga0sz30_9222_c1 3300050516 Bacteria 3747
787 Ga0495601_0044110 3300053077 Bacteria 2803
788 Ga0495612_0065860 3300053078 Bacteria 1505
789 Ga0500610_0005592 3300053079 Bacteria 5173
790 Ga0495595_0004092 3300053084 Bacteria 5846
791 Ga0495595_0047623 3300053084 Bacteria 1978
792 Ga0495619_0014988 3300053085 Bacteria 4897
793 Ga0495619_0099160 3300053085 Bacteria 1981
794 Ga0495619_0252092 3300053085 Bacteria 1223
795 Ga0500559_0012458 3300053136 Bacteria 3614
796 Ga0500645_000110 3300053730 Bacteria 65408
797 Ga0501084_0101761 3300054114 Bacteria 2413
798 Ga0501082_0220006 3300060353 Bacteria 1652
799 Ga0466962_0009124 3300061719 Bacteria 4751
800 Ga0466962_0023065 3300061719 Bacteria 2992
801 Ga0466962_0032456 3300061719 Bacteria 2500
802 Ga0466962_0112470 3300061719 Bacteria 1311
803 2501942479 2501939600 Bacteria 6907073
804 2623498098 2622736605 Bacteria 4992138
805 2623586948 2622736626 Bacteria 7181580
806 2643826692 2643221561 Bacteria 4984412
807 2644084587 2643221613 Bacteria 4622396
808 2644092915 2643221615 Bacteria 5487866
809 2644322528 2643221657 Bacteria 5490246
810 2644446796 2643221679 Bacteria 3839507
811 2644489585 2643221687 Bacteria 6500351
812 2644534049 2643221696 Bacteria 5431823
813 2738707049 2738541274 Bacteria 6909446
814 2739333520 2738543028 Bacteria 6917070
815 2739365421 2738543034 Bacteria 6084756
816 2740165774 2739367898 Bacteria 4367674
817 2772642282 2772190715 Bacteria 6959372
818 2831937565 2831935698 Bacteria 5963223
819 2832009547 2832004796 Bacteria 6538017
820 2835188291 2835188231 Bacteria 3476928
821 2835188948 2835188231 Bacteria 3476928
822 2842137118 2842134933 Bacteria 5847019
823 2855388784 2855386786 Bacteria 4752232
824 2855671344 2855670206 Bacteria 7120389
825 2855678526 2855676851 Bacteria 7063653
826 2855685877 2855683550 Bacteria 7134265
827 2856860787 2856858025 Bacteria 7255264
828 2857292041 2857288857 Bacteria 7189066
829 2857485023 2857481737 Bacteria 4761446
830 2858850828 2858848962 Bacteria 6963058
831 2858869831 2858868258 Bacteria 7683772
832 2858883799 2858882152 Bacteria 7230291
833 2858890047 2858888857 Bacteria 7060307
834 2858900982 2858895516 Bacteria 7378898
835 2858903529 2858902515 Bacteria 7086037
836 2866067656 2866065130 Bacteria 6518152
837 2867306467 2867302475 Bacteria 7087181
838 2867315911 2867312974 Bacteria 7058875
839 2867323622 2867319477 Bacteria 7069771
840 2867510250 2867507094 Bacteria 6506033
841 2869051060 2869048445 Bacteria 6875584
842 2869062500 2869061728 Bacteria 7112407
843 2869070872 2869068681 Bacteria 7205615
844 2880493338 2880489317 Bacteria 7096270
845 2880498961 2880495981 Bacteria 7340502
846 2884997595 2884994152 Bacteria 4492978
847 2902802136 2902799365 Bacteria 5419524
848 2902842368 2902837492 Bacteria 6697721
849 2904767971 2904765812 Bacteria 5369154
850 2904774257 2904770941 Bacteria 5580202
851 2908815274 2908811453 Bacteria 5478616
852 2919423599 2919420072 Bacteria 5390363
853 2919436207 2919432681 Bacteria 5390474
854 2929220980 2929219909 Bacteria 6984360
855 2929227552 2929226422 Bacteria 7248583
856 2935891213 2935890801 Bacteria 4593001
857 2964328318 2964326757 Bacteria 3290868
858 2974315930 2974315732 Bacteria 4602776
859 2984524093 2984523437 Bacteria 4508481
860 649811520 649633069 Bacteria 6962533
861 8003830674 8003830390 Bacteria 6541657
862 8003860796 8003856774 Bacteria 7675274
863 8054710801 8054704163 Bacteria 7247792
864 8054727455 8054727385 Bacteria 7558670
865 8054734902 8054734606 Bacteria 6947278
866 Ga0070660_100233175
867 LJQas_1012794
868 JGI24737J22298_10023902
869 JGI24737J22298_10064182
870 JGI24034J26672_10018556
871 JGI25407J50210_10042427
872 JGI25404J52841_10007807
873 Ga0055540_1002731
874 Ga0055540_1005641
875 Ga0055540_1015867
876 Ga0070676_10004509
877 Ga0070683_100061774
878 Ga0070683_100069891
879 Ga0070677_10135226
880 Ga0068869_100030664
881 Ga0068869_100428163
882 Ga0068869_100537444
883 Ga0070666_10080049
884 Ga0070682_100003688
885 Ga0070682_100034472
886 Ga0070682_100045094
887 Ga0068868_100004228
888 Ga0068868_100121690
889 Ga0070660_100020722
890 Ga0070660_100099066
891 Ga0070689_100037795
892 Ga0070687_100110128
893 Ga0070661_100464171
894 Ga0070692_10007517
895 Ga0070692_10056860
896 Ga0070692_10057139
897 Ga0070668_100033960
898 Ga0070668_100272711
899 Ga0070675_100170404
900 Ga0070674_100020383
901 Ga0070674_100024762
902 Ga0070674_100203454
903 Ga0070688_100005969
904 Ga0070659_100030523
905 Ga0070667_100000027
906 Ga0070667_100007912
907 Ga0070667_100062997
908 Ga0070703_10020296
909 Ga0070709_10000135
910 Ga0070709_10001866
911 Ga0070709_10022860
912 Ga0070714_100007368
913 Ga0070714_100010928
914 Ga0070714_100011917
915 Ga0070714_100023939
916 Ga0070714_100519979
917 Ga0070713_100002948
918 Ga0070713_100024429
919 Ga0070713_100183929
920 Ga0070713_100210192
921 Ga0070710_10000710
922 Ga0070710_10010043
923 Ga0070710_10247548
924 Ga0070701_10007237
925 Ga0070711_100003575
926 Ga0070711_100007335
927 Ga0070711_100015298
928 Ga0070711_100171597
929 Ga0070705_100038707
930 Ga0070705_100042692
931 Ga0070700_100002404
932 Ga0070700_100005243
933 Ga0070700_100036181
934 Ga0070700_100083450
935 Ga0070700_100155637
936 Ga0070694_100020269
937 Ga0070663_100159018
938 Ga0070663_100177317
939 Ga0070678_100003571
940 Ga0070678_100049258
941 Ga0070662_100018266
942 Ga0070662_100133759
943 Ga0068867_100001469
944 Ga0070706_100109516
945 Ga0070679_100310176
946 Ga0070679_100487733
947 Ga0070684_100004622
948 Ga0070684_100133069
949 Ga0070684_100420527
950 Ga0068853_100022280
951 Ga0070672_100001159
952 Ga0070672_100027373
953 Ga0070686_100021257
954 Ga0070686_100092564
955 Ga0070686_100144948
956 Ga0070695_100067985
957 Ga0070696_100022383
958 Ga0070693_100118629
959 Ga0070665_100000566
960 Ga0070665_100005584
961 Ga0070665_100006130
962 Ga0070704_100000126
963 Ga0068855_100081382
964 Ga0070664_100003142
965 Ga0068857_100049899
966 Ga0068854_100020208
967 Ga0068854_100368183
968 Ga0068854_100509062
969 Ga0068856_100169546
970 Ga0068856_100187901
971 Ga0070702_100001763
972 Ga0070702_100019013
973 Ga0070702_100233362
974 Ga0070702_100462911
975 Ga0068852_100004825
976 Ga0068852_100227965
977 Ga0068852_100551566
978 Ga0068859_100001466
979 Ga0068859_100073907
980 Ga0068866_10023190
981 Ga0068866_10061208
982 Ga0068866_10067927
983 Ga0068861_100004568
984 Ga0068861_100034935
985 Ga0068861_100042597
986 Ga0068861_100381332
987 Ga0068861_100429438
988 Ga0068870_10016817
989 Ga0068863_100000463
990 Ga0068863_100006631
991 Ga0068863_100160140
992 Ga0068863_100418099
993 Ga0068858_100023617
994 Ga0068858_100026870
995 Ga0068858_100046922
996 Ga0068858_100162952
997 Ga0068860_100000141
998 Ga0068860_100004584
999 Ga0068860_100060872
1000 Ga0068862_100000138
1001 Ga0068862_100189710
1002 Ga0081455_10011098
1003 Ga0081455_10142172
1004 Ga0081540_1000527
1005 Ga0081540_1062677
1006 Ga0081539_10001009
1007 Ga0070717_10011333
1008 Ga0070717_10062854
1009 Ga0070717_10076407
1010 Ga0070717_10128742
1011 Ga0070717_10195411
1012 Ga0075365_10002024
1013 Ga0075365_10012827
1014 Ga0075365_10021273
1015 Ga0075365_10023288
1016 Ga0075365_10042779
1017 Ga0075365_10134195
1018 Ga0075365_10150794
1019 Ga0075363_100003255
1020 Ga0075363_100011124
1021 Ga0075364_10002521
1022 Ga0075364_10010660
1023 Ga0075364_10060850
1024 Ga0075364_10075430
1025 Ga0075364_10247410
1026 Ga0070715_10001665
1027 Ga0070716_100000586
1028 Ga0070716_100013856
1029 Ga0070716_100038904
1030 Ga0070716_100080830
1031 Ga0070716_100190597
1032 Ga0070712_100001102
1033 Ga0070712_100013749
1034 Ga0070712_100064753
1035 Ga0070712_100253925
1036 Ga0070712_100503534
1037 Ga0075369_10001409
1038 Ga0075369_10003302
1039 Ga0075369_10006006
1040 Ga0097621_100139448
1041 Ga0075370_10022995
1042 Ga0068871_100079406
1043 Ga0068871_100108794
1044 Ga0068871_100652286
1045 Ga0075428_100013075
1046 Ga0075428_100099616
1047 Ga0075428_100321842
1048 Ga0075433_10002223
1049 Ga0075433_10136272
1050 Ga0075434_100019351
1051 Ga0075434_100314954
1052 Ga0075429_100205791
1053 Ga0068865_100006922
1054 Ga0068865_100053113
1055 Ga0075436_100059575
1056 Ga0097620_100001464
1057 Ga0097620_100073903
1058 Ga0075435_100122107
1059 Ga0105250_10047541
1060 Ga0105250_10090253
1061 Ga0105240_10432224
1062 Ga0105240_10521035
1063 Ga0111539_10021223
1064 Ga0111539_10250278
1065 Ga0105245_10003386
1066 Ga0105245_10006044
1067 Ga0105245_10010406
1068 Ga0105245_10123773
1069 Ga0105245_10666262
1070 Ga0105247_10000237
1071 Ga0105247_10002143
1072 Ga0114129_10312441
1073 Ga0105243_10002465
1074 Ga0105243_10021157
1075 Ga0105243_10043828
1076 Ga0105243_10068861
1077 Ga0105241_10229784
1078 Ga0105242_10002038
1079 Ga0105242_10431694
1080 Ga0105242_10502774
1081 Ga0105248_10000337
1082 Ga0105248_10018735
1083 Ga0105248_10058498
1084 Ga0105237_10094293
1085 Ga0105237_10104022
1086 Ga0105237_10238262
1087 Ga0105238_10046372
1088 Ga0105238_10212329
1089 Ga0105238_10619003
1090 Ga0105249_10000013
1091 Ga0105249_10003606
1092 Ga0105249_10025176
1093 Ga0105249_10085627
1094 Ga0105249_10261712
1095 Ga0105249_10588974
1096 Ga0105249_10799060
1097 Ga0105239_10043688
1098 Ga0105239_10106355
1099 Ga0105239_10132670
1100 Ga0157371_10088622
1101 Ga0157369_10161138
1102 Ga0157369_10182133
1103 Ga0157374_10198395
1104 Ga0157374_10276920
1105 Ga0157378_10005230
1106 Ga0157378_10160056
1107 Ga0163162_10010461
1108 Ga0163162_10030527
1109 Ga0163162_10090867
1110 Ga0163162_10667979
1111 Ga0157372_10052599
1112 Ga0157372_10059668
1113 Ga0157372_10328832
1114 Ga0157372_10574719
1115 Ga0157375_10008041
1116 Ga0157375_10011802
1117 Ga0157375_10130619
1118 Ga0157375_10132594
1119 Ga0157375_10209838
1120 Ga0157375_10965022
1121 Ga0163163_10079248
1122 Ga0163163_10293667
1123 Ga0163163_10306464
1124 Ga0157380_10006518
1125 Ga0157380_10095793
1126 Ga0157380_10480080
1127 Ga0157379_10007978
1128 Ga0157379_10099990
1129 Ga0157379_10109595
1130 Ga0157379_10189230
1131 Ga0157376_10069685
1132 Ga0157376_10789429
1133 Ga0163161_10004894
1134 Ga0163161_10048870
1135 Ga0197907_10042006
1136 Ga0206354_10834257
1137 Ga0206353_11905460
1138 Ga0213876_10007166
1139 Ga0213876_10009726
1140 Ga0213875_10001663
1141 Ga0213875_10001762
1142 Ga0213875_10024144
1143 Ga0213875_10038157
1144 Ga0224572_1005141
1145 Ga0224572_1017697
1146 Ga0209673_1058632
1147 Ga0209051_1000122
1148 Ga0209051_1001174
1149 Ga0209051_1005191
1150 Ga0209051_1018341
1151 Ga0207696_1046704
1152 Ga0207682_10074471
1153 Ga0207692_10000342
1154 Ga0207692_10015760
1155 Ga0207642_10032568
1156 Ga0207642_10159601
1157 Ga0207710_10000213
1158 Ga0207688_10000557
1159 Ga0207688_10006136
1160 Ga0207688_10030407
1161 Ga0207688_10045486
1162 Ga0207688_10073346
1163 Ga0207688_10128129
1164 Ga0207680_10147111
1165 Ga0207647_10014152
1166 Ga0207647_10242643
1167 Ga0207685_10005941
1168 Ga0207699_10000148
1169 Ga0207645_10005261
1170 Ga0207643_10024032
1171 Ga0207705_10024663
1172 Ga0207705_10107565
1173 Ga0207705_10128876
1174 Ga0207695_10330723
1175 Ga0207695_10397227
1176 Ga0207671_10020382
1177 Ga0207693_10000346
1178 Ga0207693_10002049
1179 Ga0207693_10002834
1180 Ga0207663_10026950
1181 Ga0207662_10016725
1182 Ga0207657_10045057
1183 Ga0207657_10185679
1184 Ga0207657_10239631
1185 Ga0207652_10324752
1186 Ga0207681_10000866
1187 Ga0207694_10146974
1188 Ga0207687_10005646
1189 Ga0207687_10070720
1190 Ga0207687_10328132
1191 Ga0207700_10000793
1192 Ga0207700_10009110
1193 Ga0207700_10009744
1194 Ga0207700_10013499
1195 Ga0207664_10000246
1196 Ga0207664_10014178
1197 Ga0207664_10024853
1198 Ga0207664_10049854
1199 Ga0207664_10111164
1200 Ga0207644_10045948
1201 Ga0207690_10239467
1202 Ga0207706_10000901
1203 Ga0207706_10006711
1204 Ga0207706_10140154
1205 Ga0207686_10045316
1206 Ga0207709_10003330
1207 Ga0207709_10009011
1208 Ga0207709_10018611
1209 Ga0207670_10052640
1210 Ga0207670_10135992
1211 Ga0207669_10015908
1212 Ga0207669_10228931
1213 Ga0207704_10007329
1214 Ga0207704_10127996
1215 Ga0207665_10000711
1216 Ga0207665_10001580
1217 Ga0207665_10006217
1218 Ga0207691_10002487
1219 Ga0207711_10000753
1220 Ga0207711_10079574
1221 Ga0207689_10055193
1222 Ga0207689_10407627
1223 Ga0207661_10334085
1224 Ga0207679_10001569
1225 Ga0207667_10089236
1226 Ga0207667_10715850
1227 Ga0207712_10000018
1228 Ga0207712_10036981
1229 Ga0207668_10000770
1230 Ga0207668_10060146
1231 Ga0207668_10068292
1232 Ga0207668_10084590
1233 Ga0207668_10107638
1234 Ga0207640_10013064
1235 Ga0207640_10052058
1236 Ga0207640_10424436
1237 Ga0207658_10000788
1238 Ga0207658_10006407
1239 Ga0207658_10057023
1240 Ga0207658_10070692
1241 Ga0207703_10039576
1242 Ga0207703_10066149
1243 Ga0207703_10097545
1244 Ga0207639_10027732
1245 Ga0207639_10082466
1246 Ga0207639_10265147
1247 Ga0207678_10075534
1248 Ga0207708_10000448
1249 Ga0207708_10001359
1250 Ga0207708_10107496
1251 Ga0207708_10139643
1252 Ga0207702_10108937
1253 Ga0207641_10000953
1254 Ga0207641_10214209
1255 Ga0207648_10000550
1256 Ga0207648_10003999
1257 Ga0207676_10167996
1258 Ga0207676_10372557
1259 Ga0207674_10061967
1260 Ga0207675_100001369
1261 Ga0207675_100003501
1262 Ga0207675_100017246
1263 Ga0207675_100062669
1264 Ga0207675_100082776
1265 Ga0207675_100162811
1266 Ga0207675_100262685
1267 Ga0207675_100547846
1268 Ga0207683_10000569
1269 Ga0207683_10167066
1270 Ga0207698_10039000
1271 Ga0207698_10202041
1272 Ga0207698_10386661
1273 Ga0265357_1003356
1274 Ga0268266_10000596
1275 Ga0268266_10004635
1276 Ga0268266_10084589
1277 Ga0268266_10387824
1278 Ga0268265_10000159
1279 Ga0268265_10012251
1280 Ga0268265_10415390
1281 Ga0268264_10000005
1282 Ga0268264_10000249
1283 Ga0268264_10302852
1284 Ga0265338_10118493
1285 Ga0265340_10098011
1286 Ga0265327_10113557
1287 Ga0307509_10077196
1288 Ga0307408_100039076
1289 Ga0265313_10100267
1290 Ga0265314_10076871
1291 Ga0316576_10012638
1292 Ga0316576_10021323
1293 Ga0316576_10091864
1294 Ga0307516_10000690
1295 Ga0307405_10016614
1296 Ga0307405_10249901
1297 Ga0316577_10008319
1298 Ga0316577_10118271
1299 Ga0307413_10106243
1300 Ga0307410_10013152
1301 Ga0307410_10071306
1302 Ga0307410_10121908
1303 Ga0307410_10130739
1304 Ga0307410_10168023
1305 Ga0307410_10455581
1306 Ga0307407_10047079
1307 Ga0307407_10083836
1308 Ga0307407_10094830
1309 Ga0307409_100033438
1310 Ga0307409_100075186
1311 Ga0307409_100161414
1312 Ga0307409_100165680
1313 Ga0307409_100193836
1314 Ga0307409_100199854
1315 Ga0307409_100254697
1316 Ga0307409_100697164
1317 Ga0307416_100040283
1318 Ga0307416_100044453
1319 Ga0307416_100176956
1320 Ga0307411_10152938
1321 Ga0307411_10196746
1322 Ga0307415_100107877
1323 Ga0307415_100204301
1324 Ga0307415_100397542
1325 Ga0316585_10094951
1326 Ga0373934_0013610
1327 Ga0373923_0000819
1328 Ga0373923_0031167
1329 Ga0373936_0029846
1330 Ga0373939_0008509
1331 Ga0373956_0016105
1332 Ga0373957_0002669
1333 Ga0373957_0064510
1334 Ga0373946_0029573
1335 Ga0373955_0042103
1336 Ga0373955_0086873
1337 Ga0316574_0070099
1338 Ga0373924_0001912
1339 Ga0373931_0008008
1340 Ga0373933_0009517
1341 Ga0373933_0094027
1342 Ga0373947_0119643
1343 Ga0373937_0697678
1344 Ga0372808_000117
1345 Ga0316582_0095694
1346 Ga0316584_0024109
1347 Ga0316584_0041308
1348 Ga0373925_0008092
1349 Ga0373925_0069650
1350 Ga0395900_0007441
1351 Ga0395900_0068195
1352 Ga0395900_0133963
1353 Ga0395900_0603533
1354 Ga0395898_0123001
1355 Ga0395898_0528836
1356 Ga0395898_0576919
1357 Ga0436364_0003227
1358 Ga0436364_0201210
1359 Ga0436364_0337262
1360 Ga0436364_0348454
1361 Ga0436364_0425968
1362 Ga0436364_0693075
1363 Ga0436364_1265507
1364 Ga0395901_0009441
1365 Ga0395901_0204101
1366 Ga0395901_0452109
1367 Ga0436365_0174550
1368 Ga0436365_0576629
1369 Ga0436365_0641890
1370 Ga0436363_1646938
1371 Ga0436362_0601122
1372 Ga0439461_0000484
1373 Ga0439466_0006739
1374 Ga0439465_0000300
1375 Ga0451835_1090130
1376 Ga0451853_3221077
1377 Ga0439431_0005136
1378 Ga0439442_001876
1379 Ga0439434_0015578
1380 Ga0439460_0017904
1381 Ga0439440_0005469
1382 Ga0466966_0008251
1383 Ga0466966_0014087
1384 Ga0466963_0008588
1385 Ga0466963_0010397
1386 Ga0466963_0014995
1387 Ga0466963_0032178
1388 Ga0466963_0056016
1389 Ga0466963_0200391
1390 Ga0466963_0255910
1391 Ga0466963_0275066
1392 Ga0466963_0379756
1393 Ga0466964_0018190
1394 Ga0466964_0072718
1395 Ga0466964_0125298
1396 Ga0466971_0006420
1397 Ga0466971_0031768
1398 Ga0466971_0073135
1399 Ga0466970_0050470
1400 Ga0466957_0075664
1401 Ga0466957_0123888
1402 Ga0466960_0003456
1403 Ga0466960_0032528
1404 Ga0466960_0082639
1405 Ga0451576_0149904
1406 Ga0466958_0011794
1407 Ga0466958_0020030
1408 Ga0466958_0205292
1409 Ga0466967_0000413
1410 Ga0466967_0006573
1411 Ga0466967_0021792
1412 Ga0466967_0036958
1413 Ga0466967_0078347
1414 Ga0466967_0102247
1415 Ga0466967_0103215
1416 Ga0466967_0111687
1417 Ga0466967_0120496
1418 Ga0466967_0157437
1419 Ga0466967_0190081
1420 Ga0466967_0230675
1421 Ga0466967_0257782
1422 Ga0466967_0359320
1423 Ga0466967_0733847
1424 Ga0495592_0009192
1425 Ga0495592_0022237
1426 Ga0495629_0008179
1427 Ga0495629_0191486
1428 Ga0495641_0017837
1429 Ga0495641_0209540
1430 Ga0495651_0003795
1431 Ga0495651_0003978
1432 Ga0495651_0197370
1433 Ga0495653_0010354
1434 Ga0495653_0070695
1435 Ga0495582_0006180
1436 Ga0495639_0023898
1437 Ga0495662_0088243
1438 Ga0495664_0051583
1439 Ga0495664_0106173
1440 Ga0495608_0003288
1441 Ga0495618_0036687
1442 Ga0495618_0071785
1443 Ga0495628_0011984
1444 Ga0495628_0111124
1445 Ga0495630_0012219
1446 Ga0495652_0007754
1447 Ga0495652_0052582
1448 Ga0495665_0008176
1449 Ga0495587_0014721
1450 Ga0495645_0043783
1451 Ga0495667_0001844
1452 Ga0495667_0110766
1453 Ga0495656_0026889
1454 Ga0495634_0022563
1455 Ga0495635_0073351
1456 Ga0495635_0151184
1457 Ga0495657_0012258
1458 Ga0495657_0040679
1459 Ga0495657_0162887
1460 Ga0495599_0186381
1461 Ga0495646_0108510
1462 Ga0495647_0063558
1463 Ga0495658_0021465
1464 Ga0495613_0328413
1465 Ga0495624_0018493
1466 Ga0495600_0011368
1467 Ga0495600_0039572
1468 Ga0495581_0030864
1469 Ga0495604_0134483
1470 Ga0495604_0383917
1471 Ga0495674_0012863
1472 Ga0495674_0065965
1473 Ga0495674_0198376
1474 Ga0495674_0249676
1475 Ga0495674_0459226
1476 Ga0495676_0309591
1477 Ga0495680_0020203
1478 Ga0495680_0225679
1479 Ga0495675_0004710
1480 Ga0495684_0073375
1481 Ga0495593_0031702
1482 Ga0495602_0039054
1483 Ga0495602_0081562
1484 Ga0495614_0008296
1485 Ga0495614_0105509
1486 Ga0496100_0001064
1487 Ga0496100_0006542
1488 Ga0496100_0046405
1489 Ga0496100_0146694
1490 Ga0496100_0161341
1491 Ga0496100_0169157
1492 Ga0496100_0437117
1493 Ga0496101_0000270
1494 Ga0496101_0003856
1495 Ga0496101_0006630
1496 Ga0496101_0235662
1497 Ga0496102_0000257
1498 Ga0496102_0020959
1499 Ga0496102_0043584
1500 Ga0496102_0088100
1501 Ga0496102_0105729
1502 Ga0496102_0247755
1503 Ga0496102_0257242
1504 Ga0496102_0501258
1505 Ga0496103_0000354
1506 Ga0496103_0002147
1507 Ga0496104_0011779
1508 Ga0496104_0177468
1509 Ga0496104_0574986
1510 Ga0496105_0001698
1511 Ga0496105_0143746
1512 Ga0496105_0175302
1513 Ga0496106_0026365
1514 Ga0496106_0062872
1515 Ga0496106_0092483
1516 Ga0496106_0140860
1517 Ga0496107_0000927
1518 Ga0496107_0024867
1519 Ga0496107_0101511
1520 Ga0496108_0020828
1521 Ga0496108_0032018
1522 Ga0496108_0037578
1523 Ga0496108_0047157
1524 Ga0496108_0124859
1525 Ga0496108_0304355
1526 Ga0496108_0342993
1527 Ga0496109_0004963
1528 Ga0496109_0014983
1529 Ga0496109_0028605
1530 Ga0496109_0062929
1531 Ga0496109_0083192
1532 Ga0496109_0093331
1533 Ga0496109_0137834
1534 Ga0496109_0219649
1535 Ga0496109_0252933
1536 Ga0496109_0562591
1537 Ga0496109_0630392
1538 Ga0496109_0682668
1539 Ga0496110_0023499
1540 Ga0496110_0036138
1541 Ga0496110_0062681
1542 Ga0496110_0109693
1543 Ga0496110_0216424
1544 Ga0496110_0298222
1545 Ga0496111_0006116
1546 Ga0496111_0067016
1547 Ga0496111_0201791
1548 Ga0496112_0001231
1549 Ga0496112_0007191
1550 Ga0496112_0012590
1551 Ga0496112_0275546
1552 Ga0496113_0022727
1553 Ga0496113_0056139
1554 Ga0496113_0058370
1555 Ga0496113_0104696
1556 Ga0496113_0197649
1557 Ga0496113_0341618
1558 Ga0496113_0437350
1559 Ga0496114_0003138
1560 Ga0496114_0011726
1561 Ga0496114_0030631
1562 Ga0496114_0051583
1563 Ga0496115_0001434
1564 Ga0496115_0012191
1565 Ga0496115_0467252
1566 Ga0496117_0000390
1567 Ga0496117_0042319
1568 Ga0496118_0000730
1569 Ga0496118_0001095
1570 Ga0496119_0000067
1571 Ga0496119_0047751
1572 Ga0496120_0004229
1573 Ga0496120_0037503
1574 Ga0496120_0096888
1575 Ga0496121_0002203
1576 Ga0496125_0010200
1577 Ga0496125_0198844
1578 Ga0496126_0008227
1579 Ga0501031_0063390
1580 Ga0501031_0185807
1581 Ga0501031_0397211
1582 Ga0501032_0006399
1583 Ga0501032_0013140
1584 Ga0501032_0400642
1585 Ga0501033_0013121
1586 Ga0501034_0001743
1587 Ga0501034_0003840
1588 Ga0501034_0005429
1589 Ga0501034_0154320
1590 Ga0501034_0362488
1591 Ga0501036_0029370
1592 Ga0501036_0054358
1593 Ga0501037_0018584
1594 Ga0501038_0057814
1595 Ga0501038_0344822
1596 Ga0501039_0017004
1597 Ga0501039_0250489
1598 Ga0501039_0286692
1599 Ga0501041_0166236
1600 Ga0501043_0005380
1601 Ga0501043_0014911
1602 Ga0501046_0000382
1603 Ga0501047_0000405
1604 Ga0501047_0018051
1605 Ga0501047_0021914
1606 Ga0501047_0033122
1607 Ga0501048_0001972
1608 Ga0501048_0015494
1609 Ga0501068_0196515
1610 Ga0501069_0016908
1611 Ga0501069_0031764
1612 Ga0501070_0001555
1613 Ga0501070_0011557
1614 Ga0501070_0033073
1615 Ga0501070_0066052
1616 Ga0501070_0479492
1617 Ga0501071_0122290
1618 Ga0501073_0140900
1619 Ga0501074_0007580
1620 Ga0501076_0134081
1621 Ga0501080_0030063
1622 Ga0501080_0051132
1623 Ga0501080_0292515
1624 Ga0501080_0419534
1625 Ga0501083_0050328
1626 Ga0501035_0000279
1627 Ga0501035_0000283
1628 Ga0501035_0118462
1629 Ga0501044_0014060
1630 Ga0501044_0025961
1631 Ga0501044_0033281
1632 Ga0501044_0058985
1633 Ga0501045_0033694
1634 nmdc:mga03n38_646_c1
1635 nmdc:mga00v17_104811_c1
1636 nmdc:mga00v17_7932_c1
1637 nmdc:mga0yw44_150561_c1
1638 nmdc:mga0yw44_15581_c2
1639 nmdc:mga0yw44_164497_c1
1640 nmdc:mga0yw44_25619_c1
1641 nmdc:mga07m45_149780_c1
1642 nmdc:mga07m45_21681_c1
1643 nmdc:mga07m45_40685_c2
1644 nmdc:mga07m45_45751_c1
1645 nmdc:mga05p37_119852_c1
1646 nmdc:mga08y16_227788_c1
1647 nmdc:mga08y16_48385_c1
1648 nmdc:mga0a205_18056_c1
1649 nmdc:mga0a205_387343_c1
1650 nmdc:mga0sz30_12916_c1
1651 nmdc:mga0sz30_9222_c1
1652 Ga0495601_0044110
1653 Ga0495612_0065860
1654 Ga0500610_0005592
1655 Ga0495595_0004092
1656 Ga0495595_0047623
1657 Ga0495619_0014988
1658 Ga0495619_0099160
1659 Ga0495619_0252092
1660 Ga0500559_0012458
1661 Ga0500645_000110
1662 Ga0501084_0101761
1663 Ga0501082_0220006
1664 Ga0466962_0009124
1665 Ga0466962_0023065
1666 Ga0466962_0032456
1667 Ga0466962_0112470
1668 2501942479
1669 2623498098
1670 2623586948
1671 2643826692
1672 2644084587
1673 2644092915
1674 2644322528
1675 2644446796
1676 2644489585
1677 2644534049
1678 2738707049
1679 2739333520
1680 2739365421
1681 2740165774
1682 2772642282
1683 2831937565
1684 2832009547
1685 2835188291
1686 2835188948
1687 2842137118
1688 2855388784
1689 2855671344
1690 2855678526
1691 2855685877
1692 2856860787
1693 2857292041
1694 2857485023
1695 2858850828
1696 2858869831
1697 2858883799
1698 2858890047
1699 2858900982
1700 2858903529
1701 2866067656
1702 2867306467
1703 2867315911
1704 2867323622
1705 2867510250
1706 2869051060
1707 2869062500
1708 2869070872
1709 2880493338
1710 2880498961
1711 2884997595
1712 2902802136
1713 2902842368
1714 2904767971
1715 2904774257
1716 2908815274
1717 2919423599
1718 2919436207
1719 2929220980
1720 2929227552
1721 2935891213
1722 2964328318
1723 2974315930
1724 2984524093
1725 649811520
1726 8003830674
1727 8003860796
1728 8054710801
1729 8054727455
1730 8054734902

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

53

301

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4otk-assembly1.cif.gz_A a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form 0.9827 4 273
1a80-assembly1.cif.gz_A native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph 0.981 3 273
4g5d-assembly2.cif.gz_B x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph 0.9782 6 275
2wzt-assembly1.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9782 4 260
2wzm-assembly2.cif.gz_B crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form 0.9781 3 273
ID Description Score Start End Superfamily
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9823 5 273 3.20.20.100
2wzmB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9781 3 273 3.20.20.100
af_Q2FXE2_1_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9744 5 273 3.20.20.100
af_A0A0R0I9K3_1_172_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.971 126 264 3.20.20.100
af_Q9VTL0_1_322_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9699 4 265 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A6L7GLA0-F1-model_v4 Aldo/keto reductase 0.9982 3 277 GO:0004033
GO:0044281
AF-A0A0Q5AG91-F1-model_v4 Oxidoreductase 0.9977 3 278 GO:0004033
GO:0044281
AF-A0A1A0L6V3-F1-model_v4 Oxidoreductase 0.9975 3 277 GO:0004033
GO:0044281
AF-A0A4R1ARH3-F1-model_v4 Aldo/keto reductase 0.9973 3 277 GO:0004033
GO:0044281
AF-A0A1H8U9L1-F1-model_v4 2,5-diketo-D-gluconate reductase A 0.9972 1 278 GO:0004033
GO:0044281

Map