F483807

General Info

Members Datasets Scaffolds Average Seq Length
860 313 1720 44

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100059068|Ga0075431_1000590682
Length 51
Sequence VIDSAAAMDNDIAKRLLWSGLLAGLGALASIATTRVAATIWRRVFGEDPPE

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
79 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
87 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
185 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
191 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
205 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
206 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
207 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
208 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
209 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
210 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
217 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
218 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
219 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
222 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
223 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
224 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
229 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
233 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
234 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
235 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
247 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
248 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
252 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
253 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
254 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
255 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
280 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
307 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.42
Metatranscriptomes 0.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 0
Rhizoplane 9.65
Rhizosphere 88.72
Stem 0
Stem Tuber 0
Unclassified 8.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100059068 3300006847 Bacteria 3958
2 JGI24739J22299_10113864 3300001989 Bacteria 811
3 JGI24737J22298_10170314 3300001990 Unclassified 643
4 JGI24743J22301_10090629 3300001991 Bacteria 651
5 JGI24735J21928_10159442 3300002067 Bacteria 652
6 JGI24748J21848_1057719 3300002074 Unclassified 515
7 JGI24738J21930_10077873 3300002075 Bacteria 692
8 JGI24744J21845_10037077 3300002077 Bacteria 919
9 JGI24034J26672_10036117 3300002239 Bacteria 818
10 Ga0070658_11417022 3300005327 Bacteria 603
11 Ga0070676_10045573 3300005328 Bacteria 2554
12 Ga0070683_100003364 3300005329 Bacteria 12958
13 Ga0070683_100030285 3300005329 Bacteria 4910
14 Ga0070683_100102120 3300005329 Bacteria 2701
15 Ga0070683_100372257 3300005329 Bacteria 1361
16 Ga0070683_100543352 3300005329 Bacteria 1111
17 Ga0070683_100950939 3300005329 Bacteria 824
18 Ga0070683_101473289 3300005329 Bacteria 654
19 Ga0070690_100176840 3300005330 Bacteria 1473
20 Ga0070690_101042540 3300005330 Unclassified 646
21 Ga0070670_100180335 3300005331 Bacteria 1833
22 Ga0070670_100504868 3300005331 Bacteria 1076
23 Ga0070670_101113790 3300005331 Bacteria 720
24 Ga0068869_100004339 3300005334 Bacteria 8806
25 Ga0070666_10687793 3300005335 Bacteria 750
26 Ga0070680_100980341 3300005336 Bacteria 730
27 Ga0070682_100004144 3300005337 Bacteria 8042
28 Ga0070682_100177099 3300005337 Bacteria 1486
29 Ga0070682_100579107 3300005337 Bacteria 883
30 Ga0068868_100009206 3300005338 Bacteria 7096
31 Ga0068868_100230445 3300005338 Bacteria 1554
32 Ga0068868_100546117 3300005338 Bacteria 1021
33 Ga0068868_101153807 3300005338 Bacteria 715
34 Ga0068868_101184459 3300005338 Bacteria 706
35 Ga0070660_101627556 3300005339 Bacteria 550
36 Ga0070689_100054887 3300005340 Bacteria 3085
37 Ga0070689_100775946 3300005340 Bacteria 841
38 Ga0070689_101254231 3300005340 Bacteria 666
39 Ga0070689_101961177 3300005340 Bacteria 535
40 Ga0070691_10017850 3300005341 Bacteria 3265
41 Ga0070691_10315209 3300005341 Bacteria 859
42 Ga0070687_100164050 3300005343 Bacteria 1316
43 Ga0070687_100686563 3300005343 Bacteria 714
44 Ga0070661_100022961 3300005344 Bacteria 4469
45 Ga0070661_100311373 3300005344 Bacteria 1228
46 Ga0070661_100571484 3300005344 Bacteria 911
47 Ga0070661_100717272 3300005344 Bacteria 816
48 Ga0070661_101309632 3300005344 Bacteria 608
49 Ga0070661_101741777 3300005344 Bacteria 528
50 Ga0070692_10070418 3300005345 Bacteria 1862
51 Ga0070692_10091462 3300005345 Bacteria 1654
52 Ga0070668_100036847 3300005347 Bacteria 3733
53 Ga0070668_101571751 3300005347 Unclassified 602
54 Ga0070669_100213615 3300005353 Bacteria 1523
55 Ga0070669_100563993 3300005353 Bacteria 951
56 Ga0070675_100078191 3300005354 Bacteria 2754
57 Ga0070671_100025974 3300005355 Bacteria 4810
58 Ga0070671_101947860 3300005355 Bacteria 523
59 Ga0070674_100033368 3300005356 Bacteria 3426
60 Ga0070674_100275496 3300005356 Bacteria 1331
61 Ga0070674_100343688 3300005356 Bacteria 1203
62 Ga0070674_100438440 3300005356 Bacteria 1076
63 Ga0070674_102077061 3300005356 Bacteria 518
64 Ga0070673_100040754 3300005364 Bacteria 3565
65 Ga0070673_100321171 3300005364 Bacteria 1367
66 Ga0070673_102137939 3300005364 Unclassified 532
67 Ga0070688_100234796 3300005365 Bacteria 1299
68 Ga0070688_100453401 3300005365 Bacteria 959
69 Ga0070688_100528190 3300005365 Bacteria 894
70 Ga0070659_100011202 3300005366 Bacteria 6626
71 Ga0070659_100551377 3300005366 Bacteria 987
72 Ga0070659_100612156 3300005366 Bacteria 937
73 Ga0070659_101494504 3300005366 Bacteria 602
74 Ga0070659_101577912 3300005366 Bacteria 586
75 Ga0070659_101959608 3300005366 Bacteria 526
76 Ga0070667_100930187 3300005367 Bacteria 810
77 Ga0070667_101392397 3300005367 Bacteria 658
78 Ga0070709_10309373 3300005434 Bacteria 1156
79 Ga0070714_100399798 3300005435 Bacteria 1298
80 Ga0070710_10039731 3300005437 Bacteria 2590
81 Ga0070701_10065585 3300005438 Bacteria 1927
82 Ga0070701_10334854 3300005438 Bacteria 941
83 Ga0070711_100169502 3300005439 Bacteria 1663
84 Ga0070705_100811388 3300005440 Bacteria 745
85 Ga0070705_101416667 3300005440 Unclassified 580
86 Ga0070705_101463372 3300005440 Bacteria 571
87 Ga0070700_100000725 3300005441 Bacteria 16282
88 Ga0070700_100212871 3300005441 Bacteria 1365
89 Ga0070700_100307334 3300005441 Bacteria 1160
90 Ga0070700_100323178 3300005441 Bacteria 1134
91 Ga0070700_100423067 3300005441 Bacteria 1007
92 Ga0070700_101035550 3300005441 Bacteria 677
93 Ga0070700_101767076 3300005441 Unclassified 532
94 Ga0070694_100473039 3300005444 Bacteria 993
95 Ga0070694_100996070 3300005444 Viruses 695
96 Ga0070694_101687454 3300005444 Bacteria 539
97 Ga0070708_102053999 3300005445 Bacteria 529
98 Ga0070663_100011110 3300005455 Bacteria 5639
99 Ga0070663_100118780 3300005455 Bacteria 1995
100 Ga0070663_100144550 3300005455 Bacteria 1819
101 Ga0070663_100200853 3300005455 Bacteria 1556
102 Ga0070663_100274254 3300005455 Bacteria 1342
103 Ga0070678_100400788 3300005456 Bacteria 1192
104 Ga0070678_100438461 3300005456 Bacteria 1142
105 Ga0070678_100694892 3300005456 Bacteria 916
106 Ga0070678_100831596 3300005456 Unclassified 840
107 Ga0070678_100939729 3300005456 Bacteria 792
108 Ga0070662_100005581 3300005457 Bacteria 8040
109 Ga0070662_100411756 3300005457 Bacteria 1117
110 Ga0070662_100924323 3300005457 Bacteria 745
111 Ga0070662_101379105 3300005457 Bacteria 607
112 Ga0070681_11608693 3300005458 Bacteria 575
113 Ga0068867_101340400 3300005459 Bacteria 662
114 Ga0068867_101353930 3300005459 Bacteria 659
115 Ga0070685_10052163 3300005466 Bacteria 2366
116 Ga0070685_10108068 3300005466 Bacteria 1709
117 Ga0070685_10124260 3300005466 Bacteria 1606
118 Ga0070685_10761949 3300005466 Bacteria 710
119 Ga0070707_101951782 3300005468 Unclassified 554
120 Ga0070699_100276684 3300005518 Bacteria 1503
121 Ga0070699_100705281 3300005518 Bacteria 922
122 Ga0070679_100795609 3300005530 Bacteria 889
123 Ga0070679_100966888 3300005530 Bacteria 795
124 Ga0070679_101240842 3300005530 Bacteria 691
125 Ga0070679_102062190 3300005530 Bacteria 520
126 Ga0070684_100002579 3300005535 Bacteria 13383
127 Ga0070684_100335967 3300005535 Bacteria 1388
128 Ga0070684_100395114 3300005535 Bacteria 1274
129 Ga0070684_100708122 3300005535 Bacteria 939
130 Ga0070684_100862786 3300005535 Bacteria 847
131 Ga0070684_101030281 3300005535 Bacteria 773
132 Ga0070684_101740949 3300005535 Bacteria 588
133 Ga0068853_100047121 3300005539 Bacteria 3699
134 Ga0068853_100512279 3300005539 Bacteria 1133
135 Ga0068853_100815826 3300005539 Bacteria 894
136 Ga0068853_100991053 3300005539 Bacteria 809
137 Ga0070672_100139346 3300005543 Bacteria 1999
138 Ga0070672_101407933 3300005543 Unclassified 624
139 Ga0070672_102143341 3300005543 Bacteria 504
140 Ga0070686_100217176 3300005544 Bacteria 1380
141 Ga0070686_100231177 3300005544 Bacteria 1341
142 Ga0070686_101061670 3300005544 Bacteria 667
143 Ga0070695_100494615 3300005545 Bacteria 945
144 Ga0070695_101573823 3300005545 Bacteria 548
145 Ga0070696_100503634 3300005546 Bacteria 964
146 Ga0070696_100879159 3300005546 Bacteria 742
147 Ga0070696_101917615 3300005546 Bacteria 513
148 Ga0070665_100465109 3300005548 Bacteria 1275
149 Ga0070665_100527188 3300005548 Bacteria 1193
150 Ga0070665_101024133 3300005548 Bacteria 838
151 Ga0070704_100052346 3300005549 Bacteria 2880
152 Ga0070704_100058336 3300005549 Bacteria 2749
153 Ga0070704_100812957 3300005549 Bacteria 836
154 Ga0070704_100816547 3300005549 Viruses 834
155 Ga0070704_101291436 3300005549 Unclassified 667
156 Ga0068855_100490730 3300005563 Bacteria 1336
157 Ga0070664_100005360 3300005564 Bacteria 10295
158 Ga0070664_100078580 3300005564 Bacteria 2838
159 Ga0070664_101558399 3300005564 Bacteria 626
160 Ga0068857_100082739 3300005577 Bacteria 2867
161 Ga0068857_100316399 3300005577 Bacteria 1441
162 Ga0068857_100872698 3300005577 Bacteria 862
163 Ga0068854_100349509 3300005578 Bacteria 1210
164 Ga0068854_100596392 3300005578 Bacteria 943
165 Ga0068854_101211568 3300005578 Bacteria 677
166 Ga0068854_101999343 3300005578 Unclassified 534
167 Ga0068856_100012491 3300005614 Bacteria 8221
168 Ga0068856_100204937 3300005614 Bacteria 1987
169 Ga0068856_100600500 3300005614 Bacteria 1122
170 Ga0068856_101796278 3300005614 Bacteria 625
171 Ga0070702_100054986 3300005615 Bacteria 2293
172 Ga0070702_100107469 3300005615 Bacteria 1723
173 Ga0070702_100182386 3300005615 Bacteria 1375
174 Ga0070702_100314456 3300005615 Bacteria 1089
175 Ga0070702_100341287 3300005615 Bacteria 1051
176 Ga0070702_101117131 3300005615 Bacteria 631
177 Ga0068852_100390075 3300005616 Bacteria 1368
178 Ga0068852_100622532 3300005616 Bacteria 1085
179 Ga0068852_101164514 3300005616 Bacteria 792
180 Ga0068852_102523188 3300005616 Unclassified 534
181 Ga0068859_100049463 3300005617 Bacteria 4221
182 Ga0068859_100078582 3300005617 Bacteria 3340
183 Ga0068864_100074645 3300005618 Bacteria 2959
184 Ga0068864_100225623 3300005618 Bacteria 1730
185 Ga0068864_100253862 3300005618 Bacteria 1633
186 Ga0068864_100413391 3300005618 Bacteria 1284
187 Ga0068866_10092451 3300005718 Bacteria 1650
188 Ga0068866_10256627 3300005718 Bacteria 1072
189 Ga0068866_10556560 3300005718 Bacteria 768
190 Ga0068866_10748333 3300005718 Bacteria 675
191 Ga0068866_11286947 3300005718 Bacteria 531
192 Ga0068866_11308613 3300005718 Bacteria 527
193 Ga0068861_100818393 3300005719 Bacteria 875
194 Ga0068861_102197204 3300005719 Bacteria 553
195 Ga0068861_102229081 3300005719 Bacteria 549
196 Ga0068861_102442662 3300005719 Bacteria 526
197 Ga0068870_10044810 3300005840 Bacteria 2312
198 Ga0068870_10296854 3300005840 Bacteria 1019
199 Ga0068870_10507331 3300005840 Bacteria 805
200 Ga0068863_100146057 3300005841 Bacteria 2262
201 Ga0068863_101137126 3300005841 Bacteria 786
202 Ga0068858_100331309 3300005842 Bacteria 1456
203 Ga0068858_100380290 3300005842 Bacteria 1355
204 Ga0068858_100745705 3300005842 Bacteria 954
205 Ga0068860_101173602 3300005843 Bacteria 788
206 Ga0068862_100191432 3300005844 Bacteria 1841
207 Ga0068862_100879207 3300005844 Bacteria 880
208 Ga0068862_101479653 3300005844 Bacteria 684
209 Ga0081455_10289922 3300005937 Bacteria 1179
210 Ga0081455_10927850 3300005937 Bacteria 541
211 Ga0081538_10030904 3300005981 Bacteria 3625
212 Ga0081538_10053449 3300005981 Bacteria 2401
213 Ga0081538_10190255 3300005981 Bacteria 862
214 Ga0081540_1060351 3300005983 Bacteria 1814
215 Ga0081539_10053688 3300005985 Bacteria 2254
216 Ga0070712_100001793 3300006175 Bacteria 13129
217 Ga0097621_101880526 3300006237 Unclassified 571
218 Ga0068871_100627562 3300006358 Bacteria 979
219 Ga0068871_100752424 3300006358 Bacteria 896
220 Ga0068871_101637770 3300006358 Bacteria 610
221 Ga0075428_100908508 3300006844 Bacteria 934
222 Ga0075430_100486137 3300006846 Bacteria 1019
223 Ga0075430_100858927 3300006846 Bacteria 748
224 Ga0075431_100355216 3300006847 Bacteria 1473
225 Ga0075433_10094042 3300006852 Bacteria 2652
226 Ga0075434_100030506 3300006871 Bacteria 5309
227 Ga0068865_100228935 3300006881 Bacteria 1457
228 Ga0068865_101692897 3300006881 Bacteria 570
229 Ga0075436_100169248 3300006914 Bacteria 1543
230 Ga0075436_101248756 3300006914 Unclassified 561
231 Ga0097620_100049470 3300006931 Bacteria 4221
232 Ga0097620_100078585 3300006931 Bacteria 3340
233 Ga0075435_100315995 3300007076 Bacteria 1337
234 Ga0111539_10012124 3300009094 Bacteria 10814
235 Ga0111539_10252149 3300009094 Bacteria 2055
236 Ga0111539_10479415 3300009094 Bacteria 1449
237 Ga0111539_10566930 3300009094 Bacteria 1322
238 Ga0111539_12220650 3300009094 Bacteria 637
239 Ga0111539_12732823 3300009094 Bacteria 572
240 Ga0105245_10003793 3300009098 Bacteria 13443
241 Ga0105245_10575130 3300009098 Bacteria 1151
242 Ga0105245_11124903 3300009098 Bacteria 832
243 Ga0105245_11181245 3300009098 Bacteria 813
244 Ga0105245_12250886 3300009098 Unclassified 599
245 Ga0105245_12411450 3300009098 Bacteria 579
246 Ga0105247_10023757 3300009101 Bacteria 3694
247 Ga0114129_10850915 3300009147 Bacteria 1159
248 Ga0114129_11683547 3300009147 Bacteria 774
249 Ga0114129_13142138 3300009147 Unclassified 539
250 Ga0105243_10033540 3300009148 Bacteria 3971
251 Ga0105243_11028374 3300009148 Bacteria 828
252 Ga0105243_11057933 3300009148 Unclassified 817
253 Ga0105243_11496373 3300009148 Bacteria 699
254 Ga0105243_11521345 3300009148 Bacteria 693
255 Ga0105243_11918093 3300009148 Bacteria 625
256 Ga0105241_10777085 3300009174 Bacteria 880
257 Ga0105241_12347539 3300009174 Bacteria 531
258 Ga0105242_10363572 3300009176 Bacteria 1340
259 Ga0105242_10667585 3300009176 Bacteria 1013
260 Ga0105242_11669387 3300009176 Bacteria 672
261 Ga0105242_13237938 3300009176 Unclassified 506
262 Ga0105248_10326665 3300009177 Bacteria 1728
263 Ga0105248_10338949 3300009177 Bacteria 1693
264 Ga0105248_10571026 3300009177 Bacteria 1276
265 Ga0105248_11054305 3300009177 Bacteria 919
266 Ga0105248_12574178 3300009177 Unclassified 580
267 Ga0105237_11029469 3300009545 Bacteria 830
268 Ga0105238_10241500 3300009551 Bacteria 1784
269 Ga0105238_11148441 3300009551 Bacteria 800
270 Ga0105238_11406495 3300009551 Bacteria 725
271 Ga0105249_10065418 3300009553 Bacteria 3345
272 Ga0105249_10252736 3300009553 Bacteria 1748
273 Ga0105249_10572425 3300009553 Bacteria 1182
274 Ga0105249_10708291 3300009553 Bacteria 1067
275 Ga0105249_12535618 3300009553 Bacteria 585
276 Ga0105249_13002101 3300009553 Bacteria 542
277 Ga0105249_13037325 3300009553 Bacteria 539
278 Ga0105239_10018542 3300010375 Bacteria 7686
279 Ga0105239_10110841 3300010375 Bacteria 3042
280 Ga0105239_10955273 3300010375 Bacteria 985
281 Ga0105239_11457845 3300010375 Bacteria 791
282 Ga0105239_12132581 3300010375 Bacteria 651
283 Ga0105239_12932832 3300010375 Bacteria 556
284 Ga0105246_10028806 3300011119 Bacteria 3650
285 Ga0105246_10247761 3300011119 Bacteria 1412
286 Ga0105246_10496215 3300011119 Bacteria 1036
287 Ga0157373_11104311 3300013100 Bacteria 595
288 Ga0157369_10319247 3300013105 Bacteria 1615
289 Ga0157369_10386682 3300013105 Bacteria 1452
290 Ga0157369_10597544 3300013105 Bacteria 1139
291 Ga0157374_10010432 3300013296 Bacteria 7988
292 Ga0157378_10171561 3300013297 Bacteria 2034
293 Ga0157378_11289057 3300013297 Unclassified 771
294 Ga0163162_10111752 3300013306 Bacteria 2830
295 Ga0163162_12156172 3300013306 Bacteria 639
296 Ga0157372_10028184 3300013307 Bacteria 6128
297 Ga0157372_11035858 3300013307 Bacteria 950
298 Ga0157372_11218980 3300013307 Bacteria 869
299 Ga0157372_11555618 3300013307 Bacteria 762
300 Ga0157372_12492440 3300013307 Bacteria 594
301 Ga0157375_10194810 3300013308 Bacteria 2181
302 Ga0157375_10783370 3300013308 Bacteria 1103
303 Ga0157375_12436003 3300013308 Bacteria 625
304 Ga0157375_12448384 3300013308 Unclassified 623
305 Ga0157375_13029451 3300013308 Bacteria 561
306 Ga0163163_10022430 3300014325 Bacteria 5978
307 Ga0163163_10475159 3300014325 Bacteria 1311
308 Ga0163163_10897289 3300014325 Bacteria 950
309 Ga0163163_11565804 3300014325 Bacteria 720
310 Ga0163163_12629867 3300014325 Unclassified 561
311 Ga0157380_11656612 3300014326 Archaea 696
312 Ga0182008_10845877 3300014497 Bacteria 534
313 Ga0157377_10001593 3300014745 Bacteria 9867
314 Ga0157377_10275000 3300014745 Bacteria 1101
315 Ga0157377_10486070 3300014745 Bacteria 860
316 Ga0157377_10508990 3300014745 Bacteria 843
317 Ga0157377_10754501 3300014745 Bacteria 712
318 Ga0157379_10137012 3300014968 Bacteria 2206
319 Ga0157379_10313769 3300014968 Bacteria 1431
320 Ga0157379_10505544 3300014968 Bacteria 1120
321 Ga0157379_11973811 3300014968 Bacteria 576
322 Ga0157376_10898434 3300014969 Bacteria 904
323 Ga0157376_11640908 3300014969 Bacteria 678
324 Ga0163161_11418270 3300017792 Bacteria 607
325 Ga0197907_11261504 3300020069 Unclassified 574
326 Ga0206356_11286675 3300020070 Unclassified 513
327 Ga0206354_11055289 3300020081 Bacteria 757
328 Ga0206353_10113409 3300020082 Bacteria 1238
329 Ga0206353_12052774 3300020082 Bacteria 1174
330 Ga0207642_10041079 3300025899 Bacteria 2023
331 Ga0207642_10871906 3300025899 Bacteria 575
332 Ga0207642_10969720 3300025899 Bacteria 547
333 Ga0207710_10009727 3300025900 Bacteria 4041
334 Ga0207710_10563030 3300025900 Bacteria 594
335 Ga0207688_10002392 3300025901 Bacteria 10104
336 Ga0207688_10468215 3300025901 Bacteria 787
337 Ga0207685_10207104 3300025905 Bacteria 925
338 Ga0207699_10405140 3300025906 Bacteria 972
339 Ga0207645_10404323 3300025907 Bacteria 919
340 Ga0207645_11236256 3300025907 Bacteria 501
341 Ga0207643_10004969 3300025908 Bacteria 7114
342 Ga0207705_11435052 3300025909 Bacteria 524
343 Ga0207705_11527108 3300025909 Bacteria 505
344 Ga0207671_10816324 3300025914 Bacteria 739
345 Ga0207693_10014638 3300025915 Bacteria 6302
346 Ga0207693_10403142 3300025915 Bacteria 1069
347 Ga0207663_10181201 3300025916 Bacteria 1505
348 Ga0207660_10290407 3300025917 Bacteria 1300
349 Ga0207660_10496059 3300025917 Bacteria 990
350 Ga0207660_11117041 3300025917 Bacteria 642
351 Ga0207662_10184090 3300025918 Bacteria 1345
352 Ga0207657_10025519 3300025919 Bacteria 5448
353 Ga0207649_10444680 3300025920 Bacteria 977
354 Ga0207649_10446558 3300025920 Bacteria 975
355 Ga0207649_10663575 3300025920 Bacteria 807
356 Ga0207649_11112230 3300025920 Bacteria 623
357 Ga0207649_11492485 3300025920 Bacteria 535
358 Ga0207652_10694483 3300025921 Bacteria 908
359 Ga0207652_10990257 3300025921 Bacteria 739
360 Ga0207652_11620487 3300025921 Bacteria 551
361 Ga0207646_10806392 3300025922 Bacteria 836
362 Ga0207681_10242777 3300025923 Bacteria 1403
363 Ga0207681_11346801 3300025923 Unclassified 599
364 Ga0207694_10286754 3300025924 Bacteria 1353
365 Ga0207650_10656646 3300025925 Bacteria 884
366 Ga0207650_10673371 3300025925 Bacteria 873
367 Ga0207687_10004429 3300025927 Bacteria 9366
368 Ga0207687_10163284 3300025927 Bacteria 1711
369 Ga0207687_10524177 3300025927 Bacteria 991
370 Ga0207664_10475768 3300025929 Bacteria 1117
371 Ga0207644_10026304 3300025931 Bacteria 4008
372 Ga0207644_10265007 3300025931 Bacteria 1375
373 Ga0207690_10058571 3300025932 Bacteria 2606
374 Ga0207690_10689219 3300025932 Bacteria 839
375 Ga0207690_10866600 3300025932 Bacteria 748
376 Ga0207690_11808096 3300025932 Bacteria 510
377 Ga0207706_10012645 3300025933 Bacteria 7683
378 Ga0207706_10162487 3300025933 Bacteria 1963
379 Ga0207706_10485433 3300025933 Bacteria 1067
380 Ga0207686_10630471 3300025934 Bacteria 846
381 Ga0207686_11648921 3300025934 Unclassified 530
382 Ga0207709_10034999 3300025935 Bacteria 2965
383 Ga0207709_10658704 3300025935 Bacteria 834
384 Ga0207670_10065355 3300025936 Bacteria 2496
385 Ga0207669_10020442 3300025937 Bacteria 3473
386 Ga0207669_10149086 3300025937 Bacteria 1636
387 Ga0207669_10294395 3300025937 Bacteria 1231
388 Ga0207669_11286426 3300025937 Unclassified 621
389 Ga0207669_11484519 3300025937 Bacteria 578
390 Ga0207704_10102734 3300025938 Bacteria 1910
391 Ga0207704_11424857 3300025938 Bacteria 594
392 Ga0207704_11529040 3300025938 Bacteria 573
393 Ga0207691_10290421 3300025940 Bacteria 1406
394 Ga0207711_10058626 3300025941 Bacteria 3314
395 Ga0207711_10193005 3300025941 Bacteria 1856
396 Ga0207711_10781826 3300025941 Bacteria 889
397 Ga0207689_10021865 3300025942 Bacteria 5379
398 Ga0207689_10138658 3300025942 Bacteria 2003
399 Ga0207689_11566637 3300025942 Unclassified 549
400 Ga0207661_10055395 3300025944 Bacteria 3181
401 Ga0207661_10068752 3300025944 Bacteria 2885
402 Ga0207661_10415650 3300025944 Bacteria 1221
403 Ga0207661_10685116 3300025944 Bacteria 942
404 Ga0207661_10837073 3300025944 Bacteria 847
405 Ga0207661_11286074 3300025944 Bacteria 672
406 Ga0207661_11357430 3300025944 Bacteria 653
407 Ga0207661_11409317 3300025944 Bacteria 639
408 Ga0207661_11989906 3300025944 Unclassified 527
409 Ga0207679_10096421 3300025945 Bacteria 2301
410 Ga0207679_10714075 3300025945 Bacteria 910
411 Ga0207651_11281441 3300025960 Unclassified 659
412 Ga0207712_10440331 3300025961 Bacteria 1103
413 Ga0207712_10515279 3300025961 Bacteria 1024
414 Ga0207668_10083223 3300025972 Bacteria 2328
415 Ga0207640_10207134 3300025981 Bacteria 1491
416 Ga0207640_10565915 3300025981 Bacteria 957
417 Ga0207640_11418934 3300025981 Bacteria 622
418 Ga0207658_10479942 3300025986 Bacteria 1105
419 Ga0207677_10013870 3300026023 Bacteria 4684
420 Ga0207677_10237779 3300026023 Bacteria 1471
421 Ga0207677_10558074 3300026023 Bacteria 999
422 Ga0207703_10127661 3300026035 Bacteria 2192
423 Ga0207703_10259390 3300026035 Bacteria 1570
424 Ga0207639_10031537 3300026041 Bacteria 3896
425 Ga0207639_11076381 3300026041 Bacteria 754
426 Ga0207678_10003308 3300026067 Bacteria 14531
427 Ga0207678_10043285 3300026067 Bacteria 3896
428 Ga0207678_10148321 3300026067 Bacteria 2002
429 Ga0207678_10226749 3300026067 Unclassified 1600
430 Ga0207678_10244212 3300026067 Bacteria 1538
431 Ga0207678_10291504 3300026067 Bacteria 1402
432 Ga0207678_10330746 3300026067 Bacteria 1312
433 Ga0207678_11630949 3300026067 Viruses 568
434 Ga0207708_10000223 3300026075 Bacteria 45098
435 Ga0207708_10096209 3300026075 Bacteria 2288
436 Ga0207708_10158190 3300026075 Bacteria 1788
437 Ga0207708_10462261 3300026075 Bacteria 1059
438 Ga0207708_10614600 3300026075 Bacteria 922
439 Ga0207708_11107345 3300026075 Bacteria 691
440 Ga0207702_10018637 3300026078 Bacteria 5743
441 Ga0207702_11755770 3300026078 Bacteria 613
442 Ga0207702_12513588 3300026078 Bacteria 501
443 Ga0207648_10650486 3300026089 Bacteria 974
444 Ga0207648_11350818 3300026089 Unclassified 670
445 Ga0207676_10032235 3300026095 Bacteria 3947
446 Ga0207676_10280570 3300026095 Bacteria 1512
447 Ga0207676_10396414 3300026095 Bacteria 1289
448 Ga0207676_11797949 3300026095 Unclassified 611
449 Ga0207674_10050164 3300026116 Bacteria 4264
450 Ga0207674_10306994 3300026116 Bacteria 1536
451 Ga0207674_10323431 3300026116 Bacteria 1492
452 Ga0207674_10358654 3300026116 Bacteria 1409
453 Ga0207674_11731449 3300026116 Bacteria 593
454 Ga0207674_11849238 3300026116 Unclassified 570
455 Ga0207675_101061100 3300026118 Bacteria 829
456 Ga0207675_101915829 3300026118 Unclassified 611
457 Ga0207675_101930133 3300026118 Bacteria 609
458 Ga0207675_102599002 3300026118 Bacteria 516
459 Ga0207683_10180676 3300026121 Bacteria 1913
460 Ga0207683_10589247 3300026121 Bacteria 1029
461 Ga0207683_11076223 3300026121 Bacteria 746
462 Ga0207683_11346830 3300026121 Bacteria 660
463 Ga0207683_11927156 3300026121 Bacteria 540
464 Ga0207698_10445231 3300026142 Bacteria 1249
465 Ga0207698_11584654 3300026142 Unclassified 670
466 Ga0207428_10038288 3300027907 Bacteria 3899
467 Ga0207428_10081645 3300027907 Bacteria 2524
468 Ga0207428_10111442 3300027907 Bacteria 2105
469 Ga0268266_10262857 3300028379 Bacteria 1600
470 Ga0268266_10393423 3300028379 Bacteria 1309
471 Ga0268265_11608788 3300028380 Bacteria 655
472 Ga0268264_11037763 3300028381 Bacteria 827
473 Ga0268264_11155057 3300028381 Bacteria 783
474 Ga0307408_100461522 3300031548 Bacteria 1104
475 Ga0307408_100859599 3300031548 Bacteria 828
476 Ga0307405_11334185 3300031731 Bacteria 625
477 Ga0307405_11544097 3300031731 Unclassified 584
478 Ga0307405_11641511 3300031731 Bacteria 568
479 Ga0307405_11915954 3300031731 Unclassified 529
480 Ga0307413_10027975 3300031824 Bacteria 3133
481 Ga0307413_10755248 3300031824 Bacteria 813
482 Ga0307413_11047184 3300031824 Bacteria 702
483 Ga0307413_11166297 3300031824 Bacteria 668
484 Ga0307410_10442322 3300031852 Bacteria 1059
485 Ga0307410_10560513 3300031852 Bacteria 948
486 Ga0307410_10942192 3300031852 Bacteria 742
487 Ga0307410_11348605 3300031852 Unclassified 625
488 Ga0307406_10494426 3300031901 Bacteria 990
489 Ga0307406_11003686 3300031901 Bacteria 716
490 Ga0307406_11015463 3300031901 Unclassified 712
491 Ga0307406_11808509 3300031901 Unclassified 543
492 Ga0307407_10030192 3300031903 Bacteria 2922
493 Ga0307407_10171739 3300031903 Bacteria 1429
494 Ga0307407_10177282 3300031903 Bacteria 1409
495 Ga0307407_10184832 3300031903 Bacteria 1384
496 Ga0307407_10413798 3300031903 Bacteria 970
497 Ga0307407_10415023 3300031903 Bacteria 969
498 Ga0307407_10931353 3300031903 Bacteria 668
499 Ga0307412_11488533 3300031911 Bacteria 615
500 Ga0307409_100112952 3300031995 Bacteria 2282
501 Ga0307409_100164326 3300031995 Bacteria 1946
502 Ga0307409_100328097 3300031995 Bacteria 1435
503 Ga0307409_100342563 3300031995 Bacteria 1407
504 Ga0307409_100855196 3300031995 Bacteria 921
505 Ga0307409_101397006 3300031995 Bacteria 726
506 Ga0307409_102778575 3300031995 Bacteria 517
507 Ga0307416_100061457 3300032002 Bacteria 3066
508 Ga0307416_100117913 3300032002 Bacteria 2358
509 Ga0307416_100449161 3300032002 Bacteria 1341
510 Ga0307416_100876761 3300032002 Bacteria 997
511 Ga0307416_100899342 3300032002 Bacteria 985
512 Ga0307416_101073592 3300032002 Unclassified 909
513 Ga0307416_102722135 3300032002 Unclassified 591
514 Ga0307414_10326146 3300032004 Bacteria 1309
515 Ga0307414_11056240 3300032004 Unclassified 749
516 Ga0307414_12042603 3300032004 Unclassified 535
517 Ga0307414_12241412 3300032004 Bacteria 510
518 Ga0307411_10097709 3300032005 Bacteria 2068
519 Ga0307411_10164823 3300032005 Bacteria 1665
520 Ga0307411_10291196 3300032005 Bacteria 1305
521 Ga0307411_10787887 3300032005 Bacteria 836
522 Ga0307415_100100640 3300032126 Bacteria 2119
523 Ga0307415_100131929 3300032126 Bacteria 1893
524 Ga0307415_100439317 3300032126 Bacteria 1125
525 Ga0307415_100646652 3300032126 Bacteria 947
526 Ga0307415_100810573 3300032126 Bacteria 855
527 Ga0307415_100949402 3300032126 Bacteria 796
528 Ga0307415_101960018 3300032126 Unclassified 570
529 Ga0373950_0155533 3300034818 Unclassified 526
530 Ga0373952_0065712 3300035092 Bacteria 897
531 Ga0373943_0862660 3300035170 Unclassified 540
532 Ga0373931_0082028 3300035691 Bacteria 1782
533 Ga0373947_0761158 3300035725 Bacteria 661
534 Ga0395899_0347670 3300037312 Bacteria 993
535 Ga0395900_0182798 3300037418 Bacteria 2130
536 Ga0395900_0665849 3300037418 Bacteria 977
537 Ga0395900_0740621 3300037418 Bacteria 914
538 Ga0395898_0214091 3300037466 Bacteria 1838
539 Ga0395898_0355614 3300037466 Unclassified 1397
540 Ga0395898_0418501 3300037466 Bacteria 1277
541 Ga0395898_0578658 3300037466 Bacteria 1065
542 Ga0395898_0636306 3300037466 Bacteria 1009
543 Ga0395898_0902247 3300037466 Bacteria 822
544 Ga0395898_1328314 3300037466 Bacteria 648
545 Ga0395905_1852938 3300037471 Bacteria 509
546 Ga0395901_0079885 3300038443 Bacteria 3415
547 Ga0395901_0237609 3300038443 Bacteria 1901
548 Ga0395901_0263552 3300038443 Bacteria 1793
549 Ga0395901_0274250 3300038443 Bacteria 1754
550 Ga0395901_0438248 3300038443 Bacteria 1338
551 Ga0395901_0450206 3300038443 Bacteria 1317
552 Ga0395901_0453814 3300038443 Bacteria 1311
553 Ga0395901_0793874 3300038443 Bacteria 936
554 Ga0395901_0828441 3300038443 Bacteria 912
555 Ga0395901_1268352 3300038443 Unclassified 700
556 Ga0395901_1409354 3300038443 Bacteria 655
557 Ga0395901_1466749 3300038443 Bacteria 639
558 Ga0436365_0389345 3300039437 Bacteria 1047
559 Ga0436363_0411358 3300039450 Unclassified 566
560 Ga0436363_0605939 3300039450 Bacteria 1027
561 Ga0436363_1337803 3300039450 Bacteria 3159
562 Ga0436362_0465695 3300039453 Bacteria 607
563 Ga0451800_0297536 3300041459 Unclassified 589
564 Ga0451800_0593088 3300041459 Bacteria 716
565 Ga0451807_2364767 3300041486 Bacteria 697
566 Ga0451833_1341614 3300041491 Unclassified 504
567 Ga0451839_1370762 3300041496 Bacteria 507
568 Ga0451851_1100163 3300041507 Bacteria 520
569 Ga0451853_0538419 3300041512 Bacteria 2308
570 Ga0451853_2649890 3300041512 Bacteria 719
571 Ga0451853_3557683 3300041512 Bacteria 751
572 Ga0439440_0112973 3300042993 Bacteria 749
573 Ga0466969_0281303 3300044656 Bacteria 753
574 Ga0466965_0439752 3300044683 Bacteria 725
575 Ga0466965_0749913 3300044683 Bacteria 563
576 Ga0466966_0131173 3300044684 Bacteria 1534
577 Ga0466966_0987982 3300044684 Bacteria 508
578 Ga0466961_0099590 3300044693 Bacteria 1832
579 Ga0466961_0106005 3300044693 Bacteria 1769
580 Ga0466963_1147716 3300044694 Unclassified 546
581 Ga0466968_0034731 3300044735 Bacteria 2106
582 Ga0466970_0593563 3300044765 Unclassified 642
583 Ga0466957_0476501 3300044842 Bacteria 863
584 Ga0466960_0102881 3300044901 Bacteria 1474
585 Ga0466960_0311373 3300044901 Bacteria 889
586 Ga0466960_0383704 3300044901 Bacteria 807
587 Ga0466960_0455079 3300044901 Bacteria 744
588 Ga0466960_0575391 3300044901 Unclassified 667
589 Ga0466960_0594098 3300044901 Bacteria 656
590 Ga0466960_0843932 3300044901 Bacteria 556
591 Ga0466959_0055361 3300045049 Bacteria 2896
592 Ga0466959_0977723 3300045049 Bacteria 564
593 Ga0466958_0136168 3300045836 Bacteria 1544
594 Ga0466967_0063114 3300045976 Bacteria 3291
595 Ga0466967_0080243 3300045976 Bacteria 2943
596 Ga0466967_0175522 3300045976 Bacteria 2019
597 Ga0466967_0417056 3300045976 Bacteria 1308
598 Ga0466967_0463876 3300045976 Bacteria 1239
599 Ga0466967_0688255 3300045976 Unclassified 1012
600 Ga0466967_1038317 3300045976 Bacteria 816
601 Ga0466967_1402526 3300045976 Bacteria 696
602 Ga0495590_0155166 3300046457 Bacteria 831
603 Ga0495582_0485169 3300046473 Bacteria 714
604 Ga0495605_0410840 3300046474 Bacteria 562
605 Ga0495584_0719611 3300046491 Bacteria 509
606 Ga0495594_0277599 3300046499 Bacteria 955
607 Ga0495596_0209004 3300046500 Bacteria 758
608 Ga0495596_0234787 3300046500 Bacteria 712
609 Ga0495596_0365072 3300046500 Unclassified 562
610 Ga0495620_0308825 3300046515 Bacteria 601
611 Ga0495628_0182897 3300046516 Bacteria 1585
612 Ga0495630_1441111 3300046517 Bacteria 517
613 Ga0495631_0168022 3300046518 Bacteria 941
614 Ga0495631_0296098 3300046518 Bacteria 689
615 Ga0495637_0288973 3300046520 Unclassified 584
616 Ga0495644_0360597 3300046523 Unclassified 573
617 Ga0495642_0563328 3300046528 Bacteria 506
618 Ga0495652_0550770 3300046529 Bacteria 793
619 Ga0495597_0347205 3300046542 Bacteria 570
620 Ga0495656_0354371 3300046615 Bacteria 761
621 Ga0495658_0400254 3300046683 Unclassified 875
622 Ga0495669_0149337 3300046684 Bacteria 1106
623 Ga0495670_0697110 3300046691 Unclassified 554
624 Ga0495660_0338313 3300046810 Bacteria 672
625 Ga0495604_0530157 3300047317 Bacteria 761
626 Ga0495676_0659712 3300047321 Bacteria 678
627 Ga0495677_0183276 3300047445 Bacteria 812
628 Ga0495602_1135348 3300048088 Unclassified 511
629 Ga0495626_0321868 3300048091 Bacteria 608
630 Ga0496100_0018409 3300048903 Bacteria 4142
631 Ga0496100_0044556 3300048903 Bacteria 2842
632 Ga0496100_0481490 3300048903 Bacteria 954
633 Ga0496100_1038560 3300048903 Bacteria 645
634 Ga0496101_0011802 3300048904 Bacteria 5811
635 Ga0496101_0096343 3300048904 Bacteria 2208
636 Ga0496101_0115575 3300048904 Bacteria 2024
637 Ga0496101_0339147 3300048904 Bacteria 1180
638 Ga0496102_0041832 3300048905 Bacteria 4151
639 Ga0496102_0465227 3300048905 Bacteria 1185
640 Ga0496102_0639989 3300048905 Bacteria 986
641 Ga0496103_0065677 3300048906 Bacteria 2263
642 Ga0496103_0074970 3300048906 Bacteria 2121
643 Ga0496103_0139235 3300048906 Bacteria 1551
644 Ga0496103_0328020 3300048906 Bacteria 984
645 Ga0496104_0011039 3300048907 Bacteria 8081
646 Ga0496104_0051261 3300048907 Bacteria 3895
647 Ga0496104_0252952 3300048907 Bacteria 1675
648 Ga0496104_0995275 3300048907 Bacteria 742
649 Ga0496105_0014234 3300048908 Bacteria 6330
650 Ga0496105_0015696 3300048908 Bacteria 6043
651 Ga0496105_0067318 3300048908 Bacteria 2957
652 Ga0496105_0467802 3300048908 Bacteria 993
653 Ga0496106_0012681 3300048909 Bacteria 6227
654 Ga0496106_0204406 3300048909 Bacteria 1572
655 Ga0496106_0289282 3300048909 Bacteria 1314
656 Ga0496106_0343681 3300048909 Bacteria 1198
657 Ga0496106_0383362 3300048909 Bacteria 1129
658 Ga0496107_0012713 3300048910 Bacteria 5881
659 Ga0496107_0092348 3300048910 Bacteria 2213
660 Ga0496107_0130846 3300048910 Bacteria 1852
661 Ga0496107_1156340 3300048910 Unclassified 557
662 Ga0496108_0018821 3300048911 Bacteria 5661
663 Ga0496108_0081580 3300048911 Bacteria 2741
664 Ga0496108_0083401 3300048911 Bacteria 2711
665 Ga0496108_0352844 3300048911 Bacteria 1284
666 Ga0496108_0449463 3300048911 Bacteria 1126
667 Ga0496108_1037461 3300048911 Bacteria 699
668 Ga0496108_1262810 3300048911 Bacteria 622
669 Ga0496108_1366936 3300048911 Bacteria 593
670 Ga0496108_1729868 3300048911 Bacteria 514
671 Ga0496109_0008670 3300048912 Bacteria 8654
672 Ga0496109_0043470 3300048912 Bacteria 4072
673 Ga0496109_0119002 3300048912 Bacteria 2459
674 Ga0496109_0180079 3300048912 Bacteria 1985
675 Ga0496109_0469493 3300048912 Bacteria 1188
676 Ga0496109_0486824 3300048912 Bacteria 1164
677 Ga0496109_0589343 3300048912 Bacteria 1048
678 Ga0496110_0010520 3300048913 Bacteria 7532
679 Ga0496110_0093312 3300048913 Bacteria 2694
680 Ga0496110_0120681 3300048913 Bacteria 2361
681 Ga0496110_0819313 3300048913 Bacteria 835
682 Ga0496110_1498506 3300048913 Bacteria 584
683 Ga0496111_0108175 3300048914 Bacteria 2047
684 Ga0496111_0214409 3300048914 Bacteria 1430
685 Ga0496111_0324367 3300048914 Bacteria 1140
686 Ga0496111_0803074 3300048914 Bacteria 681
687 Ga0496111_0855706 3300048914 Bacteria 656
688 Ga0496111_0925888 3300048914 Bacteria 627
689 Ga0496112_0031493 3300048915 Bacteria 5145
690 Ga0496112_0037174 3300048915 Bacteria 4753
691 Ga0496112_0088192 3300048915 Bacteria 3070
692 Ga0496112_0114117 3300048915 Bacteria 2672
693 Ga0496112_0128576 3300048915 Bacteria 2504
694 Ga0496112_0168765 3300048915 Bacteria 2154
695 Ga0496112_0265209 3300048915 Bacteria 1666
696 Ga0496112_1408023 3300048915 Unclassified 612
697 Ga0496113_0010848 3300048916 Bacteria 6046
698 Ga0496113_0020041 3300048916 Bacteria 4693
699 Ga0496113_0044473 3300048916 Bacteria 3290
700 Ga0496113_0187041 3300048916 Bacteria 1643
701 Ga0496113_0395971 3300048916 Bacteria 1109
702 Ga0496113_0697110 3300048916 Bacteria 810
703 Ga0496114_0288174 3300048917 Bacteria 1448
704 Ga0496114_0503942 3300048917 Bacteria 1071
705 Ga0496114_0645165 3300048917 Bacteria 931
706 Ga0496115_0093375 3300048918 Bacteria 2460
707 Ga0496115_0431610 3300048918 Bacteria 1066
708 Ga0496115_0691453 3300048918 Bacteria 803
709 Ga0496115_1031880 3300048918 Bacteria 627
710 Ga0501031_0063258 3300049568 Bacteria 2411
711 Ga0501031_0079305 3300049568 Bacteria 2139
712 Ga0501031_0283778 3300049568 Bacteria 1074
713 Ga0501031_0963615 3300049568 Bacteria 545
714 Ga0501032_0006135 3300049569 Bacteria 8849
715 Ga0501032_0327075 3300049569 Bacteria 989
716 Ga0501032_0655841 3300049569 Bacteria 666
717 Ga0501033_0006624 3300049570 Bacteria 9057
718 Ga0501034_0039234 3300049571 Bacteria 4796
719 Ga0501036_0009782 3300049572 Bacteria 7896
720 Ga0501036_0042871 3300049572 Bacteria 3831
721 Ga0501036_0487903 3300049572 Bacteria 1025
722 Ga0501037_0407871 3300049573 Bacteria 931
723 Ga0501037_0426186 3300049573 Bacteria 907
724 Ga0501038_0006494 3300049574 Bacteria 10823
725 Ga0501038_0068576 3300049574 Bacteria 3014
726 Ga0501038_0397048 3300049574 Bacteria 1067
727 Ga0501038_0598736 3300049574 Bacteria 834
728 Ga0501039_0007952 3300049575 Bacteria 8074
729 Ga0501039_0086869 3300049575 Bacteria 2436
730 Ga0501039_0142621 3300049575 Bacteria 1882
731 Ga0501039_0194396 3300049575 Bacteria 1595
732 Ga0501039_0507784 3300049575 Bacteria 947
733 Ga0501039_0946940 3300049575 Bacteria 670
734 Ga0501040_0037878 3300049576 Bacteria 3278
735 Ga0501040_0071499 3300049576 Bacteria 2395
736 Ga0501040_0254254 3300049576 Bacteria 1253
737 Ga0501041_0042699 3300049577 Bacteria 2756
738 Ga0501041_0087916 3300049577 Bacteria 1918
739 Ga0501041_0142808 3300049577 Bacteria 1493
740 Ga0501041_0163007 3300049577 Bacteria 1394
741 Ga0501042_0041153 3300049578 Bacteria 3285
742 Ga0501042_0090823 3300049578 Bacteria 2192
743 Ga0501042_0103394 3300049578 Bacteria 2049
744 Ga0501042_0113228 3300049578 Bacteria 1953
745 Ga0501042_0271841 3300049578 Bacteria 1224
746 Ga0501042_0629266 3300049578 Bacteria 780
747 Ga0501043_0214423 3300049579 Bacteria 1491
748 Ga0501046_0009601 3300049580 Bacteria 8348
749 Ga0501046_0103808 3300049580 Bacteria 2179
750 Ga0501046_0213300 3300049580 Bacteria 1432
751 Ga0501046_0656047 3300049580 Bacteria 741
752 Ga0501047_0766219 3300049581 Bacteria 780
753 Ga0501048_0038928 3300049582 Bacteria 3412
754 Ga0501048_0154485 3300049582 Bacteria 1623
755 Ga0501048_0261127 3300049582 Bacteria 1230
756 Ga0501048_0384380 3300049582 Bacteria 1002
757 Ga0501067_0001818 3300049583 Bacteria 11728
758 Ga0501067_0143821 3300049583 Bacteria 1328
759 Ga0501068_0019629 3300049584 Bacteria 3928
760 Ga0501068_1016879 3300049584 Bacteria 547
761 Ga0501069_0008018 3300049585 Bacteria 5548
762 Ga0501069_0360778 3300049585 Bacteria 857
763 Ga0501069_0468686 3300049585 Bacteria 750
764 Ga0501069_0757288 3300049585 Bacteria 587
765 Ga0501070_0013279 3300049586 Bacteria 6944
766 Ga0501070_0741261 3300049586 Bacteria 775
767 Ga0501070_0798459 3300049586 Bacteria 741
768 Ga0501071_0042005 3300049587 Bacteria 3275
769 Ga0501071_0042845 3300049587 Bacteria 3244
770 Ga0501071_0107284 3300049587 Bacteria 2062
771 Ga0501071_0113789 3300049587 Bacteria 2001
772 Ga0501071_0465478 3300049587 Bacteria 968
773 Ga0501071_0813517 3300049587 Bacteria 720
774 Ga0501072_0021721 3300049588 Bacteria 4979
775 Ga0501072_0032990 3300049588 Bacteria 4056
776 Ga0501072_0079545 3300049588 Bacteria 2596
777 Ga0501072_0133883 3300049588 Bacteria 1976
778 Ga0501072_0433769 3300049588 Unclassified 1041
779 Ga0501072_1061762 3300049588 Bacteria 631
780 Ga0501073_0002274 3300049589 Bacteria 14365
781 Ga0501073_0221907 3300049589 Bacteria 1306
782 Ga0501074_0002219 3300049590 Bacteria 13472
783 Ga0501074_0270335 3300049590 Bacteria 1208
784 Ga0501074_1069016 3300049590 Unclassified 567
785 Ga0501075_0036563 3300049591 Bacteria 3666
786 Ga0501075_0110637 3300049591 Bacteria 2088
787 Ga0501075_0167161 3300049591 Bacteria 1678
788 Ga0501075_0547118 3300049591 Bacteria 883
789 Ga0501075_0797617 3300049591 Unclassified 719
790 Ga0501076_0051538 3300049592 Bacteria 3258
791 Ga0501076_0064902 3300049592 Bacteria 2910
792 Ga0501076_0144721 3300049592 Bacteria 1932
793 Ga0501076_0241369 3300049592 Bacteria 1478
794 Ga0501076_0288370 3300049592 Bacteria 1345
795 Ga0501077_0059571 3300049593 Bacteria 2423
796 Ga0501077_0543387 3300049593 Bacteria 746
797 Ga0501077_0879244 3300049593 Bacteria 576
798 Ga0501079_0018589 3300049741 Bacteria 5309
799 Ga0501079_0093872 3300049741 Bacteria 2325
800 Ga0501079_0204822 3300049741 Bacteria 1541
801 Ga0501079_0391112 3300049741 Bacteria 1090
802 Ga0501080_0012558 3300049742 Bacteria 7767
803 Ga0501080_1678549 3300049742 Bacteria 536
804 Ga0501081_0316997 3300049743 Bacteria 1145
805 Ga0501081_0454928 3300049743 Bacteria 951
806 Ga0501081_1159613 3300049743 Bacteria 585
807 Ga0501081_1176364 3300049743 Bacteria 581
808 Ga0501083_0007155 3300049744 Bacteria 7921
809 Ga0501083_0423881 3300049744 Bacteria 866
810 Ga0501035_0004916 3300049822 Bacteria 12678
811 Ga0501035_0084036 3300049822 Bacteria 2808
812 Ga0501035_0761983 3300049822 Bacteria 776
813 Ga0501044_0005981 3300049823 Bacteria 13456
814 Ga0501044_0632164 3300049823 Bacteria 961
815 Ga0501044_0913730 3300049823 Bacteria 752
816 Ga0501045_0170202 3300049824 Bacteria 1622
817 Ga0501045_0201526 3300049824 Bacteria 1483
818 nmdc:mga0yw44_1067430_c1 3300050492 Unclassified 546
819 nmdc:mga05p37_1559571_c1 3300050507 Bacteria 653
820 nmdc:mga0qj67_1215225_c1 3300050509 Unclassified 586
821 nmdc:mga0qj67_787269_c1 3300050509 Bacteria 753
822 nmdc:mga06r32_1220247_c1 3300050510 Bacteria 698
823 nmdc:mga06r32_63064_c1 3300050510 Bacteria 3572
824 nmdc:mga06r32_643740_c1 3300050510 Bacteria 1028
825 nmdc:mga06r32_685579_c1 3300050510 Bacteria 991
826 nmdc:mga06r32_863589_c1 3300050510 Bacteria 863
827 nmdc:mga08y16_1330274_c1 3300050511 Bacteria 684
828 nmdc:mga08y16_14558_c1 3300050511 Bacteria 8272
829 nmdc:mga08y16_1982451_c1 3300050511 Bacteria 532
830 nmdc:mga08y16_245345_c1 3300050511 Bacteria 1851
831 nmdc:mga08y16_345179_c1 3300050511 Bacteria 1530
832 nmdc:mga08y16_434004_c1 3300050511 Bacteria 1341
833 nmdc:mga0n895_1263346_c1 3300050512 Bacteria 710
834 nmdc:mga0n895_28216_c1 3300050512 Bacteria 5339
835 nmdc:mga0rr50_1093252_c1 3300050513 Bacteria 678
836 nmdc:mga0rr50_1871690_c1 3300050513 Unclassified 504
837 nmdc:mga0rr50_515056_c1 3300050513 Bacteria 1018
838 nmdc:mga08x19_1035064_c1 3300050514 Unclassified 583
839 nmdc:mga0a205_1520960_c1 3300050515 Unclassified 517
840 nmdc:mga0a205_35193_c1 3300050515 Bacteria 4808
841 nmdc:mga0a205_482363_c1 3300050515 Bacteria 1098
842 Ga0495619_0916178 3300053085 Bacteria 589
843 Ga0500641_0090105 3300053096 Bacteria 1309
844 Ga0500556_0001821 3300053104 Bacteria 7822
845 Ga0500616_0018589 3300053153 Bacteria 3927
846 Ga0501084_0022628 3300054114 Bacteria 5245
847 Ga0501084_0075863 3300054114 Bacteria 2817
848 Ga0501084_0124164 3300054114 Bacteria 2171
849 Ga0501084_0556452 3300054114 Bacteria 969
850 Ga0501084_1810153 3300054114 Bacteria 510
851 Ga0501082_0004336 3300060353 Bacteria 12405
852 Ga0501082_0056127 3300060353 Bacteria 3392
853 Ga0501082_0075049 3300060353 Bacteria 2913
854 Ga0501082_0145124 3300060353 Bacteria 2060
855 Ga0501082_0556377 3300060353 Bacteria 1003
856 Ga0466962_0220004 3300061719 Bacteria 930
857 Ga0530510_0077234 3300061734 Bacteria 2420
858 Ga0530510_0082361 3300061734 Bacteria 2343
859 Ga0530510_0149434 3300061734 Bacteria 1724
860 Ga0530510_1457183 3300061734 Unclassified 526
861 Ga0075431_100059068
862 JGI24739J22299_10113864
863 JGI24737J22298_10170314
864 JGI24743J22301_10090629
865 JGI24735J21928_10159442
866 JGI24748J21848_1057719
867 JGI24738J21930_10077873
868 JGI24744J21845_10037077
869 JGI24034J26672_10036117
870 Ga0070658_11417022
871 Ga0070676_10045573
872 Ga0070683_100003364
873 Ga0070683_100030285
874 Ga0070683_100102120
875 Ga0070683_100372257
876 Ga0070683_100543352
877 Ga0070683_100950939
878 Ga0070683_101473289
879 Ga0070690_100176840
880 Ga0070690_101042540
881 Ga0070670_100180335
882 Ga0070670_100504868
883 Ga0070670_101113790
884 Ga0068869_100004339
885 Ga0070666_10687793
886 Ga0070680_100980341
887 Ga0070682_100004144
888 Ga0070682_100177099
889 Ga0070682_100579107
890 Ga0068868_100009206
891 Ga0068868_100230445
892 Ga0068868_100546117
893 Ga0068868_101153807
894 Ga0068868_101184459
895 Ga0070660_101627556
896 Ga0070689_100054887
897 Ga0070689_100775946
898 Ga0070689_101254231
899 Ga0070689_101961177
900 Ga0070691_10017850
901 Ga0070691_10315209
902 Ga0070687_100164050
903 Ga0070687_100686563
904 Ga0070661_100022961
905 Ga0070661_100311373
906 Ga0070661_100571484
907 Ga0070661_100717272
908 Ga0070661_101309632
909 Ga0070661_101741777
910 Ga0070692_10070418
911 Ga0070692_10091462
912 Ga0070668_100036847
913 Ga0070668_101571751
914 Ga0070669_100213615
915 Ga0070669_100563993
916 Ga0070675_100078191
917 Ga0070671_100025974
918 Ga0070671_101947860
919 Ga0070674_100033368
920 Ga0070674_100275496
921 Ga0070674_100343688
922 Ga0070674_100438440
923 Ga0070674_102077061
924 Ga0070673_100040754
925 Ga0070673_100321171
926 Ga0070673_102137939
927 Ga0070688_100234796
928 Ga0070688_100453401
929 Ga0070688_100528190
930 Ga0070659_100011202
931 Ga0070659_100551377
932 Ga0070659_100612156
933 Ga0070659_101494504
934 Ga0070659_101577912
935 Ga0070659_101959608
936 Ga0070667_100930187
937 Ga0070667_101392397
938 Ga0070709_10309373
939 Ga0070714_100399798
940 Ga0070710_10039731
941 Ga0070701_10065585
942 Ga0070701_10334854
943 Ga0070711_100169502
944 Ga0070705_100811388
945 Ga0070705_101416667
946 Ga0070705_101463372
947 Ga0070700_100000725
948 Ga0070700_100212871
949 Ga0070700_100307334
950 Ga0070700_100323178
951 Ga0070700_100423067
952 Ga0070700_101035550
953 Ga0070700_101767076
954 Ga0070694_100473039
955 Ga0070694_100996070
956 Ga0070694_101687454
957 Ga0070708_102053999
958 Ga0070663_100011110
959 Ga0070663_100118780
960 Ga0070663_100144550
961 Ga0070663_100200853
962 Ga0070663_100274254
963 Ga0070678_100400788
964 Ga0070678_100438461
965 Ga0070678_100694892
966 Ga0070678_100831596
967 Ga0070678_100939729
968 Ga0070662_100005581
969 Ga0070662_100411756
970 Ga0070662_100924323
971 Ga0070662_101379105
972 Ga0070681_11608693
973 Ga0068867_101340400
974 Ga0068867_101353930
975 Ga0070685_10052163
976 Ga0070685_10108068
977 Ga0070685_10124260
978 Ga0070685_10761949
979 Ga0070707_101951782
980 Ga0070699_100276684
981 Ga0070699_100705281
982 Ga0070679_100795609
983 Ga0070679_100966888
984 Ga0070679_101240842
985 Ga0070679_102062190
986 Ga0070684_100002579
987 Ga0070684_100335967
988 Ga0070684_100395114
989 Ga0070684_100708122
990 Ga0070684_100862786
991 Ga0070684_101030281
992 Ga0070684_101740949
993 Ga0068853_100047121
994 Ga0068853_100512279
995 Ga0068853_100815826
996 Ga0068853_100991053
997 Ga0070672_100139346
998 Ga0070672_101407933
999 Ga0070672_102143341
1000 Ga0070686_100217176
1001 Ga0070686_100231177
1002 Ga0070686_101061670
1003 Ga0070695_100494615
1004 Ga0070695_101573823
1005 Ga0070696_100503634
1006 Ga0070696_100879159
1007 Ga0070696_101917615
1008 Ga0070665_100465109
1009 Ga0070665_100527188
1010 Ga0070665_101024133
1011 Ga0070704_100052346
1012 Ga0070704_100058336
1013 Ga0070704_100812957
1014 Ga0070704_100816547
1015 Ga0070704_101291436
1016 Ga0068855_100490730
1017 Ga0070664_100005360
1018 Ga0070664_100078580
1019 Ga0070664_101558399
1020 Ga0068857_100082739
1021 Ga0068857_100316399
1022 Ga0068857_100872698
1023 Ga0068854_100349509
1024 Ga0068854_100596392
1025 Ga0068854_101211568
1026 Ga0068854_101999343
1027 Ga0068856_100012491
1028 Ga0068856_100204937
1029 Ga0068856_100600500
1030 Ga0068856_101796278
1031 Ga0070702_100054986
1032 Ga0070702_100107469
1033 Ga0070702_100182386
1034 Ga0070702_100314456
1035 Ga0070702_100341287
1036 Ga0070702_101117131
1037 Ga0068852_100390075
1038 Ga0068852_100622532
1039 Ga0068852_101164514
1040 Ga0068852_102523188
1041 Ga0068859_100049463
1042 Ga0068859_100078582
1043 Ga0068864_100074645
1044 Ga0068864_100225623
1045 Ga0068864_100253862
1046 Ga0068864_100413391
1047 Ga0068866_10092451
1048 Ga0068866_10256627
1049 Ga0068866_10556560
1050 Ga0068866_10748333
1051 Ga0068866_11286947
1052 Ga0068866_11308613
1053 Ga0068861_100818393
1054 Ga0068861_102197204
1055 Ga0068861_102229081
1056 Ga0068861_102442662
1057 Ga0068870_10044810
1058 Ga0068870_10296854
1059 Ga0068870_10507331
1060 Ga0068863_100146057
1061 Ga0068863_101137126
1062 Ga0068858_100331309
1063 Ga0068858_100380290
1064 Ga0068858_100745705
1065 Ga0068860_101173602
1066 Ga0068862_100191432
1067 Ga0068862_100879207
1068 Ga0068862_101479653
1069 Ga0081455_10289922
1070 Ga0081455_10927850
1071 Ga0081538_10030904
1072 Ga0081538_10053449
1073 Ga0081538_10190255
1074 Ga0081540_1060351
1075 Ga0081539_10053688
1076 Ga0070712_100001793
1077 Ga0097621_101880526
1078 Ga0068871_100627562
1079 Ga0068871_100752424
1080 Ga0068871_101637770
1081 Ga0075428_100908508
1082 Ga0075430_100486137
1083 Ga0075430_100858927
1084 Ga0075431_100355216
1085 Ga0075433_10094042
1086 Ga0075434_100030506
1087 Ga0068865_100228935
1088 Ga0068865_101692897
1089 Ga0075436_100169248
1090 Ga0075436_101248756
1091 Ga0097620_100049470
1092 Ga0097620_100078585
1093 Ga0075435_100315995
1094 Ga0111539_10012124
1095 Ga0111539_10252149
1096 Ga0111539_10479415
1097 Ga0111539_10566930
1098 Ga0111539_12220650
1099 Ga0111539_12732823
1100 Ga0105245_10003793
1101 Ga0105245_10575130
1102 Ga0105245_11124903
1103 Ga0105245_11181245
1104 Ga0105245_12250886
1105 Ga0105245_12411450
1106 Ga0105247_10023757
1107 Ga0114129_10850915
1108 Ga0114129_11683547
1109 Ga0114129_13142138
1110 Ga0105243_10033540
1111 Ga0105243_11028374
1112 Ga0105243_11057933
1113 Ga0105243_11496373
1114 Ga0105243_11521345
1115 Ga0105243_11918093
1116 Ga0105241_10777085
1117 Ga0105241_12347539
1118 Ga0105242_10363572
1119 Ga0105242_10667585
1120 Ga0105242_11669387
1121 Ga0105242_13237938
1122 Ga0105248_10326665
1123 Ga0105248_10338949
1124 Ga0105248_10571026
1125 Ga0105248_11054305
1126 Ga0105248_12574178
1127 Ga0105237_11029469
1128 Ga0105238_10241500
1129 Ga0105238_11148441
1130 Ga0105238_11406495
1131 Ga0105249_10065418
1132 Ga0105249_10252736
1133 Ga0105249_10572425
1134 Ga0105249_10708291
1135 Ga0105249_12535618
1136 Ga0105249_13002101
1137 Ga0105249_13037325
1138 Ga0105239_10018542
1139 Ga0105239_10110841
1140 Ga0105239_10955273
1141 Ga0105239_11457845
1142 Ga0105239_12132581
1143 Ga0105239_12932832
1144 Ga0105246_10028806
1145 Ga0105246_10247761
1146 Ga0105246_10496215
1147 Ga0157373_11104311
1148 Ga0157369_10319247
1149 Ga0157369_10386682
1150 Ga0157369_10597544
1151 Ga0157374_10010432
1152 Ga0157378_10171561
1153 Ga0157378_11289057
1154 Ga0163162_10111752
1155 Ga0163162_12156172
1156 Ga0157372_10028184
1157 Ga0157372_11035858
1158 Ga0157372_11218980
1159 Ga0157372_11555618
1160 Ga0157372_12492440
1161 Ga0157375_10194810
1162 Ga0157375_10783370
1163 Ga0157375_12436003
1164 Ga0157375_12448384
1165 Ga0157375_13029451
1166 Ga0163163_10022430
1167 Ga0163163_10475159
1168 Ga0163163_10897289
1169 Ga0163163_11565804
1170 Ga0163163_12629867
1171 Ga0157380_11656612
1172 Ga0182008_10845877
1173 Ga0157377_10001593
1174 Ga0157377_10275000
1175 Ga0157377_10486070
1176 Ga0157377_10508990
1177 Ga0157377_10754501
1178 Ga0157379_10137012
1179 Ga0157379_10313769
1180 Ga0157379_10505544
1181 Ga0157379_11973811
1182 Ga0157376_10898434
1183 Ga0157376_11640908
1184 Ga0163161_11418270
1185 Ga0197907_11261504
1186 Ga0206356_11286675
1187 Ga0206354_11055289
1188 Ga0206353_10113409
1189 Ga0206353_12052774
1190 Ga0207642_10041079
1191 Ga0207642_10871906
1192 Ga0207642_10969720
1193 Ga0207710_10009727
1194 Ga0207710_10563030
1195 Ga0207688_10002392
1196 Ga0207688_10468215
1197 Ga0207685_10207104
1198 Ga0207699_10405140
1199 Ga0207645_10404323
1200 Ga0207645_11236256
1201 Ga0207643_10004969
1202 Ga0207705_11435052
1203 Ga0207705_11527108
1204 Ga0207671_10816324
1205 Ga0207693_10014638
1206 Ga0207693_10403142
1207 Ga0207663_10181201
1208 Ga0207660_10290407
1209 Ga0207660_10496059
1210 Ga0207660_11117041
1211 Ga0207662_10184090
1212 Ga0207657_10025519
1213 Ga0207649_10444680
1214 Ga0207649_10446558
1215 Ga0207649_10663575
1216 Ga0207649_11112230
1217 Ga0207649_11492485
1218 Ga0207652_10694483
1219 Ga0207652_10990257
1220 Ga0207652_11620487
1221 Ga0207646_10806392
1222 Ga0207681_10242777
1223 Ga0207681_11346801
1224 Ga0207694_10286754
1225 Ga0207650_10656646
1226 Ga0207650_10673371
1227 Ga0207687_10004429
1228 Ga0207687_10163284
1229 Ga0207687_10524177
1230 Ga0207664_10475768
1231 Ga0207644_10026304
1232 Ga0207644_10265007
1233 Ga0207690_10058571
1234 Ga0207690_10689219
1235 Ga0207690_10866600
1236 Ga0207690_11808096
1237 Ga0207706_10012645
1238 Ga0207706_10162487
1239 Ga0207706_10485433
1240 Ga0207686_10630471
1241 Ga0207686_11648921
1242 Ga0207709_10034999
1243 Ga0207709_10658704
1244 Ga0207670_10065355
1245 Ga0207669_10020442
1246 Ga0207669_10149086
1247 Ga0207669_10294395
1248 Ga0207669_11286426
1249 Ga0207669_11484519
1250 Ga0207704_10102734
1251 Ga0207704_11424857
1252 Ga0207704_11529040
1253 Ga0207691_10290421
1254 Ga0207711_10058626
1255 Ga0207711_10193005
1256 Ga0207711_10781826
1257 Ga0207689_10021865
1258 Ga0207689_10138658
1259 Ga0207689_11566637
1260 Ga0207661_10055395
1261 Ga0207661_10068752
1262 Ga0207661_10415650
1263 Ga0207661_10685116
1264 Ga0207661_10837073
1265 Ga0207661_11286074
1266 Ga0207661_11357430
1267 Ga0207661_11409317
1268 Ga0207661_11989906
1269 Ga0207679_10096421
1270 Ga0207679_10714075
1271 Ga0207651_11281441
1272 Ga0207712_10440331
1273 Ga0207712_10515279
1274 Ga0207668_10083223
1275 Ga0207640_10207134
1276 Ga0207640_10565915
1277 Ga0207640_11418934
1278 Ga0207658_10479942
1279 Ga0207677_10013870
1280 Ga0207677_10237779
1281 Ga0207677_10558074
1282 Ga0207703_10127661
1283 Ga0207703_10259390
1284 Ga0207639_10031537
1285 Ga0207639_11076381
1286 Ga0207678_10003308
1287 Ga0207678_10043285
1288 Ga0207678_10148321
1289 Ga0207678_10226749
1290 Ga0207678_10244212
1291 Ga0207678_10291504
1292 Ga0207678_10330746
1293 Ga0207678_11630949
1294 Ga0207708_10000223
1295 Ga0207708_10096209
1296 Ga0207708_10158190
1297 Ga0207708_10462261
1298 Ga0207708_10614600
1299 Ga0207708_11107345
1300 Ga0207702_10018637
1301 Ga0207702_11755770
1302 Ga0207702_12513588
1303 Ga0207648_10650486
1304 Ga0207648_11350818
1305 Ga0207676_10032235
1306 Ga0207676_10280570
1307 Ga0207676_10396414
1308 Ga0207676_11797949
1309 Ga0207674_10050164
1310 Ga0207674_10306994
1311 Ga0207674_10323431
1312 Ga0207674_10358654
1313 Ga0207674_11731449
1314 Ga0207674_11849238
1315 Ga0207675_101061100
1316 Ga0207675_101915829
1317 Ga0207675_101930133
1318 Ga0207675_102599002
1319 Ga0207683_10180676
1320 Ga0207683_10589247
1321 Ga0207683_11076223
1322 Ga0207683_11346830
1323 Ga0207683_11927156
1324 Ga0207698_10445231
1325 Ga0207698_11584654
1326 Ga0207428_10038288
1327 Ga0207428_10081645
1328 Ga0207428_10111442
1329 Ga0268266_10262857
1330 Ga0268266_10393423
1331 Ga0268265_11608788
1332 Ga0268264_11037763
1333 Ga0268264_11155057
1334 Ga0307408_100461522
1335 Ga0307408_100859599
1336 Ga0307405_11334185
1337 Ga0307405_11544097
1338 Ga0307405_11641511
1339 Ga0307405_11915954
1340 Ga0307413_10027975
1341 Ga0307413_10755248
1342 Ga0307413_11047184
1343 Ga0307413_11166297
1344 Ga0307410_10442322
1345 Ga0307410_10560513
1346 Ga0307410_10942192
1347 Ga0307410_11348605
1348 Ga0307406_10494426
1349 Ga0307406_11003686
1350 Ga0307406_11015463
1351 Ga0307406_11808509
1352 Ga0307407_10030192
1353 Ga0307407_10171739
1354 Ga0307407_10177282
1355 Ga0307407_10184832
1356 Ga0307407_10413798
1357 Ga0307407_10415023
1358 Ga0307407_10931353
1359 Ga0307412_11488533
1360 Ga0307409_100112952
1361 Ga0307409_100164326
1362 Ga0307409_100328097
1363 Ga0307409_100342563
1364 Ga0307409_100855196
1365 Ga0307409_101397006
1366 Ga0307409_102778575
1367 Ga0307416_100061457
1368 Ga0307416_100117913
1369 Ga0307416_100449161
1370 Ga0307416_100876761
1371 Ga0307416_100899342
1372 Ga0307416_101073592
1373 Ga0307416_102722135
1374 Ga0307414_10326146
1375 Ga0307414_11056240
1376 Ga0307414_12042603
1377 Ga0307414_12241412
1378 Ga0307411_10097709
1379 Ga0307411_10164823
1380 Ga0307411_10291196
1381 Ga0307411_10787887
1382 Ga0307415_100100640
1383 Ga0307415_100131929
1384 Ga0307415_100439317
1385 Ga0307415_100646652
1386 Ga0307415_100810573
1387 Ga0307415_100949402
1388 Ga0307415_101960018
1389 Ga0373950_0155533
1390 Ga0373952_0065712
1391 Ga0373943_0862660
1392 Ga0373931_0082028
1393 Ga0373947_0761158
1394 Ga0395899_0347670
1395 Ga0395900_0182798
1396 Ga0395900_0665849
1397 Ga0395900_0740621
1398 Ga0395898_0214091
1399 Ga0395898_0355614
1400 Ga0395898_0418501
1401 Ga0395898_0578658
1402 Ga0395898_0636306
1403 Ga0395898_0902247
1404 Ga0395898_1328314
1405 Ga0395905_1852938
1406 Ga0395901_0079885
1407 Ga0395901_0237609
1408 Ga0395901_0263552
1409 Ga0395901_0274250
1410 Ga0395901_0438248
1411 Ga0395901_0450206
1412 Ga0395901_0453814
1413 Ga0395901_0793874
1414 Ga0395901_0828441
1415 Ga0395901_1268352
1416 Ga0395901_1409354
1417 Ga0395901_1466749
1418 Ga0436365_0389345
1419 Ga0436363_0411358
1420 Ga0436363_0605939
1421 Ga0436363_1337803
1422 Ga0436362_0465695
1423 Ga0451800_0297536
1424 Ga0451800_0593088
1425 Ga0451807_2364767
1426 Ga0451833_1341614
1427 Ga0451839_1370762
1428 Ga0451851_1100163
1429 Ga0451853_0538419
1430 Ga0451853_2649890
1431 Ga0451853_3557683
1432 Ga0439440_0112973
1433 Ga0466969_0281303
1434 Ga0466965_0439752
1435 Ga0466965_0749913
1436 Ga0466966_0131173
1437 Ga0466966_0987982
1438 Ga0466961_0099590
1439 Ga0466961_0106005
1440 Ga0466963_1147716
1441 Ga0466968_0034731
1442 Ga0466970_0593563
1443 Ga0466957_0476501
1444 Ga0466960_0102881
1445 Ga0466960_0311373
1446 Ga0466960_0383704
1447 Ga0466960_0455079
1448 Ga0466960_0575391
1449 Ga0466960_0594098
1450 Ga0466960_0843932
1451 Ga0466959_0055361
1452 Ga0466959_0977723
1453 Ga0466958_0136168
1454 Ga0466967_0063114
1455 Ga0466967_0080243
1456 Ga0466967_0175522
1457 Ga0466967_0417056
1458 Ga0466967_0463876
1459 Ga0466967_0688255
1460 Ga0466967_1038317
1461 Ga0466967_1402526
1462 Ga0495590_0155166
1463 Ga0495582_0485169
1464 Ga0495605_0410840
1465 Ga0495584_0719611
1466 Ga0495594_0277599
1467 Ga0495596_0209004
1468 Ga0495596_0234787
1469 Ga0495596_0365072
1470 Ga0495620_0308825
1471 Ga0495628_0182897
1472 Ga0495630_1441111
1473 Ga0495631_0168022
1474 Ga0495631_0296098
1475 Ga0495637_0288973
1476 Ga0495644_0360597
1477 Ga0495642_0563328
1478 Ga0495652_0550770
1479 Ga0495597_0347205
1480 Ga0495656_0354371
1481 Ga0495658_0400254
1482 Ga0495669_0149337
1483 Ga0495670_0697110
1484 Ga0495660_0338313
1485 Ga0495604_0530157
1486 Ga0495676_0659712
1487 Ga0495677_0183276
1488 Ga0495602_1135348
1489 Ga0495626_0321868
1490 Ga0496100_0018409
1491 Ga0496100_0044556
1492 Ga0496100_0481490
1493 Ga0496100_1038560
1494 Ga0496101_0011802
1495 Ga0496101_0096343
1496 Ga0496101_0115575
1497 Ga0496101_0339147
1498 Ga0496102_0041832
1499 Ga0496102_0465227
1500 Ga0496102_0639989
1501 Ga0496103_0065677
1502 Ga0496103_0074970
1503 Ga0496103_0139235
1504 Ga0496103_0328020
1505 Ga0496104_0011039
1506 Ga0496104_0051261
1507 Ga0496104_0252952
1508 Ga0496104_0995275
1509 Ga0496105_0014234
1510 Ga0496105_0015696
1511 Ga0496105_0067318
1512 Ga0496105_0467802
1513 Ga0496106_0012681
1514 Ga0496106_0204406
1515 Ga0496106_0289282
1516 Ga0496106_0343681
1517 Ga0496106_0383362
1518 Ga0496107_0012713
1519 Ga0496107_0092348
1520 Ga0496107_0130846
1521 Ga0496107_1156340
1522 Ga0496108_0018821
1523 Ga0496108_0081580
1524 Ga0496108_0083401
1525 Ga0496108_0352844
1526 Ga0496108_0449463
1527 Ga0496108_1037461
1528 Ga0496108_1262810
1529 Ga0496108_1366936
1530 Ga0496108_1729868
1531 Ga0496109_0008670
1532 Ga0496109_0043470
1533 Ga0496109_0119002
1534 Ga0496109_0180079
1535 Ga0496109_0469493
1536 Ga0496109_0486824
1537 Ga0496109_0589343
1538 Ga0496110_0010520
1539 Ga0496110_0093312
1540 Ga0496110_0120681
1541 Ga0496110_0819313
1542 Ga0496110_1498506
1543 Ga0496111_0108175
1544 Ga0496111_0214409
1545 Ga0496111_0324367
1546 Ga0496111_0803074
1547 Ga0496111_0855706
1548 Ga0496111_0925888
1549 Ga0496112_0031493
1550 Ga0496112_0037174
1551 Ga0496112_0088192
1552 Ga0496112_0114117
1553 Ga0496112_0128576
1554 Ga0496112_0168765
1555 Ga0496112_0265209
1556 Ga0496112_1408023
1557 Ga0496113_0010848
1558 Ga0496113_0020041
1559 Ga0496113_0044473
1560 Ga0496113_0187041
1561 Ga0496113_0395971
1562 Ga0496113_0697110
1563 Ga0496114_0288174
1564 Ga0496114_0503942
1565 Ga0496114_0645165
1566 Ga0496115_0093375
1567 Ga0496115_0431610
1568 Ga0496115_0691453
1569 Ga0496115_1031880
1570 Ga0501031_0063258
1571 Ga0501031_0079305
1572 Ga0501031_0283778
1573 Ga0501031_0963615
1574 Ga0501032_0006135
1575 Ga0501032_0327075
1576 Ga0501032_0655841
1577 Ga0501033_0006624
1578 Ga0501034_0039234
1579 Ga0501036_0009782
1580 Ga0501036_0042871
1581 Ga0501036_0487903
1582 Ga0501037_0407871
1583 Ga0501037_0426186
1584 Ga0501038_0006494
1585 Ga0501038_0068576
1586 Ga0501038_0397048
1587 Ga0501038_0598736
1588 Ga0501039_0007952
1589 Ga0501039_0086869
1590 Ga0501039_0142621
1591 Ga0501039_0194396
1592 Ga0501039_0507784
1593 Ga0501039_0946940
1594 Ga0501040_0037878
1595 Ga0501040_0071499
1596 Ga0501040_0254254
1597 Ga0501041_0042699
1598 Ga0501041_0087916
1599 Ga0501041_0142808
1600 Ga0501041_0163007
1601 Ga0501042_0041153
1602 Ga0501042_0090823
1603 Ga0501042_0103394
1604 Ga0501042_0113228
1605 Ga0501042_0271841
1606 Ga0501042_0629266
1607 Ga0501043_0214423
1608 Ga0501046_0009601
1609 Ga0501046_0103808
1610 Ga0501046_0213300
1611 Ga0501046_0656047
1612 Ga0501047_0766219
1613 Ga0501048_0038928
1614 Ga0501048_0154485
1615 Ga0501048_0261127
1616 Ga0501048_0384380
1617 Ga0501067_0001818
1618 Ga0501067_0143821
1619 Ga0501068_0019629
1620 Ga0501068_1016879
1621 Ga0501069_0008018
1622 Ga0501069_0360778
1623 Ga0501069_0468686
1624 Ga0501069_0757288
1625 Ga0501070_0013279
1626 Ga0501070_0741261
1627 Ga0501070_0798459
1628 Ga0501071_0042005
1629 Ga0501071_0042845
1630 Ga0501071_0107284
1631 Ga0501071_0113789
1632 Ga0501071_0465478
1633 Ga0501071_0813517
1634 Ga0501072_0021721
1635 Ga0501072_0032990
1636 Ga0501072_0079545
1637 Ga0501072_0133883
1638 Ga0501072_0433769
1639 Ga0501072_1061762
1640 Ga0501073_0002274
1641 Ga0501073_0221907
1642 Ga0501074_0002219
1643 Ga0501074_0270335
1644 Ga0501074_1069016
1645 Ga0501075_0036563
1646 Ga0501075_0110637
1647 Ga0501075_0167161
1648 Ga0501075_0547118
1649 Ga0501075_0797617
1650 Ga0501076_0051538
1651 Ga0501076_0064902
1652 Ga0501076_0144721
1653 Ga0501076_0241369
1654 Ga0501076_0288370
1655 Ga0501077_0059571
1656 Ga0501077_0543387
1657 Ga0501077_0879244
1658 Ga0501079_0018589
1659 Ga0501079_0093872
1660 Ga0501079_0204822
1661 Ga0501079_0391112
1662 Ga0501080_0012558
1663 Ga0501080_1678549
1664 Ga0501081_0316997
1665 Ga0501081_0454928
1666 Ga0501081_1159613
1667 Ga0501081_1176364
1668 Ga0501083_0007155
1669 Ga0501083_0423881
1670 Ga0501035_0004916
1671 Ga0501035_0084036
1672 Ga0501035_0761983
1673 Ga0501044_0005981
1674 Ga0501044_0632164
1675 Ga0501044_0913730
1676 Ga0501045_0170202
1677 Ga0501045_0201526
1678 nmdc:mga0yw44_1067430_c1
1679 nmdc:mga05p37_1559571_c1
1680 nmdc:mga0qj67_1215225_c1
1681 nmdc:mga0qj67_787269_c1
1682 nmdc:mga06r32_1220247_c1
1683 nmdc:mga06r32_63064_c1
1684 nmdc:mga06r32_643740_c1
1685 nmdc:mga06r32_685579_c1
1686 nmdc:mga06r32_863589_c1
1687 nmdc:mga08y16_1330274_c1
1688 nmdc:mga08y16_14558_c1
1689 nmdc:mga08y16_1982451_c1
1690 nmdc:mga08y16_245345_c1
1691 nmdc:mga08y16_345179_c1
1692 nmdc:mga08y16_434004_c1
1693 nmdc:mga0n895_1263346_c1
1694 nmdc:mga0n895_28216_c1
1695 nmdc:mga0rr50_1093252_c1
1696 nmdc:mga0rr50_1871690_c1
1697 nmdc:mga0rr50_515056_c1
1698 nmdc:mga08x19_1035064_c1
1699 nmdc:mga0a205_1520960_c1
1700 nmdc:mga0a205_35193_c1
1701 nmdc:mga0a205_482363_c1
1702 Ga0495619_0916178
1703 Ga0500641_0090105
1704 Ga0500556_0001821
1705 Ga0500616_0018589
1706 Ga0501084_0022628
1707 Ga0501084_0075863
1708 Ga0501084_0124164
1709 Ga0501084_0556452
1710 Ga0501084_1810153
1711 Ga0501082_0004336
1712 Ga0501082_0056127
1713 Ga0501082_0075049
1714 Ga0501082_0145124
1715 Ga0501082_0556377
1716 Ga0466962_0220004
1717 Ga0530510_0077234
1718 Ga0530510_0082361
1719 Ga0530510_0149434
1720 Ga0530510_1457183

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map