F483986
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 865 | 411 | 1730 | 280 |
Family's Representative Sequence
| Representative Sequence | 3300005339|Ga0070660_100233175|Ga0070660_1002331751 |
| Length | 318 |
| Sequence | VPHDGTRSLIGQRADAPIGHAQGFDAGNTTAPAVVGTRMTVPALKLNDGTTIPQLGFGVFQIPPKDTEAAVIQALEVGYRHIDTAQMYGNEKGVGSAVAASGLARDEVFVTSKLNNGFHRPDDARRAFDKTLEALGSDYVDLFLIHWPLPTRYDGDFVSTWETLIEFQADGRARSIGVSNFQVAHLDRLARETSVVPAVNQIEVHPYFGNEDVRAADAAAGIVTEAWSPIAQGDVLGDPTVTAIADRLGRTPSQVVLRWHVQRGDVVFPKTTHVERMRENFAIFDFDLSDEDMAAITALDRGETGRRGPNPDAFDWIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 6 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 7 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 87 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 117 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 118 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 119 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 178 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 185 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 186 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 187 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 189 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 192 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 193 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 196 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 200 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 204 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 205 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 206 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 207 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 208 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 209 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 210 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 211 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 212 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 213 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 214 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 215 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 218 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 219 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 223 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 224 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 225 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 226 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 232 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 233 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 234 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 235 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 236 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 237 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 238 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 239 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 242 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 243 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 244 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 245 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 291 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 292 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 294 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 295 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 296 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 297 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 298 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 299 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 300 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 301 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 302 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 303 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 304 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 305 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 306 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 325 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 329 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 333 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 334 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 335 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 337 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 338 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 340 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 343 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 347 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 2501939600 | Micromonospora sp. L5 | Isolate | Unclassified |
| 351 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 352 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 353 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 354 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 355 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 356 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 357 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 358 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 359 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 360 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 361 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 362 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 363 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 364 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 365 | 2831935698 | Jishengella sp. AZ1-13 | Isolate | Unclassified |
| 366 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 367 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 368 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 369 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 370 | 2855670206 | Micromonospora noduli Lupac 07 | Isolate | Nodule |
| 371 | 2855676851 | Micromonospora saelicesensis GAR05 | Isolate | Unclassified |
| 372 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 373 | 2856858025 | Micromonospora aurantiaca 110B(2018) | Isolate | Unclassified |
| 374 | 2857288857 | Micromonospora noduli ONO23 | Isolate | Unclassified |
| 375 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 376 | 2858848962 | Micromonospora saelicesensis GAR06 | Isolate | Unclassified |
| 377 | 2858868258 | Micromonospora sp. MH33 | Isolate | Unclassified |
| 378 | 2858882152 | Micromonospora noduli MED15 | Isolate | Nodule |
| 379 | 2858888857 | Micromonospora saelicesensis Lupac 06 | Isolate | Unclassified |
| 380 | 2858895516 | Micromonospora saelicesensis PSN13 | Isolate | Unclassified |
| 381 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 382 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 383 | 2867302475 | Micromonospora globbae WPS1-2 | Isolate | Unclassified |
| 384 | 2867312974 | Micromonospora musae NGC1-4 | Isolate | Unclassified |
| 385 | 2867319477 | Micromonospora musae MS1-9 | Isolate | Unclassified |
| 386 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 387 | 2869048445 | Micromonospora saelicesensis PSN01 | Isolate | Unclassified |
| 388 | 2869061728 | Micromonospora noduli ONO86 | Isolate | Unclassified |
| 389 | 2869068681 | Micromonospora noduli GUI43 | Isolate | Unclassified |
| 390 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 391 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 392 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 393 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 394 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 395 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 396 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 397 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 398 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 399 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 400 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 401 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 402 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 403 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 404 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 405 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 406 | 649633069 | Micromonospora sp. L5 | Isolate | Unclassified |
| 407 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 408 | 8003856774 | Micromonospora echinofusca MPMI6 | Isolate | Unclassified |
| 409 | 8054704163 | Micromonospora trifolii NIE79 | Isolate | Nodule |
| 410 | 8054727385 | Micromonospora alfalfae MED01 | Isolate | Nodule |
| 411 | 8054734606 | Micromonospora hortensis NIE111 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.25 |
| Metatranscriptomes | 0.46 |
| Isolates | 7.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 4.86 |
| Nodule | 0.69 |
| Rhizoplane | 9.25 |
| Rhizosphere | 75.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070660_100233175 | 3300005339 | Bacteria | 1498 |
| 2 | LJQas_1012794 | 3300000549 | Bacteria | 990 |
| 3 | JGI24737J22298_10023902 | 3300001990 | Bacteria | 1936 |
| 4 | JGI24737J22298_10064182 | 3300001990 | Bacteria | 1102 |
| 5 | JGI24034J26672_10018556 | 3300002239 | Bacteria | 1081 |
| 6 | JGI25407J50210_10042427 | 3300003373 | Bacteria | 1164 |
| 7 | JGI25404J52841_10007807 | 3300003659 | Bacteria | 2270 |
| 8 | Ga0055540_1002731 | 3300003792 | Bacteria | 9072 |
| 9 | Ga0055540_1005641 | 3300003792 | Bacteria | 5196 |
| 10 | Ga0055540_1015867 | 3300003792 | Bacteria | 2171 |
| 11 | Ga0070676_10004509 | 3300005328 | Bacteria | 7331 |
| 12 | Ga0070683_100061774 | 3300005329 | Bacteria | 3483 |
| 13 | Ga0070683_100069891 | 3300005329 | Bacteria | 3275 |
| 14 | Ga0070677_10135226 | 3300005333 | Bacteria | 1130 |
| 15 | Ga0068869_100030664 | 3300005334 | Bacteria | 3777 |
| 16 | Ga0068869_100428163 | 3300005334 | Bacteria | 1093 |
| 17 | Ga0068869_100537444 | 3300005334 | Bacteria | 980 |
| 18 | Ga0070666_10080049 | 3300005335 | Bacteria | 2232 |
| 19 | Ga0070682_100003688 | 3300005337 | Bacteria | 8507 |
| 20 | Ga0070682_100034472 | 3300005337 | Bacteria | 3083 |
| 21 | Ga0070682_100045094 | 3300005337 | Bacteria | 2732 |
| 22 | Ga0068868_100004228 | 3300005338 | Bacteria | 10043 |
| 23 | Ga0068868_100121690 | 3300005338 | Bacteria | 2129 |
| 24 | Ga0070660_100020722 | 3300005339 | Bacteria | 4838 |
| 25 | Ga0070660_100099066 | 3300005339 | Bacteria | 2308 |
| 26 | Ga0070689_100037795 | 3300005340 | Bacteria | 3692 |
| 27 | Ga0070687_100110128 | 3300005343 | Bacteria | 1557 |
| 28 | Ga0070661_100464171 | 3300005344 | Bacteria | 1009 |
| 29 | Ga0070692_10007517 | 3300005345 | Bacteria | 4803 |
| 30 | Ga0070692_10056860 | 3300005345 | Bacteria | 2049 |
| 31 | Ga0070692_10057139 | 3300005345 | Bacteria | 2045 |
| 32 | Ga0070668_100033960 | 3300005347 | Bacteria | 3887 |
| 33 | Ga0070668_100272711 | 3300005347 | Bacteria | 1410 |
| 34 | Ga0070675_100170404 | 3300005354 | Bacteria | 1877 |
| 35 | Ga0070674_100020383 | 3300005356 | Bacteria | 4235 |
| 36 | Ga0070674_100024762 | 3300005356 | Bacteria | 3898 |
| 37 | Ga0070674_100203454 | 3300005356 | Bacteria | 1530 |
| 38 | Ga0070688_100005969 | 3300005365 | Bacteria | 6454 |
| 39 | Ga0070659_100030523 | 3300005366 | Bacteria | 4172 |
| 40 | Ga0070667_100000027 | 3300005367 | Bacteria | 181315 |
| 41 | Ga0070667_100007912 | 3300005367 | Bacteria | 8817 |
| 42 | Ga0070667_100062997 | 3300005367 | Bacteria | 3142 |
| 43 | Ga0070703_10020296 | 3300005406 | Bacteria | 1932 |
| 44 | Ga0070709_10000135 | 3300005434 | Bacteria | 49189 |
| 45 | Ga0070709_10001866 | 3300005434 | Bacteria | 11429 |
| 46 | Ga0070709_10022860 | 3300005434 | Bacteria | 3664 |
| 47 | Ga0070714_100007368 | 3300005435 | Bacteria | 8561 |
| 48 | Ga0070714_100010928 | 3300005435 | Bacteria | 7189 |
| 49 | Ga0070714_100011917 | 3300005435 | Bacteria | 6915 |
| 50 | Ga0070714_100023939 | 3300005435 | Bacteria | 5023 |
| 51 | Ga0070714_100519979 | 3300005435 | Bacteria | 1137 |
| 52 | Ga0070713_100002948 | 3300005436 | Bacteria | 11159 |
| 53 | Ga0070713_100024429 | 3300005436 | Bacteria | 4706 |
| 54 | Ga0070713_100183929 | 3300005436 | Bacteria | 1879 |
| 55 | Ga0070713_100210192 | 3300005436 | Bacteria | 1761 |
| 56 | Ga0070710_10000710 | 3300005437 | Bacteria | 15836 |
| 57 | Ga0070710_10010043 | 3300005437 | Bacteria | 4641 |
| 58 | Ga0070710_10247548 | 3300005437 | Bacteria | 1144 |
| 59 | Ga0070701_10007237 | 3300005438 | Bacteria | 4725 |
| 60 | Ga0070711_100003575 | 3300005439 | Bacteria | 9065 |
| 61 | Ga0070711_100007335 | 3300005439 | Bacteria | 6711 |
| 62 | Ga0070711_100015298 | 3300005439 | Bacteria | 4856 |
| 63 | Ga0070711_100171597 | 3300005439 | Bacteria | 1653 |
| 64 | Ga0070705_100038707 | 3300005440 | Bacteria | 2700 |
| 65 | Ga0070705_100042692 | 3300005440 | Bacteria | 2594 |
| 66 | Ga0070700_100002404 | 3300005441 | Bacteria | 9544 |
| 67 | Ga0070700_100005243 | 3300005441 | Bacteria | 6853 |
| 68 | Ga0070700_100036181 | 3300005441 | Bacteria | 2992 |
| 69 | Ga0070700_100083450 | 3300005441 | Bacteria | 2069 |
| 70 | Ga0070700_100155637 | 3300005441 | Bacteria | 1568 |
| 71 | Ga0070694_100020269 | 3300005444 | Bacteria | 4237 |
| 72 | Ga0070663_100159018 | 3300005455 | Bacteria | 1738 |
| 73 | Ga0070663_100177317 | 3300005455 | Bacteria | 1651 |
| 74 | Ga0070678_100003571 | 3300005456 | Bacteria | 8675 |
| 75 | Ga0070678_100049258 | 3300005456 | Bacteria | 3039 |
| 76 | Ga0070662_100018266 | 3300005457 | Bacteria | 4741 |
| 77 | Ga0070662_100133759 | 3300005457 | Bacteria | 1915 |
| 78 | Ga0068867_100001469 | 3300005459 | Bacteria | 16336 |
| 79 | Ga0070706_100109516 | 3300005467 | Bacteria | 2570 |
| 80 | Ga0070679_100310176 | 3300005530 | Bacteria | 1528 |
| 81 | Ga0070679_100487733 | 3300005530 | Bacteria | 1176 |
| 82 | Ga0070684_100004622 | 3300005535 | Bacteria | 10498 |
| 83 | Ga0070684_100133069 | 3300005535 | Bacteria | 2244 |
| 84 | Ga0070684_100420527 | 3300005535 | Bacteria | 1233 |
| 85 | Ga0068853_100022280 | 3300005539 | Bacteria | 5290 |
| 86 | Ga0070672_100001159 | 3300005543 | Bacteria | 16111 |
| 87 | Ga0070672_100027373 | 3300005543 | Bacteria | 4251 |
| 88 | Ga0070686_100021257 | 3300005544 | Bacteria | 3854 |
| 89 | Ga0070686_100092564 | 3300005544 | Bacteria | 2025 |
| 90 | Ga0070686_100144948 | 3300005544 | Bacteria | 1657 |
| 91 | Ga0070695_100067985 | 3300005545 | Bacteria | 2325 |
| 92 | Ga0070696_100022383 | 3300005546 | Bacteria | 4293 |
| 93 | Ga0070693_100118629 | 3300005547 | Bacteria | 1638 |
| 94 | Ga0070665_100000566 | 3300005548 | Bacteria | 51646 |
| 95 | Ga0070665_100005584 | 3300005548 | Bacteria | 12934 |
| 96 | Ga0070665_100006130 | 3300005548 | Bacteria | 12290 |
| 97 | Ga0070704_100000126 | 3300005549 | Bacteria | 27927 |
| 98 | Ga0068855_100081382 | 3300005563 | Bacteria | 3754 |
| 99 | Ga0070664_100003142 | 3300005564 | Bacteria | 13351 |
| 100 | Ga0068857_100049899 | 3300005577 | Bacteria | 3713 |
| 101 | Ga0068854_100020208 | 3300005578 | Bacteria | 4501 |
| 102 | Ga0068854_100368183 | 3300005578 | Bacteria | 1181 |
| 103 | Ga0068854_100509062 | 3300005578 | Bacteria | 1015 |
| 104 | Ga0068856_100169546 | 3300005614 | Bacteria | 2195 |
| 105 | Ga0068856_100187901 | 3300005614 | Bacteria | 2080 |
| 106 | Ga0070702_100001763 | 3300005615 | Bacteria | 9005 |
| 107 | Ga0070702_100019013 | 3300005615 | Bacteria | 3573 |
| 108 | Ga0070702_100233362 | 3300005615 | Bacteria | 1238 |
| 109 | Ga0070702_100462911 | 3300005615 | Bacteria | 922 |
| 110 | Ga0068852_100004825 | 3300005616 | Bacteria | 9580 |
| 111 | Ga0068852_100227965 | 3300005616 | Bacteria | 1775 |
| 112 | Ga0068852_100551566 | 3300005616 | Bacteria | 1153 |
| 113 | Ga0068859_100001466 | 3300005617 | Bacteria | 24023 |
| 114 | Ga0068859_100073907 | 3300005617 | Bacteria | 3447 |
| 115 | Ga0068866_10023190 | 3300005718 | Bacteria | 2883 |
| 116 | Ga0068866_10061208 | 3300005718 | Bacteria | 1954 |
| 117 | Ga0068866_10067927 | 3300005718 | Bacteria | 1873 |
| 118 | Ga0068861_100004568 | 3300005719 | Bacteria | 9295 |
| 119 | Ga0068861_100034935 | 3300005719 | Bacteria | 3720 |
| 120 | Ga0068861_100042597 | 3300005719 | Bacteria | 3403 |
| 121 | Ga0068861_100381332 | 3300005719 | Bacteria | 1246 |
| 122 | Ga0068861_100429438 | 3300005719 | Bacteria | 1179 |
| 123 | Ga0068870_10016817 | 3300005840 | Bacteria | 3505 |
| 124 | Ga0068863_100000463 | 3300005841 | Bacteria | 41401 |
| 125 | Ga0068863_100006631 | 3300005841 | Bacteria | 11362 |
| 126 | Ga0068863_100160140 | 3300005841 | Bacteria | 2156 |
| 127 | Ga0068863_100418099 | 3300005841 | Bacteria | 1313 |
| 128 | Ga0068858_100023617 | 3300005842 | Bacteria | 5728 |
| 129 | Ga0068858_100026870 | 3300005842 | Bacteria | 5347 |
| 130 | Ga0068858_100046922 | 3300005842 | Bacteria | 4005 |
| 131 | Ga0068858_100162952 | 3300005842 | Bacteria | 2100 |
| 132 | Ga0068860_100000141 | 3300005843 | Bacteria | 117843 |
| 133 | Ga0068860_100004584 | 3300005843 | Bacteria | 14106 |
| 134 | Ga0068860_100060872 | 3300005843 | Bacteria | 3587 |
| 135 | Ga0068862_100000138 | 3300005844 | Bacteria | 82578 |
| 136 | Ga0068862_100189710 | 3300005844 | Bacteria | 1849 |
| 137 | Ga0081455_10011098 | 3300005937 | Bacteria | 9069 |
| 138 | Ga0081455_10142172 | 3300005937 | Bacteria | 1862 |
| 139 | Ga0081540_1000527 | 3300005983 | Bacteria | 37363 |
| 140 | Ga0081540_1062677 | 3300005983 | Bacteria | 1764 |
| 141 | Ga0081539_10001009 | 3300005985 | Bacteria | 52009 |
| 142 | Ga0070717_10011333 | 3300006028 | Bacteria | 6765 |
| 143 | Ga0070717_10062854 | 3300006028 | Bacteria | 3079 |
| 144 | Ga0070717_10076407 | 3300006028 | Bacteria | 2803 |
| 145 | Ga0070717_10128742 | 3300006028 | Bacteria | 2175 |
| 146 | Ga0070717_10195411 | 3300006028 | Bacteria | 1770 |
| 147 | Ga0075365_10002024 | 3300006038 | Bacteria | 9622 |
| 148 | Ga0075365_10012827 | 3300006038 | Bacteria | 4992 |
| 149 | Ga0075365_10021273 | 3300006038 | Bacteria | 4043 |
| 150 | Ga0075365_10023288 | 3300006038 | Bacteria | 3893 |
| 151 | Ga0075365_10042779 | 3300006038 | Bacteria | 2963 |
| 152 | Ga0075365_10134195 | 3300006038 | Bacteria | 1715 |
| 153 | Ga0075365_10150794 | 3300006038 | Bacteria | 1617 |
| 154 | Ga0075363_100003255 | 3300006048 | Bacteria | 6871 |
| 155 | Ga0075363_100011124 | 3300006048 | Bacteria | 4301 |
| 156 | Ga0075364_10002521 | 3300006051 | Bacteria | 10257 |
| 157 | Ga0075364_10010660 | 3300006051 | Bacteria | 5558 |
| 158 | Ga0075364_10060850 | 3300006051 | Bacteria | 2476 |
| 159 | Ga0075364_10075430 | 3300006051 | Bacteria | 2225 |
| 160 | Ga0075364_10247410 | 3300006051 | Bacteria | 1212 |
| 161 | Ga0070715_10001665 | 3300006163 | Bacteria | 6591 |
| 162 | Ga0070716_100000586 | 3300006173 | Bacteria | 15288 |
| 163 | Ga0070716_100013856 | 3300006173 | Bacteria | 4119 |
| 164 | Ga0070716_100038904 | 3300006173 | Bacteria | 2636 |
| 165 | Ga0070716_100080830 | 3300006173 | Bacteria | 1939 |
| 166 | Ga0070716_100190597 | 3300006173 | Bacteria | 1354 |
| 167 | Ga0070712_100001102 | 3300006175 | Bacteria | 16265 |
| 168 | Ga0070712_100013749 | 3300006175 | Bacteria | 5178 |
| 169 | Ga0070712_100064753 | 3300006175 | Bacteria | 2593 |
| 170 | Ga0070712_100253925 | 3300006175 | Bacteria | 1406 |
| 171 | Ga0070712_100503534 | 3300006175 | Bacteria | 1015 |
| 172 | Ga0075369_10001409 | 3300006186 | Bacteria | 8187 |
| 173 | Ga0075369_10003302 | 3300006186 | Bacteria | 5860 |
| 174 | Ga0075369_10006006 | 3300006186 | Bacteria | 4570 |
| 175 | Ga0097621_100139448 | 3300006237 | Bacteria | 2071 |
| 176 | Ga0075370_10022995 | 3300006353 | Bacteria | 3429 |
| 177 | Ga0068871_100079406 | 3300006358 | Bacteria | 2715 |
| 178 | Ga0068871_100108794 | 3300006358 | Bacteria | 2330 |
| 179 | Ga0068871_100652286 | 3300006358 | Bacteria | 961 |
| 180 | Ga0075428_100013075 | 3300006844 | Bacteria | 9228 |
| 181 | Ga0075428_100099616 | 3300006844 | Bacteria | 3169 |
| 182 | Ga0075428_100321842 | 3300006844 | Bacteria | 1662 |
| 183 | Ga0075433_10002223 | 3300006852 | Bacteria | 14722 |
| 184 | Ga0075433_10136272 | 3300006852 | Bacteria | 2182 |
| 185 | Ga0075434_100019351 | 3300006871 | Bacteria | 6588 |
| 186 | Ga0075434_100314954 | 3300006871 | Bacteria | 1585 |
| 187 | Ga0075429_100205791 | 3300006880 | Bacteria | 1724 |
| 188 | Ga0068865_100006922 | 3300006881 | Bacteria | 6952 |
| 189 | Ga0068865_100053113 | 3300006881 | Bacteria | 2811 |
| 190 | Ga0075436_100059575 | 3300006914 | Bacteria | 2637 |
| 191 | Ga0097620_100001464 | 3300006931 | Bacteria | 24023 |
| 192 | Ga0097620_100073903 | 3300006931 | Bacteria | 3447 |
| 193 | Ga0075435_100122107 | 3300007076 | Bacteria | 2174 |
| 194 | Ga0105250_10047541 | 3300009092 | Bacteria | 1721 |
| 195 | Ga0105250_10090253 | 3300009092 | Bacteria | 1246 |
| 196 | Ga0105240_10432224 | 3300009093 | Bacteria | 1477 |
| 197 | Ga0105240_10521035 | 3300009093 | Bacteria | 1319 |
| 198 | Ga0111539_10021223 | 3300009094 | Bacteria | 7997 |
| 199 | Ga0111539_10250278 | 3300009094 | Bacteria | 2063 |
| 200 | Ga0105245_10003386 | 3300009098 | Bacteria | 14283 |
| 201 | Ga0105245_10006044 | 3300009098 | Bacteria | 10645 |
| 202 | Ga0105245_10010406 | 3300009098 | Bacteria | 8100 |
| 203 | Ga0105245_10123773 | 3300009098 | Bacteria | 2418 |
| 204 | Ga0105245_10666262 | 3300009098 | Bacteria | 1072 |
| 205 | Ga0105247_10000237 | 3300009101 | Bacteria | 51740 |
| 206 | Ga0105247_10002143 | 3300009101 | Bacteria | 13636 |
| 207 | Ga0114129_10312441 | 3300009147 | Bacteria | 2091 |
| 208 | Ga0105243_10002465 | 3300009148 | Bacteria | 15457 |
| 209 | Ga0105243_10021157 | 3300009148 | Bacteria | 4936 |
| 210 | Ga0105243_10043828 | 3300009148 | Bacteria | 3507 |
| 211 | Ga0105243_10068861 | 3300009148 | Bacteria | 2853 |
| 212 | Ga0105241_10229784 | 3300009174 | Bacteria | 1563 |
| 213 | Ga0105242_10002038 | 3300009176 | Bacteria | 15908 |
| 214 | Ga0105242_10431694 | 3300009176 | Bacteria | 1237 |
| 215 | Ga0105242_10502774 | 3300009176 | Bacteria | 1153 |
| 216 | Ga0105248_10000337 | 3300009177 | Bacteria | 55206 |
| 217 | Ga0105248_10018735 | 3300009177 | Bacteria | 7654 |
| 218 | Ga0105248_10058498 | 3300009177 | Bacteria | 4329 |
| 219 | Ga0105237_10094293 | 3300009545 | Bacteria | 2982 |
| 220 | Ga0105237_10104022 | 3300009545 | Bacteria | 2831 |
| 221 | Ga0105237_10238262 | 3300009545 | Bacteria | 1821 |
| 222 | Ga0105238_10046372 | 3300009551 | Bacteria | 4387 |
| 223 | Ga0105238_10212329 | 3300009551 | Bacteria | 1911 |
| 224 | Ga0105238_10619003 | 3300009551 | Bacteria | 1091 |
| 225 | Ga0105249_10000013 | 3300009553 | Bacteria | 283609 |
| 226 | Ga0105249_10003606 | 3300009553 | Bacteria | 13386 |
| 227 | Ga0105249_10025176 | 3300009553 | Bacteria | 5355 |
| 228 | Ga0105249_10085627 | 3300009553 | Bacteria | 2937 |
| 229 | Ga0105249_10261712 | 3300009553 | Bacteria | 1719 |
| 230 | Ga0105249_10588974 | 3300009553 | Bacteria | 1166 |
| 231 | Ga0105249_10799060 | 3300009553 | Bacteria | 1007 |
| 232 | Ga0105239_10043688 | 3300010375 | Bacteria | 4913 |
| 233 | Ga0105239_10106355 | 3300010375 | Bacteria | 3108 |
| 234 | Ga0105239_10132670 | 3300010375 | Bacteria | 2771 |
| 235 | Ga0157371_10088622 | 3300013102 | Bacteria | 2191 |
| 236 | Ga0157369_10161138 | 3300013105 | Bacteria | 2368 |
| 237 | Ga0157369_10182133 | 3300013105 | Bacteria | 2210 |
| 238 | Ga0157374_10198395 | 3300013296 | Bacteria | 1964 |
| 239 | Ga0157374_10276920 | 3300013296 | Bacteria | 1656 |
| 240 | Ga0157378_10005230 | 3300013297 | Bacteria | 11395 |
| 241 | Ga0157378_10160056 | 3300013297 | Bacteria | 2105 |
| 242 | Ga0163162_10010461 | 3300013306 | Bacteria | 9020 |
| 243 | Ga0163162_10030527 | 3300013306 | Bacteria | 5340 |
| 244 | Ga0163162_10090867 | 3300013306 | Bacteria | 3135 |
| 245 | Ga0163162_10667979 | 3300013306 | Bacteria | 1162 |
| 246 | Ga0157372_10052599 | 3300013307 | Bacteria | 4536 |
| 247 | Ga0157372_10059668 | 3300013307 | Bacteria | 4267 |
| 248 | Ga0157372_10328832 | 3300013307 | Bacteria | 1780 |
| 249 | Ga0157372_10574719 | 3300013307 | Bacteria | 1314 |
| 250 | Ga0157375_10008041 | 3300013308 | Bacteria | 9234 |
| 251 | Ga0157375_10011802 | 3300013308 | Bacteria | 7724 |
| 252 | Ga0157375_10130619 | 3300013308 | Bacteria | 2631 |
| 253 | Ga0157375_10132594 | 3300013308 | Bacteria | 2612 |
| 254 | Ga0157375_10209838 | 3300013308 | Bacteria | 2105 |
| 255 | Ga0157375_10965022 | 3300013308 | Bacteria | 993 |
| 256 | Ga0163163_10079248 | 3300014325 | Bacteria | 3283 |
| 257 | Ga0163163_10293667 | 3300014325 | Bacteria | 1678 |
| 258 | Ga0163163_10306464 | 3300014325 | Bacteria | 1641 |
| 259 | Ga0157380_10006518 | 3300014326 | Bacteria | 8230 |
| 260 | Ga0157380_10095793 | 3300014326 | Bacteria | 2460 |
| 261 | Ga0157380_10480080 | 3300014326 | Bacteria | 1202 |
| 262 | Ga0157379_10007978 | 3300014968 | Bacteria | 9184 |
| 263 | Ga0157379_10099990 | 3300014968 | Bacteria | 2604 |
| 264 | Ga0157379_10109595 | 3300014968 | Bacteria | 2480 |
| 265 | Ga0157379_10189230 | 3300014968 | Bacteria | 1860 |
| 266 | Ga0157376_10069685 | 3300014969 | Bacteria | 2982 |
| 267 | Ga0157376_10789429 | 3300014969 | Bacteria | 961 |
| 268 | Ga0163161_10004894 | 3300017792 | Bacteria | 9331 |
| 269 | Ga0163161_10048870 | 3300017792 | Bacteria | 3056 |
| 270 | Ga0197907_10042006 | 3300020069 | Bacteria | 993 |
| 271 | Ga0206354_10834257 | 3300020081 | Bacteria | 1008 |
| 272 | Ga0206353_11905460 | 3300020082 | Bacteria | 987 |
| 273 | Ga0213876_10007166 | 3300021384 | Bacteria | 6079 |
| 274 | Ga0213876_10009726 | 3300021384 | Bacteria | 5174 |
| 275 | Ga0213875_10001663 | 3300021388 | Bacteria | 14012 |
| 276 | Ga0213875_10001762 | 3300021388 | Bacteria | 13549 |
| 277 | Ga0213875_10024144 | 3300021388 | Bacteria | 2901 |
| 278 | Ga0213875_10038157 | 3300021388 | Bacteria | 2264 |
| 279 | Ga0224572_1005141 | 3300024225 | Bacteria | 2319 |
| 280 | Ga0224572_1017697 | 3300024225 | Bacteria | 1369 |
| 281 | Ga0209673_1058632 | 3300025273 | Bacteria | 973 |
| 282 | Ga0209051_1000122 | 3300025303 | Bacteria | 144507 |
| 283 | Ga0209051_1001174 | 3300025303 | Bacteria | 23776 |
| 284 | Ga0209051_1005191 | 3300025303 | Bacteria | 7707 |
| 285 | Ga0209051_1018341 | 3300025303 | Bacteria | 3098 |
| 286 | Ga0207696_1046704 | 3300025711 | Bacteria | 1249 |
| 287 | Ga0207682_10074471 | 3300025893 | Bacteria | 1444 |
| 288 | Ga0207692_10000342 | 3300025898 | Bacteria | 16158 |
| 289 | Ga0207692_10015760 | 3300025898 | Bacteria | 3333 |
| 290 | Ga0207642_10032568 | 3300025899 | Bacteria | 2196 |
| 291 | Ga0207642_10159601 | 3300025899 | Bacteria | 1209 |
| 292 | Ga0207710_10000213 | 3300025900 | Bacteria | 51731 |
| 293 | Ga0207688_10000557 | 3300025901 | Bacteria | 18190 |
| 294 | Ga0207688_10006136 | 3300025901 | Bacteria | 6541 |
| 295 | Ga0207688_10030407 | 3300025901 | Bacteria | 2977 |
| 296 | Ga0207688_10045486 | 3300025901 | Bacteria | 2449 |
| 297 | Ga0207688_10073346 | 3300025901 | Bacteria | 1945 |
| 298 | Ga0207688_10128129 | 3300025901 | Bacteria | 1486 |
| 299 | Ga0207680_10147111 | 3300025903 | Bacteria | 1567 |
| 300 | Ga0207647_10014152 | 3300025904 | Bacteria | 5508 |
| 301 | Ga0207647_10242643 | 3300025904 | Bacteria | 1034 |
| 302 | Ga0207685_10005941 | 3300025905 | Bacteria | 3275 |
| 303 | Ga0207699_10000148 | 3300025906 | Bacteria | 45232 |
| 304 | Ga0207645_10005261 | 3300025907 | Bacteria | 9425 |
| 305 | Ga0207643_10024032 | 3300025908 | Bacteria | 3363 |
| 306 | Ga0207705_10024663 | 3300025909 | Bacteria | 4291 |
| 307 | Ga0207705_10107565 | 3300025909 | Bacteria | 2058 |
| 308 | Ga0207705_10128876 | 3300025909 | Bacteria | 1882 |
| 309 | Ga0207695_10330723 | 3300025913 | Bacteria | 1412 |
| 310 | Ga0207695_10397227 | 3300025913 | Bacteria | 1263 |
| 311 | Ga0207671_10020382 | 3300025914 | Bacteria | 5046 |
| 312 | Ga0207693_10000346 | 3300025915 | Bacteria | 42778 |
| 313 | Ga0207693_10002049 | 3300025915 | Bacteria | 17626 |
| 314 | Ga0207693_10002834 | 3300025915 | Bacteria | 15019 |
| 315 | Ga0207663_10026950 | 3300025916 | Bacteria | 3343 |
| 316 | Ga0207662_10016725 | 3300025918 | Bacteria | 4142 |
| 317 | Ga0207657_10045057 | 3300025919 | Bacteria | 3874 |
| 318 | Ga0207657_10185679 | 3300025919 | Bacteria | 1679 |
| 319 | Ga0207657_10239631 | 3300025919 | Bacteria | 1448 |
| 320 | Ga0207652_10324752 | 3300025921 | Bacteria | 1389 |
| 321 | Ga0207681_10000866 | 3300025923 | Bacteria | 19891 |
| 322 | Ga0207694_10146974 | 3300025924 | Bacteria | 1897 |
| 323 | Ga0207687_10005646 | 3300025927 | Bacteria | 8276 |
| 324 | Ga0207687_10070720 | 3300025927 | Bacteria | 2492 |
| 325 | Ga0207687_10328132 | 3300025927 | Bacteria | 1241 |
| 326 | Ga0207700_10000793 | 3300025928 | Bacteria | 18260 |
| 327 | Ga0207700_10009110 | 3300025928 | Bacteria | 6183 |
| 328 | Ga0207700_10009744 | 3300025928 | Bacteria | 6022 |
| 329 | Ga0207700_10013499 | 3300025928 | Bacteria | 5318 |
| 330 | Ga0207664_10000246 | 3300025929 | Bacteria | 40614 |
| 331 | Ga0207664_10014178 | 3300025929 | Bacteria | 5748 |
| 332 | Ga0207664_10024853 | 3300025929 | Bacteria | 4504 |
| 333 | Ga0207664_10049854 | 3300025929 | Bacteria | 3298 |
| 334 | Ga0207664_10111164 | 3300025929 | Bacteria | 2279 |
| 335 | Ga0207644_10045948 | 3300025931 | Bacteria | 3108 |
| 336 | Ga0207690_10239467 | 3300025932 | Bacteria | 1397 |
| 337 | Ga0207706_10000901 | 3300025933 | Bacteria | 30536 |
| 338 | Ga0207706_10006711 | 3300025933 | Bacteria | 10639 |
| 339 | Ga0207706_10140154 | 3300025933 | Bacteria | 2127 |
| 340 | Ga0207686_10045316 | 3300025934 | Bacteria | 2705 |
| 341 | Ga0207709_10003330 | 3300025935 | Bacteria | 9625 |
| 342 | Ga0207709_10009011 | 3300025935 | Bacteria | 5501 |
| 343 | Ga0207709_10018611 | 3300025935 | Bacteria | 3893 |
| 344 | Ga0207670_10052640 | 3300025936 | Bacteria | 2738 |
| 345 | Ga0207670_10135992 | 3300025936 | Bacteria | 1807 |
| 346 | Ga0207669_10015908 | 3300025937 | Bacteria | 3807 |
| 347 | Ga0207669_10228931 | 3300025937 | Bacteria | 1370 |
| 348 | Ga0207704_10007329 | 3300025938 | Bacteria | 5205 |
| 349 | Ga0207704_10127996 | 3300025938 | Bacteria | 1752 |
| 350 | Ga0207665_10000711 | 3300025939 | Bacteria | 22571 |
| 351 | Ga0207665_10001580 | 3300025939 | Bacteria | 15361 |
| 352 | Ga0207665_10006217 | 3300025939 | Bacteria | 7931 |
| 353 | Ga0207691_10002487 | 3300025940 | Bacteria | 18018 |
| 354 | Ga0207711_10000753 | 3300025941 | Bacteria | 31755 |
| 355 | Ga0207711_10079574 | 3300025941 | Bacteria | 2861 |
| 356 | Ga0207689_10055193 | 3300025942 | Bacteria | 3270 |
| 357 | Ga0207689_10407627 | 3300025942 | Bacteria | 1134 |
| 358 | Ga0207661_10334085 | 3300025944 | Bacteria | 1365 |
| 359 | Ga0207679_10001569 | 3300025945 | Bacteria | 14281 |
| 360 | Ga0207667_10089236 | 3300025949 | Bacteria | 3187 |
| 361 | Ga0207667_10715850 | 3300025949 | Bacteria | 1003 |
| 362 | Ga0207712_10000018 | 3300025961 | Bacteria | 317921 |
| 363 | Ga0207712_10036981 | 3300025961 | Bacteria | 3328 |
| 364 | Ga0207668_10000770 | 3300025972 | Bacteria | 19610 |
| 365 | Ga0207668_10060146 | 3300025972 | Bacteria | 2665 |
| 366 | Ga0207668_10068292 | 3300025972 | Bacteria | 2526 |
| 367 | Ga0207668_10084590 | 3300025972 | Bacteria | 2312 |
| 368 | Ga0207668_10107638 | 3300025972 | Bacteria | 2085 |
| 369 | Ga0207640_10013064 | 3300025981 | Bacteria | 4749 |
| 370 | Ga0207640_10052058 | 3300025981 | Bacteria | 2665 |
| 371 | Ga0207640_10424436 | 3300025981 | Bacteria | 1089 |
| 372 | Ga0207658_10000788 | 3300025986 | Bacteria | 26993 |
| 373 | Ga0207658_10006407 | 3300025986 | Bacteria | 8035 |
| 374 | Ga0207658_10057023 | 3300025986 | Bacteria | 2901 |
| 375 | Ga0207658_10070692 | 3300025986 | Bacteria | 2641 |
| 376 | Ga0207703_10039576 | 3300026035 | Bacteria | 3768 |
| 377 | Ga0207703_10066149 | 3300026035 | Bacteria | 2973 |
| 378 | Ga0207703_10097545 | 3300026035 | Bacteria | 2483 |
| 379 | Ga0207639_10027732 | 3300026041 | Bacteria | 4129 |
| 380 | Ga0207639_10082466 | 3300026041 | Bacteria | 2549 |
| 381 | Ga0207639_10265147 | 3300026041 | Bacteria | 1504 |
| 382 | Ga0207678_10075534 | 3300026067 | Bacteria | 2887 |
| 383 | Ga0207708_10000448 | 3300026075 | Bacteria | 32061 |
| 384 | Ga0207708_10001359 | 3300026075 | Bacteria | 18383 |
| 385 | Ga0207708_10107496 | 3300026075 | Bacteria | 2163 |
| 386 | Ga0207708_10139643 | 3300026075 | Bacteria | 1899 |
| 387 | Ga0207702_10108937 | 3300026078 | Bacteria | 2459 |
| 388 | Ga0207641_10000953 | 3300026088 | Bacteria | 29732 |
| 389 | Ga0207641_10214209 | 3300026088 | Bacteria | 1783 |
| 390 | Ga0207648_10000550 | 3300026089 | Bacteria | 42009 |
| 391 | Ga0207648_10003999 | 3300026089 | Bacteria | 15298 |
| 392 | Ga0207676_10167996 | 3300026095 | Bacteria | 1908 |
| 393 | Ga0207676_10372557 | 3300026095 | Bacteria | 1327 |
| 394 | Ga0207674_10061967 | 3300026116 | Bacteria | 3778 |
| 395 | Ga0207675_100001369 | 3300026118 | Bacteria | 24433 |
| 396 | Ga0207675_100003501 | 3300026118 | Bacteria | 15316 |
| 397 | Ga0207675_100017246 | 3300026118 | Bacteria | 6742 |
| 398 | Ga0207675_100062669 | 3300026118 | Bacteria | 3474 |
| 399 | Ga0207675_100082776 | 3300026118 | Bacteria | 3010 |
| 400 | Ga0207675_100162811 | 3300026118 | Bacteria | 2129 |
| 401 | Ga0207675_100262685 | 3300026118 | Bacteria | 1674 |
| 402 | Ga0207675_100547846 | 3300026118 | Bacteria | 1156 |
| 403 | Ga0207683_10000569 | 3300026121 | Bacteria | 34187 |
| 404 | Ga0207683_10167066 | 3300026121 | Bacteria | 1991 |
| 405 | Ga0207698_10039000 | 3300026142 | Bacteria | 3515 |
| 406 | Ga0207698_10202041 | 3300026142 | Bacteria | 1780 |
| 407 | Ga0207698_10386661 | 3300026142 | Bacteria | 1333 |
| 408 | Ga0265357_1003356 | 3300028023 | Bacteria | 1384 |
| 409 | Ga0268266_10000596 | 3300028379 | Bacteria | 49462 |
| 410 | Ga0268266_10004635 | 3300028379 | Bacteria | 13108 |
| 411 | Ga0268266_10084589 | 3300028379 | Bacteria | 2770 |
| 412 | Ga0268266_10387824 | 3300028379 | Bacteria | 1319 |
| 413 | Ga0268265_10000159 | 3300028380 | Bacteria | 82592 |
| 414 | Ga0268265_10012251 | 3300028380 | Bacteria | 5810 |
| 415 | Ga0268265_10415390 | 3300028380 | Bacteria | 1248 |
| 416 | Ga0268264_10000005 | 3300028381 | Bacteria | 934972 |
| 417 | Ga0268264_10000249 | 3300028381 | Bacteria | 101309 |
| 418 | Ga0268264_10302852 | 3300028381 | Bacteria | 1505 |
| 419 | Ga0265338_10118493 | 3300028800 | Bacteria | 2115 |
| 420 | Ga0265340_10098011 | 3300031247 | Bacteria | 1364 |
| 421 | Ga0265327_10113557 | 3300031251 | Bacteria | 1291 |
| 422 | Ga0307509_10077196 | 3300031507 | Bacteria | 3454 |
| 423 | Ga0307408_100039076 | 3300031548 | Bacteria | 3352 |
| 424 | Ga0265313_10100267 | 3300031595 | Bacteria | 1286 |
| 425 | Ga0265314_10076871 | 3300031711 | Bacteria | 2216 |
| 426 | Ga0316576_10012638 | 3300031727 | Bacteria | 5584 |
| 427 | Ga0316576_10021323 | 3300031727 | Bacteria | 4479 |
| 428 | Ga0316576_10091864 | 3300031727 | Bacteria | 2262 |
| 429 | Ga0307516_10000690 | 3300031730 | Bacteria | 45875 |
| 430 | Ga0307405_10016614 | 3300031731 | Bacteria | 4018 |
| 431 | Ga0307405_10249901 | 3300031731 | Bacteria | 1319 |
| 432 | Ga0316577_10008319 | 3300031733 | Bacteria | 5557 |
| 433 | Ga0316577_10118271 | 3300031733 | Bacteria | 1489 |
| 434 | Ga0307413_10106243 | 3300031824 | Bacteria | 1868 |
| 435 | Ga0307410_10013152 | 3300031852 | Bacteria | 4817 |
| 436 | Ga0307410_10071306 | 3300031852 | Bacteria | 2409 |
| 437 | Ga0307410_10121908 | 3300031852 | Bacteria | 1903 |
| 438 | Ga0307410_10130739 | 3300031852 | Bacteria | 1844 |
| 439 | Ga0307410_10168023 | 3300031852 | Bacteria | 1650 |
| 440 | Ga0307410_10455581 | 3300031852 | Bacteria | 1044 |
| 441 | Ga0307407_10047079 | 3300031903 | Bacteria | 2445 |
| 442 | Ga0307407_10083836 | 3300031903 | Bacteria | 1935 |
| 443 | Ga0307407_10094830 | 3300031903 | Bacteria | 1838 |
| 444 | Ga0307409_100033438 | 3300031995 | Bacteria | 3742 |
| 445 | Ga0307409_100075186 | 3300031995 | Bacteria | 2703 |
| 446 | Ga0307409_100161414 | 3300031995 | Bacteria | 1960 |
| 447 | Ga0307409_100165680 | 3300031995 | Bacteria | 1939 |
| 448 | Ga0307409_100193836 | 3300031995 | Bacteria | 1811 |
| 449 | Ga0307409_100199854 | 3300031995 | Bacteria | 1787 |
| 450 | Ga0307409_100254697 | 3300031995 | Bacteria | 1607 |
| 451 | Ga0307409_100697164 | 3300031995 | Bacteria | 1014 |
| 452 | Ga0307416_100040283 | 3300032002 | Bacteria | 3627 |
| 453 | Ga0307416_100044453 | 3300032002 | Bacteria | 3488 |
| 454 | Ga0307416_100176956 | 3300032002 | Bacteria | 1994 |
| 455 | Ga0307411_10152938 | 3300032005 | Bacteria | 1717 |
| 456 | Ga0307411_10196746 | 3300032005 | Bacteria | 1544 |
| 457 | Ga0307415_100107877 | 3300032126 | Bacteria | 2059 |
| 458 | Ga0307415_100204301 | 3300032126 | Bacteria | 1570 |
| 459 | Ga0307415_100397542 | 3300032126 | Bacteria | 1175 |
| 460 | Ga0316585_10094951 | 3300032137 | Bacteria | 976 |
| 461 | Ga0373934_0013610 | 3300035086 | Bacteria | 3078 |
| 462 | Ga0373923_0000819 | 3300035111 | Bacteria | 8143 |
| 463 | Ga0373923_0031167 | 3300035111 | Bacteria | 2148 |
| 464 | Ga0373936_0029846 | 3300035113 | Bacteria | 2148 |
| 465 | Ga0373939_0008509 | 3300035114 | Bacteria | 2518 |
| 466 | Ga0373956_0016105 | 3300035119 | Bacteria | 3135 |
| 467 | Ga0373957_0002669 | 3300035120 | Bacteria | 5118 |
| 468 | Ga0373957_0064510 | 3300035120 | Bacteria | 1424 |
| 469 | Ga0373946_0029573 | 3300035171 | Bacteria | 2182 |
| 470 | Ga0373955_0042103 | 3300035172 | Bacteria | 2451 |
| 471 | Ga0373955_0086873 | 3300035172 | Bacteria | 1776 |
| 472 | Ga0316574_0070099 | 3300035398 | Bacteria | 2213 |
| 473 | Ga0373924_0001912 | 3300035410 | Bacteria | 6923 |
| 474 | Ga0373931_0008008 | 3300035691 | Bacteria | 5000 |
| 475 | Ga0373933_0009517 | 3300035724 | Bacteria | 5306 |
| 476 | Ga0373933_0094027 | 3300035724 | Bacteria | 1853 |
| 477 | Ga0373947_0119643 | 3300035725 | Bacteria | 1672 |
| 478 | Ga0373937_0697678 | 3300036401 | Bacteria | 961 |
| 479 | Ga0372808_000117 | 3300036459 | Bacteria | 4184 |
| 480 | Ga0316582_0095694 | 3300036647 | Bacteria | 1960 |
| 481 | Ga0316584_0024109 | 3300036712 | Bacteria | 4450 |
| 482 | Ga0316584_0041308 | 3300036712 | Bacteria | 3437 |
| 483 | Ga0373925_0008092 | 3300037068 | Bacteria | 7656 |
| 484 | Ga0373925_0069650 | 3300037068 | Bacteria | 2657 |
| 485 | Ga0395900_0007441 | 3300037418 | Bacteria | 11314 |
| 486 | Ga0395900_0068195 | 3300037418 | Bacteria | 3655 |
| 487 | Ga0395900_0133963 | 3300037418 | Bacteria | 2538 |
| 488 | Ga0395900_0603533 | 3300037418 | Bacteria | 1038 |
| 489 | Ga0395898_0123001 | 3300037466 | Bacteria | 2486 |
| 490 | Ga0395898_0528836 | 3300037466 | Bacteria | 1121 |
| 491 | Ga0395898_0576919 | 3300037466 | Bacteria | 1067 |
| 492 | Ga0436364_0003227 | 3300037853 | Bacteria | 16956 |
| 493 | Ga0436364_0201210 | 3300037853 | Bacteria | 60188 |
| 494 | Ga0436364_0337262 | 3300037853 | Bacteria | 2445 |
| 495 | Ga0436364_0348454 | 3300037853 | Bacteria | 2060 |
| 496 | Ga0436364_0425968 | 3300037853 | Bacteria | 1783 |
| 497 | Ga0436364_0693075 | 3300037853 | Bacteria | 1730 |
| 498 | Ga0436364_1265507 | 3300037853 | Bacteria | 48294 |
| 499 | Ga0395901_0009441 | 3300038443 | Bacteria | 9898 |
| 500 | Ga0395901_0204101 | 3300038443 | Bacteria | 2071 |
| 501 | Ga0395901_0452109 | 3300038443 | Bacteria | 1314 |
| 502 | Ga0436365_0174550 | 3300039437 | Bacteria | 6140 |
| 503 | Ga0436365_0576629 | 3300039437 | Bacteria | 3153 |
| 504 | Ga0436365_0641890 | 3300039437 | Bacteria | 23847 |
| 505 | Ga0436363_1646938 | 3300039450 | Bacteria | 1141 |
| 506 | Ga0436362_0601122 | 3300039453 | Bacteria | 1185 |
| 507 | Ga0439461_0000484 | 3300041410 | Bacteria | 5740 |
| 508 | Ga0439466_0006739 | 3300041411 | Bacteria | 4357 |
| 509 | Ga0439465_0000300 | 3300041413 | Bacteria | 13940 |
| 510 | Ga0451835_1090130 | 3300041492 | Bacteria | 1187 |
| 511 | Ga0451853_3221077 | 3300041512 | Bacteria | 1348 |
| 512 | Ga0439431_0005136 | 3300041997 | Bacteria | 2887 |
| 513 | Ga0439442_001876 | 3300042002 | Bacteria | 4121 |
| 514 | Ga0439434_0015578 | 3300042435 | Bacteria | 2267 |
| 515 | Ga0439460_0017904 | 3300042461 | Bacteria | 1903 |
| 516 | Ga0439440_0005469 | 3300042993 | Bacteria | 2525 |
| 517 | Ga0466966_0008251 | 3300044684 | Bacteria | 6907 |
| 518 | Ga0466966_0014087 | 3300044684 | Bacteria | 5294 |
| 519 | Ga0466963_0008588 | 3300044694 | Bacteria | 6131 |
| 520 | Ga0466963_0010397 | 3300044694 | Bacteria | 5633 |
| 521 | Ga0466963_0014995 | 3300044694 | Bacteria | 4790 |
| 522 | Ga0466963_0032178 | 3300044694 | Bacteria | 3395 |
| 523 | Ga0466963_0056016 | 3300044694 | Bacteria | 2623 |
| 524 | Ga0466963_0200391 | 3300044694 | Bacteria | 1396 |
| 525 | Ga0466963_0255910 | 3300044694 | Bacteria | 1229 |
| 526 | Ga0466963_0275066 | 3300044694 | Bacteria | 1183 |
| 527 | Ga0466963_0379756 | 3300044694 | Bacteria | 996 |
| 528 | Ga0466964_0018190 | 3300044706 | Bacteria | 2695 |
| 529 | Ga0466964_0072718 | 3300044706 | Bacteria | 1458 |
| 530 | Ga0466964_0125298 | 3300044706 | Bacteria | 1163 |
| 531 | Ga0466971_0006420 | 3300044719 | Bacteria | 5108 |
| 532 | Ga0466971_0031768 | 3300044719 | Bacteria | 2364 |
| 533 | Ga0466971_0073135 | 3300044719 | Bacteria | 1558 |
| 534 | Ga0466970_0050470 | 3300044765 | Bacteria | 2219 |
| 535 | Ga0466957_0075664 | 3300044842 | Bacteria | 2089 |
| 536 | Ga0466957_0123888 | 3300044842 | Bacteria | 1650 |
| 537 | Ga0466960_0003456 | 3300044901 | Bacteria | 6078 |
| 538 | Ga0466960_0032528 | 3300044901 | Bacteria | 2416 |
| 539 | Ga0466960_0082639 | 3300044901 | Bacteria | 1622 |
| 540 | Ga0451576_0149904 | 3300045051 | Bacteria | 2432 |
| 541 | Ga0466958_0011794 | 3300045836 | Bacteria | 4934 |
| 542 | Ga0466958_0020030 | 3300045836 | Bacteria | 3898 |
| 543 | Ga0466958_0205292 | 3300045836 | Bacteria | 1254 |
| 544 | Ga0466967_0000413 | 3300045976 | Bacteria | 20236 |
| 545 | Ga0466967_0006573 | 3300045976 | Bacteria | 8252 |
| 546 | Ga0466967_0021792 | 3300045976 | Bacteria | 5213 |
| 547 | Ga0466967_0036958 | 3300045976 | Bacteria | 4174 |
| 548 | Ga0466967_0078347 | 3300045976 | Bacteria | 2977 |
| 549 | Ga0466967_0102247 | 3300045976 | Bacteria | 2621 |
| 550 | Ga0466967_0103215 | 3300045976 | Bacteria | 2609 |
| 551 | Ga0466967_0111687 | 3300045976 | Bacteria | 2512 |
| 552 | Ga0466967_0120496 | 3300045976 | Bacteria | 2423 |
| 553 | Ga0466967_0157437 | 3300045976 | Bacteria | 2129 |
| 554 | Ga0466967_0190081 | 3300045976 | Bacteria | 1940 |
| 555 | Ga0466967_0230675 | 3300045976 | Bacteria | 1762 |
| 556 | Ga0466967_0257782 | 3300045976 | Bacteria | 1668 |
| 557 | Ga0466967_0359320 | 3300045976 | Bacteria | 1411 |
| 558 | Ga0466967_0733847 | 3300045976 | Bacteria | 979 |
| 559 | Ga0495592_0009192 | 3300046454 | Bacteria | 7436 |
| 560 | Ga0495592_0022237 | 3300046454 | Bacteria | 4823 |
| 561 | Ga0495629_0008179 | 3300046459 | Bacteria | 7691 |
| 562 | Ga0495629_0191486 | 3300046459 | Bacteria | 1415 |
| 563 | Ga0495641_0017837 | 3300046461 | Bacteria | 3683 |
| 564 | Ga0495641_0209540 | 3300046461 | Bacteria | 874 |
| 565 | Ga0495651_0003795 | 3300046462 | Bacteria | 11559 |
| 566 | Ga0495651_0003978 | 3300046462 | Bacteria | 11298 |
| 567 | Ga0495651_0197370 | 3300046462 | Bacteria | 1411 |
| 568 | Ga0495653_0010354 | 3300046463 | Bacteria | 7627 |
| 569 | Ga0495653_0070695 | 3300046463 | Bacteria | 2611 |
| 570 | Ga0495582_0006180 | 3300046473 | Bacteria | 6666 |
| 571 | Ga0495639_0023898 | 3300046475 | Bacteria | 2688 |
| 572 | Ga0495662_0088243 | 3300046476 | Bacteria | 1511 |
| 573 | Ga0495664_0051583 | 3300046477 | Bacteria | 2442 |
| 574 | Ga0495664_0106173 | 3300046477 | Bacteria | 1693 |
| 575 | Ga0495608_0003288 | 3300046511 | Bacteria | 11548 |
| 576 | Ga0495618_0036687 | 3300046514 | Bacteria | 3076 |
| 577 | Ga0495618_0071785 | 3300046514 | Bacteria | 2203 |
| 578 | Ga0495628_0011984 | 3300046516 | Bacteria | 7312 |
| 579 | Ga0495628_0111124 | 3300046516 | Bacteria | 2107 |
| 580 | Ga0495630_0012219 | 3300046517 | Bacteria | 6228 |
| 581 | Ga0495652_0007754 | 3300046529 | Bacteria | 9869 |
| 582 | Ga0495652_0052582 | 3300046529 | Bacteria | 3473 |
| 583 | Ga0495665_0008176 | 3300046531 | Bacteria | 5673 |
| 584 | Ga0495587_0014721 | 3300046536 | Bacteria | 4899 |
| 585 | Ga0495645_0043783 | 3300046543 | Bacteria | 3266 |
| 586 | Ga0495667_0001844 | 3300046559 | Bacteria | 14067 |
| 587 | Ga0495667_0110766 | 3300046559 | Bacteria | 1773 |
| 588 | Ga0495656_0026889 | 3300046615 | Bacteria | 2294 |
| 589 | Ga0495634_0022563 | 3300046642 | Bacteria | 4434 |
| 590 | Ga0495635_0073351 | 3300046663 | Bacteria | 2344 |
| 591 | Ga0495635_0151184 | 3300046663 | Bacteria | 1580 |
| 592 | Ga0495657_0012258 | 3300046675 | Bacteria | 6370 |
| 593 | Ga0495657_0040679 | 3300046675 | Bacteria | 3186 |
| 594 | Ga0495657_0162887 | 3300046675 | Bacteria | 1379 |
| 595 | Ga0495599_0186381 | 3300046678 | Bacteria | 1277 |
| 596 | Ga0495646_0108510 | 3300046680 | Bacteria | 1582 |
| 597 | Ga0495647_0063558 | 3300046681 | Bacteria | 1462 |
| 598 | Ga0495658_0021465 | 3300046683 | Bacteria | 3404 |
| 599 | Ga0495613_0328413 | 3300046689 | Bacteria | 1054 |
| 600 | Ga0495624_0018493 | 3300046690 | Bacteria | 4661 |
| 601 | Ga0495600_0011368 | 3300046809 | Bacteria | 5545 |
| 602 | Ga0495600_0039572 | 3300046809 | Bacteria | 3070 |
| 603 | Ga0495581_0030864 | 3300047315 | Bacteria | 3104 |
| 604 | Ga0495604_0134483 | 3300047317 | Bacteria | 1773 |
| 605 | Ga0495604_0383917 | 3300047317 | Bacteria | 927 |
| 606 | Ga0495674_0012863 | 3300047319 | Bacteria | 7882 |
| 607 | Ga0495674_0065965 | 3300047319 | Bacteria | 3142 |
| 608 | Ga0495674_0198376 | 3300047319 | Bacteria | 1666 |
| 609 | Ga0495674_0249676 | 3300047319 | Bacteria | 1460 |
| 610 | Ga0495674_0459226 | 3300047319 | Bacteria | 1022 |
| 611 | Ga0495676_0309591 | 3300047321 | Bacteria | 1063 |
| 612 | Ga0495680_0020203 | 3300047322 | Bacteria | 5609 |
| 613 | Ga0495680_0225679 | 3300047322 | Bacteria | 1335 |
| 614 | Ga0495675_0004710 | 3300047444 | Bacteria | 8286 |
| 615 | Ga0495684_0073375 | 3300047471 | Bacteria | 2599 |
| 616 | Ga0495593_0031702 | 3300047673 | Bacteria | 2885 |
| 617 | Ga0495602_0039054 | 3300048088 | Bacteria | 4377 |
| 618 | Ga0495602_0081562 | 3300048088 | Bacteria | 2719 |
| 619 | Ga0495614_0008296 | 3300048089 | Bacteria | 4625 |
| 620 | Ga0495614_0105509 | 3300048089 | Bacteria | 1235 |
| 621 | Ga0496100_0001064 | 3300048903 | Bacteria | 13233 |
| 622 | Ga0496100_0006542 | 3300048903 | Bacteria | 6360 |
| 623 | Ga0496100_0046405 | 3300048903 | Bacteria | 2793 |
| 624 | Ga0496100_0146694 | 3300048903 | Bacteria | 1679 |
| 625 | Ga0496100_0161341 | 3300048903 | Bacteria | 1607 |
| 626 | Ga0496100_0169157 | 3300048903 | Bacteria | 1572 |
| 627 | Ga0496100_0437117 | 3300048903 | Bacteria | 1001 |
| 628 | Ga0496101_0000270 | 3300048904 | Bacteria | 36620 |
| 629 | Ga0496101_0003856 | 3300048904 | Bacteria | 9375 |
| 630 | Ga0496101_0006630 | 3300048904 | Bacteria | 7461 |
| 631 | Ga0496101_0235662 | 3300048904 | Bacteria | 1423 |
| 632 | Ga0496102_0000257 | 3300048905 | Bacteria | 69091 |
| 633 | Ga0496102_0020959 | 3300048905 | Bacteria | 5780 |
| 634 | Ga0496102_0043584 | 3300048905 | Bacteria | 4069 |
| 635 | Ga0496102_0088100 | 3300048905 | Bacteria | 2869 |
| 636 | Ga0496102_0105729 | 3300048905 | Bacteria | 2619 |
| 637 | Ga0496102_0247755 | 3300048905 | Bacteria | 1680 |
| 638 | Ga0496102_0257242 | 3300048905 | Bacteria | 1646 |
| 639 | Ga0496102_0501258 | 3300048905 | Bacteria | 1136 |
| 640 | Ga0496103_0000354 | 3300048906 | Bacteria | 41815 |
| 641 | Ga0496103_0002147 | 3300048906 | Bacteria | 12550 |
| 642 | Ga0496104_0011779 | 3300048907 | Bacteria | 7846 |
| 643 | Ga0496104_0177468 | 3300048907 | Bacteria | 2040 |
| 644 | Ga0496104_0574986 | 3300048907 | Bacteria | 1037 |
| 645 | Ga0496105_0001698 | 3300048908 | Bacteria | 15705 |
| 646 | Ga0496105_0143746 | 3300048908 | Bacteria | 1963 |
| 647 | Ga0496105_0175302 | 3300048908 | Bacteria | 1757 |
| 648 | Ga0496106_0026365 | 3300048909 | Bacteria | 4327 |
| 649 | Ga0496106_0062872 | 3300048909 | Bacteria | 2819 |
| 650 | Ga0496106_0092483 | 3300048909 | Bacteria | 2336 |
| 651 | Ga0496106_0140860 | 3300048909 | Bacteria | 1897 |
| 652 | Ga0496107_0000927 | 3300048910 | Bacteria | 17302 |
| 653 | Ga0496107_0024867 | 3300048910 | Bacteria | 4238 |
| 654 | Ga0496107_0101511 | 3300048910 | Bacteria | 2109 |
| 655 | Ga0496108_0020828 | 3300048911 | Bacteria | 5392 |
| 656 | Ga0496108_0032018 | 3300048911 | Bacteria | 4365 |
| 657 | Ga0496108_0037578 | 3300048911 | Bacteria | 4034 |
| 658 | Ga0496108_0047157 | 3300048911 | Bacteria | 3602 |
| 659 | Ga0496108_0124859 | 3300048911 | Bacteria | 2209 |
| 660 | Ga0496108_0304355 | 3300048911 | Bacteria | 1389 |
| 661 | Ga0496108_0342993 | 3300048911 | Bacteria | 1303 |
| 662 | Ga0496109_0004963 | 3300048912 | Bacteria | 11113 |
| 663 | Ga0496109_0014983 | 3300048912 | Bacteria | 6748 |
| 664 | Ga0496109_0028605 | 3300048912 | Bacteria | 4986 |
| 665 | Ga0496109_0062929 | 3300048912 | Bacteria | 3393 |
| 666 | Ga0496109_0083192 | 3300048912 | Bacteria | 2951 |
| 667 | Ga0496109_0093331 | 3300048912 | Bacteria | 2785 |
| 668 | Ga0496109_0137834 | 3300048912 | Bacteria | 2281 |
| 669 | Ga0496109_0219649 | 3300048912 | Bacteria | 1787 |
| 670 | Ga0496109_0252933 | 3300048912 | Bacteria | 1659 |
| 671 | Ga0496109_0562591 | 3300048912 | Bacteria | 1075 |
| 672 | Ga0496109_0630392 | 3300048912 | Bacteria | 1009 |
| 673 | Ga0496109_0682668 | 3300048912 | Bacteria | 964 |
| 674 | Ga0496110_0023499 | 3300048913 | Bacteria | 5244 |
| 675 | Ga0496110_0036138 | 3300048913 | Bacteria | 4289 |
| 676 | Ga0496110_0062681 | 3300048913 | Bacteria | 3284 |
| 677 | Ga0496110_0109693 | 3300048913 | Bacteria | 2479 |
| 678 | Ga0496110_0216424 | 3300048913 | Bacteria | 1742 |
| 679 | Ga0496110_0298222 | 3300048913 | Bacteria | 1468 |
| 680 | Ga0496111_0006116 | 3300048914 | Bacteria | 7788 |
| 681 | Ga0496111_0067016 | 3300048914 | Bacteria | 2608 |
| 682 | Ga0496111_0201791 | 3300048914 | Bacteria | 1478 |
| 683 | Ga0496112_0001231 | 3300048915 | Bacteria | 19312 |
| 684 | Ga0496112_0007191 | 3300048915 | Bacteria | 9862 |
| 685 | Ga0496112_0012590 | 3300048915 | Bacteria | 7773 |
| 686 | Ga0496112_0275546 | 3300048915 | Bacteria | 1630 |
| 687 | Ga0496113_0022727 | 3300048916 | Bacteria | 4440 |
| 688 | Ga0496113_0056139 | 3300048916 | Bacteria | 2955 |
| 689 | Ga0496113_0058370 | 3300048916 | Bacteria | 2903 |
| 690 | Ga0496113_0104696 | 3300048916 | Bacteria | 2196 |
| 691 | Ga0496113_0197649 | 3300048916 | Bacteria | 1598 |
| 692 | Ga0496113_0341618 | 3300048916 | Bacteria | 1201 |
| 693 | Ga0496113_0437350 | 3300048916 | Bacteria | 1051 |
| 694 | Ga0496114_0003138 | 3300048917 | Bacteria | 12682 |
| 695 | Ga0496114_0011726 | 3300048917 | Bacteria | 7010 |
| 696 | Ga0496114_0030631 | 3300048917 | Bacteria | 4427 |
| 697 | Ga0496114_0051583 | 3300048917 | Bacteria | 3425 |
| 698 | Ga0496115_0001434 | 3300048918 | Bacteria | 17065 |
| 699 | Ga0496115_0012191 | 3300048918 | Bacteria | 6465 |
| 700 | Ga0496115_0467252 | 3300048918 | Bacteria | 1017 |
| 701 | Ga0496117_0000390 | 3300048920 | Bacteria | 75361 |
| 702 | Ga0496117_0042319 | 3300048920 | Bacteria | 3325 |
| 703 | Ga0496118_0000730 | 3300048921 | Bacteria | 53095 |
| 704 | Ga0496118_0001095 | 3300048921 | Bacteria | 42156 |
| 705 | Ga0496119_0000067 | 3300048922 | Bacteria | 162404 |
| 706 | Ga0496119_0047751 | 3300048922 | Bacteria | 2660 |
| 707 | Ga0496120_0004229 | 3300048923 | Bacteria | 12248 |
| 708 | Ga0496120_0037503 | 3300048923 | Bacteria | 2876 |
| 709 | Ga0496120_0096888 | 3300048923 | Bacteria | 1566 |
| 710 | Ga0496121_0002203 | 3300048924 | Bacteria | 30428 |
| 711 | Ga0496125_0010200 | 3300048928 | Bacteria | 9523 |
| 712 | Ga0496125_0198844 | 3300048928 | Bacteria | 1315 |
| 713 | Ga0496126_0008227 | 3300048929 | Bacteria | 11275 |
| 714 | Ga0501031_0063390 | 3300049568 | Bacteria | 2408 |
| 715 | Ga0501031_0185807 | 3300049568 | Bacteria | 1357 |
| 716 | Ga0501031_0397211 | 3300049568 | Bacteria | 892 |
| 717 | Ga0501032_0006399 | 3300049569 | Bacteria | 8668 |
| 718 | Ga0501032_0013140 | 3300049569 | Bacteria | 5894 |
| 719 | Ga0501032_0400642 | 3300049569 | Bacteria | 881 |
| 720 | Ga0501033_0013121 | 3300049570 | Bacteria | 6313 |
| 721 | Ga0501034_0001743 | 3300049571 | Bacteria | 27930 |
| 722 | Ga0501034_0003840 | 3300049571 | Bacteria | 16933 |
| 723 | Ga0501034_0005429 | 3300049571 | Bacteria | 13939 |
| 724 | Ga0501034_0154320 | 3300049571 | Bacteria | 2271 |
| 725 | Ga0501034_0362488 | 3300049571 | Bacteria | 1376 |
| 726 | Ga0501036_0029370 | 3300049572 | Bacteria | 4645 |
| 727 | Ga0501036_0054358 | 3300049572 | Bacteria | 3391 |
| 728 | Ga0501037_0018584 | 3300049573 | Bacteria | 5123 |
| 729 | Ga0501038_0057814 | 3300049574 | Bacteria | 3328 |
| 730 | Ga0501038_0344822 | 3300049574 | Bacteria | 1161 |
| 731 | Ga0501039_0017004 | 3300049575 | Bacteria | 5575 |
| 732 | Ga0501039_0250489 | 3300049575 | Bacteria | 1393 |
| 733 | Ga0501039_0286692 | 3300049575 | Bacteria | 1294 |
| 734 | Ga0501041_0166236 | 3300049577 | Bacteria | 1380 |
| 735 | Ga0501043_0005380 | 3300049579 | Bacteria | 10338 |
| 736 | Ga0501043_0014911 | 3300049579 | Bacteria | 6084 |
| 737 | Ga0501046_0000382 | 3300049580 | Bacteria | 44315 |
| 738 | Ga0501047_0000405 | 3300049581 | Bacteria | 48286 |
| 739 | Ga0501047_0018051 | 3300049581 | Bacteria | 6761 |
| 740 | Ga0501047_0021914 | 3300049581 | Bacteria | 6135 |
| 741 | Ga0501047_0033122 | 3300049581 | Bacteria | 4989 |
| 742 | Ga0501048_0001972 | 3300049582 | Bacteria | 15610 |
| 743 | Ga0501048_0015494 | 3300049582 | Bacteria | 5631 |
| 744 | Ga0501068_0196515 | 3300049584 | Bacteria | 1279 |
| 745 | Ga0501069_0016908 | 3300049585 | Bacteria | 3920 |
| 746 | Ga0501069_0031764 | 3300049585 | Bacteria | 2906 |
| 747 | Ga0501070_0001555 | 3300049586 | Bacteria | 20409 |
| 748 | Ga0501070_0011557 | 3300049586 | Bacteria | 7453 |
| 749 | Ga0501070_0033073 | 3300049586 | Bacteria | 4325 |
| 750 | Ga0501070_0066052 | 3300049586 | Bacteria | 2995 |
| 751 | Ga0501070_0479492 | 3300049586 | Bacteria | 1001 |
| 752 | Ga0501071_0122290 | 3300049587 | Bacteria | 1930 |
| 753 | Ga0501073_0140900 | 3300049589 | Bacteria | 1671 |
| 754 | Ga0501074_0007580 | 3300049590 | Bacteria | 7853 |
| 755 | Ga0501076_0134081 | 3300049592 | Bacteria | 2010 |
| 756 | Ga0501080_0030063 | 3300049742 | Bacteria | 5059 |
| 757 | Ga0501080_0051132 | 3300049742 | Bacteria | 3845 |
| 758 | Ga0501080_0292515 | 3300049742 | Bacteria | 1479 |
| 759 | Ga0501080_0419534 | 3300049742 | Bacteria | 1202 |
| 760 | Ga0501083_0050328 | 3300049744 | Bacteria | 2805 |
| 761 | Ga0501035_0000279 | 3300049822 | Bacteria | 60584 |
| 762 | Ga0501035_0000283 | 3300049822 | Bacteria | 60218 |
| 763 | Ga0501035_0118462 | 3300049822 | Bacteria | 2316 |
| 764 | Ga0501044_0014060 | 3300049823 | Bacteria | 8643 |
| 765 | Ga0501044_0025961 | 3300049823 | Bacteria | 6206 |
| 766 | Ga0501044_0033281 | 3300049823 | Bacteria | 5418 |
| 767 | Ga0501044_0058985 | 3300049823 | Bacteria | 3933 |
| 768 | Ga0501045_0033694 | 3300049824 | Bacteria | 3714 |
| 769 | nmdc:mga03n38_646_c1 | 3300050490 | Bacteria | 8937 |
| 770 | nmdc:mga00v17_104811_c1 | 3300050491 | Bacteria | 1788 |
| 771 | nmdc:mga00v17_7932_c1 | 3300050491 | Bacteria | 5691 |
| 772 | nmdc:mga0yw44_150561_c1 | 3300050492 | Bacteria | 1517 |
| 773 | nmdc:mga0yw44_15581_c2 | 3300050492 | Bacteria | 2852 |
| 774 | nmdc:mga0yw44_164497_c1 | 3300050492 | Bacteria | 1454 |
| 775 | nmdc:mga0yw44_25619_c1 | 3300050492 | Bacteria | 3357 |
| 776 | nmdc:mga07m45_149780_c1 | 3300050496 | Bacteria | 1353 |
| 777 | nmdc:mga07m45_21681_c1 | 3300050496 | Bacteria | 3500 |
| 778 | nmdc:mga07m45_40685_c2 | 3300050496 | Bacteria | 2002 |
| 779 | nmdc:mga07m45_45751_c1 | 3300050496 | Bacteria | 2457 |
| 780 | nmdc:mga05p37_119852_c1 | 3300050507 | Bacteria | 3233 |
| 781 | nmdc:mga08y16_227788_c1 | 3300050511 | Bacteria | 1928 |
| 782 | nmdc:mga08y16_48385_c1 | 3300050511 | Bacteria | 4451 |
| 783 | nmdc:mga0a205_18056_c1 | 3300050515 | Bacteria | 6627 |
| 784 | nmdc:mga0a205_387343_c1 | 3300050515 | Bacteria | 1263 |
| 785 | nmdc:mga0sz30_12916_c1 | 3300050516 | Bacteria | 3259 |
| 786 | nmdc:mga0sz30_9222_c1 | 3300050516 | Bacteria | 3747 |
| 787 | Ga0495601_0044110 | 3300053077 | Bacteria | 2803 |
| 788 | Ga0495612_0065860 | 3300053078 | Bacteria | 1505 |
| 789 | Ga0500610_0005592 | 3300053079 | Bacteria | 5173 |
| 790 | Ga0495595_0004092 | 3300053084 | Bacteria | 5846 |
| 791 | Ga0495595_0047623 | 3300053084 | Bacteria | 1978 |
| 792 | Ga0495619_0014988 | 3300053085 | Bacteria | 4897 |
| 793 | Ga0495619_0099160 | 3300053085 | Bacteria | 1981 |
| 794 | Ga0495619_0252092 | 3300053085 | Bacteria | 1223 |
| 795 | Ga0500559_0012458 | 3300053136 | Bacteria | 3614 |
| 796 | Ga0500645_000110 | 3300053730 | Bacteria | 65408 |
| 797 | Ga0501084_0101761 | 3300054114 | Bacteria | 2413 |
| 798 | Ga0501082_0220006 | 3300060353 | Bacteria | 1652 |
| 799 | Ga0466962_0009124 | 3300061719 | Bacteria | 4751 |
| 800 | Ga0466962_0023065 | 3300061719 | Bacteria | 2992 |
| 801 | Ga0466962_0032456 | 3300061719 | Bacteria | 2500 |
| 802 | Ga0466962_0112470 | 3300061719 | Bacteria | 1311 |
| 803 | 2501942479 | 2501939600 | Bacteria | 6907073 |
| 804 | 2623498098 | 2622736605 | Bacteria | 4992138 |
| 805 | 2623586948 | 2622736626 | Bacteria | 7181580 |
| 806 | 2643826692 | 2643221561 | Bacteria | 4984412 |
| 807 | 2644084587 | 2643221613 | Bacteria | 4622396 |
| 808 | 2644092915 | 2643221615 | Bacteria | 5487866 |
| 809 | 2644322528 | 2643221657 | Bacteria | 5490246 |
| 810 | 2644446796 | 2643221679 | Bacteria | 3839507 |
| 811 | 2644489585 | 2643221687 | Bacteria | 6500351 |
| 812 | 2644534049 | 2643221696 | Bacteria | 5431823 |
| 813 | 2738707049 | 2738541274 | Bacteria | 6909446 |
| 814 | 2739333520 | 2738543028 | Bacteria | 6917070 |
| 815 | 2739365421 | 2738543034 | Bacteria | 6084756 |
| 816 | 2740165774 | 2739367898 | Bacteria | 4367674 |
| 817 | 2772642282 | 2772190715 | Bacteria | 6959372 |
| 818 | 2831937565 | 2831935698 | Bacteria | 5963223 |
| 819 | 2832009547 | 2832004796 | Bacteria | 6538017 |
| 820 | 2835188291 | 2835188231 | Bacteria | 3476928 |
| 821 | 2835188948 | 2835188231 | Bacteria | 3476928 |
| 822 | 2842137118 | 2842134933 | Bacteria | 5847019 |
| 823 | 2855388784 | 2855386786 | Bacteria | 4752232 |
| 824 | 2855671344 | 2855670206 | Bacteria | 7120389 |
| 825 | 2855678526 | 2855676851 | Bacteria | 7063653 |
| 826 | 2855685877 | 2855683550 | Bacteria | 7134265 |
| 827 | 2856860787 | 2856858025 | Bacteria | 7255264 |
| 828 | 2857292041 | 2857288857 | Bacteria | 7189066 |
| 829 | 2857485023 | 2857481737 | Bacteria | 4761446 |
| 830 | 2858850828 | 2858848962 | Bacteria | 6963058 |
| 831 | 2858869831 | 2858868258 | Bacteria | 7683772 |
| 832 | 2858883799 | 2858882152 | Bacteria | 7230291 |
| 833 | 2858890047 | 2858888857 | Bacteria | 7060307 |
| 834 | 2858900982 | 2858895516 | Bacteria | 7378898 |
| 835 | 2858903529 | 2858902515 | Bacteria | 7086037 |
| 836 | 2866067656 | 2866065130 | Bacteria | 6518152 |
| 837 | 2867306467 | 2867302475 | Bacteria | 7087181 |
| 838 | 2867315911 | 2867312974 | Bacteria | 7058875 |
| 839 | 2867323622 | 2867319477 | Bacteria | 7069771 |
| 840 | 2867510250 | 2867507094 | Bacteria | 6506033 |
| 841 | 2869051060 | 2869048445 | Bacteria | 6875584 |
| 842 | 2869062500 | 2869061728 | Bacteria | 7112407 |
| 843 | 2869070872 | 2869068681 | Bacteria | 7205615 |
| 844 | 2880493338 | 2880489317 | Bacteria | 7096270 |
| 845 | 2880498961 | 2880495981 | Bacteria | 7340502 |
| 846 | 2884997595 | 2884994152 | Bacteria | 4492978 |
| 847 | 2902802136 | 2902799365 | Bacteria | 5419524 |
| 848 | 2902842368 | 2902837492 | Bacteria | 6697721 |
| 849 | 2904767971 | 2904765812 | Bacteria | 5369154 |
| 850 | 2904774257 | 2904770941 | Bacteria | 5580202 |
| 851 | 2908815274 | 2908811453 | Bacteria | 5478616 |
| 852 | 2919423599 | 2919420072 | Bacteria | 5390363 |
| 853 | 2919436207 | 2919432681 | Bacteria | 5390474 |
| 854 | 2929220980 | 2929219909 | Bacteria | 6984360 |
| 855 | 2929227552 | 2929226422 | Bacteria | 7248583 |
| 856 | 2935891213 | 2935890801 | Bacteria | 4593001 |
| 857 | 2964328318 | 2964326757 | Bacteria | 3290868 |
| 858 | 2974315930 | 2974315732 | Bacteria | 4602776 |
| 859 | 2984524093 | 2984523437 | Bacteria | 4508481 |
| 860 | 649811520 | 649633069 | Bacteria | 6962533 |
| 861 | 8003830674 | 8003830390 | Bacteria | 6541657 |
| 862 | 8003860796 | 8003856774 | Bacteria | 7675274 |
| 863 | 8054710801 | 8054704163 | Bacteria | 7247792 |
| 864 | 8054727455 | 8054727385 | Bacteria | 7558670 |
| 865 | 8054734902 | 8054734606 | Bacteria | 6947278 |
| 866 | Ga0070660_100233175 | |||
| 867 | LJQas_1012794 | |||
| 868 | JGI24737J22298_10023902 | |||
| 869 | JGI24737J22298_10064182 | |||
| 870 | JGI24034J26672_10018556 | |||
| 871 | JGI25407J50210_10042427 | |||
| 872 | JGI25404J52841_10007807 | |||
| 873 | Ga0055540_1002731 | |||
| 874 | Ga0055540_1005641 | |||
| 875 | Ga0055540_1015867 | |||
| 876 | Ga0070676_10004509 | |||
| 877 | Ga0070683_100061774 | |||
| 878 | Ga0070683_100069891 | |||
| 879 | Ga0070677_10135226 | |||
| 880 | Ga0068869_100030664 | |||
| 881 | Ga0068869_100428163 | |||
| 882 | Ga0068869_100537444 | |||
| 883 | Ga0070666_10080049 | |||
| 884 | Ga0070682_100003688 | |||
| 885 | Ga0070682_100034472 | |||
| 886 | Ga0070682_100045094 | |||
| 887 | Ga0068868_100004228 | |||
| 888 | Ga0068868_100121690 | |||
| 889 | Ga0070660_100020722 | |||
| 890 | Ga0070660_100099066 | |||
| 891 | Ga0070689_100037795 | |||
| 892 | Ga0070687_100110128 | |||
| 893 | Ga0070661_100464171 | |||
| 894 | Ga0070692_10007517 | |||
| 895 | Ga0070692_10056860 | |||
| 896 | Ga0070692_10057139 | |||
| 897 | Ga0070668_100033960 | |||
| 898 | Ga0070668_100272711 | |||
| 899 | Ga0070675_100170404 | |||
| 900 | Ga0070674_100020383 | |||
| 901 | Ga0070674_100024762 | |||
| 902 | Ga0070674_100203454 | |||
| 903 | Ga0070688_100005969 | |||
| 904 | Ga0070659_100030523 | |||
| 905 | Ga0070667_100000027 | |||
| 906 | Ga0070667_100007912 | |||
| 907 | Ga0070667_100062997 | |||
| 908 | Ga0070703_10020296 | |||
| 909 | Ga0070709_10000135 | |||
| 910 | Ga0070709_10001866 | |||
| 911 | Ga0070709_10022860 | |||
| 912 | Ga0070714_100007368 | |||
| 913 | Ga0070714_100010928 | |||
| 914 | Ga0070714_100011917 | |||
| 915 | Ga0070714_100023939 | |||
| 916 | Ga0070714_100519979 | |||
| 917 | Ga0070713_100002948 | |||
| 918 | Ga0070713_100024429 | |||
| 919 | Ga0070713_100183929 | |||
| 920 | Ga0070713_100210192 | |||
| 921 | Ga0070710_10000710 | |||
| 922 | Ga0070710_10010043 | |||
| 923 | Ga0070710_10247548 | |||
| 924 | Ga0070701_10007237 | |||
| 925 | Ga0070711_100003575 | |||
| 926 | Ga0070711_100007335 | |||
| 927 | Ga0070711_100015298 | |||
| 928 | Ga0070711_100171597 | |||
| 929 | Ga0070705_100038707 | |||
| 930 | Ga0070705_100042692 | |||
| 931 | Ga0070700_100002404 | |||
| 932 | Ga0070700_100005243 | |||
| 933 | Ga0070700_100036181 | |||
| 934 | Ga0070700_100083450 | |||
| 935 | Ga0070700_100155637 | |||
| 936 | Ga0070694_100020269 | |||
| 937 | Ga0070663_100159018 | |||
| 938 | Ga0070663_100177317 | |||
| 939 | Ga0070678_100003571 | |||
| 940 | Ga0070678_100049258 | |||
| 941 | Ga0070662_100018266 | |||
| 942 | Ga0070662_100133759 | |||
| 943 | Ga0068867_100001469 | |||
| 944 | Ga0070706_100109516 | |||
| 945 | Ga0070679_100310176 | |||
| 946 | Ga0070679_100487733 | |||
| 947 | Ga0070684_100004622 | |||
| 948 | Ga0070684_100133069 | |||
| 949 | Ga0070684_100420527 | |||
| 950 | Ga0068853_100022280 | |||
| 951 | Ga0070672_100001159 | |||
| 952 | Ga0070672_100027373 | |||
| 953 | Ga0070686_100021257 | |||
| 954 | Ga0070686_100092564 | |||
| 955 | Ga0070686_100144948 | |||
| 956 | Ga0070695_100067985 | |||
| 957 | Ga0070696_100022383 | |||
| 958 | Ga0070693_100118629 | |||
| 959 | Ga0070665_100000566 | |||
| 960 | Ga0070665_100005584 | |||
| 961 | Ga0070665_100006130 | |||
| 962 | Ga0070704_100000126 | |||
| 963 | Ga0068855_100081382 | |||
| 964 | Ga0070664_100003142 | |||
| 965 | Ga0068857_100049899 | |||
| 966 | Ga0068854_100020208 | |||
| 967 | Ga0068854_100368183 | |||
| 968 | Ga0068854_100509062 | |||
| 969 | Ga0068856_100169546 | |||
| 970 | Ga0068856_100187901 | |||
| 971 | Ga0070702_100001763 | |||
| 972 | Ga0070702_100019013 | |||
| 973 | Ga0070702_100233362 | |||
| 974 | Ga0070702_100462911 | |||
| 975 | Ga0068852_100004825 | |||
| 976 | Ga0068852_100227965 | |||
| 977 | Ga0068852_100551566 | |||
| 978 | Ga0068859_100001466 | |||
| 979 | Ga0068859_100073907 | |||
| 980 | Ga0068866_10023190 | |||
| 981 | Ga0068866_10061208 | |||
| 982 | Ga0068866_10067927 | |||
| 983 | Ga0068861_100004568 | |||
| 984 | Ga0068861_100034935 | |||
| 985 | Ga0068861_100042597 | |||
| 986 | Ga0068861_100381332 | |||
| 987 | Ga0068861_100429438 | |||
| 988 | Ga0068870_10016817 | |||
| 989 | Ga0068863_100000463 | |||
| 990 | Ga0068863_100006631 | |||
| 991 | Ga0068863_100160140 | |||
| 992 | Ga0068863_100418099 | |||
| 993 | Ga0068858_100023617 | |||
| 994 | Ga0068858_100026870 | |||
| 995 | Ga0068858_100046922 | |||
| 996 | Ga0068858_100162952 | |||
| 997 | Ga0068860_100000141 | |||
| 998 | Ga0068860_100004584 | |||
| 999 | Ga0068860_100060872 | |||
| 1000 | Ga0068862_100000138 | |||
| 1001 | Ga0068862_100189710 | |||
| 1002 | Ga0081455_10011098 | |||
| 1003 | Ga0081455_10142172 | |||
| 1004 | Ga0081540_1000527 | |||
| 1005 | Ga0081540_1062677 | |||
| 1006 | Ga0081539_10001009 | |||
| 1007 | Ga0070717_10011333 | |||
| 1008 | Ga0070717_10062854 | |||
| 1009 | Ga0070717_10076407 | |||
| 1010 | Ga0070717_10128742 | |||
| 1011 | Ga0070717_10195411 | |||
| 1012 | Ga0075365_10002024 | |||
| 1013 | Ga0075365_10012827 | |||
| 1014 | Ga0075365_10021273 | |||
| 1015 | Ga0075365_10023288 | |||
| 1016 | Ga0075365_10042779 | |||
| 1017 | Ga0075365_10134195 | |||
| 1018 | Ga0075365_10150794 | |||
| 1019 | Ga0075363_100003255 | |||
| 1020 | Ga0075363_100011124 | |||
| 1021 | Ga0075364_10002521 | |||
| 1022 | Ga0075364_10010660 | |||
| 1023 | Ga0075364_10060850 | |||
| 1024 | Ga0075364_10075430 | |||
| 1025 | Ga0075364_10247410 | |||
| 1026 | Ga0070715_10001665 | |||
| 1027 | Ga0070716_100000586 | |||
| 1028 | Ga0070716_100013856 | |||
| 1029 | Ga0070716_100038904 | |||
| 1030 | Ga0070716_100080830 | |||
| 1031 | Ga0070716_100190597 | |||
| 1032 | Ga0070712_100001102 | |||
| 1033 | Ga0070712_100013749 | |||
| 1034 | Ga0070712_100064753 | |||
| 1035 | Ga0070712_100253925 | |||
| 1036 | Ga0070712_100503534 | |||
| 1037 | Ga0075369_10001409 | |||
| 1038 | Ga0075369_10003302 | |||
| 1039 | Ga0075369_10006006 | |||
| 1040 | Ga0097621_100139448 | |||
| 1041 | Ga0075370_10022995 | |||
| 1042 | Ga0068871_100079406 | |||
| 1043 | Ga0068871_100108794 | |||
| 1044 | Ga0068871_100652286 | |||
| 1045 | Ga0075428_100013075 | |||
| 1046 | Ga0075428_100099616 | |||
| 1047 | Ga0075428_100321842 | |||
| 1048 | Ga0075433_10002223 | |||
| 1049 | Ga0075433_10136272 | |||
| 1050 | Ga0075434_100019351 | |||
| 1051 | Ga0075434_100314954 | |||
| 1052 | Ga0075429_100205791 | |||
| 1053 | Ga0068865_100006922 | |||
| 1054 | Ga0068865_100053113 | |||
| 1055 | Ga0075436_100059575 | |||
| 1056 | Ga0097620_100001464 | |||
| 1057 | Ga0097620_100073903 | |||
| 1058 | Ga0075435_100122107 | |||
| 1059 | Ga0105250_10047541 | |||
| 1060 | Ga0105250_10090253 | |||
| 1061 | Ga0105240_10432224 | |||
| 1062 | Ga0105240_10521035 | |||
| 1063 | Ga0111539_10021223 | |||
| 1064 | Ga0111539_10250278 | |||
| 1065 | Ga0105245_10003386 | |||
| 1066 | Ga0105245_10006044 | |||
| 1067 | Ga0105245_10010406 | |||
| 1068 | Ga0105245_10123773 | |||
| 1069 | Ga0105245_10666262 | |||
| 1070 | Ga0105247_10000237 | |||
| 1071 | Ga0105247_10002143 | |||
| 1072 | Ga0114129_10312441 | |||
| 1073 | Ga0105243_10002465 | |||
| 1074 | Ga0105243_10021157 | |||
| 1075 | Ga0105243_10043828 | |||
| 1076 | Ga0105243_10068861 | |||
| 1077 | Ga0105241_10229784 | |||
| 1078 | Ga0105242_10002038 | |||
| 1079 | Ga0105242_10431694 | |||
| 1080 | Ga0105242_10502774 | |||
| 1081 | Ga0105248_10000337 | |||
| 1082 | Ga0105248_10018735 | |||
| 1083 | Ga0105248_10058498 | |||
| 1084 | Ga0105237_10094293 | |||
| 1085 | Ga0105237_10104022 | |||
| 1086 | Ga0105237_10238262 | |||
| 1087 | Ga0105238_10046372 | |||
| 1088 | Ga0105238_10212329 | |||
| 1089 | Ga0105238_10619003 | |||
| 1090 | Ga0105249_10000013 | |||
| 1091 | Ga0105249_10003606 | |||
| 1092 | Ga0105249_10025176 | |||
| 1093 | Ga0105249_10085627 | |||
| 1094 | Ga0105249_10261712 | |||
| 1095 | Ga0105249_10588974 | |||
| 1096 | Ga0105249_10799060 | |||
| 1097 | Ga0105239_10043688 | |||
| 1098 | Ga0105239_10106355 | |||
| 1099 | Ga0105239_10132670 | |||
| 1100 | Ga0157371_10088622 | |||
| 1101 | Ga0157369_10161138 | |||
| 1102 | Ga0157369_10182133 | |||
| 1103 | Ga0157374_10198395 | |||
| 1104 | Ga0157374_10276920 | |||
| 1105 | Ga0157378_10005230 | |||
| 1106 | Ga0157378_10160056 | |||
| 1107 | Ga0163162_10010461 | |||
| 1108 | Ga0163162_10030527 | |||
| 1109 | Ga0163162_10090867 | |||
| 1110 | Ga0163162_10667979 | |||
| 1111 | Ga0157372_10052599 | |||
| 1112 | Ga0157372_10059668 | |||
| 1113 | Ga0157372_10328832 | |||
| 1114 | Ga0157372_10574719 | |||
| 1115 | Ga0157375_10008041 | |||
| 1116 | Ga0157375_10011802 | |||
| 1117 | Ga0157375_10130619 | |||
| 1118 | Ga0157375_10132594 | |||
| 1119 | Ga0157375_10209838 | |||
| 1120 | Ga0157375_10965022 | |||
| 1121 | Ga0163163_10079248 | |||
| 1122 | Ga0163163_10293667 | |||
| 1123 | Ga0163163_10306464 | |||
| 1124 | Ga0157380_10006518 | |||
| 1125 | Ga0157380_10095793 | |||
| 1126 | Ga0157380_10480080 | |||
| 1127 | Ga0157379_10007978 | |||
| 1128 | Ga0157379_10099990 | |||
| 1129 | Ga0157379_10109595 | |||
| 1130 | Ga0157379_10189230 | |||
| 1131 | Ga0157376_10069685 | |||
| 1132 | Ga0157376_10789429 | |||
| 1133 | Ga0163161_10004894 | |||
| 1134 | Ga0163161_10048870 | |||
| 1135 | Ga0197907_10042006 | |||
| 1136 | Ga0206354_10834257 | |||
| 1137 | Ga0206353_11905460 | |||
| 1138 | Ga0213876_10007166 | |||
| 1139 | Ga0213876_10009726 | |||
| 1140 | Ga0213875_10001663 | |||
| 1141 | Ga0213875_10001762 | |||
| 1142 | Ga0213875_10024144 | |||
| 1143 | Ga0213875_10038157 | |||
| 1144 | Ga0224572_1005141 | |||
| 1145 | Ga0224572_1017697 | |||
| 1146 | Ga0209673_1058632 | |||
| 1147 | Ga0209051_1000122 | |||
| 1148 | Ga0209051_1001174 | |||
| 1149 | Ga0209051_1005191 | |||
| 1150 | Ga0209051_1018341 | |||
| 1151 | Ga0207696_1046704 | |||
| 1152 | Ga0207682_10074471 | |||
| 1153 | Ga0207692_10000342 | |||
| 1154 | Ga0207692_10015760 | |||
| 1155 | Ga0207642_10032568 | |||
| 1156 | Ga0207642_10159601 | |||
| 1157 | Ga0207710_10000213 | |||
| 1158 | Ga0207688_10000557 | |||
| 1159 | Ga0207688_10006136 | |||
| 1160 | Ga0207688_10030407 | |||
| 1161 | Ga0207688_10045486 | |||
| 1162 | Ga0207688_10073346 | |||
| 1163 | Ga0207688_10128129 | |||
| 1164 | Ga0207680_10147111 | |||
| 1165 | Ga0207647_10014152 | |||
| 1166 | Ga0207647_10242643 | |||
| 1167 | Ga0207685_10005941 | |||
| 1168 | Ga0207699_10000148 | |||
| 1169 | Ga0207645_10005261 | |||
| 1170 | Ga0207643_10024032 | |||
| 1171 | Ga0207705_10024663 | |||
| 1172 | Ga0207705_10107565 | |||
| 1173 | Ga0207705_10128876 | |||
| 1174 | Ga0207695_10330723 | |||
| 1175 | Ga0207695_10397227 | |||
| 1176 | Ga0207671_10020382 | |||
| 1177 | Ga0207693_10000346 | |||
| 1178 | Ga0207693_10002049 | |||
| 1179 | Ga0207693_10002834 | |||
| 1180 | Ga0207663_10026950 | |||
| 1181 | Ga0207662_10016725 | |||
| 1182 | Ga0207657_10045057 | |||
| 1183 | Ga0207657_10185679 | |||
| 1184 | Ga0207657_10239631 | |||
| 1185 | Ga0207652_10324752 | |||
| 1186 | Ga0207681_10000866 | |||
| 1187 | Ga0207694_10146974 | |||
| 1188 | Ga0207687_10005646 | |||
| 1189 | Ga0207687_10070720 | |||
| 1190 | Ga0207687_10328132 | |||
| 1191 | Ga0207700_10000793 | |||
| 1192 | Ga0207700_10009110 | |||
| 1193 | Ga0207700_10009744 | |||
| 1194 | Ga0207700_10013499 | |||
| 1195 | Ga0207664_10000246 | |||
| 1196 | Ga0207664_10014178 | |||
| 1197 | Ga0207664_10024853 | |||
| 1198 | Ga0207664_10049854 | |||
| 1199 | Ga0207664_10111164 | |||
| 1200 | Ga0207644_10045948 | |||
| 1201 | Ga0207690_10239467 | |||
| 1202 | Ga0207706_10000901 | |||
| 1203 | Ga0207706_10006711 | |||
| 1204 | Ga0207706_10140154 | |||
| 1205 | Ga0207686_10045316 | |||
| 1206 | Ga0207709_10003330 | |||
| 1207 | Ga0207709_10009011 | |||
| 1208 | Ga0207709_10018611 | |||
| 1209 | Ga0207670_10052640 | |||
| 1210 | Ga0207670_10135992 | |||
| 1211 | Ga0207669_10015908 | |||
| 1212 | Ga0207669_10228931 | |||
| 1213 | Ga0207704_10007329 | |||
| 1214 | Ga0207704_10127996 | |||
| 1215 | Ga0207665_10000711 | |||
| 1216 | Ga0207665_10001580 | |||
| 1217 | Ga0207665_10006217 | |||
| 1218 | Ga0207691_10002487 | |||
| 1219 | Ga0207711_10000753 | |||
| 1220 | Ga0207711_10079574 | |||
| 1221 | Ga0207689_10055193 | |||
| 1222 | Ga0207689_10407627 | |||
| 1223 | Ga0207661_10334085 | |||
| 1224 | Ga0207679_10001569 | |||
| 1225 | Ga0207667_10089236 | |||
| 1226 | Ga0207667_10715850 | |||
| 1227 | Ga0207712_10000018 | |||
| 1228 | Ga0207712_10036981 | |||
| 1229 | Ga0207668_10000770 | |||
| 1230 | Ga0207668_10060146 | |||
| 1231 | Ga0207668_10068292 | |||
| 1232 | Ga0207668_10084590 | |||
| 1233 | Ga0207668_10107638 | |||
| 1234 | Ga0207640_10013064 | |||
| 1235 | Ga0207640_10052058 | |||
| 1236 | Ga0207640_10424436 | |||
| 1237 | Ga0207658_10000788 | |||
| 1238 | Ga0207658_10006407 | |||
| 1239 | Ga0207658_10057023 | |||
| 1240 | Ga0207658_10070692 | |||
| 1241 | Ga0207703_10039576 | |||
| 1242 | Ga0207703_10066149 | |||
| 1243 | Ga0207703_10097545 | |||
| 1244 | Ga0207639_10027732 | |||
| 1245 | Ga0207639_10082466 | |||
| 1246 | Ga0207639_10265147 | |||
| 1247 | Ga0207678_10075534 | |||
| 1248 | Ga0207708_10000448 | |||
| 1249 | Ga0207708_10001359 | |||
| 1250 | Ga0207708_10107496 | |||
| 1251 | Ga0207708_10139643 | |||
| 1252 | Ga0207702_10108937 | |||
| 1253 | Ga0207641_10000953 | |||
| 1254 | Ga0207641_10214209 | |||
| 1255 | Ga0207648_10000550 | |||
| 1256 | Ga0207648_10003999 | |||
| 1257 | Ga0207676_10167996 | |||
| 1258 | Ga0207676_10372557 | |||
| 1259 | Ga0207674_10061967 | |||
| 1260 | Ga0207675_100001369 | |||
| 1261 | Ga0207675_100003501 | |||
| 1262 | Ga0207675_100017246 | |||
| 1263 | Ga0207675_100062669 | |||
| 1264 | Ga0207675_100082776 | |||
| 1265 | Ga0207675_100162811 | |||
| 1266 | Ga0207675_100262685 | |||
| 1267 | Ga0207675_100547846 | |||
| 1268 | Ga0207683_10000569 | |||
| 1269 | Ga0207683_10167066 | |||
| 1270 | Ga0207698_10039000 | |||
| 1271 | Ga0207698_10202041 | |||
| 1272 | Ga0207698_10386661 | |||
| 1273 | Ga0265357_1003356 | |||
| 1274 | Ga0268266_10000596 | |||
| 1275 | Ga0268266_10004635 | |||
| 1276 | Ga0268266_10084589 | |||
| 1277 | Ga0268266_10387824 | |||
| 1278 | Ga0268265_10000159 | |||
| 1279 | Ga0268265_10012251 | |||
| 1280 | Ga0268265_10415390 | |||
| 1281 | Ga0268264_10000005 | |||
| 1282 | Ga0268264_10000249 | |||
| 1283 | Ga0268264_10302852 | |||
| 1284 | Ga0265338_10118493 | |||
| 1285 | Ga0265340_10098011 | |||
| 1286 | Ga0265327_10113557 | |||
| 1287 | Ga0307509_10077196 | |||
| 1288 | Ga0307408_100039076 | |||
| 1289 | Ga0265313_10100267 | |||
| 1290 | Ga0265314_10076871 | |||
| 1291 | Ga0316576_10012638 | |||
| 1292 | Ga0316576_10021323 | |||
| 1293 | Ga0316576_10091864 | |||
| 1294 | Ga0307516_10000690 | |||
| 1295 | Ga0307405_10016614 | |||
| 1296 | Ga0307405_10249901 | |||
| 1297 | Ga0316577_10008319 | |||
| 1298 | Ga0316577_10118271 | |||
| 1299 | Ga0307413_10106243 | |||
| 1300 | Ga0307410_10013152 | |||
| 1301 | Ga0307410_10071306 | |||
| 1302 | Ga0307410_10121908 | |||
| 1303 | Ga0307410_10130739 | |||
| 1304 | Ga0307410_10168023 | |||
| 1305 | Ga0307410_10455581 | |||
| 1306 | Ga0307407_10047079 | |||
| 1307 | Ga0307407_10083836 | |||
| 1308 | Ga0307407_10094830 | |||
| 1309 | Ga0307409_100033438 | |||
| 1310 | Ga0307409_100075186 | |||
| 1311 | Ga0307409_100161414 | |||
| 1312 | Ga0307409_100165680 | |||
| 1313 | Ga0307409_100193836 | |||
| 1314 | Ga0307409_100199854 | |||
| 1315 | Ga0307409_100254697 | |||
| 1316 | Ga0307409_100697164 | |||
| 1317 | Ga0307416_100040283 | |||
| 1318 | Ga0307416_100044453 | |||
| 1319 | Ga0307416_100176956 | |||
| 1320 | Ga0307411_10152938 | |||
| 1321 | Ga0307411_10196746 | |||
| 1322 | Ga0307415_100107877 | |||
| 1323 | Ga0307415_100204301 | |||
| 1324 | Ga0307415_100397542 | |||
| 1325 | Ga0316585_10094951 | |||
| 1326 | Ga0373934_0013610 | |||
| 1327 | Ga0373923_0000819 | |||
| 1328 | Ga0373923_0031167 | |||
| 1329 | Ga0373936_0029846 | |||
| 1330 | Ga0373939_0008509 | |||
| 1331 | Ga0373956_0016105 | |||
| 1332 | Ga0373957_0002669 | |||
| 1333 | Ga0373957_0064510 | |||
| 1334 | Ga0373946_0029573 | |||
| 1335 | Ga0373955_0042103 | |||
| 1336 | Ga0373955_0086873 | |||
| 1337 | Ga0316574_0070099 | |||
| 1338 | Ga0373924_0001912 | |||
| 1339 | Ga0373931_0008008 | |||
| 1340 | Ga0373933_0009517 | |||
| 1341 | Ga0373933_0094027 | |||
| 1342 | Ga0373947_0119643 | |||
| 1343 | Ga0373937_0697678 | |||
| 1344 | Ga0372808_000117 | |||
| 1345 | Ga0316582_0095694 | |||
| 1346 | Ga0316584_0024109 | |||
| 1347 | Ga0316584_0041308 | |||
| 1348 | Ga0373925_0008092 | |||
| 1349 | Ga0373925_0069650 | |||
| 1350 | Ga0395900_0007441 | |||
| 1351 | Ga0395900_0068195 | |||
| 1352 | Ga0395900_0133963 | |||
| 1353 | Ga0395900_0603533 | |||
| 1354 | Ga0395898_0123001 | |||
| 1355 | Ga0395898_0528836 | |||
| 1356 | Ga0395898_0576919 | |||
| 1357 | Ga0436364_0003227 | |||
| 1358 | Ga0436364_0201210 | |||
| 1359 | Ga0436364_0337262 | |||
| 1360 | Ga0436364_0348454 | |||
| 1361 | Ga0436364_0425968 | |||
| 1362 | Ga0436364_0693075 | |||
| 1363 | Ga0436364_1265507 | |||
| 1364 | Ga0395901_0009441 | |||
| 1365 | Ga0395901_0204101 | |||
| 1366 | Ga0395901_0452109 | |||
| 1367 | Ga0436365_0174550 | |||
| 1368 | Ga0436365_0576629 | |||
| 1369 | Ga0436365_0641890 | |||
| 1370 | Ga0436363_1646938 | |||
| 1371 | Ga0436362_0601122 | |||
| 1372 | Ga0439461_0000484 | |||
| 1373 | Ga0439466_0006739 | |||
| 1374 | Ga0439465_0000300 | |||
| 1375 | Ga0451835_1090130 | |||
| 1376 | Ga0451853_3221077 | |||
| 1377 | Ga0439431_0005136 | |||
| 1378 | Ga0439442_001876 | |||
| 1379 | Ga0439434_0015578 | |||
| 1380 | Ga0439460_0017904 | |||
| 1381 | Ga0439440_0005469 | |||
| 1382 | Ga0466966_0008251 | |||
| 1383 | Ga0466966_0014087 | |||
| 1384 | Ga0466963_0008588 | |||
| 1385 | Ga0466963_0010397 | |||
| 1386 | Ga0466963_0014995 | |||
| 1387 | Ga0466963_0032178 | |||
| 1388 | Ga0466963_0056016 | |||
| 1389 | Ga0466963_0200391 | |||
| 1390 | Ga0466963_0255910 | |||
| 1391 | Ga0466963_0275066 | |||
| 1392 | Ga0466963_0379756 | |||
| 1393 | Ga0466964_0018190 | |||
| 1394 | Ga0466964_0072718 | |||
| 1395 | Ga0466964_0125298 | |||
| 1396 | Ga0466971_0006420 | |||
| 1397 | Ga0466971_0031768 | |||
| 1398 | Ga0466971_0073135 | |||
| 1399 | Ga0466970_0050470 | |||
| 1400 | Ga0466957_0075664 | |||
| 1401 | Ga0466957_0123888 | |||
| 1402 | Ga0466960_0003456 | |||
| 1403 | Ga0466960_0032528 | |||
| 1404 | Ga0466960_0082639 | |||
| 1405 | Ga0451576_0149904 | |||
| 1406 | Ga0466958_0011794 | |||
| 1407 | Ga0466958_0020030 | |||
| 1408 | Ga0466958_0205292 | |||
| 1409 | Ga0466967_0000413 | |||
| 1410 | Ga0466967_0006573 | |||
| 1411 | Ga0466967_0021792 | |||
| 1412 | Ga0466967_0036958 | |||
| 1413 | Ga0466967_0078347 | |||
| 1414 | Ga0466967_0102247 | |||
| 1415 | Ga0466967_0103215 | |||
| 1416 | Ga0466967_0111687 | |||
| 1417 | Ga0466967_0120496 | |||
| 1418 | Ga0466967_0157437 | |||
| 1419 | Ga0466967_0190081 | |||
| 1420 | Ga0466967_0230675 | |||
| 1421 | Ga0466967_0257782 | |||
| 1422 | Ga0466967_0359320 | |||
| 1423 | Ga0466967_0733847 | |||
| 1424 | Ga0495592_0009192 | |||
| 1425 | Ga0495592_0022237 | |||
| 1426 | Ga0495629_0008179 | |||
| 1427 | Ga0495629_0191486 | |||
| 1428 | Ga0495641_0017837 | |||
| 1429 | Ga0495641_0209540 | |||
| 1430 | Ga0495651_0003795 | |||
| 1431 | Ga0495651_0003978 | |||
| 1432 | Ga0495651_0197370 | |||
| 1433 | Ga0495653_0010354 | |||
| 1434 | Ga0495653_0070695 | |||
| 1435 | Ga0495582_0006180 | |||
| 1436 | Ga0495639_0023898 | |||
| 1437 | Ga0495662_0088243 | |||
| 1438 | Ga0495664_0051583 | |||
| 1439 | Ga0495664_0106173 | |||
| 1440 | Ga0495608_0003288 | |||
| 1441 | Ga0495618_0036687 | |||
| 1442 | Ga0495618_0071785 | |||
| 1443 | Ga0495628_0011984 | |||
| 1444 | Ga0495628_0111124 | |||
| 1445 | Ga0495630_0012219 | |||
| 1446 | Ga0495652_0007754 | |||
| 1447 | Ga0495652_0052582 | |||
| 1448 | Ga0495665_0008176 | |||
| 1449 | Ga0495587_0014721 | |||
| 1450 | Ga0495645_0043783 | |||
| 1451 | Ga0495667_0001844 | |||
| 1452 | Ga0495667_0110766 | |||
| 1453 | Ga0495656_0026889 | |||
| 1454 | Ga0495634_0022563 | |||
| 1455 | Ga0495635_0073351 | |||
| 1456 | Ga0495635_0151184 | |||
| 1457 | Ga0495657_0012258 | |||
| 1458 | Ga0495657_0040679 | |||
| 1459 | Ga0495657_0162887 | |||
| 1460 | Ga0495599_0186381 | |||
| 1461 | Ga0495646_0108510 | |||
| 1462 | Ga0495647_0063558 | |||
| 1463 | Ga0495658_0021465 | |||
| 1464 | Ga0495613_0328413 | |||
| 1465 | Ga0495624_0018493 | |||
| 1466 | Ga0495600_0011368 | |||
| 1467 | Ga0495600_0039572 | |||
| 1468 | Ga0495581_0030864 | |||
| 1469 | Ga0495604_0134483 | |||
| 1470 | Ga0495604_0383917 | |||
| 1471 | Ga0495674_0012863 | |||
| 1472 | Ga0495674_0065965 | |||
| 1473 | Ga0495674_0198376 | |||
| 1474 | Ga0495674_0249676 | |||
| 1475 | Ga0495674_0459226 | |||
| 1476 | Ga0495676_0309591 | |||
| 1477 | Ga0495680_0020203 | |||
| 1478 | Ga0495680_0225679 | |||
| 1479 | Ga0495675_0004710 | |||
| 1480 | Ga0495684_0073375 | |||
| 1481 | Ga0495593_0031702 | |||
| 1482 | Ga0495602_0039054 | |||
| 1483 | Ga0495602_0081562 | |||
| 1484 | Ga0495614_0008296 | |||
| 1485 | Ga0495614_0105509 | |||
| 1486 | Ga0496100_0001064 | |||
| 1487 | Ga0496100_0006542 | |||
| 1488 | Ga0496100_0046405 | |||
| 1489 | Ga0496100_0146694 | |||
| 1490 | Ga0496100_0161341 | |||
| 1491 | Ga0496100_0169157 | |||
| 1492 | Ga0496100_0437117 | |||
| 1493 | Ga0496101_0000270 | |||
| 1494 | Ga0496101_0003856 | |||
| 1495 | Ga0496101_0006630 | |||
| 1496 | Ga0496101_0235662 | |||
| 1497 | Ga0496102_0000257 | |||
| 1498 | Ga0496102_0020959 | |||
| 1499 | Ga0496102_0043584 | |||
| 1500 | Ga0496102_0088100 | |||
| 1501 | Ga0496102_0105729 | |||
| 1502 | Ga0496102_0247755 | |||
| 1503 | Ga0496102_0257242 | |||
| 1504 | Ga0496102_0501258 | |||
| 1505 | Ga0496103_0000354 | |||
| 1506 | Ga0496103_0002147 | |||
| 1507 | Ga0496104_0011779 | |||
| 1508 | Ga0496104_0177468 | |||
| 1509 | Ga0496104_0574986 | |||
| 1510 | Ga0496105_0001698 | |||
| 1511 | Ga0496105_0143746 | |||
| 1512 | Ga0496105_0175302 | |||
| 1513 | Ga0496106_0026365 | |||
| 1514 | Ga0496106_0062872 | |||
| 1515 | Ga0496106_0092483 | |||
| 1516 | Ga0496106_0140860 | |||
| 1517 | Ga0496107_0000927 | |||
| 1518 | Ga0496107_0024867 | |||
| 1519 | Ga0496107_0101511 | |||
| 1520 | Ga0496108_0020828 | |||
| 1521 | Ga0496108_0032018 | |||
| 1522 | Ga0496108_0037578 | |||
| 1523 | Ga0496108_0047157 | |||
| 1524 | Ga0496108_0124859 | |||
| 1525 | Ga0496108_0304355 | |||
| 1526 | Ga0496108_0342993 | |||
| 1527 | Ga0496109_0004963 | |||
| 1528 | Ga0496109_0014983 | |||
| 1529 | Ga0496109_0028605 | |||
| 1530 | Ga0496109_0062929 | |||
| 1531 | Ga0496109_0083192 | |||
| 1532 | Ga0496109_0093331 | |||
| 1533 | Ga0496109_0137834 | |||
| 1534 | Ga0496109_0219649 | |||
| 1535 | Ga0496109_0252933 | |||
| 1536 | Ga0496109_0562591 | |||
| 1537 | Ga0496109_0630392 | |||
| 1538 | Ga0496109_0682668 | |||
| 1539 | Ga0496110_0023499 | |||
| 1540 | Ga0496110_0036138 | |||
| 1541 | Ga0496110_0062681 | |||
| 1542 | Ga0496110_0109693 | |||
| 1543 | Ga0496110_0216424 | |||
| 1544 | Ga0496110_0298222 | |||
| 1545 | Ga0496111_0006116 | |||
| 1546 | Ga0496111_0067016 | |||
| 1547 | Ga0496111_0201791 | |||
| 1548 | Ga0496112_0001231 | |||
| 1549 | Ga0496112_0007191 | |||
| 1550 | Ga0496112_0012590 | |||
| 1551 | Ga0496112_0275546 | |||
| 1552 | Ga0496113_0022727 | |||
| 1553 | Ga0496113_0056139 | |||
| 1554 | Ga0496113_0058370 | |||
| 1555 | Ga0496113_0104696 | |||
| 1556 | Ga0496113_0197649 | |||
| 1557 | Ga0496113_0341618 | |||
| 1558 | Ga0496113_0437350 | |||
| 1559 | Ga0496114_0003138 | |||
| 1560 | Ga0496114_0011726 | |||
| 1561 | Ga0496114_0030631 | |||
| 1562 | Ga0496114_0051583 | |||
| 1563 | Ga0496115_0001434 | |||
| 1564 | Ga0496115_0012191 | |||
| 1565 | Ga0496115_0467252 | |||
| 1566 | Ga0496117_0000390 | |||
| 1567 | Ga0496117_0042319 | |||
| 1568 | Ga0496118_0000730 | |||
| 1569 | Ga0496118_0001095 | |||
| 1570 | Ga0496119_0000067 | |||
| 1571 | Ga0496119_0047751 | |||
| 1572 | Ga0496120_0004229 | |||
| 1573 | Ga0496120_0037503 | |||
| 1574 | Ga0496120_0096888 | |||
| 1575 | Ga0496121_0002203 | |||
| 1576 | Ga0496125_0010200 | |||
| 1577 | Ga0496125_0198844 | |||
| 1578 | Ga0496126_0008227 | |||
| 1579 | Ga0501031_0063390 | |||
| 1580 | Ga0501031_0185807 | |||
| 1581 | Ga0501031_0397211 | |||
| 1582 | Ga0501032_0006399 | |||
| 1583 | Ga0501032_0013140 | |||
| 1584 | Ga0501032_0400642 | |||
| 1585 | Ga0501033_0013121 | |||
| 1586 | Ga0501034_0001743 | |||
| 1587 | Ga0501034_0003840 | |||
| 1588 | Ga0501034_0005429 | |||
| 1589 | Ga0501034_0154320 | |||
| 1590 | Ga0501034_0362488 | |||
| 1591 | Ga0501036_0029370 | |||
| 1592 | Ga0501036_0054358 | |||
| 1593 | Ga0501037_0018584 | |||
| 1594 | Ga0501038_0057814 | |||
| 1595 | Ga0501038_0344822 | |||
| 1596 | Ga0501039_0017004 | |||
| 1597 | Ga0501039_0250489 | |||
| 1598 | Ga0501039_0286692 | |||
| 1599 | Ga0501041_0166236 | |||
| 1600 | Ga0501043_0005380 | |||
| 1601 | Ga0501043_0014911 | |||
| 1602 | Ga0501046_0000382 | |||
| 1603 | Ga0501047_0000405 | |||
| 1604 | Ga0501047_0018051 | |||
| 1605 | Ga0501047_0021914 | |||
| 1606 | Ga0501047_0033122 | |||
| 1607 | Ga0501048_0001972 | |||
| 1608 | Ga0501048_0015494 | |||
| 1609 | Ga0501068_0196515 | |||
| 1610 | Ga0501069_0016908 | |||
| 1611 | Ga0501069_0031764 | |||
| 1612 | Ga0501070_0001555 | |||
| 1613 | Ga0501070_0011557 | |||
| 1614 | Ga0501070_0033073 | |||
| 1615 | Ga0501070_0066052 | |||
| 1616 | Ga0501070_0479492 | |||
| 1617 | Ga0501071_0122290 | |||
| 1618 | Ga0501073_0140900 | |||
| 1619 | Ga0501074_0007580 | |||
| 1620 | Ga0501076_0134081 | |||
| 1621 | Ga0501080_0030063 | |||
| 1622 | Ga0501080_0051132 | |||
| 1623 | Ga0501080_0292515 | |||
| 1624 | Ga0501080_0419534 | |||
| 1625 | Ga0501083_0050328 | |||
| 1626 | Ga0501035_0000279 | |||
| 1627 | Ga0501035_0000283 | |||
| 1628 | Ga0501035_0118462 | |||
| 1629 | Ga0501044_0014060 | |||
| 1630 | Ga0501044_0025961 | |||
| 1631 | Ga0501044_0033281 | |||
| 1632 | Ga0501044_0058985 | |||
| 1633 | Ga0501045_0033694 | |||
| 1634 | nmdc:mga03n38_646_c1 | |||
| 1635 | nmdc:mga00v17_104811_c1 | |||
| 1636 | nmdc:mga00v17_7932_c1 | |||
| 1637 | nmdc:mga0yw44_150561_c1 | |||
| 1638 | nmdc:mga0yw44_15581_c2 | |||
| 1639 | nmdc:mga0yw44_164497_c1 | |||
| 1640 | nmdc:mga0yw44_25619_c1 | |||
| 1641 | nmdc:mga07m45_149780_c1 | |||
| 1642 | nmdc:mga07m45_21681_c1 | |||
| 1643 | nmdc:mga07m45_40685_c2 | |||
| 1644 | nmdc:mga07m45_45751_c1 | |||
| 1645 | nmdc:mga05p37_119852_c1 | |||
| 1646 | nmdc:mga08y16_227788_c1 | |||
| 1647 | nmdc:mga08y16_48385_c1 | |||
| 1648 | nmdc:mga0a205_18056_c1 | |||
| 1649 | nmdc:mga0a205_387343_c1 | |||
| 1650 | nmdc:mga0sz30_12916_c1 | |||
| 1651 | nmdc:mga0sz30_9222_c1 | |||
| 1652 | Ga0495601_0044110 | |||
| 1653 | Ga0495612_0065860 | |||
| 1654 | Ga0500610_0005592 | |||
| 1655 | Ga0495595_0004092 | |||
| 1656 | Ga0495595_0047623 | |||
| 1657 | Ga0495619_0014988 | |||
| 1658 | Ga0495619_0099160 | |||
| 1659 | Ga0495619_0252092 | |||
| 1660 | Ga0500559_0012458 | |||
| 1661 | Ga0500645_000110 | |||
| 1662 | Ga0501084_0101761 | |||
| 1663 | Ga0501082_0220006 | |||
| 1664 | Ga0466962_0009124 | |||
| 1665 | Ga0466962_0023065 | |||
| 1666 | Ga0466962_0032456 | |||
| 1667 | Ga0466962_0112470 | |||
| 1668 | 2501942479 | |||
| 1669 | 2623498098 | |||
| 1670 | 2623586948 | |||
| 1671 | 2643826692 | |||
| 1672 | 2644084587 | |||
| 1673 | 2644092915 | |||
| 1674 | 2644322528 | |||
| 1675 | 2644446796 | |||
| 1676 | 2644489585 | |||
| 1677 | 2644534049 | |||
| 1678 | 2738707049 | |||
| 1679 | 2739333520 | |||
| 1680 | 2739365421 | |||
| 1681 | 2740165774 | |||
| 1682 | 2772642282 | |||
| 1683 | 2831937565 | |||
| 1684 | 2832009547 | |||
| 1685 | 2835188291 | |||
| 1686 | 2835188948 | |||
| 1687 | 2842137118 | |||
| 1688 | 2855388784 | |||
| 1689 | 2855671344 | |||
| 1690 | 2855678526 | |||
| 1691 | 2855685877 | |||
| 1692 | 2856860787 | |||
| 1693 | 2857292041 | |||
| 1694 | 2857485023 | |||
| 1695 | 2858850828 | |||
| 1696 | 2858869831 | |||
| 1697 | 2858883799 | |||
| 1698 | 2858890047 | |||
| 1699 | 2858900982 | |||
| 1700 | 2858903529 | |||
| 1701 | 2866067656 | |||
| 1702 | 2867306467 | |||
| 1703 | 2867315911 | |||
| 1704 | 2867323622 | |||
| 1705 | 2867510250 | |||
| 1706 | 2869051060 | |||
| 1707 | 2869062500 | |||
| 1708 | 2869070872 | |||
| 1709 | 2880493338 | |||
| 1710 | 2880498961 | |||
| 1711 | 2884997595 | |||
| 1712 | 2902802136 | |||
| 1713 | 2902842368 | |||
| 1714 | 2904767971 | |||
| 1715 | 2904774257 | |||
| 1716 | 2908815274 | |||
| 1717 | 2919423599 | |||
| 1718 | 2919436207 | |||
| 1719 | 2929220980 | |||
| 1720 | 2929227552 | |||
| 1721 | 2935891213 | |||
| 1722 | 2964328318 | |||
| 1723 | 2974315930 | |||
| 1724 | 2984524093 | |||
| 1725 | 649811520 | |||
| 1726 | 8003830674 | |||
| 1727 | 8003860796 | |||
| 1728 | 8054710801 | |||
| 1729 | 8054727455 | |||
| 1730 | 8054734902 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4otk-assembly1.cif.gz_A | a structural characterization of the isoniazid mycobacterium tuberculosis drug target, rv2971, in its unliganded form | 0.9827 | 4 | 273 |
| 1a80-assembly1.cif.gz_A | native 2,5-diketo-d-gluconic acid reductase a from corynbacterium sp. complexed with nadph | 0.981 | 3 | 273 |
| 4g5d-assembly2.cif.gz_B | x-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to nadph | 0.9782 | 6 | 275 |
| 2wzt-assembly1.cif.gz_B | crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form | 0.9782 | 4 | 260 |
| 2wzm-assembly2.cif.gz_B | crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form | 0.9781 | 3 | 273 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G2T8_4_275_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9823 | 5 | 273 | 3.20.20.100 |
| 2wzmB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9781 | 3 | 273 | 3.20.20.100 |
| af_Q2FXE2_1_275_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9744 | 5 | 273 | 3.20.20.100 |
| af_A0A0R0I9K3_1_172_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.971 | 126 | 264 | 3.20.20.100 |
| af_Q9VTL0_1_322_3.20.20.100 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain | 0.9699 | 4 | 265 | 3.20.20.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L7GLA0-F1-model_v4 | Aldo/keto reductase | 0.9982 | 3 | 277 |
GO:0004033
GO:0044281 |
| AF-A0A0Q5AG91-F1-model_v4 | Oxidoreductase | 0.9977 | 3 | 278 |
GO:0004033
GO:0044281 |
| AF-A0A1A0L6V3-F1-model_v4 | Oxidoreductase | 0.9975 | 3 | 277 |
GO:0004033
GO:0044281 |
| AF-A0A4R1ARH3-F1-model_v4 | Aldo/keto reductase | 0.9973 | 3 | 277 |
GO:0004033
GO:0044281 |
| AF-A0A1H8U9L1-F1-model_v4 | 2,5-diketo-D-gluconate reductase A | 0.9972 | 1 | 278 |
GO:0004033
GO:0044281 |