F483980

General Info

Members Datasets Scaffolds Average Seq Length
865 696 313 350

Family's Representative Sequence

Representative Sequence 3300002773|JGI25152J39213_1009871|JGI25152J39213_10098713
Length 355
Sequence MSRAALRPAFTRWDMSMITCHLRYVIDPYKLAEFEEYAQSGCGKTTVLRMIAGFETPTGGTLTINGKDQSALKPNQRNIGMVFQAYALFPNMTVHDNVAFGLKVAAAPKPEIDARVKEMLGLIKLDHLADRFPYQLSGGQQQRVALARALAVKPQVLLLDEPLSALDAKIRVSLREEIRQIQQQLGITTVFVTHDQEEALSISDRIVVMNAGKADQIGSPFEIYNTPATRFVASFVGTLNLIEAKVIDPGANRIQIGDQGVTLKQSVAAHKAGETISLALRPEAGSLSDNVKSDTALTGQVVSAHFLGSVIRTRMNVGGNVISFDMFNSPGITPPQAGETVTLRFMAADLLIIRD

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
14 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
15 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
16 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
17 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
18 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
19 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
20 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
21 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
22 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
23 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
24 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
25 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
26 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
27 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
28 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
29 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
30 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
31 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
32 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
33 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
34 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
35 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
36 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
37 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
38 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
39 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
40 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
41 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
42 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
43 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
44 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
45 2519899620 Rhizobium sp. Pop5 Isolate Nodule
46 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
47 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
48 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
49 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
50 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
51 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
52 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
53 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
54 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
55 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
56 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
61 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
62 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
63 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
64 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
65 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
66 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
67 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
68 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
69 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
70 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
71 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
72 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
73 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
74 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
78 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
79 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
80 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
81 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
82 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
83 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
84 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
85 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
86 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
87 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
88 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
89 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
90 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
91 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
92 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
93 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
94 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
95 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
96 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
97 2643221557 Ensifer sp. Root558 Isolate Unclassified
98 2643221558 Rhizobium sp. Root149 Isolate Unclassified
99 2643221568 Rhizobium sp. Root564 Isolate Unclassified
100 2643221582 Rhizobium sp. Root651 Isolate Unclassified
101 2643221599 Rhizobium sp. Root708 Isolate Unclassified
102 2643221607 Rhizobium sp. Root73 Isolate Unclassified
103 2643221610 Ensifer sp. Root74 Isolate Unclassified
104 2643221618 Ensifer sp. Root231 Isolate Unclassified
105 2643221626 Ensifer sp. Root31 Isolate Unclassified
106 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
107 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
108 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
109 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
110 2643221655 Ensifer sp. Root1252 Isolate Unclassified
111 2643221659 Ensifer sp. Root127 Isolate Unclassified
112 2643221668 Ensifer sp. Root423 Isolate Unclassified
113 2643221675 Ensifer sp. Root1298 Isolate Unclassified
114 2643221680 Ensifer sp. Root1312 Isolate Unclassified
115 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
116 2643221688 Rhizobium sp. Root482 Isolate Unclassified
117 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
118 2643221693 Rhizobium sp. Root491 Isolate Unclassified
119 2643221698 Ensifer sp. Root142 Isolate Unclassified
120 2643221712 Ensifer sp. Root258 Isolate Unclassified
121 2643221719 Rhizobium sp. Root274 Isolate Unclassified
122 2643221723 Ensifer sp. Root278 Isolate Unclassified
123 2643221726 Ensifer sp. Root954 Isolate Unclassified
124 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
125 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
126 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
127 2718217882 Rhizobium sp. N741 Isolate Nodule
128 2718217927 Rhizobium sp. N324 Isolate Nodule
129 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
130 2718218009 Rhizobium sp. N561 Isolate Nodule
131 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
132 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
133 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
134 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
135 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
136 2718218363 Rhizobium sp. N113 Isolate Nodule
137 2718218365 Rhizobium sp. N731 Isolate Nodule
138 2718218366 Rhizobium sp. N621 Isolate Nodule
139 2718218423 Rhizobium sp. N941 Isolate Nodule
140 2721755514 Rhizobium sp. N6212 Isolate Nodule
141 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
142 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
143 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
144 2721755809 Rhizobium sp. N541 Isolate Nodule
145 2721755810 Rhizobium sp. N871 Isolate Nodule
146 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
147 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
148 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
149 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
150 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
151 2728369365 Rhizobium sp. N1341 Isolate Nodule
152 2728369397 Rhizobium sp. N1314 Isolate Nodule
153 2738541293 Rhizobium sp. GV031 Isolate Unclassified
154 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
155 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
156 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
157 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
158 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
159 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
160 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
161 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
162 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
163 2791355256 Rhizobium sp. M10 Isolate Nodule
164 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
165 2791355260 Rhizobium sp. L9 Isolate Nodule
166 2791355261 Rhizobium sp. J15 Isolate Nodule
167 2791355262 Rhizobium sp. M1 Isolate Nodule
168 2791355263 Rhizobium chutanense C5 Isolate Nodule
169 2791355264 Rhizobium sp. S9 Isolate Nodule
170 2791355265 Rhizobium sp. H4 Isolate Nodule
171 2791355266 Rhizobium sp. L43 Isolate Nodule
172 2791355267 Rhizobium sp. L18 Isolate Nodule
173 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
174 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
175 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
176 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
177 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
178 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
179 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
180 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
181 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
182 2802429633 Rhizobium anhuiense J3 Isolate Nodule
183 2802429634 Rhizobium anhuiense S10 Isolate Nodule
184 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
185 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
186 2802429637 Rhizobium anhuiense C15 Isolate Nodule
187 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
188 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
189 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
190 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
191 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
192 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
193 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
194 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
195 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
196 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
197 2838048938 Rhizobium pisi 27/80 Isolate Nodule
198 2838061910 Rhizobium phaseoli L15 Isolate Nodule
199 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
200 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
201 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
202 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
203 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
204 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
205 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
206 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
207 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
208 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
209 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
210 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
211 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
212 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
213 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
214 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
215 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
216 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
217 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
218 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
219 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
220 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
221 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
222 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
223 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
224 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
225 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
226 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
227 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
228 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
229 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
230 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
231 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
232 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
233 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
234 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
235 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
236 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
237 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
238 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
239 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
240 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
241 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
242 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
243 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
244 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
245 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
246 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
247 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
248 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
249 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
250 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
251 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
252 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
253 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
254 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
255 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
256 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
257 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
258 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
259 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
260 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
261 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
262 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
263 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
264 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
265 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
266 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
267 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
268 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
269 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
270 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
271 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
272 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
273 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
274 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
275 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
276 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
277 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
278 2844163670 Ensifer sp. 1H6 Isolate Unclassified
279 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
280 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
281 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
282 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
283 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
284 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
285 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
286 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
287 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
288 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
289 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
290 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
291 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
292 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
293 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
294 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
295 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
296 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
297 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
298 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
299 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
300 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
301 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
302 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
303 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
304 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
305 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
306 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
307 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
308 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
309 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
310 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
311 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
312 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
313 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
314 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
315 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
316 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
317 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
318 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
319 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
320 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
321 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
322 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
323 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
324 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
325 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
326 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
327 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
328 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
329 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
330 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
331 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
332 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
333 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
334 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
335 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
336 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
337 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
338 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
339 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
340 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
341 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
342 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
343 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
344 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
345 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
346 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
347 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
348 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
349 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
350 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
351 2933599457 Rhizobium phaseoli M3 Isolate Nodule
352 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
353 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
354 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
355 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
356 2936381700 Rhizobium chutanense C16 Isolate Unclassified
357 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
358 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
359 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
360 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
361 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
362 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
363 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
364 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
365 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
366 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
367 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
368 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
369 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
370 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
371 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
372 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
373 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
374 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
375 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
376 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
377 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
378 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
379 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
380 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
381 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
382 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
383 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
384 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
385 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
386 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
387 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
388 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
389 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
390 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
391 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
392 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
393 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
394 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
395 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
396 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
397 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
398 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
399 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
400 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
401 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
402 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
403 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
404 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
405 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
406 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
407 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
408 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
409 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
410 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
411 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
412 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
413 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
414 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
415 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
416 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
417 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
418 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
419 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
420 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
421 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
422 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
423 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
424 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
425 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
426 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
427 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
428 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
429 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
430 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
431 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
432 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
433 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
434 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
435 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
436 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
437 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
438 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
439 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
440 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
441 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
442 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
443 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
444 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
445 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
446 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
447 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
448 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
449 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
450 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
451 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
452 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
453 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
454 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
455 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
456 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
457 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
458 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
459 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
460 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
461 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
462 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
463 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
464 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
465 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
466 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
467 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
468 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
469 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
470 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
471 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
472 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
473 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
474 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
475 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
476 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
477 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
478 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
479 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
480 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
481 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
482 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
483 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
484 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
485 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
486 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
487 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
488 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
489 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
490 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
491 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
492 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
493 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
494 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
495 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
496 2996887358 Rhizobium sp. R711 Isolate Nodule
497 2996893221 Rhizobium sp. R635 Isolate Nodule
498 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
499 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
500 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
501 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
502 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
503 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
504 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
505 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
506 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
507 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
508 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
509 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
510 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
511 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
512 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
513 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
514 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
515 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
516 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
517 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
518 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
519 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
520 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
521 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
522 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
523 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
524 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
525 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
526 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
527 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
528 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
529 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
530 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
531 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
532 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
533 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
534 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
535 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
536 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
537 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
538 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
539 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
540 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
541 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
542 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
543 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
544 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
545 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
546 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
547 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
548 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
549 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
550 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
551 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
552 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
553 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
554 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
555 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
556 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
557 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
558 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
559 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
560 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
561 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
562 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
563 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
564 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
565 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
566 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
567 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
568 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
569 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
570 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
571 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
572 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
573 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
574 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
575 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
576 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
577 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
578 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
579 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
580 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
581 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
582 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
583 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
584 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
585 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
586 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
587 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
588 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
589 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
590 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
591 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
592 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
593 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
594 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
595 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
596 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
597 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
598 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
599 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
600 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
601 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
602 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
603 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
604 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
605 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
606 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
607 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
608 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
609 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
610 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
611 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
612 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
613 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
614 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
615 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
616 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
617 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
618 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
619 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
620 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
621 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
622 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
623 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
624 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
625 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
626 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
627 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
628 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
630 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
631 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
632 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
633 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
634 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
635 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
636 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
637 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
638 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
639 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
640 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
641 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
642 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
643 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
644 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
645 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
646 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
647 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
648 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
649 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
650 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
651 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
652 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
653 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
654 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
655 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
656 8005258706 Rhizobium sp. R693 Isolate Nodule
657 8005275841 Rhizobium sp. N4311 Isolate Nodule
658 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
659 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
660 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
661 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
662 8005321885 Rhizobium sp. R72 Isolate Nodule
663 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
664 8005382845 Rhizobium sp. R634 Isolate Nodule
665 8005395548 Rhizobium sp. R339 Isolate Nodule
666 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
667 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
668 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
669 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
670 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
671 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
672 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
673 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
674 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
675 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
676 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
677 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
678 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
679 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
680 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
681 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
682 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
683 8018176218 Rhizobium sp. N122 Isolate Nodule
684 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
685 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
686 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
687 8024501048 Rhizobium sp. H4 Isolate Nodule
688 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
689 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
690 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
691 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
692 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
693 8056382006 Rhizobium croatiense 13T Isolate Nodule
694 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
695 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
696 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 36.18
Metatranscriptomes 0
Isolates 63.82

Biome Distribution

Category Percentage (%)
Aerial Root 0.58
Bulb 0
Endosphere 17.8
Nodule 50.29
Rhizoplane 1.39
Rhizosphere 13.06
Stem 0
Stem Tuber 0
Unclassified 16.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000143 3300002737 Bacteria 77302
2 JGI25152J39213_1000982 3300002773 Bacteria 13855
3 JGI25152J39213_1007180 3300002773 Bacteria 2917
4 JGI25152J39213_1009871 3300002773 Bacteria 2228
5 JGI25150J39212_1000074 3300002774 Bacteria 60735
6 JGI25159J45721_1000014 3300002987 Bacteria 147809
7 JGI25159J45721_1000411 3300002987 Bacteria 19832
8 JGI25151J46595_10000414 3300003187 Bacteria 43361
9 JGI25151J46595_10000492 3300003187 Bacteria 37383
10 JGI25151J46595_10011793 3300003187 Bacteria 4004
11 JGI25151J46595_10018861 3300003187 Bacteria 2947
12 JGI25151J46595_10019895 3300003187 Bacteria 2839
13 JGI25165J46597_1000356 3300003214 Bacteria 51368
14 JGI25153J46596_10001781 3300003215 Bacteria 12771
15 JGI25153J46596_10004667 3300003215 Bacteria 7324
16 JGI25153J46596_10005619 3300003215 Bacteria 6554
17 JGI25160J50197_1000001 3300003354 Bacteria 782301
18 JGI25160J50197_1000020 3300003354 Bacteria 232739
19 JGI25160J50197_1000695 3300003354 Bacteria 18566
20 JGI25161J50226_1000001 3300003374 Bacteria 655036
21 JGI25161J50226_1001048 3300003374 Bacteria 9473
22 JGI25161J50226_1001061 3300003374 Bacteria 9408
23 Ga0055526_1004520 3300003771 Bacteria 8325
24 Ga0055526_1005394 3300003771 Bacteria 7360
25 Ga0055526_1013390 3300003771 Bacteria 3475
26 Ga0055524_1001901 3300003775 Bacteria 11334
27 Ga0055524_1001996 3300003775 Bacteria 10898
28 Ga0055524_1002315 3300003775 Bacteria 9918
29 Ga0055524_1003899 3300003775 Bacteria 7071
30 Ga0055524_1013498 3300003775 Bacteria 3077
31 Ga0055524_1024028 3300003775 Bacteria 1946
32 Ga0055536_1004884 3300003781 Bacteria 6693
33 Ga0055528_1000234 3300003790 Bacteria 46499
34 Ga0055528_1004593 3300003790 Bacteria 6613
35 Ga0055528_1007746 3300003790 Bacteria 4701
36 Ga0055528_1010076 3300003790 Bacteria 3880
37 Ga0055528_1017220 3300003790 Bacteria 2515
38 Ga0055540_1000350 3300003792 Bacteria 39199
39 Ga0055540_1008122 3300003792 Bacteria 3825
40 Ga0055531_10007729 3300003794 Bacteria 5804
41 Ga0055543_1000003 3300004625 Bacteria 358656
42 Ga0055543_1000352 3300004625 Bacteria 31251
43 Ga0055543_1000660 3300004625 Bacteria 18202
44 Ga0055543_1000768 3300004625 Bacteria 15975
45 Ga0065165_1000013 3300005262 Bacteria 301887
46 Ga0065165_1000068 3300005262 Bacteria 170609
47 Ga0065165_1004654 3300005262 Bacteria 8309
48 Ga0065165_1008320 3300005262 Bacteria 4882
49 Ga0065165_1015514 3300005262 Bacteria 2899
50 Ga0065165_1021513 3300005262 Bacteria 2239
51 Ga0070665_100002086 3300005548 Bacteria 22429
52 Ga0070665_100075747 3300005548 Bacteria 3372
53 Ga0068855_100046761 3300005563 Bacteria 5114
54 Ga0068854_100170807 3300005578 Bacteria 1692
55 Ga0075365_10001211 3300006038 Bacteria 11405
56 Ga0075365_10003006 3300006038 Bacteria 8545
57 Ga0075368_10002107 3300006042 Bacteria 6423
58 Ga0075363_100020559 3300006048 Bacteria 3312
59 Ga0075363_100041304 3300006048 Bacteria 2432
60 Ga0075362_10000283 3300006177 Bacteria 14286
61 Ga0075367_10001444 3300006178 Bacteria 10222
62 Ga0075367_10002037 3300006178 Bacteria 9045
63 Ga0075369_10002302 3300006186 Bacteria 6790
64 Ga0075370_10002369 3300006353 Bacteria 8721
65 Ga0079104_1000045 3300006946 Bacteria 183705
66 Ga0079104_1002855 3300006946 Bacteria 8654
67 Ga0079104_1004289 3300006946 Bacteria 6184
68 Ga0099826_10001200 3300006948 Bacteria 15051
69 Ga0105251_10052275 3300009011 Bacteria 1945
70 Ga0105243_10008058 3300009148 Bacteria 8089
71 Ga0123341_1000007 3300009765 Bacteria 147072
72 Ga0123342_1014140 3300009766 Bacteria 7726
73 Ga0157373_10053402 3300013100 Bacteria 2873
74 Ga0157371_10000017 3300013102 Bacteria 320830
75 Ga0157370_10000494 3300013104 Bacteria 49013
76 Ga0157369_10435551 3300013105 Bacteria 1358
77 Ga0171463_1003 3300013249 Bacteria 695693
78 Ga0157374_10416828 3300013296 Bacteria 1341
79 Ga0157378_10375241 3300013297 Bacteria 1395
80 Ga0183363_1085 3300015690 Bacteria 28396
81 Ga0214544_1003096 3300021320 Bacteria 34775
82 Ga0214542_1000012 3300021321 Bacteria 235800
83 Ga0214542_1015464 3300021321 Bacteria 7945
84 Ga0214543_1000024 3300021327 Bacteria 235745
85 Ga0214543_1000038 3300021327 Bacteria 182106
86 Ga0228711_1013581 3300022739 Bacteria 9519
87 Ga0228710_1013926 3300022740 Bacteria 9395
88 Ga0209436_100147 3300025208 Bacteria 34133
89 Ga0209436_105029 3300025208 Bacteria 3138
90 Ga0209563_104009 3300025230 Bacteria 2901
91 Ga0209437_100098 3300025233 Bacteria 229766
92 Ga0207425_1000075 3300025245 Bacteria 107452
93 Ga0207425_1000998 3300025245 Bacteria 13263
94 Ga0207425_1002674 3300025245 Bacteria 6111
95 Ga0207425_1004012 3300025245 Bacteria 4528
96 Ga0207425_1014228 3300025245 Bacteria 1812
97 Ga0209129_1000156 3300025258 Bacteria 107484
98 Ga0209129_1000218 3300025258 Bacteria 66076
99 Ga0209129_1000537 3300025258 Bacteria 26442
100 Ga0209129_1002124 3300025258 Bacteria 10080
101 Ga0209129_1003562 3300025258 Bacteria 6689
102 Ga0209129_1004888 3300025258 Bacteria 5006
103 Ga0209129_1008231 3300025258 Bacteria 2933
104 Ga0209233_1000095 3300025261 Bacteria 303783
105 Ga0209673_1000010 3300025273 Bacteria 596656
106 Ga0209673_1000117 3300025273 Bacteria 172081
107 Ga0209673_1000151 3300025273 Bacteria 148103
108 Ga0209673_1003173 3300025273 Bacteria 10014
109 Ga0209673_1003745 3300025273 Bacteria 8675
110 Ga0209673_1004460 3300025273 Bacteria 7488
111 Ga0209673_1004544 3300025273 Bacteria 7380
112 Ga0209673_1016155 3300025273 Bacteria 2803
113 Ga0209130_1000003 3300025284 Bacteria 677988
114 Ga0209130_1000020 3300025284 Bacteria 379297
115 Ga0209130_1000034 3300025284 Bacteria 302439
116 Ga0209130_1014152 3300025284 Bacteria 2014
117 Ga0209676_1004445 3300025292 Bacteria 7808
118 Ga0209676_1024683 3300025292 Bacteria 1941
119 Ga0209025_1000070 3300025294 Bacteria 287776
120 Ga0209025_1000140 3300025294 Bacteria 184765
121 Ga0209025_1000213 3300025294 Bacteria 139002
122 Ga0209025_1000311 3300025294 Bacteria 108141
123 Ga0209025_1000571 3300025294 Bacteria 66955
124 Ga0209025_1004070 3300025294 Bacteria 13061
125 Ga0209025_1005154 3300025294 Bacteria 10823
126 Ga0209025_1007774 3300025294 Bacteria 7894
127 Ga0209025_1013223 3300025294 Bacteria 5209
128 Ga0209564_1000013 3300025295 Bacteria 775755
129 Ga0209564_1000386 3300025295 Bacteria 79939
130 Ga0209564_1000424 3300025295 Bacteria 74299
131 Ga0209564_1000628 3300025295 Bacteria 53862
132 Ga0209564_1006484 3300025295 Bacteria 6297
133 Ga0209564_1010015 3300025295 Bacteria 4423
134 Ga0209758_1000094 3300025297 Bacteria 241068
135 Ga0209758_1000405 3300025297 Bacteria 73971
136 Ga0209758_1001271 3300025297 Bacteria 31244
137 Ga0209758_1004593 3300025297 Bacteria 11355
138 Ga0209758_1005305 3300025297 Bacteria 10061
139 Ga0209758_1005493 3300025297 Bacteria 9718
140 Ga0209256_1000396 3300025299 Bacteria 69216
141 Ga0209256_1000610 3300025299 Bacteria 49586
142 Ga0209256_1000717 3300025299 Bacteria 43910
143 Ga0209256_1000729 3300025299 Bacteria 43454
144 Ga0209256_1002535 3300025299 Bacteria 14621
145 Ga0209256_1004313 3300025299 Bacteria 9047
146 Ga0209256_1008506 3300025299 Bacteria 4740
147 Ga0207426_1000006 3300025302 Bacteria 1025969
148 Ga0207426_1000008 3300025302 Bacteria 848730
149 Ga0207426_1000011 3300025302 Bacteria 791203
150 Ga0207426_1000394 3300025302 Bacteria 74327
151 Ga0207426_1000449 3300025302 Bacteria 65802
152 Ga0209051_1000097 3300025303 Bacteria 167378
153 Ga0209051_1003361 3300025303 Bacteria 10534
154 Ga0209051_1005942 3300025303 Bacteria 7001
155 Ga0209051_1006793 3300025303 Bacteria 6374
156 Ga0209051_1008328 3300025303 Bacteria 5501
157 Ga0209257_1005542 3300025304 Bacteria 8796
158 Ga0209257_1006157 3300025304 Bacteria 7926
159 Ga0207681_10167166 3300025923 Bacteria 1664
160 Ga0207667_10062566 3300025949 Bacteria 3891
161 Ga0207668_10037900 3300025972 Bacteria 3231
162 Ga0207640_10164156 3300025981 Bacteria 1647
163 Ga0209281_1000034 3300027111 Bacteria 382562
164 Ga0209281_1000246 3300027111 Bacteria 107513
165 Ga0209281_1001017 3300027111 Bacteria 21872
166 Ga0209371_1000022 3300027312 Bacteria 536342
167 Ga0209371_1000173 3300027312 Bacteria 96201
168 Ga0209371_1001202 3300027312 Bacteria 18718
169 Ga0209282_1000062 3300027666 Bacteria 95390
170 Ga0209282_1000467 3300027666 Bacteria 19765
171 Ga0268266_10002745 3300028379 Bacteria 18393
172 Ga0268266_10088508 3300028379 Bacteria 2710
173 Ga0268266_10209118 3300028379 Bacteria 1789
174 Ga0307515_10009778 3300028794 Bacteria 18481
175 Ga0307515_10042115 3300028794 Bacteria 7154
176 Ga0268256_1000019 3300030500 Bacteria 587949
177 Ga0268256_1001146 3300030500 Bacteria 17130
178 Ga0307513_10044354 3300031456 Bacteria 4872
179 Ga0307408_100009284 3300031548 Bacteria 6484
180 Ga0307405_10002545 3300031731 Bacteria 8082
181 Ga0307406_10055375 3300031901 Bacteria 2535
182 Ga0307412_10002336 3300031911 Bacteria 10508
183 Ga0315914_1000015 3300031967 Bacteria 128727
184 Ga0307409_100370347 3300031995 Bacteria 1358
185 Ga0307414_10067218 3300032004 Bacteria 2566
186 Ga0315913_1000021 3300033430 Bacteria 95385
187 Ga0315915_1000020 3300033464 Bacteria 128727
188 Ga0439436_0001599 3300041404 Bacteria 6597
189 Ga0439465_0009631 3300041413 Bacteria 3043
190 Ga0439465_0029260 3300041413 Bacteria 1749
191 Ga0439465_0030199 3300041413 Bacteria 1723
192 Ga0451793_1772810 3300041452 Bacteria 1821
193 Ga0451845_0195281 3300041501 Bacteria 1912
194 Ga0451847_0446455 3300041503 Bacteria 5662
195 Ga0451851_1052628 3300041507 Bacteria 2029
196 Ga0439452_013276 3300042010 Bacteria 2317
197 Ga0495638_0000906 3300046460 Bacteria 30294
198 Ga0495638_0082376 3300046460 Bacteria 1951
199 Ga0495605_0002717 3300046474 Bacteria 10802
200 Ga0495583_0011472 3300046506 Bacteria 5085
201 Ga0495606_0026343 3300046507 Bacteria 4145
202 Ga0495610_0014280 3300046512 Bacteria 4674
203 Ga0495610_0043889 3300046512 Bacteria 2224
204 Ga0495610_0102133 3300046512 Bacteria 1283
205 Ga0495620_0018446 3300046515 Bacteria 3455
206 Ga0495620_0052980 3300046515 Bacteria 1720
207 Ga0495631_0005338 3300046518 Bacteria 6744
208 Ga0495632_0017650 3300046519 Bacteria 3934
209 Ga0495643_0050441 3300046522 Bacteria 2241
210 Ga0495654_0004493 3300046530 Bacteria 8258
211 Ga0495622_0010093 3300046557 Bacteria 4370
212 Ga0495633_0012270 3300046558 Bacteria 4568
213 Ga0495633_0037090 3300046558 Bacteria 2334
214 Ga0495656_0004719 3300046615 Bacteria 4685
215 Ga0495668_0031693 3300046616 Bacteria 2979
216 Ga0495668_0062438 3300046616 Bacteria 2053
217 Ga0495611_0012471 3300046648 Bacteria 3613
218 Ga0495625_0010469 3300046660 Bacteria 7672
219 Ga0495588_0009216 3300046674 Bacteria 4558
220 Ga0495658_0041086 3300046683 Bacteria 2574
221 Ga0495660_0057445 3300046810 Bacteria 2099
222 Ga0495604_0034898 3300047317 Bacteria 3974
223 Ga0495681_0008089 3300047470 Bacteria 6624
224 Ga0495681_0043481 3300047470 Bacteria 2166
225 Ga0495686_0049209 3300047472 Bacteria 2653
226 Ga0495615_0003975 3300048090 Bacteria 2534
227 Ga0496102_0005350 3300048905 Bacteria 10896
228 Ga0496106_0016765 3300048909 Bacteria 5421
229 Ga0496116_0000142 3300048919 Bacteria 150342
230 Ga0496116_0010778 3300048919 Bacteria 7628
231 Ga0496116_0029595 3300048919 Bacteria 3945
232 Ga0496116_0034646 3300048919 Bacteria 3558
233 Ga0496116_0051656 3300048919 Bacteria 2729
234 Ga0496117_0000002 3300048920 Bacteria 2483758
235 Ga0496117_0009152 3300048920 Bacteria 9282
236 Ga0496117_0027005 3300048920 Bacteria 4481
237 Ga0496117_0035002 3300048920 Bacteria 3776
238 Ga0496117_0092612 3300048920 Bacteria 1941
239 Ga0496118_0000087 3300048921 Bacteria 176693
240 Ga0496118_0038147 3300048921 Bacteria 3855
241 Ga0496118_0056102 3300048921 Bacteria 2964
242 Ga0496118_0056744 3300048921 Bacteria 2941
243 Ga0496118_0124907 3300048921 Bacteria 1668
244 Ga0496119_0025158 3300048922 Bacteria 4165
245 Ga0496119_0060873 3300048922 Bacteria 2257
246 Ga0496119_0092384 3300048922 Bacteria 1717
247 Ga0496120_0000413 3300048923 Bacteria 68125
248 Ga0496120_0024689 3300048923 Bacteria 3743
249 Ga0496121_0000003 3300048924 Bacteria 1191431
250 Ga0496121_0005438 3300048924 Bacteria 16328
251 Ga0496121_0025478 3300048924 Bacteria 5609
252 Ga0496121_0029823 3300048924 Bacteria 5028
253 Ga0496121_0031672 3300048924 Bacteria 4826
254 Ga0496121_0101951 3300048924 Bacteria 2212
255 Ga0496121_0182870 3300048924 Bacteria 1510
256 Ga0496122_0000004 3300048925 Bacteria 645283
257 Ga0496122_0000215 3300048925 Bacteria 128810
258 Ga0496122_0000840 3300048925 Bacteria 58107
259 Ga0496122_0010915 3300048925 Bacteria 9290
260 Ga0496122_0011469 3300048925 Bacteria 8969
261 Ga0496122_0018457 3300048925 Bacteria 6441
262 Ga0496122_0033766 3300048925 Bacteria 4201
263 Ga0496123_0000007 3300048926 Bacteria 645283
264 Ga0496123_0000306 3300048926 Bacteria 95266
265 Ga0496123_0000336 3300048926 Bacteria 89161
266 Ga0496123_0012309 3300048926 Bacteria 7308
267 Ga0496123_0045025 3300048926 Bacteria 3011
268 Ga0496124_0000252 3300048927 Bacteria 103596
269 Ga0496124_0011348 3300048927 Bacteria 8908
270 Ga0496124_0012281 3300048927 Bacteria 8463
271 Ga0496124_0015820 3300048927 Bacteria 7209
272 Ga0496124_0016267 3300048927 Bacteria 7083
273 Ga0496124_0129154 3300048927 Bacteria 2010
274 Ga0496124_0143643 3300048927 Bacteria 1880
275 Ga0496124_0156923 3300048927 Bacteria 1778
276 Ga0496124_0186966 3300048927 Bacteria 1589
277 Ga0496125_0000039 3300048928 Bacteria 318665
278 Ga0496125_0000248 3300048928 Bacteria 110840
279 Ga0496125_0010334 3300048928 Bacteria 9443
280 Ga0496125_0018248 3300048928 Bacteria 6667
281 Ga0496126_0000166 3300048929 Bacteria 152470
282 Ga0496126_0001356 3300048929 Bacteria 38810
283 Ga0496126_0042751 3300048929 Bacteria 4184
284 Ga0496126_0314580 3300048929 Bacteria 1288
285 Ga0496126_0342915 3300048929 Bacteria 1223
286 Ga0501031_0089662 3300049568 Bacteria 2005
287 Ga0501033_0000327 3300049570 Bacteria 45361
288 Ga0501280_001556 3300049776 Bacteria 4160
289 Ga0501035_0001644 3300049822 Bacteria 22585
290 nmdc:mga03683_12871_c1 3300050489 Bacteria 3066
291 nmdc:mga00v17_238_c1 3300050491 Bacteria 32698
292 nmdc:mga00v17_45_c1 3300050491 Bacteria 78686
293 nmdc:mga0yw44_6155_c1 3300050492 Bacteria 5768
294 nmdc:mga0k408_1579_c1 3300050493 Bacteria 12312
295 nmdc:mga0sz30_11646_c1 3300050516 Bacteria 3402
296 nmdc:mga0sz30_13618_c1 3300050516 Bacteria 3188
297 Ga0495619_0029077 3300053085 Bacteria 3569
298 Ga0500569_001579 3300053109 Bacteria 4328
299 Ga0500594_0010271 3300053118 Bacteria 2171
300 Ga0500607_057030 3300053121 Bacteria 2060
301 Ga0500618_000233 3300053125 Bacteria 43724
302 Ga0500618_007956 3300053125 Bacteria 2993
303 Ga0500618_028501 3300053125 Bacteria 1322
304 Ga0500658_0002650 3300053134 Bacteria 6887
305 Ga0500561_0000291 3300053137 Bacteria 8735
306 Ga0500604_0003689 3300053151 Bacteria 4105
307 Ga0500616_0000102 3300053153 Bacteria 168834
308 Ga0500616_0001640 3300053153 Bacteria 20715
309 Ga0500616_0034202 3300053153 Bacteria 2769
310 Ga0500622_0008185 3300053156 Bacteria 5872
311 Ga0500624_000573 3300053157 Bacteria 10147
312 Ga0500636_0000003 3300053177 Bacteria 240189
313 Ga0500636_0013778 3300053177 Bacteria 4752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046512 Ga0495610_0102133 Ga0495610_0102133_343_1263 306
2 3300050516 nmdc:mga0sz30_13618_c1 nmdc:mga0sz30_13618_c1_2170_3159 329
3 3300046515 Ga0495620_0052980 Ga0495620_0052980_10_1002 330
4 3300048927 Ga0496124_0156923 Ga0496124_0156923_16_1008 330
5 3300006038 Ga0075365_10003006 Ga0075365_100030061 343
6 3300002773 JGI25152J39213_1009871 JGI25152J39213_10098713 345
7 iso_pu_bacteria 2510461069 2510841249 346
8 iso_pu_bacteria 2643221653 2644298712 346
9 iso_pu_bacteria 2643221719 2644656941 346
10 iso_pu_bacteria 2818991272 2819241363 346
11 iso_pu_bacteria 2989776772 2989779249 346
12 iso_pu_bacteria 8005246636 8005248808 346
13 iso_pu_bacteria 8056875544 8056877257 347
14 iso_pu_bacteria 2537561587 2537876051 348
15 iso_pu_bacteria 2554235003 2554248272 348
16 iso_pu_bacteria 2558860242 2559295388 348
17 iso_pu_bacteria 2558860983 2561468337 348
18 iso_pu_bacteria 2599185210 2599601700 348
19 iso_pu_bacteria 2600255279 2601610038 348
20 iso_pu_bacteria 2600255308 2601746813 348
21 iso_pu_bacteria 2643221558 2643811494 348
22 iso_pu_bacteria 2643221568 2643856726 348
23 iso_pu_bacteria 2643221582 2643920302 348
24 iso_pu_bacteria 2643221693 2644521918 348
25 iso_pu_bacteria 2775507049 2776913982 348
26 iso_pu_bacteria 2808606387 2808987878 348
27 iso_pu_bacteria 2818991439 2819559101 348
28 iso_pu_bacteria 2838675328 2838675731 348
29 iso_pu_bacteria 2838714209 2838714613 348
30 iso_pu_bacteria 2838719591 2838721586 348
31 iso_pu_bacteria 2838724970 2838725373 348
32 iso_pu_bacteria 2841846520 2841848536 348
33 iso_pu_bacteria 2841859092 2841862166 348
34 iso_pu_bacteria 2842124991 2842125433 348
35 iso_pu_bacteria 2842130223 2842130626 348
36 iso_pu_bacteria 2842152218 2842154204 348
37 iso_pu_bacteria 2842170452 2842170857 348
38 iso_pu_bacteria 2842175837 2842177824 348
39 iso_pu_bacteria 2842187318 2842187722 348
40 iso_pu_bacteria 2842211629 2842212033 348
41 iso_pu_bacteria 2842224351 2842226348 348
42 iso_pu_bacteria 2842515876 2842518950 348
43 iso_pu_bacteria 2899792073 2899796010 348
44 iso_pu_bacteria 2899803654 2899807223 348
45 iso_pu_bacteria 2899845264 2899850587 348
46 iso_pu_bacteria 2919114240 2919114651 348
47 iso_pu_bacteria 2919166419 2919169287 348
48 iso_pu_bacteria 2926754445 2926755667 348
49 iso_pu_bacteria 2926760298 2926762787 348
50 iso_pu_bacteria 2933006813 2933008849 348
51 iso_pu_bacteria 2933011516 2933014876 348
52 iso_pu_bacteria 2933594066 2933596552 348
53 iso_pu_bacteria 2978969890 2978974664 348
54 iso_pu_bacteria 2979089926 2979094723 348
55 iso_pu_bacteria 2979095461 2979100711 348
56 iso_pu_bacteria 2979100975 2979103955 348
57 iso_pu_bacteria 2984509177 2984511477 348
58 iso_pu_bacteria 2984518228 2984522162 348
59 iso_pu_bacteria 2984537506 2984541461 348
60 iso_pu_bacteria 2984587000 2984589985 348
61 iso_pu_bacteria 2984601300 2984603738 348
62 iso_pu_bacteria 650716007 650740598 348
63 iso_pu_bacteria 8003570095 8003571665 348
64 iso_pu_bacteria 8054460903 8054463023 348
65 iso_pu_bacteria 2508501122 2509108357 349
66 iso_pu_bacteria 2509276019 2509376510 349
67 iso_pu_bacteria 2509276021 2509392016 349
68 iso_pu_bacteria 2509276033 2509445607 349
69 iso_pu_bacteria 2509276033 2509447092 349
70 iso_pu_bacteria 2510065019 2510133995 349
71 iso_pu_bacteria 2510065057 2510306493 349
72 iso_pu_bacteria 2510461076 2510895414 349
73 iso_pu_bacteria 2510917022 2511133995 349
74 iso_pu_bacteria 2510917026 2511174197 349
75 iso_pu_bacteria 2510917028 2511187093 349
76 iso_pu_bacteria 2510917030 2511199068 349
77 iso_pu_bacteria 2511231052 2511502283 349
78 iso_pu_bacteria 2512047086 2512533659 349
79 iso_pu_bacteria 2512875026 2512970643 349
80 iso_pu_bacteria 2513237084 2513567931 349
81 iso_pu_bacteria 2513237085 2513576984 349
82 iso_pu_bacteria 2513237086 2513584345 349
83 iso_pu_bacteria 2513237088 2513596514 349
84 iso_pu_bacteria 2513237089 2513601705 349
85 iso_pu_bacteria 2513237091 2513618843 349
86 iso_pu_bacteria 2513237093 2513633346 349
87 iso_pu_bacteria 2513237103 2513707637 349
88 iso_pu_bacteria 2513237138 2513865638 349
89 iso_pu_bacteria 2513237140 2513884365 349
90 iso_pu_bacteria 2513237143 2513905050 349
91 iso_pu_bacteria 2513237144 2513908956 349
92 iso_pu_bacteria 2513237146 2513925346 349
93 iso_pu_bacteria 2513237156 2513984142 349
94 iso_pu_bacteria 2513237159 2514001462 349
95 iso_pu_bacteria 2513237160 2514002852 349
96 iso_pu_bacteria 2513237162 2514019967 349
97 iso_pu_bacteria 2515075009 2515113042 349
98 iso_pu_bacteria 2515154107 2515609062 349
99 iso_pu_bacteria 2515154113 2515638321 349
100 iso_pu_bacteria 2515154114 2515641002 349
101 iso_pu_bacteria 2515154116 2515655315 349
102 iso_pu_bacteria 2515154134 2515739524 349
103 iso_pu_bacteria 2516653046 2516893662 349
104 iso_pu_bacteria 2516653077 2517036744 349
105 iso_pu_bacteria 2516653085 2517077105 349
106 iso_pu_bacteria 2517093000 2517095871 349
107 iso_pu_bacteria 2517287029 2517407442 349
108 iso_pu_bacteria 2517487022 2517570386 349
109 iso_pu_bacteria 2519899620 2520380490 349
110 iso_pu_bacteria 2524023207 2524448515 349
111 iso_pu_bacteria 2524023209 2524459629 349
112 iso_pu_bacteria 2529292951 2530645912 349
113 iso_pu_bacteria 2534681796 2535516905 349
114 iso_pu_bacteria 2551306084 2551678494 349
115 iso_pu_bacteria 2551306085 2551689778 349
116 iso_pu_bacteria 2551306086 2551694384 349
117 iso_pu_bacteria 2551306087 2551702002 349
118 iso_pu_bacteria 2551306089 2551715271 349
119 iso_pu_bacteria 2551306090 2551723280 349
120 iso_pu_bacteria 2551306090 2551723707 349
121 iso_pu_bacteria 2551306091 2551730488 349
122 iso_pu_bacteria 2551306092 2551732999 349
123 iso_pu_bacteria 2551306093 2551743390 349
124 iso_pu_bacteria 2558860100 2558864422 349
125 iso_pu_bacteria 2582581283 2585166393 349
126 iso_pu_bacteria 2582581294 2585202230 349
127 iso_pu_bacteria 2582581298 2585222871 349
128 iso_pu_bacteria 2582581299 2585231782 349
129 iso_pu_bacteria 2582581304 2585255128 349
130 iso_pu_bacteria 2582581306 2585267382 349
131 iso_pu_bacteria 2582581307 2585271176 349
132 iso_pu_bacteria 2582581865 2585386450 349
133 iso_pu_bacteria 2582581866 2585393295 349
134 iso_pu_bacteria 2582581867 2585402359 349
135 iso_pu_bacteria 2585427526 2585527486 349
136 iso_pu_bacteria 2585427528 2585538224 349
137 iso_pu_bacteria 2585427529 2585545454 349
138 iso_pu_bacteria 2585427531 2585558900 349
139 iso_pu_bacteria 2585427590 2585822954 349
140 iso_pu_bacteria 2585427593 2585836173 349
141 iso_pu_bacteria 2585427594 2585843269 349
142 iso_pu_bacteria 2585427608 2585898281 349
143 iso_pu_bacteria 2585427609 2585904130 349
144 iso_pu_bacteria 2585427633 2585996243 349
145 iso_pu_bacteria 2585427634 2586000854 349
146 iso_pu_bacteria 2585428125 2587980753 349
147 iso_pu_bacteria 2599185156 2599331788 349
148 iso_pu_bacteria 2599185170 2599417262 349
149 iso_pu_bacteria 2599185236 2599721879 349
150 iso_pu_bacteria 2599185352 2600195476 349
151 iso_pu_bacteria 2600254933 2600374325 349
152 iso_pu_bacteria 2615840624 2616293322 349
153 iso_pu_bacteria 2615840698 2616554267 349
154 iso_pu_bacteria 2617270742 2617383607 349
155 iso_pu_bacteria 2643221557 2643803042 349
156 iso_pu_bacteria 2643221599 2644003130 349
157 iso_pu_bacteria 2643221607 2644050474 349
158 iso_pu_bacteria 2643221610 2644063404 349
159 iso_pu_bacteria 2643221618 2644107237 349
160 iso_pu_bacteria 2643221626 2644150803 349
161 iso_pu_bacteria 2643221634 2644193552 349
162 iso_pu_bacteria 2643221636 2644205702 349
163 iso_pu_bacteria 2643221643 2644238638 349
164 iso_pu_bacteria 2643221655 2644308632 349
165 iso_pu_bacteria 2643221659 2644335450 349
166 iso_pu_bacteria 2643221668 2644374687 349
167 iso_pu_bacteria 2643221675 2644414167 349
168 iso_pu_bacteria 2643221680 2644447695 349
169 iso_pu_bacteria 2643221686 2644483392 349
170 iso_pu_bacteria 2643221688 2644492073 349
171 iso_pu_bacteria 2643221689 2644499603 349
172 iso_pu_bacteria 2643221698 2644539855 349
173 iso_pu_bacteria 2643221712 2644614573 349
174 iso_pu_bacteria 2643221723 2644676036 349
175 iso_pu_bacteria 2643221726 2644690168 349
176 iso_pu_bacteria 2657244999 2657681604 349
177 iso_pu_bacteria 2667528174 2671111392 349
178 iso_pu_bacteria 2690316117 2692315503 349
179 iso_pu_bacteria 2718217882 2719181845 349
180 iso_pu_bacteria 2718217927 2719386451 349
181 iso_pu_bacteria 2718217997 2719666197 349
182 iso_pu_bacteria 2718218009 2719732509 349
183 iso_pu_bacteria 2718218199 2720492617 349
184 iso_pu_bacteria 2718218232 2720614051 349
185 iso_pu_bacteria 2718218233 2720620858 349
186 iso_pu_bacteria 2718218235 2720632183 349
187 iso_pu_bacteria 2718218269 2720775911 349
188 iso_pu_bacteria 2718218363 2721147936 349
189 iso_pu_bacteria 2718218365 2721159387 349
190 iso_pu_bacteria 2718218366 2721164772 349
191 iso_pu_bacteria 2718218423 2721400155 349
192 iso_pu_bacteria 2721755514 2722840942 349
193 iso_pu_bacteria 2721755556 2723027513 349
194 iso_pu_bacteria 2721755684 2723561134 349
195 iso_pu_bacteria 2721755685 2723567730 349
196 iso_pu_bacteria 2721755809 2724038968 349
197 iso_pu_bacteria 2721755810 2724045265 349
198 iso_pu_bacteria 2721755819 2724090518 349
199 iso_pu_bacteria 2721755822 2724104995 349
200 iso_pu_bacteria 2721755823 2724110853 349
201 iso_pu_bacteria 2724679232 2725952522 349
202 iso_pu_bacteria 2728369352 2730108449 349
203 iso_pu_bacteria 2728369365 2730165080 349
204 iso_pu_bacteria 2728369397 2730299019 349
205 iso_pu_bacteria 2738541293 2738800127 349
206 iso_pu_bacteria 2738541317 2738947289 349
207 iso_pu_bacteria 2738541333 2739032880 349
208 iso_pu_bacteria 2751185821 2753462066 349
209 iso_pu_bacteria 2765235942 2766065911 349
210 iso_pu_bacteria 2791355082 2792585086 349
211 iso_pu_bacteria 2791355091 2792620731 349
212 iso_pu_bacteria 2791355092 2792626091 349
213 iso_pu_bacteria 2791355094 2792639028 349
214 iso_pu_bacteria 2791355256 2793294398 349
215 iso_pu_bacteria 2791355259 2793314505 349
216 iso_pu_bacteria 2791355260 2793320332 349
217 iso_pu_bacteria 2791355261 2793331709 349
218 iso_pu_bacteria 2791355262 2793334529 349
219 iso_pu_bacteria 2791355263 2793339249 349
220 iso_pu_bacteria 2791355264 2793348919 349
221 iso_pu_bacteria 2791355265 2793351793 349
222 iso_pu_bacteria 2791355266 2793362541 349
223 iso_pu_bacteria 2791355267 2793368834 349
224 iso_pu_bacteria 2802428858 2802716997 349
225 iso_pu_bacteria 2802428859 2802725746 349
226 iso_pu_bacteria 2802428860 2802730165 349
227 iso_pu_bacteria 2802428861 2802737864 349
228 iso_pu_bacteria 2802428862 2802742682 349
229 iso_pu_bacteria 2802428863 2802750170 349
230 iso_pu_bacteria 2802429268 2804752793 349
231 iso_pu_bacteria 2802429605 2805928761 349
232 iso_pu_bacteria 2802429606 2805935043 349
233 iso_pu_bacteria 2802429633 2806043860 349
234 iso_pu_bacteria 2802429634 2806050209 349
235 iso_pu_bacteria 2802429635 2806057025 349
236 iso_pu_bacteria 2802429636 2806064406 349
237 iso_pu_bacteria 2802429637 2806071673 349
238 iso_pu_bacteria 2818991461 2819684953 349
239 iso_pu_bacteria 2821123053 2821127456 349
240 iso_pu_bacteria 2838016132 2838017613 349
241 iso_pu_bacteria 2838022645 2838027588 349
242 iso_pu_bacteria 2838029111 2838029767 349
243 iso_pu_bacteria 2838035591 2838038539 349
244 iso_pu_bacteria 2838042994 2838045002 349
245 iso_pu_bacteria 2838048938 2838054341 349
246 iso_pu_bacteria 2838061910 2838067696 349
247 iso_pu_bacteria 2838068647 2838070103 349
248 iso_pu_bacteria 2838661181 2838661550 349
249 iso_pu_bacteria 2838668709 2838670401 349
250 iso_pu_bacteria 2838680041 2838683425 349
251 iso_pu_bacteria 2838686498 2838687012 349
252 iso_pu_bacteria 2838694306 2838697632 349
253 iso_pu_bacteria 2838701080 2838702772 349
254 iso_pu_bacteria 2838707686 2838710748 349
255 iso_pu_bacteria 2838729681 2838730015 349
256 iso_pu_bacteria 2838736955 2838737980 349
257 iso_pu_bacteria 2838742623 2838742970 349
258 iso_pu_bacteria 2841840854 2841841651 349
259 iso_pu_bacteria 2841851746 2841852456 349
260 iso_pu_bacteria 2841864319 2841870822 349
261 iso_pu_bacteria 2842077413 2842078921 349
262 iso_pu_bacteria 2842110456 2842113226 349
263 iso_pu_bacteria 2842118031 2842118569 349
264 iso_pu_bacteria 2842140634 2842141429 349
265 iso_pu_bacteria 2842146304 2842147970 349
266 iso_pu_bacteria 2842156927 2842158085 349
267 iso_pu_bacteria 2842163707 2842168752 349
268 iso_pu_bacteria 2842180545 2842181704 349
269 iso_pu_bacteria 2842192696 2842197397 349
270 iso_pu_bacteria 2842198810 2842203598 349
271 iso_pu_bacteria 2842205361 2842205440 349
272 iso_pu_bacteria 2842217011 2842217976 349
273 iso_pu_bacteria 2842229732 2842230245 349
274 iso_pu_bacteria 2842237096 2842240481 349
275 iso_pu_bacteria 2842243621 2842244148 349
276 iso_pu_bacteria 2842250916 2842253036 349
277 iso_pu_bacteria 2842257432 2842257766 349
278 iso_pu_bacteria 2842264693 2842266306 349
279 iso_pu_bacteria 2842271015 2842271450 349
280 iso_pu_bacteria 2842278818 2842278897 349
281 iso_pu_bacteria 2842285085 2842285560 349
282 iso_pu_bacteria 2842291075 2842292583 349
283 iso_pu_bacteria 2842298080 2842301411 349
284 iso_pu_bacteria 2842304105 2842305079 349
285 iso_pu_bacteria 2842311132 2842316982 349
286 iso_pu_bacteria 2842317721 2842320750 349
287 iso_pu_bacteria 2842341865 2842346498 349
288 iso_pu_bacteria 2842357229 2842357948 349
289 iso_pu_bacteria 2842363717 2842368919 349
290 iso_pu_bacteria 2842370503 2842374056 349
291 iso_pu_bacteria 2842377471 2842378981 349
292 iso_pu_bacteria 2842384541 2842385080 349
293 iso_pu_bacteria 2842395702 2842399840 349
294 iso_pu_bacteria 2842402390 2842402920 349
295 iso_pu_bacteria 2842409023 2842409708 349
296 iso_pu_bacteria 2842415677 2842416359 349
297 iso_pu_bacteria 2842422224 2842423717 349
298 iso_pu_bacteria 2842428310 2842430769 349
299 iso_pu_bacteria 2842434925 2842437244 349
300 iso_pu_bacteria 2842441272 2842443614 349
301 iso_pu_bacteria 2842447887 2842453880 349
302 iso_pu_bacteria 2842462802 2842464912 349
303 iso_pu_bacteria 2842469257 2842471862 349
304 iso_pu_bacteria 2842475841 2842476948 349
305 iso_pu_bacteria 2842489311 2842492018 349
306 iso_pu_bacteria 2842495871 2842496786 349
307 iso_pu_bacteria 2842502639 2842503295 349
308 iso_pu_bacteria 2842509118 2842511090 349
309 iso_pu_bacteria 2842521101 2842521856 349
310 iso_pu_bacteria 2842922631 2842924194 349
311 iso_pu_bacteria 2844163670 2844164618 349
312 iso_pu_bacteria 2844454524 2844458379 349
313 iso_pu_bacteria 2847417321 2847419436 349
314 iso_pu_bacteria 2848992105 2848994464 349
315 iso_pu_bacteria 2850079185 2850081507 349
316 iso_pu_bacteria 2852387548 2852390266 349
317 iso_pu_bacteria 2854896431 2854899631 349
318 iso_pu_bacteria 2854916844 2854918454 349
319 iso_pu_bacteria 2855825444 2855826384 349
320 iso_pu_bacteria 2855839649 2855841773 349
321 iso_pu_bacteria 2855872281 2855872482 349
322 iso_pu_bacteria 2857516855 2857517390 349
323 iso_pu_bacteria 2857531043 2857536531 349
324 iso_pu_bacteria 2858800743 2858802558 349
325 iso_pu_bacteria 2891373044 2891373392 349
326 iso_pu_bacteria 2913295892 2913299270 349
327 iso_pu_bacteria 2913308742 2913312614 349
328 iso_pu_bacteria 2915980308 2915982985 349
329 iso_pu_bacteria 2915986958 2915989273 349
330 iso_pu_bacteria 2915993759 2916000819 349
331 iso_pu_bacteria 2916000859 2916003443 349
332 iso_pu_bacteria 2916007675 2916008088 349
333 iso_pu_bacteria 2916014648 2916019583 349
334 iso_pu_bacteria 2916021584 2916022171 349
335 iso_pu_bacteria 2916028427 2916034230 349
336 iso_pu_bacteria 2916035215 2916037909 349
337 iso_pu_bacteria 2916041962 2916045291 349
338 iso_pu_bacteria 2916048683 2916049085 349
339 iso_pu_bacteria 2916055098 2916055677 349
340 iso_pu_bacteria 2916061851 2916064306 349
341 iso_pu_bacteria 2916068649 2916075996 349
342 iso_pu_bacteria 2916076590 2916082297 349
343 iso_pu_bacteria 2919100787 2919107617 349
344 iso_pu_bacteria 2919408235 2919410018 349
345 iso_pu_bacteria 2920822456 2920825261 349
346 iso_pu_bacteria 2921201388 2921208494 349
347 iso_pu_bacteria 2921208531 2921210648 349
348 iso_pu_bacteria 2921237296 2921240887 349
349 iso_pu_bacteria 2921244191 2921246731 349
350 iso_pu_bacteria 2921250672 2921253832 349
351 iso_pu_bacteria 2921257292 2921263070 349
352 iso_pu_bacteria 2921263974 2921266252 349
353 iso_pu_bacteria 2921282425 2921289153 349
354 iso_pu_bacteria 2921289301 2921296270 349
355 iso_pu_bacteria 2921296804 2921298224 349
356 iso_pu_bacteria 2923556063 2923558612 349
357 iso_pu_bacteria 2924144063 2924146711 349
358 iso_pu_bacteria 2924150972 2924157949 349
359 iso_pu_bacteria 2924158325 2924159317 349
360 iso_pu_bacteria 2924165586 2924170527 349
361 iso_pu_bacteria 2924172951 2924174526 349
362 iso_pu_bacteria 2924179722 2924182957 349
363 iso_pu_bacteria 2924186466 2924187485 349
364 iso_pu_bacteria 2924193448 2924195427 349
365 iso_pu_bacteria 2924200457 2924203282 349
366 iso_pu_bacteria 2924207177 2924210701 349
367 iso_pu_bacteria 2924214083 2924215662 349
368 iso_pu_bacteria 2924221636 2924223251 349
369 iso_pu_bacteria 2924228884 2924230563 349
370 iso_pu_bacteria 2929138655 2929140915 349
371 iso_pu_bacteria 2933016740 2933022201 349
372 iso_pu_bacteria 2933570622 2933570887 349
373 iso_pu_bacteria 2933586486 2933588718 349
374 iso_pu_bacteria 2933599457 2933600909 349
375 iso_pu_bacteria 2935894831 2935896982 349
376 iso_pu_bacteria 2935901341 2935901916 349
377 iso_pu_bacteria 2936367885 2936371995 349
378 iso_pu_bacteria 2936375103 2936379857 349
379 iso_pu_bacteria 2936381700 2936382761 349
380 iso_pu_bacteria 2936996657 2936998260 349
381 iso_pu_bacteria 2937002841 2937004516 349
382 iso_pu_bacteria 2937009748 2937011241 349
383 iso_pu_bacteria 2937016420 2937019781 349
384 iso_pu_bacteria 2937023124 2937024628 349
385 iso_pu_bacteria 2937029754 2937031098 349
386 iso_pu_bacteria 2937036028 2937037032 349
387 iso_pu_bacteria 2937042894 2937047986 349
388 iso_pu_bacteria 2937049772 2937056473 349
389 iso_pu_bacteria 2937056579 2937063528 349
390 iso_pu_bacteria 2937063883 2937067817 349
391 iso_pu_bacteria 2937071275 2937074434 349
392 iso_pu_bacteria 2937078374 2937081582 349
393 iso_pu_bacteria 2937084907 2937085645 349
394 iso_pu_bacteria 2937091812 2937094554 349
395 iso_pu_bacteria 2937098957 2937105447 349
396 iso_pu_bacteria 2937106411 2937111300 349
397 iso_pu_bacteria 2937113482 2937116101 349
398 iso_pu_bacteria 2937119839 2937122028 349
399 iso_pu_bacteria 2937126314 2937128869 349
400 iso_pu_bacteria 2941499720 2941502092 349
401 iso_pu_bacteria 2957375807 2957378382 349
402 iso_pu_bacteria 2957382221 2957384235 349
403 iso_pu_bacteria 2957388812 2957390698 349
404 iso_pu_bacteria 2957395598 2957401683 349
405 iso_pu_bacteria 2957402308 2957404460 349
406 iso_pu_bacteria 2957408893 2957414096 349
407 iso_pu_bacteria 2957415311 2957417311 349
408 iso_pu_bacteria 2957422303 2957423226 349
409 iso_pu_bacteria 2957430029 2957431759 349
410 iso_pu_bacteria 2957443900 2957446866 349
411 iso_pu_bacteria 2957450854 2957453708 349
412 iso_pu_bacteria 2957457609 2957461904 349
413 iso_pu_bacteria 2957464669 2957467002 349
414 iso_pu_bacteria 2957471148 2957471614 349
415 iso_pu_bacteria 2957478035 2957479562 349
416 iso_pu_bacteria 2957484790 2957490420 349
417 iso_pu_bacteria 2957491536 2957497359 349
418 iso_pu_bacteria 2957498199 2957503353 349
419 iso_pu_bacteria 2957505466 2957507266 349
420 iso_pu_bacteria 2960584000 2960590872 349
421 iso_pu_bacteria 2960591022 2960594238 349
422 iso_pu_bacteria 2960597568 2960599951 349
423 iso_pu_bacteria 2960603979 2960610633 349
424 iso_pu_bacteria 2960610863 2960614568 349
425 iso_pu_bacteria 2960617483 2960620507 349
426 iso_pu_bacteria 2960624210 2960624439 349
427 iso_pu_bacteria 2960631154 2960633638 349
428 iso_pu_bacteria 2960637947 2960645000 349
429 iso_pu_bacteria 2960645483 2960652437 349
430 iso_pu_bacteria 2960652885 2960654675 349
431 iso_pu_bacteria 2960660292 2960666537 349
432 iso_pu_bacteria 2960667422 2960669700 349
433 iso_pu_bacteria 2960674078 2960675118 349
434 iso_pu_bacteria 2960680706 2960681028 349
435 iso_pu_bacteria 2960687367 2960692493 349
436 iso_pu_bacteria 2960693952 2960698042 349
437 iso_pu_bacteria 2964607997 2964614168 349
438 iso_pu_bacteria 2964615318 2964617991 349
439 iso_pu_bacteria 2964621998 2964623591 349
440 iso_pu_bacteria 2964628898 2964632629 349
441 iso_pu_bacteria 2964636051 2964637124 349
442 iso_pu_bacteria 2964643177 2964645643 349
443 iso_pu_bacteria 2964649959 2964651598 349
444 iso_pu_bacteria 2964656573 2964661769 349
445 iso_pu_bacteria 2964663802 2964666881 349
446 iso_pu_bacteria 2964670856 2964677596 349
447 iso_pu_bacteria 2964678106 2964682917 349
448 iso_pu_bacteria 2964685014 2964688525 349
449 iso_pu_bacteria 2964691889 2964692522 349
450 iso_pu_bacteria 2964698721 2964705362 349
451 iso_pu_bacteria 2964705432 2964710479 349
452 iso_pu_bacteria 2964712639 2964718371 349
453 iso_pu_bacteria 2964719344 2964721465 349
454 iso_pu_bacteria 2967664464 2967670748 349
455 iso_pu_bacteria 2967671571 2967678372 349
456 iso_pu_bacteria 2967678726 2967684384 349
457 iso_pu_bacteria 2967686174 2967689973 349
458 iso_pu_bacteria 2967693043 2967694686 349
459 iso_pu_bacteria 2967699805 2967701792 349
460 iso_pu_bacteria 2967706974 2967708664 349
461 iso_pu_bacteria 2967714385 2967714917 349
462 iso_pu_bacteria 2967721400 2967727960 349
463 iso_pu_bacteria 2967728569 2967730042 349
464 iso_pu_bacteria 2967735183 2967737189 349
465 iso_pu_bacteria 2967742019 2967742299 349
466 iso_pu_bacteria 2967748971 2967751561 349
467 iso_pu_bacteria 2967755722 2967757870 349
468 iso_pu_bacteria 2967762386 2967767711 349
469 iso_pu_bacteria 2967769361 2967772079 349
470 iso_pu_bacteria 2967775926 2967779023 349
471 iso_pu_bacteria 2970019648 2970021020 349
472 iso_pu_bacteria 2970026789 2970031733 349
473 iso_pu_bacteria 2970033650 2970034120 349
474 iso_pu_bacteria 2970040964 2970041757 349
475 iso_pu_bacteria 2970047711 2970054587 349
476 iso_pu_bacteria 2970054988 2970056743 349
477 iso_pu_bacteria 2970061556 2970067185 349
478 iso_pu_bacteria 2970068827 2970071629 349
479 iso_pu_bacteria 2970076120 2970078305 349
480 iso_pu_bacteria 2970082768 2970085286 349
481 iso_pu_bacteria 2970088815 2970092589 349
482 iso_pu_bacteria 2970095765 2970096142 349
483 iso_pu_bacteria 2970102677 2970107956 349
484 iso_pu_bacteria 2970109326 2970110751 349
485 iso_pu_bacteria 2970116247 2970117396 349
486 iso_pu_bacteria 2970122695 2970124902 349
487 iso_pu_bacteria 2970129317 2970131124 349
488 iso_pu_bacteria 2970136068 2970136335 349
489 iso_pu_bacteria 2970143518 2970145138 349
490 iso_pu_bacteria 2970149975 2970151574 349
491 iso_pu_bacteria 2970156795 2970159610 349
492 iso_pu_bacteria 2970164137 2970166936 349
493 iso_pu_bacteria 2970170962 2970174285 349
494 iso_pu_bacteria 2970177841 2970180866 349
495 iso_pu_bacteria 2970184632 2970185968 349
496 iso_pu_bacteria 2970191845 2970198830 349
497 iso_pu_bacteria 2977516862 2977523728 349
498 iso_pu_bacteria 2977523885 2977528828 349
499 iso_pu_bacteria 2977530762 2977531460 349
500 iso_pu_bacteria 2977537788 2977539668 349
501 iso_pu_bacteria 2977544691 2977548351 349
502 iso_pu_bacteria 2977551784 2977558474 349
503 iso_pu_bacteria 2977558990 2977563215 349
504 iso_pu_bacteria 2977565890 2977567708 349
505 iso_pu_bacteria 2977572785 2977575705 349
506 iso_pu_bacteria 2977579622 2977581956 349
507 iso_pu_bacteria 2989349275 2989349716 349
508 iso_pu_bacteria 2989771324 2989774331 349
509 iso_pu_bacteria 2996887358 2996888998 349
510 iso_pu_bacteria 2996893221 2996894288 349
511 iso_pu_bacteria 3003930520 3003934113 349
512 iso_pu_bacteria 3005409236 3005414554 349
513 iso_pu_bacteria 3005445848 3005448486 349
514 iso_pu_bacteria 3005452660 3005454664 349
515 iso_pu_bacteria 639633055 639649226 349
516 iso_pu_bacteria 643692032 643826350 349
517 iso_pu_bacteria 648276728 648739251 349
518 iso_pu_bacteria 8003992118 8003994208 349
519 iso_pu_bacteria 8003999396 8004001850 349
520 iso_pu_bacteria 8005258706 8005260345 349
521 iso_pu_bacteria 8005275841 8005281249 349
522 iso_pu_bacteria 8005282627 8005286094 349
523 iso_pu_bacteria 8005289223 8005292247 349
524 iso_pu_bacteria 8005301065 8005303165 349
525 iso_pu_bacteria 8005307578 8005312873 349
526 iso_pu_bacteria 8005321885 8005323525 349
527 iso_pu_bacteria 8005376324 8005380967 349
528 iso_pu_bacteria 8005382845 8005389082 349
529 iso_pu_bacteria 8005395548 8005396065 349
530 iso_pu_bacteria 8005430974 8005435194 349
531 iso_pu_bacteria 8005460587 8005463723 349
532 iso_pu_bacteria 8005484373 8005489149 349
533 iso_pu_bacteria 8005497431 8005500935 349
534 iso_pu_bacteria 8005542996 8005545659 349
535 iso_pu_bacteria 8005556819 8005556979 349
536 iso_pu_bacteria 8005563573 8005568029 349
537 iso_pu_bacteria 8005570704 8005573426 349
538 iso_pu_bacteria 8005619151 8005622308 349
539 iso_pu_bacteria 8005626139 8005629809 349
540 iso_pu_bacteria 8005668836 8005672353 349
541 iso_pu_bacteria 8005682033 8005682851 349
542 iso_pu_bacteria 8005688590 8005692067 349
543 iso_pu_bacteria 8005695170 8005697439 349
544 iso_pu_bacteria 8018127388 8018134133 349
545 iso_pu_bacteria 8018150411 8018155223 349
546 iso_pu_bacteria 8018163183 8018164590 349
547 iso_pu_bacteria 8018176218 8018181285 349
548 iso_pu_bacteria 8023680758 8023683129 349
549 iso_pu_bacteria 8024479707 8024482827 349
550 iso_pu_bacteria 8024486573 8024488066 349
551 iso_pu_bacteria 8024501048 8024504460 349
552 iso_pu_bacteria 8046767195 8046771125 349
553 iso_pu_bacteria 8049293176 8049295364 349
554 iso_pu_bacteria 8054558443 8054558597 349
555 iso_pu_bacteria 8056375014 8056375970 349
556 iso_pu_bacteria 8056382006 8056386762 349
557 iso_pu_bacteria 8057575449 8057575698 349
558 iso_pu_bacteria 8057874678 8057877637 349
559 3300049776 Ga0501280_001556 Ga0501280_001556_1760_2812 350
560 3300003187 JGI25151J46595_10011793 JGI25151J46595_100117934 352
561 3300005548 Ga0070665_100002086 Ga0070665_1000020866 352
562 3300005563 Ga0068855_100046761 Ga0068855_1000467614 352
563 3300005578 Ga0068854_100170807 Ga0068854_1001708072 352
564 3300006042 Ga0075368_10002107 Ga0075368_100021073 352
565 3300006948 Ga0099826_10001200 Ga0099826_100012006 352
566 3300009148 Ga0105243_10008058 Ga0105243_100080583 352
567 3300013100 Ga0157373_10053402 Ga0157373_100534022 352
568 3300013102 Ga0157371_10000017 Ga0157371_10000017100 352
569 3300013104 Ga0157370_10000494 Ga0157370_1000049415 352
570 3300013296 Ga0157374_10416828 Ga0157374_104168281 352
571 3300013297 Ga0157378_10375241 Ga0157378_103752411 352
572 3300025294 Ga0209025_1000213 Ga0209025_100021342 352
573 3300025923 Ga0207681_10167166 Ga0207681_101671662 352
574 3300025981 Ga0207640_10164156 Ga0207640_101641562 352
575 3300027312 Ga0209371_1000022 Ga0209371_1000022126 352
576 3300027312 Ga0209371_1000173 Ga0209371_100017334 352
577 3300027666 Ga0209282_1000467 Ga0209282_100046713 352
578 3300028379 Ga0268266_10002745 Ga0268266_1000274517 352
579 3300030500 Ga0268256_1000019 Ga0268256_1000019394 352
580 3300046507 Ga0495606_0026343 Ga0495606_0026343_2942_4000 352
581 3300046558 Ga0495633_0012270 Ga0495633_0012270_3349_4407 352
582 3300046674 Ga0495588_0009216 Ga0495588_0009216_679_1737 352
583 3300046683 Ga0495658_0041086 Ga0495658_0041086_26_1084 352
584 3300047470 Ga0495681_0008089 Ga0495681_0008089_3957_5015 352
585 3300048919 Ga0496116_0000142 Ga0496116_0000142_45067_46125 352
586 3300048919 Ga0496116_0051656 Ga0496116_0051656_112_1170 352
587 3300048920 Ga0496117_0000002 Ga0496117_0000002_424195_425253 352
588 3300048920 Ga0496117_0092612 Ga0496117_0092612_294_1352 352
589 3300048921 Ga0496118_0000087 Ga0496118_0000087_35754_36812 352
590 3300048921 Ga0496118_0056744 Ga0496118_0056744_1171_2229 352
591 3300048922 Ga0496119_0025158 Ga0496119_0025158_3096_4154 352
592 3300048922 Ga0496119_0060873 Ga0496119_0060873_370_1428 352
593 3300048923 Ga0496120_0000413 Ga0496120_0000413_60708_61766 352
594 3300048925 Ga0496122_0000004 Ga0496122_0000004_164605_165663 352
595 3300048925 Ga0496122_0011469 Ga0496122_0011469_4984_6042 352
596 3300048926 Ga0496123_0000007 Ga0496123_0000007_164605_165663 352
597 3300048926 Ga0496123_0045025 Ga0496123_0045025_1398_2456 352
598 3300048927 Ga0496124_0000252 Ga0496124_0000252_85479_86537 352
599 3300048927 Ga0496124_0016267 Ga0496124_0016267_449_1507 352
600 3300048929 Ga0496126_0000166 Ga0496126_0000166_7426_8484 352
601 3300048929 Ga0496126_0342915 Ga0496126_0342915_71_1129 352
602 3300050489 nmdc:mga03683_12871_c1 nmdc:mga03683_12871_c1_404_1462 352
603 3300050491 nmdc:mga00v17_238_c1 nmdc:mga00v17_238_c1_25492_26550 352
604 3300053137 Ga0500561_0000291 Ga0500561_0000291_6487_7545 352
605 3300053157 Ga0500624_000573 Ga0500624_000573_469_1527 352
606 3300053177 Ga0500636_0000003 Ga0500636_0000003_199990_201048 352
607 3300053177 Ga0500636_0013778 Ga0500636_0013778_1530_2588 352
608 3300002737 JGI25162J39368_1000143 JGI25162J39368_100014384 353
609 3300002773 JGI25152J39213_1000982 JGI25152J39213_10009828 353
610 3300002773 JGI25152J39213_1007180 JGI25152J39213_10071803 353
611 3300002774 JGI25150J39212_1000074 JGI25150J39212_100007415 353
612 3300002987 JGI25159J45721_1000014 JGI25159J45721_1000014100 353
613 3300002987 JGI25159J45721_1000411 JGI25159J45721_10004114 353
614 3300003187 JGI25151J46595_10000414 JGI25151J46595_1000041415 353
615 3300003187 JGI25151J46595_10000492 JGI25151J46595_100004929 353
616 3300003187 JGI25151J46595_10018861 JGI25151J46595_100188612 353
617 3300003187 JGI25151J46595_10019895 JGI25151J46595_100198952 353
618 3300003214 JGI25165J46597_1000356 JGI25165J46597_100035664 353
619 3300003215 JGI25153J46596_10001781 JGI25153J46596_100017813 353
620 3300003215 JGI25153J46596_10004667 JGI25153J46596_100046675 353
621 3300003215 JGI25153J46596_10005619 JGI25153J46596_100056195 353
622 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001609 353
623 3300003354 JGI25160J50197_1000020 JGI25160J50197_1000020100 353
624 3300003354 JGI25160J50197_1000695 JGI25160J50197_100069516 353
625 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001145 353
626 3300003374 JGI25161J50226_1001048 JGI25161J50226_10010488 353
627 3300003374 JGI25161J50226_1001061 JGI25161J50226_10010617 353
628 3300003771 Ga0055526_1004520 Ga0055526_10045207 353
629 3300003771 Ga0055526_1005394 Ga0055526_10053946 353
630 3300003771 Ga0055526_1013390 Ga0055526_10133903 353
631 3300003775 Ga0055524_1001901 Ga0055524_10019017 353
632 3300003775 Ga0055524_1001996 Ga0055524_100199610 353
633 3300003775 Ga0055524_1002315 Ga0055524_10023152 353
634 3300003775 Ga0055524_1003899 Ga0055524_10038996 353
635 3300003775 Ga0055524_1013498 Ga0055524_10134984 353
636 3300003775 Ga0055524_1024028 Ga0055524_10240282 353
637 3300003781 Ga0055536_1004884 Ga0055536_10048842 353
638 3300003790 Ga0055528_1000234 Ga0055528_10002348 353
639 3300003790 Ga0055528_1004593 Ga0055528_10045935 353
640 3300003790 Ga0055528_1007746 Ga0055528_10077462 353
641 3300003790 Ga0055528_1010076 Ga0055528_10100764 353
642 3300003790 Ga0055528_1017220 Ga0055528_10172203 353
643 3300003792 Ga0055540_1000350 Ga0055540_10003504 353
644 3300003792 Ga0055540_1008122 Ga0055540_10081223 353
645 3300003794 Ga0055531_10007729 Ga0055531_100077292 353
646 3300004625 Ga0055543_1000003 Ga0055543_1000003161 353
647 3300004625 Ga0055543_1000352 Ga0055543_10003529 353
648 3300004625 Ga0055543_1000660 Ga0055543_10006606 353
649 3300004625 Ga0055543_1000768 Ga0055543_10007686 353
650 3300005262 Ga0065165_1000013 Ga0065165_1000013118 353
651 3300005262 Ga0065165_1000068 Ga0065165_10000687 353
652 3300005262 Ga0065165_1004654 Ga0065165_10046543 353
653 3300005262 Ga0065165_1008320 Ga0065165_10083203 353
654 3300005262 Ga0065165_1015514 Ga0065165_10155143 353
655 3300005262 Ga0065165_1021513 Ga0065165_10215132 353
656 3300005548 Ga0070665_100075747 Ga0070665_1000757472 353
657 3300006038 Ga0075365_10001211 Ga0075365_100012117 353
658 3300006048 Ga0075363_100020559 Ga0075363_1000205593 353
659 3300006048 Ga0075363_100041304 Ga0075363_1000413043 353
660 3300006177 Ga0075362_10000283 Ga0075362_100002836 353
661 3300006178 Ga0075367_10001444 Ga0075367_100014447 353
662 3300006178 Ga0075367_10002037 Ga0075367_100020375 353
663 3300006186 Ga0075369_10002302 Ga0075369_100023025 353
664 3300006353 Ga0075370_10002369 Ga0075370_100023696 353
665 3300006946 Ga0079104_1000045 Ga0079104_100004525 353
666 3300006946 Ga0079104_1002855 Ga0079104_10028558 353
667 3300006946 Ga0079104_1004289 Ga0079104_10042896 353
668 3300009011 Ga0105251_10052275 Ga0105251_100522752 353
669 3300009765 Ga0123341_1000007 Ga0123341_100000744 353
670 3300009766 Ga0123342_1014140 Ga0123342_10141404 353
671 3300013105 Ga0157369_10435551 Ga0157369_104355511 353
672 3300013249 Ga0171463_1003 Ga0171463_1003113 353
673 3300015690 Ga0183363_1085 Ga0183363_108519 353
674 3300021320 Ga0214544_1003096 Ga0214544_10030964 353
675 3300021321 Ga0214542_1000012 Ga0214542_100001246 353
676 3300021321 Ga0214542_1015464 Ga0214542_10154647 353
677 3300021327 Ga0214543_1000024 Ga0214543_100002447 353
678 3300021327 Ga0214543_1000038 Ga0214543_100003826 353
679 3300022739 Ga0228711_1013581 Ga0228711_10135815 353
680 3300022740 Ga0228710_1013926 Ga0228710_10139265 353
681 3300025208 Ga0209436_100147 Ga0209436_10014722 353
682 3300025208 Ga0209436_105029 Ga0209436_1050293 353
683 3300025230 Ga0209563_104009 Ga0209563_1040092 353
684 3300025233 Ga0209437_100098 Ga0209437_100098130 353
685 3300025245 Ga0207425_1000075 Ga0207425_100007516 353
686 3300025245 Ga0207425_1000998 Ga0207425_10009988 353
687 3300025245 Ga0207425_1002674 Ga0207425_10026746 353
688 3300025245 Ga0207425_1004012 Ga0207425_10040125 353
689 3300025245 Ga0207425_1014228 Ga0207425_10142282 353
690 3300025258 Ga0209129_1000156 Ga0209129_100015682 353
691 3300025258 Ga0209129_1000218 Ga0209129_100021846 353
692 3300025258 Ga0209129_1000537 Ga0209129_100053714 353
693 3300025258 Ga0209129_1002124 Ga0209129_10021244 353
694 3300025258 Ga0209129_1003562 Ga0209129_10035624 353
695 3300025258 Ga0209129_1004888 Ga0209129_10048885 353
696 3300025258 Ga0209129_1008231 Ga0209129_10082313 353
697 3300025261 Ga0209233_1000095 Ga0209233_1000095247 353
698 3300025273 Ga0209673_1000010 Ga0209673_1000010254 353
699 3300025273 Ga0209673_1000117 Ga0209673_100011737 353
700 3300025273 Ga0209673_1000151 Ga0209673_1000151111 353
701 3300025273 Ga0209673_1003173 Ga0209673_10031739 353
702 3300025273 Ga0209673_1003745 Ga0209673_10037457 353
703 3300025273 Ga0209673_1004460 Ga0209673_10044604 353
704 3300025273 Ga0209673_1004544 Ga0209673_10045444 353
705 3300025273 Ga0209673_1016155 Ga0209673_10161553 353
706 3300025284 Ga0209130_1000003 Ga0209130_1000003168 353
707 3300025284 Ga0209130_1000020 Ga0209130_1000020213 353
708 3300025284 Ga0209130_1000034 Ga0209130_1000034115 353
709 3300025284 Ga0209130_1014152 Ga0209130_10141522 353
710 3300025292 Ga0209676_1004445 Ga0209676_10044453 353
711 3300025292 Ga0209676_1024683 Ga0209676_10246832 353
712 3300025294 Ga0209025_1000070 Ga0209025_1000070195 353
713 3300025294 Ga0209025_1000140 Ga0209025_100014028 353
714 3300025294 Ga0209025_1000311 Ga0209025_100031126 353
715 3300025294 Ga0209025_1000571 Ga0209025_100057138 353
716 3300025294 Ga0209025_1004070 Ga0209025_10040705 353
717 3300025294 Ga0209025_1005154 Ga0209025_10051547 353
718 3300025294 Ga0209025_1007774 Ga0209025_10077744 353
719 3300025294 Ga0209025_1013223 Ga0209025_10132232 353
720 3300025295 Ga0209564_1000013 Ga0209564_1000013115 353
721 3300025295 Ga0209564_1000386 Ga0209564_100038637 353
722 3300025295 Ga0209564_1000424 Ga0209564_100042432 353
723 3300025295 Ga0209564_1000628 Ga0209564_100062853 353
724 3300025295 Ga0209564_1006484 Ga0209564_10064844 353
725 3300025295 Ga0209564_1010015 Ga0209564_10100154 353
726 3300025297 Ga0209758_1000094 Ga0209758_100009440 353
727 3300025297 Ga0209758_1000405 Ga0209758_100040545 353
728 3300025297 Ga0209758_1001271 Ga0209758_100127113 353
729 3300025297 Ga0209758_1004593 Ga0209758_10045934 353
730 3300025297 Ga0209758_1005305 Ga0209758_10053054 353
731 3300025297 Ga0209758_1005493 Ga0209758_10054937 353
732 3300025299 Ga0209256_1000396 Ga0209256_100039650 353
733 3300025299 Ga0209256_1000610 Ga0209256_100061013 353
734 3300025299 Ga0209256_1000717 Ga0209256_100071725 353
735 3300025299 Ga0209256_1000729 Ga0209256_100072921 353
736 3300025299 Ga0209256_1002535 Ga0209256_100253512 353
737 3300025299 Ga0209256_1004313 Ga0209256_10043137 353
738 3300025299 Ga0209256_1008506 Ga0209256_10085063 353
739 3300025302 Ga0207426_1000006 Ga0207426_1000006488 353
740 3300025302 Ga0207426_1000008 Ga0207426_1000008281 353
741 3300025302 Ga0207426_1000011 Ga0207426_1000011609 353
742 3300025302 Ga0207426_1000394 Ga0207426_100039463 353
743 3300025302 Ga0207426_1000449 Ga0207426_100044938 353
744 3300025303 Ga0209051_1000097 Ga0209051_1000097101 353
745 3300025303 Ga0209051_1003361 Ga0209051_10033619 353
746 3300025303 Ga0209051_1005942 Ga0209051_10059424 353
747 3300025303 Ga0209051_1006793 Ga0209051_10067937 353
748 3300025303 Ga0209051_1008328 Ga0209051_10083284 353
749 3300025304 Ga0209257_1005542 Ga0209257_10055428 353
750 3300025304 Ga0209257_1006157 Ga0209257_10061575 353
751 3300025949 Ga0207667_10062566 Ga0207667_100625662 353
752 3300025972 Ga0207668_10037900 Ga0207668_100379002 353
753 3300027111 Ga0209281_1000034 Ga0209281_1000034101 353
754 3300027111 Ga0209281_1000246 Ga0209281_100024680 353
755 3300027111 Ga0209281_1001017 Ga0209281_10010175 353
756 3300027312 Ga0209371_1001202 Ga0209371_100120210 353
757 3300027666 Ga0209282_1000062 Ga0209282_100006280 353
758 3300028379 Ga0268266_10088508 Ga0268266_100885082 353
759 3300028379 Ga0268266_10209118 Ga0268266_102091183 353
760 3300028794 Ga0307515_10009778 Ga0307515_1000977810 353
761 3300028794 Ga0307515_10042115 Ga0307515_100421153 353
762 3300030500 Ga0268256_1001146 Ga0268256_100114610 353
763 3300031456 Ga0307513_10044354 Ga0307513_100443542 353
764 3300031548 Ga0307408_100009284 Ga0307408_1000092846 353
765 3300031731 Ga0307405_10002545 Ga0307405_100025452 353
766 3300031901 Ga0307406_10055375 Ga0307406_100553753 353
767 3300031911 Ga0307412_10002336 Ga0307412_100023368 353
768 3300031967 Ga0315914_1000015 Ga0315914_1000015106 353
769 3300031995 Ga0307409_100370347 Ga0307409_1003703471 353
770 3300032004 Ga0307414_10067218 Ga0307414_100672183 353
771 3300033430 Ga0315913_1000021 Ga0315913_10000215 353
772 3300033464 Ga0315915_1000020 Ga0315915_1000020106 353
773 3300041404 Ga0439436_0001599 Ga0439436_0001599_4954_6015 353
774 3300041413 Ga0439465_0009631 Ga0439465_0009631_320_1381 353
775 3300041413 Ga0439465_0029260 Ga0439465_0029260_184_1245 353
776 3300041413 Ga0439465_0030199 Ga0439465_0030199_202_1263 353
777 3300041452 Ga0451793_1772810 Ga0451793_1772810_559_1620 353
778 3300041501 Ga0451845_0195281 Ga0451845_0195281_713_1774 353
779 3300041503 Ga0451847_0446455 Ga0451847_0446455_374_1435 353
780 3300041507 Ga0451851_1052628 Ga0451851_1052628_739_1800 353
781 3300042010 Ga0439452_013276 Ga0439452_013276_812_1873 353
782 3300046460 Ga0495638_0000906 Ga0495638_0000906_4337_5398 353
783 3300046460 Ga0495638_0082376 Ga0495638_0082376_445_1506 353
784 3300046474 Ga0495605_0002717 Ga0495605_0002717_4039_5100 353
785 3300046506 Ga0495583_0011472 Ga0495583_0011472_1074_2135 353
786 3300046512 Ga0495610_0014280 Ga0495610_0014280_3096_4157 353
787 3300046512 Ga0495610_0043889 Ga0495610_0043889_312_1373 353
788 3300046515 Ga0495620_0018446 Ga0495620_0018446_1652_2713 353
789 3300046518 Ga0495631_0005338 Ga0495631_0005338_2587_3648 353
790 3300046519 Ga0495632_0017650 Ga0495632_0017650_2185_3246 353
791 3300046522 Ga0495643_0050441 Ga0495643_0050441_150_1211 353
792 3300046530 Ga0495654_0004493 Ga0495654_0004493_3532_4593 353
793 3300046557 Ga0495622_0010093 Ga0495622_0010093_2858_3919 353
794 3300046558 Ga0495633_0037090 Ga0495633_0037090_815_1876 353
795 3300046615 Ga0495656_0004719 Ga0495656_0004719_739_1800 353
796 3300046616 Ga0495668_0031693 Ga0495668_0031693_1109_2170 353
797 3300046616 Ga0495668_0062438 Ga0495668_0062438_315_1376 353
798 3300046648 Ga0495611_0012471 Ga0495611_0012471_2162_3223 353
799 3300046660 Ga0495625_0010469 Ga0495625_0010469_415_1476 353
800 3300046810 Ga0495660_0057445 Ga0495660_0057445_965_2026 353
801 3300047317 Ga0495604_0034898 Ga0495604_0034898_953_2014 353
802 3300047470 Ga0495681_0043481 Ga0495681_0043481_142_1203 353
803 3300047472 Ga0495686_0049209 Ga0495686_0049209_1208_2269 353
804 3300048090 Ga0495615_0003975 Ga0495615_0003975_754_1815 353
805 3300048905 Ga0496102_0005350 Ga0496102_0005350_2120_3181 353
806 3300048909 Ga0496106_0016765 Ga0496106_0016765_1943_3004 353
807 3300048919 Ga0496116_0010778 Ga0496116_0010778_845_1906 353
808 3300048919 Ga0496116_0029595 Ga0496116_0029595_2490_3551 353
809 3300048919 Ga0496116_0034646 Ga0496116_0034646_2409_3470 353
810 3300048920 Ga0496117_0009152 Ga0496117_0009152_7937_8998 353
811 3300048920 Ga0496117_0027005 Ga0496117_0027005_2249_3310 353
812 3300048920 Ga0496117_0035002 Ga0496117_0035002_2427_3488 353
813 3300048921 Ga0496118_0038147 Ga0496118_0038147_2089_3150 353
814 3300048921 Ga0496118_0056102 Ga0496118_0056102_1647_2708 353
815 3300048921 Ga0496118_0124907 Ga0496118_0124907_161_1222 353
816 3300048922 Ga0496119_0092384 Ga0496119_0092384_316_1377 353
817 3300048923 Ga0496120_0024689 Ga0496120_0024689_384_1445 353
818 3300048924 Ga0496121_0000003 Ga0496121_0000003_441456_442517 353
819 3300048924 Ga0496121_0005438 Ga0496121_0005438_11060_12121 353
820 3300048924 Ga0496121_0025478 Ga0496121_0025478_2597_3658 353
821 3300048924 Ga0496121_0029823 Ga0496121_0029823_2052_3113 353
822 3300048924 Ga0496121_0031672 Ga0496121_0031672_75_1136 353
823 3300048924 Ga0496121_0101951 Ga0496121_0101951_999_2060 353
824 3300048924 Ga0496121_0182870 Ga0496121_0182870_357_1418 353
825 3300048925 Ga0496122_0000215 Ga0496122_0000215_95883_96944 353
826 3300048925 Ga0496122_0000840 Ga0496122_0000840_15399_16460 353
827 3300048925 Ga0496122_0010915 Ga0496122_0010915_3675_4736 353
828 3300048925 Ga0496122_0018457 Ga0496122_0018457_926_1987 353
829 3300048925 Ga0496122_0033766 Ga0496122_0033766_2838_3899 353
830 3300048926 Ga0496123_0000306 Ga0496123_0000306_31867_32928 353
831 3300048926 Ga0496123_0000336 Ga0496123_0000336_65893_66954 353
832 3300048926 Ga0496123_0012309 Ga0496123_0012309_4393_5454 353
833 3300048927 Ga0496124_0011348 Ga0496124_0011348_2385_3446 353
834 3300048927 Ga0496124_0012281 Ga0496124_0012281_5963_7024 353
835 3300048927 Ga0496124_0015820 Ga0496124_0015820_5346_6407 353
836 3300048927 Ga0496124_0129154 Ga0496124_0129154_360_1421 353
837 3300048927 Ga0496124_0143643 Ga0496124_0143643_423_1484 353
838 3300048927 Ga0496124_0186966 Ga0496124_0186966_100_1161 353
839 3300048928 Ga0496125_0000039 Ga0496125_0000039_219699_220760 353
840 3300048928 Ga0496125_0000248 Ga0496125_0000248_45144_46205 353
841 3300048928 Ga0496125_0010334 Ga0496125_0010334_1491_2552 353
842 3300048928 Ga0496125_0018248 Ga0496125_0018248_3288_4349 353
843 3300048929 Ga0496126_0001356 Ga0496126_0001356_1758_2819 353
844 3300048929 Ga0496126_0042751 Ga0496126_0042751_1894_2955 353
845 3300048929 Ga0496126_0314580 Ga0496126_0314580_165_1226 353
846 3300049568 Ga0501031_0089662 Ga0501031_0089662_109_1170 353
847 3300049570 Ga0501033_0000327 Ga0501033_0000327_37634_38698 353
848 3300049822 Ga0501035_0001644 Ga0501035_0001644_10639_11703 353
849 3300050491 nmdc:mga00v17_45_c1 nmdc:mga00v17_45_c1_31921_32982 353
850 3300050492 nmdc:mga0yw44_6155_c1 nmdc:mga0yw44_6155_c1_2189_3250 353
851 3300050493 nmdc:mga0k408_1579_c1 nmdc:mga0k408_1579_c1_4044_5105 353
852 3300050516 nmdc:mga0sz30_11646_c1 nmdc:mga0sz30_11646_c1_1270_2331 353
853 3300053085 Ga0495619_0029077 Ga0495619_0029077_808_1869 353
854 3300053109 Ga0500569_001579 Ga0500569_001579_3047_4108 353
855 3300053118 Ga0500594_0010271 Ga0500594_0010271_405_1466 353
856 3300053121 Ga0500607_057030 Ga0500607_057030_652_1713 353
857 3300053125 Ga0500618_000233 Ga0500618_000233_27248_28309 353
858 3300053125 Ga0500618_007956 Ga0500618_007956_694_1755 353
859 3300053125 Ga0500618_028501 Ga0500618_028501_29_1090 353
860 3300053134 Ga0500658_0002650 Ga0500658_0002650_4978_6039 353
861 3300053151 Ga0500604_0003689 Ga0500604_0003689_1267_2328 353
862 3300053153 Ga0500616_0000102 Ga0500616_0000102_145265_146326 353
863 3300053153 Ga0500616_0001640 Ga0500616_0001640_6372_7433 353
864 3300053153 Ga0500616_0034202 Ga0500616_0034202_392_1453 353
865 3300053156 Ga0500622_0008185 Ga0500622_0008185_2329_3390 353

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

38

164

0.98

PF08402

TOBE_2

TOBE domain

278

353

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9534 3 222
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9439 4 225
6z67-assembly2.cif.gz_B ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution 0.9436 1 218
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9436 3 211
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9388 1 218
ID Description Score Start End Superfamily
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9767 2 217 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9756 4 216 3.40.50.300
af_Q47538_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9681 4 217 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9667 4 227 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9635 2 217 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A2N5A791-F1-model_v4 Fe3+/spermidine/putrescine ABC transporter ATP-binding protein 0.9821 1 213 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A2N5A791-F1-model_v4 Fe3+/spermidine/putrescine ABC transporter ATP-binding protein 0.9775 1 213 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A382V5S9-F1-model_v4 ABC transporter domain-containing protein 0.9753 48 191 GO:0005524
GO:0016887
GO:0055052
AF-A0A3M1A2L0-F1-model_v4 ATP-binding cassette domain-containing protein 0.975 1 209 GO:0005524
GO:0015423
GO:0016887
GO:0055052
GO:1990060
AF-A0A661S1Z9-F1-model_v4 Iron ABC transporter ATP-binding protein 0.9749 4 227 GO:0005524
GO:0005886
GO:0015408
GO:0016887

Feature Viewer

pLDDT pTM Quality
84.53 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map