F483763

General Info

Members Datasets Scaffolds Average Seq Length
859 423 1718 115

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100076996|Ga0070683_1000769964
Length 122
Sequence MSRLTYTASLLTAVVAAWPGAWLGPASAQPFAPTDGLHSPPFTATLSNNTPLAFGMAVEDASRALGTPLNYIRGRPGDEIYLAFRNIGGSGLFFQKHRLYLQFRKGRLAGWKGDWGQNWMWQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
72 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
79 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
80 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
93 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
94 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
193 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
194 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
195 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
196 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
197 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
198 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
199 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
203 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
212 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
213 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
214 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
220 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
223 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
226 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
227 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
228 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
229 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
230 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
231 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
232 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
233 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
234 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
235 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
236 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
237 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
238 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
243 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
244 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
247 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
248 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
252 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
253 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
254 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
255 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
256 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
257 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
258 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
259 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
265 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
266 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
267 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
268 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
269 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
270 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
271 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
272 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
273 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
274 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
275 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
276 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
277 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
278 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
279 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
280 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
281 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
290 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
295 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
296 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
302 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
303 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
306 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
307 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
308 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
309 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
310 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
311 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
330 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
331 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
334 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
335 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
336 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
337 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
338 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
354 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
355 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
356 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
357 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
358 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
359 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
360 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
361 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
362 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
363 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
364 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
365 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
367 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
368 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
369 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
370 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
371 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
372 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
373 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
374 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
375 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
376 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
377 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
378 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
386 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
387 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
388 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
391 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
392 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
393 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
394 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
395 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
396 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
400 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
401 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
402 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
403 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
404 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
405 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
406 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
407 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
408 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
409 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
410 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
411 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
412 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
413 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
414 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
415 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
416 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
417 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
418 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
419 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
420 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
421 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
422 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
423 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0
Isolates 0.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.43
Nodule 0.7
Rhizoplane 5.94
Rhizosphere 79.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100076996 3300005329 Bacteria 3119
2 JGI25405J52794_10116768 3300003911 Bacteria 600
3 JGI25405J52794_10124290 3300003911 Bacteria 583
4 Ga0070658_10058564 3300005327 Bacteria 3136
5 Ga0070676_10059655 3300005328 Bacteria 2263
6 Ga0070676_10311972 3300005328 Bacteria 1070
7 Ga0070690_100232960 3300005330 Bacteria 1296
8 Ga0070670_100084409 3300005331 Bacteria 2728
9 Ga0070670_100377261 3300005331 Bacteria 1249
10 Ga0070670_100928751 3300005331 Bacteria 790
11 Ga0070677_10692774 3300005333 Bacteria 573
12 Ga0068869_100026819 3300005334 Bacteria 4012
13 Ga0068869_100226634 3300005334 Bacteria 1483
14 Ga0068869_100296800 3300005334 Bacteria 1304
15 Ga0068869_100824813 3300005334 Bacteria 799
16 Ga0068869_101033245 3300005334 Bacteria 717
17 Ga0068869_101697381 3300005334 Bacteria 564
18 Ga0070666_10167959 3300005335 Bacteria 1535
19 Ga0070666_10867135 3300005335 Bacteria 667
20 Ga0070666_11430715 3300005335 Bacteria 517
21 Ga0070680_100014001 3300005336 Bacteria 6261
22 Ga0070680_100067588 3300005336 Bacteria 2932
23 Ga0070680_100641442 3300005336 Bacteria 913
24 Ga0070680_101921840 3300005336 Bacteria 513
25 Ga0070682_100053092 3300005337 Bacteria 2539
26 Ga0070682_100312361 3300005337 Bacteria 1157
27 Ga0068868_100034468 3300005338 Bacteria 3908
28 Ga0068868_100039961 3300005338 Bacteria 3648
29 Ga0068868_100222291 3300005338 Bacteria 1581
30 Ga0068868_100285263 3300005338 Bacteria 1398
31 Ga0068868_100547010 3300005338 Bacteria 1020
32 Ga0070660_100004691 3300005339 Bacteria 9464
33 Ga0070660_100459801 3300005339 Bacteria 1056
34 Ga0070660_101092352 3300005339 Bacteria 675
35 Ga0070689_100693201 3300005340 Bacteria 889
36 Ga0070691_10258421 3300005341 Bacteria 937
37 Ga0070691_10263549 3300005341 Bacteria 929
38 Ga0070687_100273471 3300005343 Bacteria 1060
39 Ga0070661_100087649 3300005344 Bacteria 2303
40 Ga0070668_100085982 3300005347 Bacteria 2472
41 Ga0070668_100164050 3300005347 Bacteria 1804
42 Ga0070668_100472543 3300005347 Bacteria 1081
43 Ga0070669_100372721 3300005353 Bacteria 1163
44 Ga0070675_100151842 3300005354 Bacteria 1986
45 Ga0070675_101491077 3300005354 Bacteria 624
46 Ga0070671_100173901 3300005355 Bacteria 1822
47 Ga0070671_100286063 3300005355 Bacteria 1403
48 Ga0070674_100129940 3300005356 Bacteria 1876
49 Ga0070674_100431546 3300005356 Bacteria 1083
50 Ga0070674_101440547 3300005356 Bacteria 618
51 Ga0070659_100038841 3300005366 Bacteria 3714
52 Ga0070659_100056701 3300005366 Bacteria 3089
53 Ga0070659_100890255 3300005366 Bacteria 777
54 Ga0070667_100141064 3300005367 Bacteria 2110
55 Ga0070667_100239246 3300005367 Bacteria 1620
56 Ga0070667_100450165 3300005367 Bacteria 1176
57 Ga0070667_100733050 3300005367 Bacteria 916
58 Ga0070713_101248008 3300005436 Bacteria 720
59 Ga0070701_10047819 3300005438 Bacteria 2204
60 Ga0070701_10100444 3300005438 Bacteria 1601
61 Ga0070701_10329977 3300005438 Bacteria 947
62 Ga0070701_10874393 3300005438 Bacteria 619
63 Ga0070705_100318513 3300005440 Bacteria 1122
64 Ga0070700_100060127 3300005441 Bacteria 2394
65 Ga0070694_100556885 3300005444 Bacteria 919
66 Ga0070663_100004964 3300005455 Bacteria 7855
67 Ga0070663_100038922 3300005455 Bacteria 3320
68 Ga0070663_100556425 3300005455 Bacteria 959
69 Ga0070663_100561369 3300005455 Bacteria 955
70 Ga0070678_100014720 3300005456 Bacteria 4946
71 Ga0070678_100122692 3300005456 Bacteria 2051
72 Ga0070678_100205720 3300005456 Bacteria 1627
73 Ga0070678_100491444 3300005456 Bacteria 1081
74 Ga0070678_100698622 3300005456 Bacteria 914
75 Ga0070678_100706570 3300005456 Bacteria 909
76 Ga0070678_101266059 3300005456 Bacteria 685
77 Ga0070662_100052750 3300005457 Bacteria 2941
78 Ga0070662_100794102 3300005457 Bacteria 804
79 Ga0070681_10025253 3300005458 Bacteria 5976
80 Ga0070681_10421574 3300005458 Bacteria 1246
81 Ga0068867_100017224 3300005459 Bacteria 5132
82 Ga0070685_10059934 3300005466 Bacteria 2224
83 Ga0070706_100705567 3300005467 Bacteria 935
84 Ga0070698_100821854 3300005471 Bacteria 874
85 Ga0070699_100267423 3300005518 Bacteria 1530
86 Ga0070699_100768062 3300005518 Bacteria 882
87 Ga0070679_100007145 3300005530 Bacteria 10422
88 Ga0070679_100385131 3300005530 Bacteria 1349
89 Ga0070684_100036427 3300005535 Bacteria 4215
90 Ga0070697_100817827 3300005536 Bacteria 825
91 Ga0068853_100004567 3300005539 Bacteria 10738
92 Ga0068853_100609047 3300005539 Bacteria 1038
93 Ga0068853_101341295 3300005539 Bacteria 692
94 Ga0068853_101596471 3300005539 Bacteria 632
95 Ga0070672_100222163 3300005543 Bacteria 1585
96 Ga0070672_100293315 3300005543 Bacteria 1377
97 Ga0070672_100341270 3300005543 Bacteria 1276
98 Ga0070672_100654384 3300005543 Bacteria 918
99 Ga0070672_101314735 3300005543 Bacteria 646
100 Ga0070686_100413433 3300005544 Bacteria 1029
101 Ga0070695_100230054 3300005545 Bacteria 1340
102 Ga0070695_100678608 3300005545 Bacteria 816
103 Ga0070696_100079555 3300005546 Bacteria 2319
104 Ga0070693_100261516 3300005547 Bacteria 1151
105 Ga0070693_100521632 3300005547 Bacteria 846
106 Ga0070693_101633422 3300005547 Bacteria 507
107 Ga0070665_100047706 3300005548 Bacteria 4298
108 Ga0070665_100208388 3300005548 Bacteria 1955
109 Ga0070665_100307566 3300005548 Bacteria 1588
110 Ga0070665_100717564 3300005548 Bacteria 1013
111 Ga0070704_101094073 3300005549 Bacteria 724
112 Ga0068855_100018753 3300005563 Bacteria 8319
113 Ga0068855_100096595 3300005563 Bacteria 3403
114 Ga0068855_100288669 3300005563 Bacteria 1819
115 Ga0068855_101180237 3300005563 Bacteria 797
116 Ga0070664_100047321 3300005564 Bacteria 3633
117 Ga0068857_100025975 3300005577 Bacteria 5158
118 Ga0068857_100187862 3300005577 Bacteria 1881
119 Ga0068857_102262432 3300005577 Bacteria 534
120 Ga0068854_100397499 3300005578 Bacteria 1139
121 Ga0068856_100038417 3300005614 Bacteria 4700
122 Ga0068856_100636096 3300005614 Bacteria 1087
123 Ga0068856_100765449 3300005614 Bacteria 985
124 Ga0070702_100376781 3300005615 Bacteria 1008
125 Ga0070702_100454688 3300005615 Bacteria 930
126 Ga0070702_100711809 3300005615 Bacteria 767
127 Ga0068852_100299262 3300005616 Bacteria 1557
128 Ga0068852_100464047 3300005616 Bacteria 1256
129 Ga0068852_100467173 3300005616 Bacteria 1252
130 Ga0068859_100135569 3300005617 Bacteria 2534
131 Ga0068859_100136429 3300005617 Bacteria 2526
132 Ga0068859_102031501 3300005617 Bacteria 635
133 Ga0068864_100488821 3300005618 Bacteria 1182
134 Ga0068866_10642090 3300005718 Bacteria 722
135 Ga0068866_10925954 3300005718 Bacteria 615
136 Ga0068861_100074844 3300005719 Bacteria 2634
137 Ga0068861_100135970 3300005719 Bacteria 2000
138 Ga0068861_100176355 3300005719 Bacteria 1775
139 Ga0068861_100483837 3300005719 Bacteria 1116
140 Ga0068861_100753943 3300005719 Bacteria 909
141 Ga0068861_101415820 3300005719 Bacteria 679
142 Ga0068861_101741658 3300005719 Bacteria 617
143 Ga0068861_101925205 3300005719 Bacteria 588
144 Ga0068861_102078798 3300005719 Bacteria 568
145 Ga0068851_10098448 3300005834 Bacteria 1548
146 Ga0068851_10264472 3300005834 Bacteria 979
147 Ga0068870_10212799 3300005840 Bacteria 1178
148 Ga0068863_100715897 3300005841 Bacteria 995
149 Ga0068858_100207124 3300005842 Bacteria 1855
150 Ga0068858_100344671 3300005842 Bacteria 1426
151 Ga0068858_100915654 3300005842 Bacteria 858
152 Ga0068860_100186229 3300005843 Bacteria 2008
153 Ga0068860_100232067 3300005843 Bacteria 1793
154 Ga0068862_100161124 3300005844 Bacteria 2002
155 Ga0068862_100465082 3300005844 Bacteria 1194
156 Ga0068862_101930088 3300005844 Bacteria 601
157 Ga0068862_102067193 3300005844 Bacteria 581
158 Ga0081455_10018681 3300005937 Bacteria 6585
159 Ga0081455_10032981 3300005937 Bacteria 4659
160 Ga0081538_10104798 3300005981 Bacteria 1410
161 Ga0081540_1007439 3300005983 Bacteria 7804
162 Ga0081540_1050044 3300005983 Bacteria 2079
163 Ga0081539_10051625 3300005985 Bacteria 2316
164 Ga0081539_10144708 3300005985 Bacteria 1151
165 Ga0075365_10056435 3300006038 Bacteria 2610
166 Ga0075365_10166156 3300006038 Bacteria 1539
167 Ga0075368_10018641 3300006042 Bacteria 2609
168 Ga0075368_10058752 3300006042 Bacteria 1537
169 Ga0075363_100005168 3300006048 Bacteria 5775
170 Ga0075363_100035758 3300006048 Bacteria 2602
171 Ga0075364_10352059 3300006051 Bacteria 1004
172 Ga0075364_10462652 3300006051 Bacteria 867
173 Ga0070715_10083643 3300006163 Bacteria 1454
174 Ga0070716_100204444 3300006173 Bacteria 1315
175 Ga0070716_100785250 3300006173 Bacteria 736
176 Ga0070712_100198700 3300006175 Bacteria 1574
177 Ga0075362_10058957 3300006177 Bacteria 1733
178 Ga0075362_10278740 3300006177 Bacteria 827
179 Ga0075362_10343815 3300006177 Bacteria 746
180 Ga0075362_10353586 3300006177 Bacteria 736
181 Ga0075367_10009454 3300006178 Bacteria 5096
182 Ga0075367_10097409 3300006178 Bacteria 1794
183 Ga0075369_10069710 3300006186 Bacteria 1546
184 Ga0075369_10140275 3300006186 Bacteria 1102
185 Ga0075366_10044357 3300006195 Bacteria 2635
186 Ga0075366_10524614 3300006195 Bacteria 733
187 Ga0075366_10550044 3300006195 Bacteria 715
188 Ga0097621_100022308 3300006237 Bacteria 4913
189 Ga0075370_10173503 3300006353 Bacteria 1268
190 Ga0075370_10730321 3300006353 Bacteria 602
191 Ga0068871_100088664 3300006358 Bacteria 2574
192 Ga0068871_101197152 3300006358 Bacteria 712
193 Ga0075428_100063028 3300006844 Bacteria 4058
194 Ga0075428_100359501 3300006844 Bacteria 1562
195 Ga0075431_102014789 3300006847 Bacteria 532
196 Ga0075433_10967648 3300006852 Bacteria 742
197 Ga0075434_100289164 3300006871 Bacteria 1659
198 Ga0068865_100088644 3300006881 Bacteria 2239
199 Ga0068865_100304564 3300006881 Bacteria 1276
200 Ga0068865_100367640 3300006881 Bacteria 1169
201 Ga0075436_100980080 3300006914 Bacteria 634
202 Ga0097620_100135577 3300006931 Bacteria 2534
203 Ga0097620_100136438 3300006931 Bacteria 2526
204 Ga0097620_102031258 3300006931 Bacteria 635
205 Ga0075435_100089748 3300007076 Bacteria 2534
206 Ga0099794_10019661 3300007265 Bacteria 3047
207 Ga0099794_10079276 3300007265 Bacteria 1618
208 Ga0099794_10264596 3300007265 Bacteria 888
209 Ga0099794_10326509 3300007265 Bacteria 796
210 Ga0099795_10017040 3300007788 Bacteria 2310
211 Ga0099795_10112925 3300007788 Bacteria 1079
212 Ga0099795_10133713 3300007788 Bacteria 1003
213 Ga0105250_10077365 3300009092 Bacteria 1347
214 Ga0105240_10018737 3300009093 Bacteria 9274
215 Ga0105240_10033366 3300009093 Bacteria 6651
216 Ga0111539_10075408 3300009094 Bacteria 3973
217 Ga0111539_11195934 3300009094 Bacteria 883
218 Ga0105245_10060094 3300009098 Bacteria 3423
219 Ga0105245_10197061 3300009098 Bacteria 1932
220 Ga0105245_10405802 3300009098 Bacteria 1363
221 Ga0105245_10663885 3300009098 Bacteria 1073
222 Ga0105247_10101031 3300009101 Bacteria 1844
223 Ga0105247_10334333 3300009101 Bacteria 1061
224 Ga0105247_10516201 3300009101 Bacteria 873
225 Ga0105247_10596331 3300009101 Bacteria 819
226 Ga0105247_11809206 3300009101 Bacteria 508
227 Ga0114129_11184070 3300009147 Bacteria 953
228 Ga0105243_10633655 3300009148 Bacteria 1034
229 Ga0105243_11827512 3300009148 Bacteria 639
230 Ga0105241_10014728 3300009174 Bacteria 5724
231 Ga0105241_11478690 3300009174 Bacteria 653
232 Ga0105242_10091902 3300009176 Bacteria 2555
233 Ga0105242_10479257 3300009176 Bacteria 1179
234 Ga0105248_10056837 3300009177 Bacteria 4390
235 Ga0105248_11237757 3300009177 Bacteria 844
236 Ga0105248_11270089 3300009177 Bacteria 833
237 Ga0105248_12103583 3300009177 Bacteria 642
238 Ga0105237_10018689 3300009545 Bacteria 7167
239 Ga0105237_10031336 3300009545 Bacteria 5393
240 Ga0105237_10552785 3300009545 Bacteria 1158
241 Ga0105237_10720565 3300009545 Bacteria 1004
242 Ga0105237_12486962 3300009545 Bacteria 528
243 Ga0105238_10234062 3300009551 Bacteria 1814
244 Ga0105238_10423937 3300009551 Bacteria 1325
245 Ga0105238_10685753 3300009551 Bacteria 1036
246 Ga0105249_10713480 3300009553 Bacteria 1063
247 Ga0105249_10907954 3300009553 Bacteria 948
248 Ga0105249_11024109 3300009553 Bacteria 895
249 Ga0105249_12082790 3300009553 Bacteria 640
250 Ga0105249_12916308 3300009553 Bacteria 549
251 Ga0099796_10158391 3300010159 Bacteria 896
252 Ga0099796_10183672 3300010159 Bacteria 840
253 Ga0099796_10471206 3300010159 Bacteria 560
254 Ga0099796_10505247 3300010159 Bacteria 541
255 Ga0105239_10052151 3300010375 Bacteria 4485
256 Ga0105239_10254562 3300010375 Bacteria 1972
257 Ga0105239_10448977 3300010375 Bacteria 1463
258 Ga0105239_10946479 3300010375 Bacteria 989
259 Ga0105239_11707409 3300010375 Bacteria 729
260 Ga0105239_12746297 3300010375 Bacteria 575
261 Ga0105239_13353874 3300010375 Bacteria 521
262 Ga0105246_10008520 3300011119 Bacteria 6306
263 Ga0105246_10128475 3300011119 Bacteria 1889
264 Ga0105246_10193144 3300011119 Bacteria 1577
265 Ga0105246_10270150 3300011119 Bacteria 1359
266 Ga0105246_10414148 3300011119 Bacteria 1123
267 Ga0105246_11264250 3300011119 Bacteria 682
268 Ga0157313_1039677 3300012503 Bacteria 572
269 Ga0157371_10439283 3300013102 Bacteria 958
270 Ga0157370_10254898 3300013104 Bacteria 1623
271 Ga0157370_10662268 3300013104 Bacteria 954
272 Ga0157374_10165066 3300013296 Bacteria 2158
273 Ga0157374_11017083 3300013296 Bacteria 848
274 Ga0157378_10196439 3300013297 Bacteria 1906
275 Ga0157378_11491068 3300013297 Bacteria 721
276 Ga0163162_10185550 3300013306 Bacteria 2207
277 Ga0163162_10826586 3300013306 Bacteria 1043
278 Ga0163162_11736662 3300013306 Bacteria 713
279 Ga0163162_12348331 3300013306 Bacteria 613
280 Ga0163162_13314663 3300013306 Bacteria 515
281 Ga0157372_10220095 3300013307 Bacteria 2201
282 Ga0157375_10076706 3300013308 Bacteria 3370
283 Ga0157375_10169765 3300013308 Bacteria 2328
284 Ga0157375_10301230 3300013308 Bacteria 1767
285 Ga0157375_10395649 3300013308 Bacteria 1548
286 Ga0157375_10807821 3300013308 Bacteria 1086
287 Ga0157375_12079872 3300013308 Bacteria 675
288 Ga0157375_12192570 3300013308 Bacteria 658
289 Ga0163163_10090685 3300014325 Bacteria 3070
290 Ga0163163_10103381 3300014325 Bacteria 2873
291 Ga0163163_10122024 3300014325 Bacteria 2640
292 Ga0163163_10770945 3300014325 Bacteria 1025
293 Ga0163163_12359830 3300014325 Bacteria 590
294 Ga0163163_13062141 3300014325 Bacteria 521
295 Ga0157380_10198028 3300014326 Bacteria 1780
296 Ga0157380_10326083 3300014326 Bacteria 1426
297 Ga0157380_10356327 3300014326 Bacteria 1371
298 Ga0157380_10792445 3300014326 Bacteria 964
299 Ga0157377_10092060 3300014745 Bacteria 1792
300 Ga0157379_10429469 3300014968 Bacteria 1217
301 Ga0157379_11219291 3300014968 Bacteria 724
302 Ga0157379_11434101 3300014968 Bacteria 670
303 Ga0157376_10051008 3300014969 Bacteria 3435
304 Ga0157376_10171007 3300014969 Bacteria 1979
305 Ga0163161_10154924 3300017792 Bacteria 1744
306 Ga0163161_10372405 3300017792 Bacteria 1140
307 Ga0163161_10622917 3300017792 Bacteria 892
308 Ga0209758_1030854 3300025297 Bacteria 2210
309 Ga0207697_10033307 3300025315 Bacteria 2109
310 Ga0207697_10122192 3300025315 Bacteria 1121
311 Ga0207656_10003494 3300025321 Bacteria 5408
312 Ga0207656_10026557 3300025321 Bacteria 2362
313 Ga0207656_10385817 3300025321 Bacteria 703
314 Ga0207696_1053198 3300025711 Bacteria 1153
315 Ga0207642_10555711 3300025899 Bacteria 709
316 Ga0207710_10143222 3300025900 Bacteria 1155
317 Ga0207710_10527160 3300025900 Bacteria 614
318 Ga0207710_10672605 3300025900 Bacteria 542
319 Ga0207688_10095280 3300025901 Bacteria 1713
320 Ga0207688_10383054 3300025901 Bacteria 870
321 Ga0207688_10451114 3300025901 Bacteria 802
322 Ga0207688_10520223 3300025901 Bacteria 746
323 Ga0207680_10875758 3300025903 Bacteria 644
324 Ga0207645_10086241 3300025907 Bacteria 2017
325 Ga0207645_10135103 3300025907 Bacteria 1606
326 Ga0207645_10157338 3300025907 Bacteria 1485
327 Ga0207645_10351120 3300025907 Bacteria 987
328 Ga0207645_10989650 3300025907 Bacteria 570
329 Ga0207643_10026468 3300025908 Bacteria 3211
330 Ga0207643_10691310 3300025908 Bacteria 659
331 Ga0207643_10873198 3300025908 Bacteria 583
332 Ga0207705_10054974 3300025909 Bacteria 2870
333 Ga0207684_10403937 3300025910 Bacteria 1174
334 Ga0207684_10835758 3300025910 Bacteria 777
335 Ga0207654_10119561 3300025911 Bacteria 1652
336 Ga0207707_10038323 3300025912 Bacteria 4189
337 Ga0207707_10220411 3300025912 Bacteria 1651
338 Ga0207707_10429101 3300025912 Bacteria 1132
339 Ga0207695_10887128 3300025913 Bacteria 772
340 Ga0207671_10020862 3300025914 Bacteria 4982
341 Ga0207671_10065596 3300025914 Bacteria 2701
342 Ga0207693_10120319 3300025915 Bacteria 2062
343 Ga0207660_10013490 3300025917 Bacteria 5354
344 Ga0207660_10166029 3300025917 Bacteria 1706
345 Ga0207662_10498033 3300025918 Bacteria 839
346 Ga0207657_10002309 3300025919 Bacteria 20677
347 Ga0207657_10262532 3300025919 Bacteria 1374
348 Ga0207657_10273927 3300025919 Bacteria 1341
349 Ga0207657_10323048 3300025919 Bacteria 1220
350 Ga0207657_10468073 3300025919 Bacteria 988
351 Ga0207649_10090261 3300025920 Bacteria 2005
352 Ga0207649_10352095 3300025920 Bacteria 1090
353 Ga0207652_10004639 3300025921 Bacteria 11139
354 Ga0207652_10193606 3300025921 Bacteria 1829
355 Ga0207681_10439694 3300025923 Bacteria 1059
356 Ga0207694_10261632 3300025924 Bacteria 1417
357 Ga0207694_11490825 3300025924 Bacteria 571
358 Ga0207650_10201196 3300025925 Bacteria 1596
359 Ga0207650_10407695 3300025925 Bacteria 1126
360 Ga0207659_10718002 3300025926 Bacteria 856
361 Ga0207659_10838120 3300025926 Bacteria 790
362 Ga0207687_10137961 3300025927 Bacteria 1847
363 Ga0207687_10206678 3300025927 Bacteria 1538
364 Ga0207687_10421763 3300025927 Bacteria 1101
365 Ga0207664_10358917 3300025929 Bacteria 1291
366 Ga0207644_10139695 3300025931 Bacteria 1864
367 Ga0207644_10429432 3300025931 Bacteria 1083
368 Ga0207644_10910594 3300025931 Bacteria 737
369 Ga0207644_11198977 3300025931 Bacteria 638
370 Ga0207690_10159436 3300025932 Bacteria 1680
371 Ga0207690_10363009 3300025932 Bacteria 1148
372 Ga0207690_10449980 3300025932 Bacteria 1035
373 Ga0207690_11675592 3300025932 Bacteria 531
374 Ga0207706_10036340 3300025933 Bacteria 4375
375 Ga0207706_10550822 3300025933 Bacteria 993
376 Ga0207706_11203722 3300025933 Bacteria 629
377 Ga0207706_11711311 3300025933 Bacteria 506
378 Ga0207686_10944318 3300025934 Bacteria 698
379 Ga0207709_10017623 3300025935 Bacteria 3988
380 Ga0207709_10789542 3300025935 Bacteria 766
381 Ga0207669_10107978 3300025937 Bacteria 1857
382 Ga0207669_11853061 3300025937 Bacteria 515
383 Ga0207704_10009818 3300025938 Bacteria 4636
384 Ga0207704_10119565 3300025938 Bacteria 1800
385 Ga0207704_10520083 3300025938 Bacteria 962
386 Ga0207704_11803947 3300025938 Bacteria 526
387 Ga0207665_10226676 3300025939 Bacteria 1372
388 Ga0207665_10741127 3300025939 Bacteria 774
389 Ga0207691_10040414 3300025940 Bacteria 4309
390 Ga0207691_10071235 3300025940 Bacteria 3138
391 Ga0207691_10099018 3300025940 Bacteria 2604
392 Ga0207711_10563929 3300025941 Bacteria 1062
393 Ga0207711_10952966 3300025941 Bacteria 797
394 Ga0207711_10999864 3300025941 Bacteria 776
395 Ga0207711_11673567 3300025941 Bacteria 580
396 Ga0207689_10016538 3300025942 Bacteria 6243
397 Ga0207689_10021369 3300025942 Bacteria 5442
398 Ga0207689_10070806 3300025942 Bacteria 2864
399 Ga0207689_10956801 3300025942 Bacteria 722
400 Ga0207689_10965276 3300025942 Bacteria 719
401 Ga0207661_10466706 3300025944 Bacteria 1151
402 Ga0207679_10100633 3300025945 Bacteria 2259
403 Ga0207679_12056044 3300025945 Bacteria 519
404 Ga0207667_10006322 3300025949 Bacteria 14355
405 Ga0207667_10318105 3300025949 Bacteria 1589
406 Ga0207667_10460754 3300025949 Bacteria 1291
407 Ga0207667_10987265 3300025949 Bacteria 830
408 Ga0207651_10063236 3300025960 Bacteria 2584
409 Ga0207651_10081599 3300025960 Bacteria 2331
410 Ga0207651_10243012 3300025960 Bacteria 1468
411 Ga0207712_10107984 3300025961 Bacteria 2082
412 Ga0207712_10425947 3300025961 Bacteria 1121
413 Ga0207712_10559950 3300025961 Bacteria 984
414 Ga0207668_10076400 3300025972 Bacteria 2411
415 Ga0207668_10163436 3300025972 Bacteria 1737
416 Ga0207668_10994147 3300025972 Bacteria 749
417 Ga0207668_11266182 3300025972 Bacteria 663
418 Ga0207640_10211235 3300025981 Bacteria 1478
419 Ga0207658_10213131 3300025986 Bacteria 1620
420 Ga0207658_10266721 3300025986 Bacteria 1461
421 Ga0207658_10337930 3300025986 Bacteria 1308
422 Ga0207658_10714038 3300025986 Bacteria 906
423 Ga0207658_12191482 3300025986 Bacteria 502
424 Ga0207677_10192228 3300026023 Bacteria 1615
425 Ga0207677_10453660 3300026023 Bacteria 1099
426 Ga0207677_10821802 3300026023 Bacteria 833
427 Ga0207703_10240071 3300026035 Bacteria 1629
428 Ga0207703_10579961 3300026035 Bacteria 1060
429 Ga0207639_10222481 3300026041 Bacteria 1631
430 Ga0207639_10252419 3300026041 Bacteria 1539
431 Ga0207639_11229477 3300026041 Bacteria 703
432 Ga0207639_12289529 3300026041 Bacteria 502
433 Ga0207678_10033062 3300026067 Bacteria 4507
434 Ga0207678_10043944 3300026067 Bacteria 3866
435 Ga0207678_10051334 3300026067 Bacteria 3560
436 Ga0207678_10077151 3300026067 Bacteria 2854
437 Ga0207678_10880259 3300026067 Bacteria 792
438 Ga0207708_10042791 3300026075 Bacteria 3452
439 Ga0207708_10054915 3300026075 Bacteria 3037
440 Ga0207708_10677964 3300026075 Bacteria 879
441 Ga0207702_10060713 3300026078 Bacteria 3223
442 Ga0207702_10661637 3300026078 Bacteria 1028
443 Ga0207702_11380668 3300026078 Bacteria 698
444 Ga0207641_10557586 3300026088 Bacteria 1118
445 Ga0207641_10696392 3300026088 Bacteria 1000
446 Ga0207648_10020971 3300026089 Bacteria 5883
447 Ga0207648_10906148 3300026089 Bacteria 824
448 Ga0207648_11021016 3300026089 Bacteria 775
449 Ga0207676_10110915 3300026095 Bacteria 2295
450 Ga0207676_10846411 3300026095 Bacteria 894
451 Ga0207674_10023884 3300026116 Bacteria 6539
452 Ga0207674_10151198 3300026116 Bacteria 2279
453 Ga0207675_100110767 3300026118 Bacteria 2590
454 Ga0207675_100217286 3300026118 Bacteria 1841
455 Ga0207675_100271191 3300026118 Bacteria 1647
456 Ga0207675_100316658 3300026118 Bacteria 1522
457 Ga0207675_101199187 3300026118 Bacteria 779
458 Ga0207675_101205192 3300026118 Bacteria 777
459 Ga0207683_10037173 3300026121 Bacteria 4240
460 Ga0207683_10082367 3300026121 Bacteria 2858
461 Ga0207683_10124835 3300026121 Bacteria 2313
462 Ga0207683_10824692 3300026121 Bacteria 861
463 Ga0207683_11690860 3300026121 Bacteria 582
464 Ga0207698_10815042 3300026142 Bacteria 936
465 Ga0207698_11984775 3300026142 Bacteria 596
466 Ga0207698_12410289 3300026142 Bacteria 537
467 Ga0209588_1003598 3300027671 Bacteria 4302
468 Ga0209588_1033521 3300027671 Bacteria 1647
469 Ga0209588_1073412 3300027671 Bacteria 1105
470 Ga0209813_10036914 3300027866 Bacteria 1470
471 Ga0209813_10376691 3300027866 Bacteria 567
472 Ga0207428_10310907 3300027907 Bacteria 1165
473 Ga0207428_10573163 3300027907 Bacteria 815
474 Ga0268266_10004734 3300028379 Bacteria 12936
475 Ga0268266_10015035 3300028379 Bacteria 6644
476 Ga0268266_10110977 3300028379 Bacteria 2429
477 Ga0268266_10529555 3300028379 Bacteria 1127
478 Ga0268266_11382377 3300028379 Bacteria 679
479 Ga0268265_10017430 3300028380 Bacteria 4955
480 Ga0268265_10045734 3300028380 Bacteria 3268
481 Ga0268265_10800639 3300028380 Bacteria 918
482 Ga0268265_11125286 3300028380 Bacteria 780
483 Ga0268265_11516563 3300028380 Bacteria 674
484 Ga0268265_11533669 3300028380 Bacteria 670
485 Ga0268265_11639742 3300028380 Bacteria 648
486 Ga0268264_10050917 3300028381 Bacteria 3450
487 Ga0268264_10359762 3300028381 Bacteria 1388
488 Ga0268264_10575553 3300028381 Bacteria 1107
489 Ga0268264_10801260 3300028381 Bacteria 941
490 Ga0307517_10051925 3300028786 Bacteria 4123
491 Ga0307515_10751265 3300028794 Bacteria 594
492 Ga0265339_10455158 3300031249 Bacteria 594
493 Ga0265331_10053219 3300031250 Bacteria 1932
494 Ga0307509_10242859 3300031507 Bacteria 1592
495 Ga0307408_100807797 3300031548 Bacteria 852
496 Ga0307408_102489086 3300031548 Bacteria 503
497 Ga0307508_10135984 3300031616 Bacteria 2061
498 Ga0307514_10474075 3300031649 Bacteria 606
499 Ga0307516_10093931 3300031730 Bacteria 2824
500 Ga0307407_10593089 3300031903 Bacteria 824
501 Ga0307416_102380449 3300032002 Bacteria 629
502 Ga0307415_100359193 3300032126 Bacteria 1229
503 Ga0307415_100382137 3300032126 Bacteria 1196
504 Ga0307415_100710326 3300032126 Bacteria 908
505 Ga0307415_100711372 3300032126 Bacteria 908
506 Ga0307507_10314194 3300033179 Bacteria 949
507 Ga0307510_10030947 3300033180 Bacteria 6057
508 Ga0307510_10116063 3300033180 Bacteria 2400
509 Ga0307510_10600413 3300033180 Bacteria 552
510 Ga0373926_0111022 3300035083 Bacteria 1030
511 Ga0373944_0052635 3300035089 Bacteria 1287
512 Ga0373923_0361974 3300035111 Bacteria 694
513 Ga0373936_0011098 3300035113 Bacteria 3405
514 Ga0373939_0257329 3300035114 Bacteria 682
515 Ga0373945_0039199 3300035116 Bacteria 1707
516 Ga0373960_0101285 3300035121 Bacteria 934
517 Ga0373943_0078979 3300035170 Bacteria 1683
518 Ga0373946_0011293 3300035171 Bacteria 3329
519 Ga0373955_0003503 3300035172 Bacteria 6901
520 Ga0373924_0029664 3300035410 Bacteria 2188
521 Ga0373931_1031038 3300035691 Bacteria 558
522 Ga0373935_0000039 3300035692 Bacteria 50470
523 Ga0373927_0000363 3300035695 Bacteria 35245
524 Ga0373927_0383368 3300035695 Bacteria 927
525 Ga0373947_0000196 3300035725 Bacteria 33591
526 Ga0373937_0045077 3300036401 Bacteria 4029
527 Ga0373925_0000280 3300037068 Bacteria 53260
528 Ga0373925_0531744 3300037068 Bacteria 966
529 Ga0395898_0880048 3300037466 Bacteria 834
530 Ga0395905_0084175 3300037471 Bacteria 2980
531 Ga0395905_1191677 3300037471 Bacteria 665
532 Ga0436363_0180011 3300039450 Bacteria 2610
533 Ga0439465_0128016 3300041413 Bacteria 894
534 Ga0451795_0654717 3300041456 Bacteria 642
535 Ga0451800_1217771 3300041459 Bacteria 1195
536 Ga0451807_0654396 3300041486 Bacteria 518
537 Ga0451837_0786431 3300041494 Bacteria 781
538 Ga0451853_2367645 3300041512 Bacteria 571
539 Ga0439458_0029798 3300042157 Bacteria 1296
540 Ga0495617_107426 3300046452 Bacteria 904
541 Ga0495617_112226 3300046452 Bacteria 881
542 Ga0495617_125487 3300046452 Bacteria 825
543 Ga0495627_144376 3300046453 Bacteria 666
544 Ga0495592_0059204 3300046454 Bacteria 2821
545 Ga0495603_0001166 3300046455 Bacteria 15302
546 Ga0495603_0009532 3300046455 Bacteria 5865
547 Ga0495603_0013646 3300046455 Bacteria 4916
548 Ga0495603_0052566 3300046455 Bacteria 2418
549 Ga0495603_0207304 3300046455 Bacteria 1132
550 Ga0495603_0266565 3300046455 Bacteria 986
551 Ga0495590_0312434 3300046457 Bacteria 592
552 Ga0495590_0349518 3300046457 Bacteria 562
553 Ga0495629_0000136 3300046459 Bacteria 64126
554 Ga0495629_0015181 3300046459 Bacteria 5535
555 Ga0495638_0112657 3300046460 Bacteria 1614
556 Ga0495638_0157961 3300046460 Bacteria 1310
557 Ga0495638_0224908 3300046460 Bacteria 1047
558 Ga0495638_0402588 3300046460 Bacteria 709
559 Ga0495641_0009910 3300046461 Bacteria 5605
560 Ga0495651_0351574 3300046462 Bacteria 974
561 Ga0495650_0124333 3300046471 Bacteria 947
562 Ga0495580_0002073 3300046472 Bacteria 17604
563 Ga0495582_0000015 3300046473 Bacteria 101848
564 Ga0495582_0127206 3300046473 Bacteria 1438
565 Ga0495582_0778249 3300046473 Bacteria 554
566 Ga0495605_0088024 3300046474 Bacteria 1443
567 Ga0495605_0408732 3300046474 Bacteria 563
568 Ga0495639_0000025 3300046475 Bacteria 68702
569 Ga0495639_0067424 3300046475 Bacteria 1648
570 Ga0495639_0663971 3300046475 Bacteria 538
571 Ga0495662_0000115 3300046476 Bacteria 30046
572 Ga0495664_0011671 3300046477 Bacteria 4959
573 Ga0495584_0080995 3300046491 Bacteria 1634
574 Ga0495584_0126413 3300046491 Bacteria 1296
575 Ga0495584_0668655 3300046491 Bacteria 529
576 Ga0495585_0190206 3300046492 Bacteria 1050
577 Ga0495585_0201198 3300046492 Bacteria 1014
578 Ga0495585_0322328 3300046492 Bacteria 755
579 Ga0495594_0000057 3300046499 Bacteria 48453
580 Ga0495594_0171835 3300046499 Bacteria 1233
581 Ga0495583_0198411 3300046506 Bacteria 816
582 Ga0495606_0151942 3300046507 Bacteria 1358
583 Ga0495608_0171230 3300046511 Bacteria 1377
584 Ga0495610_0275985 3300046512 Bacteria 656
585 Ga0495616_0091608 3300046513 Bacteria 1438
586 Ga0495620_0057136 3300046515 Bacteria 1639
587 Ga0495628_0126101 3300046516 Bacteria 1961
588 Ga0495630_0003941 3300046517 Bacteria 10378
589 Ga0495631_0022733 3300046518 Bacteria 2914
590 Ga0495631_0134261 3300046518 Bacteria 1063
591 Ga0495631_0316462 3300046518 Bacteria 664
592 Ga0495631_0353515 3300046518 Bacteria 625
593 Ga0495632_0183449 3300046519 Bacteria 958
594 Ga0495637_0068410 3300046520 Bacteria 1439
595 Ga0495644_0162193 3300046523 Bacteria 857
596 Ga0495644_0461514 3300046523 Bacteria 506
597 Ga0495663_0069114 3300046525 Bacteria 1122
598 Ga0495663_0086631 3300046525 Bacteria 1016
599 Ga0495663_0298400 3300046525 Bacteria 580
600 Ga0495666_0147228 3300046526 Bacteria 1096
601 Ga0495666_0339593 3300046526 Bacteria 677
602 Ga0495642_0178486 3300046528 Bacteria 924
603 Ga0495652_0116059 3300046529 Bacteria 2144
604 Ga0495665_0000548 3300046531 Bacteria 19083
605 Ga0495640_0005492 3300046533 Bacteria 10081
606 Ga0495586_0012247 3300046535 Bacteria 4553
607 Ga0495598_0069560 3300046537 Bacteria 1105
608 Ga0495598_0144174 3300046537 Bacteria 826
609 Ga0495609_0060482 3300046538 Bacteria 1675
610 Ga0495609_0289046 3300046538 Bacteria 669
611 Ga0495621_0422845 3300046539 Bacteria 567
612 Ga0495622_0002100 3300046557 Bacteria 9739
613 Ga0495622_0160280 3300046557 Bacteria 1015
614 Ga0495622_0226301 3300046557 Bacteria 827
615 Ga0495622_0294106 3300046557 Bacteria 708
616 Ga0495633_0133620 3300046558 Bacteria 1148
617 Ga0495667_0020056 3300046559 Bacteria 4510
618 Ga0495668_0152996 3300046616 Bacteria 1263
619 Ga0495668_0583095 3300046616 Bacteria 617
620 Ga0495634_0000387 3300046642 Bacteria 43011
621 Ga0495611_0135340 3300046648 Bacteria 1150
622 Ga0495611_0305945 3300046648 Bacteria 732
623 Ga0495611_0405958 3300046648 Bacteria 623
624 Ga0495625_0043196 3300046660 Bacteria 3270
625 Ga0495625_0343918 3300046660 Bacteria 944
626 Ga0495625_0573375 3300046660 Bacteria 681
627 Ga0495635_0000143 3300046663 Bacteria 43594
628 Ga0495659_0143206 3300046664 Bacteria 955
629 Ga0495659_0262156 3300046664 Bacteria 722
630 Ga0495588_0031831 3300046674 Bacteria 2656
631 Ga0495588_0302968 3300046674 Bacteria 841
632 Ga0495588_0322445 3300046674 Bacteria 812
633 Ga0495623_0348518 3300046679 Bacteria 807
634 Ga0495646_0348338 3300046680 Bacteria 776
635 Ga0495647_0000218 3300046681 Bacteria 15523
636 Ga0495658_0002394 3300046683 Bacteria 9462
637 Ga0495669_0074537 3300046684 Bacteria 1551
638 Ga0495613_0001610 3300046689 Bacteria 17161
639 Ga0495624_0000050 3300046690 Bacteria 74686
640 Ga0495670_0317545 3300046691 Bacteria 836
641 Ga0495670_0602654 3300046691 Bacteria 598
642 Ga0495671_0303219 3300046692 Bacteria 768
643 Ga0495589_0074574 3300046794 Bacteria 1655
644 Ga0495589_0147331 3300046794 Bacteria 1125
645 Ga0495589_0393385 3300046794 Bacteria 636
646 Ga0495600_0176134 3300046809 Bacteria 1379
647 Ga0495600_0550884 3300046809 Bacteria 705
648 Ga0495581_0000997 3300047315 Bacteria 15249
649 Ga0495581_0150928 3300047315 Bacteria 1357
650 Ga0495581_0253769 3300047315 Bacteria 1028
651 Ga0495581_0553301 3300047315 Bacteria 668
652 Ga0495604_0155308 3300047317 Bacteria 1622
653 Ga0495636_0169637 3300047318 Bacteria 986
654 Ga0495636_0195523 3300047318 Bacteria 922
655 Ga0495674_0000332 3300047319 Bacteria 41530
656 Ga0495672_0046769 3300047320 Bacteria 2578
657 Ga0495676_0060727 3300047321 Bacteria 2961
658 Ga0495676_0554290 3300047321 Bacteria 751
659 Ga0495680_0439296 3300047322 Bacteria 895
660 Ga0495683_0178851 3300047323 Bacteria 970
661 Ga0495683_0292704 3300047323 Bacteria 701
662 Ga0495677_0049271 3300047445 Bacteria 1548
663 Ga0495677_0360668 3300047445 Bacteria 574
664 Ga0495679_035226 3300047446 Bacteria 1588
665 Ga0495685_048099 3300047447 Bacteria 1450
666 Ga0495673_0051663 3300047469 Bacteria 1799
667 Ga0495681_0081046 3300047470 Bacteria 1449
668 Ga0495681_0194029 3300047470 Bacteria 827
669 Ga0495686_0070961 3300047472 Bacteria 2145
670 Ga0495686_0285093 3300047472 Bacteria 917
671 Ga0495686_0666448 3300047472 Bacteria 533
672 Ga0495593_0000037 3300047673 Bacteria 53464
673 Ga0495593_0111897 3300047673 Bacteria 1394
674 Ga0495602_0246456 3300048088 Bacteria 1334
675 Ga0495614_0010502 3300048089 Bacteria 4084
676 Ga0495615_0105805 3300048090 Bacteria 800
677 Ga0495626_0165877 3300048091 Bacteria 923
678 Ga0495626_0421165 3300048091 Bacteria 515
679 Ga0496100_0050635 3300048903 Bacteria 2692
680 Ga0496101_0034333 3300048904 Bacteria 3582
681 Ga0496101_0296331 3300048904 Bacteria 1266
682 Ga0496101_1498409 3300048904 Bacteria 525
683 Ga0496102_0004540 3300048905 Bacteria 11737
684 Ga0496102_0025193 3300048905 Bacteria 5293
685 Ga0496102_0294970 3300048905 Bacteria 1528
686 Ga0496102_0735550 3300048905 Bacteria 909
687 Ga0496102_1456846 3300048905 Bacteria 603
688 Ga0496103_0267670 3300048906 Bacteria 1099
689 Ga0496103_0275828 3300048906 Bacteria 1082
690 Ga0496103_0356942 3300048906 Bacteria 940
691 Ga0496103_0504896 3300048906 Bacteria 774
692 Ga0496103_0718780 3300048906 Bacteria 633
693 Ga0496104_0017703 3300048907 Bacteria 6495
694 Ga0496104_0295160 3300048907 Bacteria 1533
695 Ga0496104_1345531 3300048907 Bacteria 617
696 Ga0496105_0700383 3300048908 Bacteria 777
697 Ga0496106_0031423 3300048909 Bacteria 3957
698 Ga0496106_0076924 3300048909 Bacteria 2558
699 Ga0496106_0079839 3300048909 Bacteria 2512
700 Ga0496106_0332331 3300048909 Bacteria 1220
701 Ga0496107_0011149 3300048910 Bacteria 6255
702 Ga0496107_0613530 3300048910 Bacteria 803
703 Ga0496108_0051533 3300048911 Bacteria 3448
704 Ga0496108_0387465 3300048911 Bacteria 1220
705 Ga0496109_0046397 3300048912 Bacteria 3946
706 Ga0496109_0079216 3300048912 Bacteria 3026
707 Ga0496109_0091645 3300048912 Bacteria 2811
708 Ga0496109_0510250 3300048912 Bacteria 1135
709 Ga0496110_0177200 3300048913 Bacteria 1935
710 Ga0496110_0428881 3300048913 Bacteria 1205
711 Ga0496110_0472536 3300048913 Bacteria 1142
712 Ga0496110_1747323 3300048913 Bacteria 532
713 Ga0496111_0006236 3300048914 Bacteria 7729
714 Ga0496111_0898920 3300048914 Bacteria 638
715 Ga0496111_1277333 3300048914 Bacteria 518
716 Ga0496112_0212873 3300048915 Bacteria 1889
717 Ga0496113_0046669 3300048916 Bacteria 3216
718 Ga0496113_0193720 3300048916 Bacteria 1614
719 Ga0496114_0076326 3300048917 Bacteria 2824
720 Ga0496114_0187375 3300048917 Bacteria 1809
721 Ga0496114_0315759 3300048917 Bacteria 1380
722 Ga0496114_1260380 3300048917 Bacteria 626
723 Ga0496115_0003033 3300048918 Bacteria 12058
724 Ga0496115_0028937 3300048918 Bacteria 4347
725 Ga0496115_0557983 3300048918 Bacteria 915
726 Ga0496115_0651370 3300048918 Bacteria 832
727 Ga0496116_0389809 3300048919 Bacteria 621
728 Ga0496118_0142211 3300048921 Bacteria 1518
729 Ga0496119_0107633 3300048922 Bacteria 1554
730 Ga0496121_0001325 3300048924 Bacteria 42402
731 Ga0496121_0059773 3300048924 Bacteria 3140
732 Ga0496121_0128579 3300048924 Bacteria 1900
733 Ga0496121_0457757 3300048924 Bacteria 820
734 Ga0496121_0489472 3300048924 Bacteria 783
735 Ga0496121_0646283 3300048924 Bacteria 645
736 Ga0496121_0842180 3300048924 Bacteria 534
737 Ga0496124_0083976 3300048927 Bacteria 2612
738 Ga0496124_0432504 3300048927 Bacteria 903
739 Ga0496125_0407090 3300048928 Bacteria 793
740 Ga0496125_0601277 3300048928 Bacteria 600
741 Ga0496126_0004556 3300048929 Bacteria 16466
742 Ga0496126_0227009 3300048929 Bacteria 1566
743 Ga0496126_0294954 3300048929 Bacteria 1340
744 Ga0496126_0302083 3300048929 Bacteria 1320
745 Ga0496126_0776741 3300048929 Bacteria 737
746 Ga0496126_0777863 3300048929 Bacteria 736
747 Ga0496126_0910722 3300048929 Bacteria 666
748 Ga0495678_084097 3300049459 Bacteria 1136
749 Ga0495682_0056931 3300049460 Bacteria 1416
750 Ga0495682_0291080 3300049460 Bacteria 576
751 Ga0501032_0000165 3300049569 Bacteria 53852
752 Ga0501033_0002872 3300049570 Bacteria 14429
753 Ga0501034_0000058 3300049571 Bacteria 198554
754 Ga0501036_0000020 3300049572 Bacteria 115993
755 Ga0501037_0000250 3300049573 Bacteria 45924
756 Ga0501038_0000050 3300049574 Bacteria 99270
757 Ga0501039_0038472 3300049575 Bacteria 3694
758 Ga0501040_1122620 3300049576 Bacteria 570
759 Ga0501041_0548310 3300049577 Bacteria 737
760 Ga0501042_0073310 3300049578 Bacteria 2449
761 Ga0501043_0000547 3300049579 Bacteria 33839
762 Ga0501046_0006778 3300049580 Bacteria 10109
763 Ga0501047_0000538 3300049581 Bacteria 40982
764 Ga0501048_0000129 3300049582 Bacteria 44483
765 Ga0501067_0000809 3300049583 Bacteria 16860
766 Ga0501068_0011201 3300049584 Bacteria 5055
767 Ga0501068_0675619 3300049584 Bacteria 675
768 Ga0501069_0011385 3300049585 Bacteria 4715
769 Ga0501070_0021764 3300049586 Bacteria 5373
770 Ga0501071_0172499 3300049587 Bacteria 1619
771 Ga0501072_0006764 3300049588 Bacteria 8707
772 Ga0501073_0000061 3300049589 Bacteria 68332
773 Ga0501074_0000022 3300049590 Bacteria 70431
774 Ga0501076_0974049 3300049592 Bacteria 699
775 Ga0501077_0631181 3300049593 Bacteria 688
776 Ga0501079_0020096 3300049741 Bacteria 5102
777 Ga0501080_0000226 3300049742 Bacteria 42194
778 Ga0501083_0002631 3300049744 Bacteria 12367
779 Ga0501035_0006960 3300049822 Bacteria 10561
780 Ga0501044_0000145 3300049823 Bacteria 87425
781 Ga0501045_0017567 3300049824 Bacteria 5079
782 nmdc:mga03683_251343_c1 3300050489 Bacteria 821
783 nmdc:mga03683_41591_c1 3300050489 Bacteria 1888
784 nmdc:mga03n38_168931_c1 3300050490 Bacteria 1113
785 nmdc:mga00v17_334169_c1 3300050491 Bacteria 985
786 nmdc:mga0yw44_10576_c1 3300050492 Bacteria 4721
787 nmdc:mga0yw44_162919_c1 3300050492 Bacteria 1461
788 nmdc:mga0yw44_23830_c1 3300050492 Bacteria 3454
789 nmdc:mga0k408_288078_c1 3300050493 Bacteria 980
790 nmdc:mga0k408_33186_c1 3300050493 Bacteria 2952
791 nmdc:mga0k408_780946_c1 3300050493 Bacteria 557
792 nmdc:mga06z11_110946_c1 3300050494 Bacteria 1519
793 nmdc:mga06z11_227600_c1 3300050494 Bacteria 1091
794 nmdc:mga06z11_29040_c1 3300050494 Bacteria 2660
795 nmdc:mga04h51_30879_c1 3300050495 Bacteria 1689
796 nmdc:mga04h51_327682_c1 3300050495 Bacteria 629
797 nmdc:mga07m45_20657_c1 3300050496 Bacteria 3578
798 nmdc:mga06r32_560655_c1 3300050510 Bacteria 1115
799 nmdc:mga08y16_1273151_c1 3300050511 Bacteria 703
800 nmdc:mga08y16_62788_c1 3300050511 Bacteria 3879
801 nmdc:mga08y16_647800_c1 3300050511 Bacteria 1061
802 nmdc:mga0n895_1354211_c1 3300050512 Bacteria 681
803 nmdc:mga0a205_273018_c1 3300050515 Bacteria 1567
804 Ga0495601_0269751 3300053077 Bacteria 1110
805 Ga0500635_0000616 3300053080 Bacteria 9287
806 Ga0500635_0365823 3300053080 Bacteria 571
807 Ga0495619_0246341 3300053085 Bacteria 1238
808 Ga0500646_0116339 3300053090 Bacteria 855
809 Ga0500646_0203961 3300053090 Bacteria 679
810 Ga0500583_0164079 3300053092 Bacteria 1106
811 Ga0500651_0532548 3300053093 Bacteria 644
812 Ga0500566_0001933 3300053094 Bacteria 12190
813 Ga0500641_0014721 3300053096 Bacteria 2890
814 Ga0500641_0029430 3300053096 Bacteria 2152
815 Ga0500554_008444 3300053102 Bacteria 2420
816 Ga0500554_010427 3300053102 Bacteria 2264
817 Ga0500556_0181655 3300053104 Bacteria 831
818 Ga0500592_082408 3300053116 Bacteria 536
819 Ga0500594_0015392 3300053118 Bacteria 1844
820 Ga0500594_0196515 3300053118 Bacteria 662
821 Ga0500595_000149 3300053119 Bacteria 45942
822 Ga0500595_025744 3300053119 Bacteria 2034
823 Ga0500614_048713 3300053123 Bacteria 1105
824 Ga0500642_0454930 3300053130 Bacteria 549
825 Ga0500642_0503903 3300053130 Bacteria 511
826 Ga0500652_063878 3300053131 Bacteria 1520
827 Ga0500655_127075 3300053133 Bacteria 543
828 Ga0500559_0216552 3300053136 Bacteria 903
829 Ga0500568_0029216 3300053139 Bacteria 2290
830 Ga0500577_0178583 3300053142 Bacteria 910
831 Ga0500589_108323 3300053147 Bacteria 1195
832 Ga0500603_000534 3300053150 Bacteria 9617
833 Ga0500633_0298481 3300053160 Bacteria 593
834 Ga0500634_0075985 3300053161 Bacteria 1745
835 Ga0500634_0266726 3300053161 Bacteria 700
836 Ga0500638_002269 3300053162 Bacteria 6590
837 Ga0500638_067299 3300053162 Bacteria 1716
838 Ga0500636_0207954 3300053177 Bacteria 1029
839 Ga0500637_0000079 3300053178 Bacteria 34524
840 Ga0500637_0167057 3300053178 Bacteria 1266
841 Ga0500637_0273710 3300053178 Bacteria 932
842 Ga0500645_051333 3300053730 Bacteria 1203
843 Ga0500609_008736 3300053731 Bacteria 1368
844 Ga0500656_048173 3300053732 Bacteria 614
845 Ga0500587_063335 3300053739 Bacteria 570
846 Ga0501084_0006118 3300054114 Bacteria 9896
847 Ga0501084_0646711 3300054114 Bacteria 893
848 Ga0500661_000500 3300055283 Bacteria 7285
849 Ga0590071_116622 3300059421 Bacteria 680
850 Ga0501082_0004306 3300060353 Bacteria 12447
851 Ga0530510_0379938 3300061734 Bacteria 1063
852 2723849464 2721755755 Bacteria 8322773
853 2879112955 2879110137 Bacteria 8907982
854 2889035730 2889033259 Bacteria 9099371
855 2922364207 2922361189 Bacteria 7436256
856 2922392777 2922386360 Bacteria 7017218
857 8006989136 8006984368 Bacteria 9651211
858 8007000094 8006994254 Bacteria 8309700
859 8056677819 8056673599 Bacteria 7871253
860 Ga0070683_100076996
861 JGI25405J52794_10116768
862 JGI25405J52794_10124290
863 Ga0070658_10058564
864 Ga0070676_10059655
865 Ga0070676_10311972
866 Ga0070690_100232960
867 Ga0070670_100084409
868 Ga0070670_100377261
869 Ga0070670_100928751
870 Ga0070677_10692774
871 Ga0068869_100026819
872 Ga0068869_100226634
873 Ga0068869_100296800
874 Ga0068869_100824813
875 Ga0068869_101033245
876 Ga0068869_101697381
877 Ga0070666_10167959
878 Ga0070666_10867135
879 Ga0070666_11430715
880 Ga0070680_100014001
881 Ga0070680_100067588
882 Ga0070680_100641442
883 Ga0070680_101921840
884 Ga0070682_100053092
885 Ga0070682_100312361
886 Ga0068868_100034468
887 Ga0068868_100039961
888 Ga0068868_100222291
889 Ga0068868_100285263
890 Ga0068868_100547010
891 Ga0070660_100004691
892 Ga0070660_100459801
893 Ga0070660_101092352
894 Ga0070689_100693201
895 Ga0070691_10258421
896 Ga0070691_10263549
897 Ga0070687_100273471
898 Ga0070661_100087649
899 Ga0070668_100085982
900 Ga0070668_100164050
901 Ga0070668_100472543
902 Ga0070669_100372721
903 Ga0070675_100151842
904 Ga0070675_101491077
905 Ga0070671_100173901
906 Ga0070671_100286063
907 Ga0070674_100129940
908 Ga0070674_100431546
909 Ga0070674_101440547
910 Ga0070659_100038841
911 Ga0070659_100056701
912 Ga0070659_100890255
913 Ga0070667_100141064
914 Ga0070667_100239246
915 Ga0070667_100450165
916 Ga0070667_100733050
917 Ga0070713_101248008
918 Ga0070701_10047819
919 Ga0070701_10100444
920 Ga0070701_10329977
921 Ga0070701_10874393
922 Ga0070705_100318513
923 Ga0070700_100060127
924 Ga0070694_100556885
925 Ga0070663_100004964
926 Ga0070663_100038922
927 Ga0070663_100556425
928 Ga0070663_100561369
929 Ga0070678_100014720
930 Ga0070678_100122692
931 Ga0070678_100205720
932 Ga0070678_100491444
933 Ga0070678_100698622
934 Ga0070678_100706570
935 Ga0070678_101266059
936 Ga0070662_100052750
937 Ga0070662_100794102
938 Ga0070681_10025253
939 Ga0070681_10421574
940 Ga0068867_100017224
941 Ga0070685_10059934
942 Ga0070706_100705567
943 Ga0070698_100821854
944 Ga0070699_100267423
945 Ga0070699_100768062
946 Ga0070679_100007145
947 Ga0070679_100385131
948 Ga0070684_100036427
949 Ga0070697_100817827
950 Ga0068853_100004567
951 Ga0068853_100609047
952 Ga0068853_101341295
953 Ga0068853_101596471
954 Ga0070672_100222163
955 Ga0070672_100293315
956 Ga0070672_100341270
957 Ga0070672_100654384
958 Ga0070672_101314735
959 Ga0070686_100413433
960 Ga0070695_100230054
961 Ga0070695_100678608
962 Ga0070696_100079555
963 Ga0070693_100261516
964 Ga0070693_100521632
965 Ga0070693_101633422
966 Ga0070665_100047706
967 Ga0070665_100208388
968 Ga0070665_100307566
969 Ga0070665_100717564
970 Ga0070704_101094073
971 Ga0068855_100018753
972 Ga0068855_100096595
973 Ga0068855_100288669
974 Ga0068855_101180237
975 Ga0070664_100047321
976 Ga0068857_100025975
977 Ga0068857_100187862
978 Ga0068857_102262432
979 Ga0068854_100397499
980 Ga0068856_100038417
981 Ga0068856_100636096
982 Ga0068856_100765449
983 Ga0070702_100376781
984 Ga0070702_100454688
985 Ga0070702_100711809
986 Ga0068852_100299262
987 Ga0068852_100464047
988 Ga0068852_100467173
989 Ga0068859_100135569
990 Ga0068859_100136429
991 Ga0068859_102031501
992 Ga0068864_100488821
993 Ga0068866_10642090
994 Ga0068866_10925954
995 Ga0068861_100074844
996 Ga0068861_100135970
997 Ga0068861_100176355
998 Ga0068861_100483837
999 Ga0068861_100753943
1000 Ga0068861_101415820
1001 Ga0068861_101741658
1002 Ga0068861_101925205
1003 Ga0068861_102078798
1004 Ga0068851_10098448
1005 Ga0068851_10264472
1006 Ga0068870_10212799
1007 Ga0068863_100715897
1008 Ga0068858_100207124
1009 Ga0068858_100344671
1010 Ga0068858_100915654
1011 Ga0068860_100186229
1012 Ga0068860_100232067
1013 Ga0068862_100161124
1014 Ga0068862_100465082
1015 Ga0068862_101930088
1016 Ga0068862_102067193
1017 Ga0081455_10018681
1018 Ga0081455_10032981
1019 Ga0081538_10104798
1020 Ga0081540_1007439
1021 Ga0081540_1050044
1022 Ga0081539_10051625
1023 Ga0081539_10144708
1024 Ga0075365_10056435
1025 Ga0075365_10166156
1026 Ga0075368_10018641
1027 Ga0075368_10058752
1028 Ga0075363_100005168
1029 Ga0075363_100035758
1030 Ga0075364_10352059
1031 Ga0075364_10462652
1032 Ga0070715_10083643
1033 Ga0070716_100204444
1034 Ga0070716_100785250
1035 Ga0070712_100198700
1036 Ga0075362_10058957
1037 Ga0075362_10278740
1038 Ga0075362_10343815
1039 Ga0075362_10353586
1040 Ga0075367_10009454
1041 Ga0075367_10097409
1042 Ga0075369_10069710
1043 Ga0075369_10140275
1044 Ga0075366_10044357
1045 Ga0075366_10524614
1046 Ga0075366_10550044
1047 Ga0097621_100022308
1048 Ga0075370_10173503
1049 Ga0075370_10730321
1050 Ga0068871_100088664
1051 Ga0068871_101197152
1052 Ga0075428_100063028
1053 Ga0075428_100359501
1054 Ga0075431_102014789
1055 Ga0075433_10967648
1056 Ga0075434_100289164
1057 Ga0068865_100088644
1058 Ga0068865_100304564
1059 Ga0068865_100367640
1060 Ga0075436_100980080
1061 Ga0097620_100135577
1062 Ga0097620_100136438
1063 Ga0097620_102031258
1064 Ga0075435_100089748
1065 Ga0099794_10019661
1066 Ga0099794_10079276
1067 Ga0099794_10264596
1068 Ga0099794_10326509
1069 Ga0099795_10017040
1070 Ga0099795_10112925
1071 Ga0099795_10133713
1072 Ga0105250_10077365
1073 Ga0105240_10018737
1074 Ga0105240_10033366
1075 Ga0111539_10075408
1076 Ga0111539_11195934
1077 Ga0105245_10060094
1078 Ga0105245_10197061
1079 Ga0105245_10405802
1080 Ga0105245_10663885
1081 Ga0105247_10101031
1082 Ga0105247_10334333
1083 Ga0105247_10516201
1084 Ga0105247_10596331
1085 Ga0105247_11809206
1086 Ga0114129_11184070
1087 Ga0105243_10633655
1088 Ga0105243_11827512
1089 Ga0105241_10014728
1090 Ga0105241_11478690
1091 Ga0105242_10091902
1092 Ga0105242_10479257
1093 Ga0105248_10056837
1094 Ga0105248_11237757
1095 Ga0105248_11270089
1096 Ga0105248_12103583
1097 Ga0105237_10018689
1098 Ga0105237_10031336
1099 Ga0105237_10552785
1100 Ga0105237_10720565
1101 Ga0105237_12486962
1102 Ga0105238_10234062
1103 Ga0105238_10423937
1104 Ga0105238_10685753
1105 Ga0105249_10713480
1106 Ga0105249_10907954
1107 Ga0105249_11024109
1108 Ga0105249_12082790
1109 Ga0105249_12916308
1110 Ga0099796_10158391
1111 Ga0099796_10183672
1112 Ga0099796_10471206
1113 Ga0099796_10505247
1114 Ga0105239_10052151
1115 Ga0105239_10254562
1116 Ga0105239_10448977
1117 Ga0105239_10946479
1118 Ga0105239_11707409
1119 Ga0105239_12746297
1120 Ga0105239_13353874
1121 Ga0105246_10008520
1122 Ga0105246_10128475
1123 Ga0105246_10193144
1124 Ga0105246_10270150
1125 Ga0105246_10414148
1126 Ga0105246_11264250
1127 Ga0157313_1039677
1128 Ga0157371_10439283
1129 Ga0157370_10254898
1130 Ga0157370_10662268
1131 Ga0157374_10165066
1132 Ga0157374_11017083
1133 Ga0157378_10196439
1134 Ga0157378_11491068
1135 Ga0163162_10185550
1136 Ga0163162_10826586
1137 Ga0163162_11736662
1138 Ga0163162_12348331
1139 Ga0163162_13314663
1140 Ga0157372_10220095
1141 Ga0157375_10076706
1142 Ga0157375_10169765
1143 Ga0157375_10301230
1144 Ga0157375_10395649
1145 Ga0157375_10807821
1146 Ga0157375_12079872
1147 Ga0157375_12192570
1148 Ga0163163_10090685
1149 Ga0163163_10103381
1150 Ga0163163_10122024
1151 Ga0163163_10770945
1152 Ga0163163_12359830
1153 Ga0163163_13062141
1154 Ga0157380_10198028
1155 Ga0157380_10326083
1156 Ga0157380_10356327
1157 Ga0157380_10792445
1158 Ga0157377_10092060
1159 Ga0157379_10429469
1160 Ga0157379_11219291
1161 Ga0157379_11434101
1162 Ga0157376_10051008
1163 Ga0157376_10171007
1164 Ga0163161_10154924
1165 Ga0163161_10372405
1166 Ga0163161_10622917
1167 Ga0209758_1030854
1168 Ga0207697_10033307
1169 Ga0207697_10122192
1170 Ga0207656_10003494
1171 Ga0207656_10026557
1172 Ga0207656_10385817
1173 Ga0207696_1053198
1174 Ga0207642_10555711
1175 Ga0207710_10143222
1176 Ga0207710_10527160
1177 Ga0207710_10672605
1178 Ga0207688_10095280
1179 Ga0207688_10383054
1180 Ga0207688_10451114
1181 Ga0207688_10520223
1182 Ga0207680_10875758
1183 Ga0207645_10086241
1184 Ga0207645_10135103
1185 Ga0207645_10157338
1186 Ga0207645_10351120
1187 Ga0207645_10989650
1188 Ga0207643_10026468
1189 Ga0207643_10691310
1190 Ga0207643_10873198
1191 Ga0207705_10054974
1192 Ga0207684_10403937
1193 Ga0207684_10835758
1194 Ga0207654_10119561
1195 Ga0207707_10038323
1196 Ga0207707_10220411
1197 Ga0207707_10429101
1198 Ga0207695_10887128
1199 Ga0207671_10020862
1200 Ga0207671_10065596
1201 Ga0207693_10120319
1202 Ga0207660_10013490
1203 Ga0207660_10166029
1204 Ga0207662_10498033
1205 Ga0207657_10002309
1206 Ga0207657_10262532
1207 Ga0207657_10273927
1208 Ga0207657_10323048
1209 Ga0207657_10468073
1210 Ga0207649_10090261
1211 Ga0207649_10352095
1212 Ga0207652_10004639
1213 Ga0207652_10193606
1214 Ga0207681_10439694
1215 Ga0207694_10261632
1216 Ga0207694_11490825
1217 Ga0207650_10201196
1218 Ga0207650_10407695
1219 Ga0207659_10718002
1220 Ga0207659_10838120
1221 Ga0207687_10137961
1222 Ga0207687_10206678
1223 Ga0207687_10421763
1224 Ga0207664_10358917
1225 Ga0207644_10139695
1226 Ga0207644_10429432
1227 Ga0207644_10910594
1228 Ga0207644_11198977
1229 Ga0207690_10159436
1230 Ga0207690_10363009
1231 Ga0207690_10449980
1232 Ga0207690_11675592
1233 Ga0207706_10036340
1234 Ga0207706_10550822
1235 Ga0207706_11203722
1236 Ga0207706_11711311
1237 Ga0207686_10944318
1238 Ga0207709_10017623
1239 Ga0207709_10789542
1240 Ga0207669_10107978
1241 Ga0207669_11853061
1242 Ga0207704_10009818
1243 Ga0207704_10119565
1244 Ga0207704_10520083
1245 Ga0207704_11803947
1246 Ga0207665_10226676
1247 Ga0207665_10741127
1248 Ga0207691_10040414
1249 Ga0207691_10071235
1250 Ga0207691_10099018
1251 Ga0207711_10563929
1252 Ga0207711_10952966
1253 Ga0207711_10999864
1254 Ga0207711_11673567
1255 Ga0207689_10016538
1256 Ga0207689_10021369
1257 Ga0207689_10070806
1258 Ga0207689_10956801
1259 Ga0207689_10965276
1260 Ga0207661_10466706
1261 Ga0207679_10100633
1262 Ga0207679_12056044
1263 Ga0207667_10006322
1264 Ga0207667_10318105
1265 Ga0207667_10460754
1266 Ga0207667_10987265
1267 Ga0207651_10063236
1268 Ga0207651_10081599
1269 Ga0207651_10243012
1270 Ga0207712_10107984
1271 Ga0207712_10425947
1272 Ga0207712_10559950
1273 Ga0207668_10076400
1274 Ga0207668_10163436
1275 Ga0207668_10994147
1276 Ga0207668_11266182
1277 Ga0207640_10211235
1278 Ga0207658_10213131
1279 Ga0207658_10266721
1280 Ga0207658_10337930
1281 Ga0207658_10714038
1282 Ga0207658_12191482
1283 Ga0207677_10192228
1284 Ga0207677_10453660
1285 Ga0207677_10821802
1286 Ga0207703_10240071
1287 Ga0207703_10579961
1288 Ga0207639_10222481
1289 Ga0207639_10252419
1290 Ga0207639_11229477
1291 Ga0207639_12289529
1292 Ga0207678_10033062
1293 Ga0207678_10043944
1294 Ga0207678_10051334
1295 Ga0207678_10077151
1296 Ga0207678_10880259
1297 Ga0207708_10042791
1298 Ga0207708_10054915
1299 Ga0207708_10677964
1300 Ga0207702_10060713
1301 Ga0207702_10661637
1302 Ga0207702_11380668
1303 Ga0207641_10557586
1304 Ga0207641_10696392
1305 Ga0207648_10020971
1306 Ga0207648_10906148
1307 Ga0207648_11021016
1308 Ga0207676_10110915
1309 Ga0207676_10846411
1310 Ga0207674_10023884
1311 Ga0207674_10151198
1312 Ga0207675_100110767
1313 Ga0207675_100217286
1314 Ga0207675_100271191
1315 Ga0207675_100316658
1316 Ga0207675_101199187
1317 Ga0207675_101205192
1318 Ga0207683_10037173
1319 Ga0207683_10082367
1320 Ga0207683_10124835
1321 Ga0207683_10824692
1322 Ga0207683_11690860
1323 Ga0207698_10815042
1324 Ga0207698_11984775
1325 Ga0207698_12410289
1326 Ga0209588_1003598
1327 Ga0209588_1033521
1328 Ga0209588_1073412
1329 Ga0209813_10036914
1330 Ga0209813_10376691
1331 Ga0207428_10310907
1332 Ga0207428_10573163
1333 Ga0268266_10004734
1334 Ga0268266_10015035
1335 Ga0268266_10110977
1336 Ga0268266_10529555
1337 Ga0268266_11382377
1338 Ga0268265_10017430
1339 Ga0268265_10045734
1340 Ga0268265_10800639
1341 Ga0268265_11125286
1342 Ga0268265_11516563
1343 Ga0268265_11533669
1344 Ga0268265_11639742
1345 Ga0268264_10050917
1346 Ga0268264_10359762
1347 Ga0268264_10575553
1348 Ga0268264_10801260
1349 Ga0307517_10051925
1350 Ga0307515_10751265
1351 Ga0265339_10455158
1352 Ga0265331_10053219
1353 Ga0307509_10242859
1354 Ga0307408_100807797
1355 Ga0307408_102489086
1356 Ga0307508_10135984
1357 Ga0307514_10474075
1358 Ga0307516_10093931
1359 Ga0307407_10593089
1360 Ga0307416_102380449
1361 Ga0307415_100359193
1362 Ga0307415_100382137
1363 Ga0307415_100710326
1364 Ga0307415_100711372
1365 Ga0307507_10314194
1366 Ga0307510_10030947
1367 Ga0307510_10116063
1368 Ga0307510_10600413
1369 Ga0373926_0111022
1370 Ga0373944_0052635
1371 Ga0373923_0361974
1372 Ga0373936_0011098
1373 Ga0373939_0257329
1374 Ga0373945_0039199
1375 Ga0373960_0101285
1376 Ga0373943_0078979
1377 Ga0373946_0011293
1378 Ga0373955_0003503
1379 Ga0373924_0029664
1380 Ga0373931_1031038
1381 Ga0373935_0000039
1382 Ga0373927_0000363
1383 Ga0373927_0383368
1384 Ga0373947_0000196
1385 Ga0373937_0045077
1386 Ga0373925_0000280
1387 Ga0373925_0531744
1388 Ga0395898_0880048
1389 Ga0395905_0084175
1390 Ga0395905_1191677
1391 Ga0436363_0180011
1392 Ga0439465_0128016
1393 Ga0451795_0654717
1394 Ga0451800_1217771
1395 Ga0451807_0654396
1396 Ga0451837_0786431
1397 Ga0451853_2367645
1398 Ga0439458_0029798
1399 Ga0495617_107426
1400 Ga0495617_112226
1401 Ga0495617_125487
1402 Ga0495627_144376
1403 Ga0495592_0059204
1404 Ga0495603_0001166
1405 Ga0495603_0009532
1406 Ga0495603_0013646
1407 Ga0495603_0052566
1408 Ga0495603_0207304
1409 Ga0495603_0266565
1410 Ga0495590_0312434
1411 Ga0495590_0349518
1412 Ga0495629_0000136
1413 Ga0495629_0015181
1414 Ga0495638_0112657
1415 Ga0495638_0157961
1416 Ga0495638_0224908
1417 Ga0495638_0402588
1418 Ga0495641_0009910
1419 Ga0495651_0351574
1420 Ga0495650_0124333
1421 Ga0495580_0002073
1422 Ga0495582_0000015
1423 Ga0495582_0127206
1424 Ga0495582_0778249
1425 Ga0495605_0088024
1426 Ga0495605_0408732
1427 Ga0495639_0000025
1428 Ga0495639_0067424
1429 Ga0495639_0663971
1430 Ga0495662_0000115
1431 Ga0495664_0011671
1432 Ga0495584_0080995
1433 Ga0495584_0126413
1434 Ga0495584_0668655
1435 Ga0495585_0190206
1436 Ga0495585_0201198
1437 Ga0495585_0322328
1438 Ga0495594_0000057
1439 Ga0495594_0171835
1440 Ga0495583_0198411
1441 Ga0495606_0151942
1442 Ga0495608_0171230
1443 Ga0495610_0275985
1444 Ga0495616_0091608
1445 Ga0495620_0057136
1446 Ga0495628_0126101
1447 Ga0495630_0003941
1448 Ga0495631_0022733
1449 Ga0495631_0134261
1450 Ga0495631_0316462
1451 Ga0495631_0353515
1452 Ga0495632_0183449
1453 Ga0495637_0068410
1454 Ga0495644_0162193
1455 Ga0495644_0461514
1456 Ga0495663_0069114
1457 Ga0495663_0086631
1458 Ga0495663_0298400
1459 Ga0495666_0147228
1460 Ga0495666_0339593
1461 Ga0495642_0178486
1462 Ga0495652_0116059
1463 Ga0495665_0000548
1464 Ga0495640_0005492
1465 Ga0495586_0012247
1466 Ga0495598_0069560
1467 Ga0495598_0144174
1468 Ga0495609_0060482
1469 Ga0495609_0289046
1470 Ga0495621_0422845
1471 Ga0495622_0002100
1472 Ga0495622_0160280
1473 Ga0495622_0226301
1474 Ga0495622_0294106
1475 Ga0495633_0133620
1476 Ga0495667_0020056
1477 Ga0495668_0152996
1478 Ga0495668_0583095
1479 Ga0495634_0000387
1480 Ga0495611_0135340
1481 Ga0495611_0305945
1482 Ga0495611_0405958
1483 Ga0495625_0043196
1484 Ga0495625_0343918
1485 Ga0495625_0573375
1486 Ga0495635_0000143
1487 Ga0495659_0143206
1488 Ga0495659_0262156
1489 Ga0495588_0031831
1490 Ga0495588_0302968
1491 Ga0495588_0322445
1492 Ga0495623_0348518
1493 Ga0495646_0348338
1494 Ga0495647_0000218
1495 Ga0495658_0002394
1496 Ga0495669_0074537
1497 Ga0495613_0001610
1498 Ga0495624_0000050
1499 Ga0495670_0317545
1500 Ga0495670_0602654
1501 Ga0495671_0303219
1502 Ga0495589_0074574
1503 Ga0495589_0147331
1504 Ga0495589_0393385
1505 Ga0495600_0176134
1506 Ga0495600_0550884
1507 Ga0495581_0000997
1508 Ga0495581_0150928
1509 Ga0495581_0253769
1510 Ga0495581_0553301
1511 Ga0495604_0155308
1512 Ga0495636_0169637
1513 Ga0495636_0195523
1514 Ga0495674_0000332
1515 Ga0495672_0046769
1516 Ga0495676_0060727
1517 Ga0495676_0554290
1518 Ga0495680_0439296
1519 Ga0495683_0178851
1520 Ga0495683_0292704
1521 Ga0495677_0049271
1522 Ga0495677_0360668
1523 Ga0495679_035226
1524 Ga0495685_048099
1525 Ga0495673_0051663
1526 Ga0495681_0081046
1527 Ga0495681_0194029
1528 Ga0495686_0070961
1529 Ga0495686_0285093
1530 Ga0495686_0666448
1531 Ga0495593_0000037
1532 Ga0495593_0111897
1533 Ga0495602_0246456
1534 Ga0495614_0010502
1535 Ga0495615_0105805
1536 Ga0495626_0165877
1537 Ga0495626_0421165
1538 Ga0496100_0050635
1539 Ga0496101_0034333
1540 Ga0496101_0296331
1541 Ga0496101_1498409
1542 Ga0496102_0004540
1543 Ga0496102_0025193
1544 Ga0496102_0294970
1545 Ga0496102_0735550
1546 Ga0496102_1456846
1547 Ga0496103_0267670
1548 Ga0496103_0275828
1549 Ga0496103_0356942
1550 Ga0496103_0504896
1551 Ga0496103_0718780
1552 Ga0496104_0017703
1553 Ga0496104_0295160
1554 Ga0496104_1345531
1555 Ga0496105_0700383
1556 Ga0496106_0031423
1557 Ga0496106_0076924
1558 Ga0496106_0079839
1559 Ga0496106_0332331
1560 Ga0496107_0011149
1561 Ga0496107_0613530
1562 Ga0496108_0051533
1563 Ga0496108_0387465
1564 Ga0496109_0046397
1565 Ga0496109_0079216
1566 Ga0496109_0091645
1567 Ga0496109_0510250
1568 Ga0496110_0177200
1569 Ga0496110_0428881
1570 Ga0496110_0472536
1571 Ga0496110_1747323
1572 Ga0496111_0006236
1573 Ga0496111_0898920
1574 Ga0496111_1277333
1575 Ga0496112_0212873
1576 Ga0496113_0046669
1577 Ga0496113_0193720
1578 Ga0496114_0076326
1579 Ga0496114_0187375
1580 Ga0496114_0315759
1581 Ga0496114_1260380
1582 Ga0496115_0003033
1583 Ga0496115_0028937
1584 Ga0496115_0557983
1585 Ga0496115_0651370
1586 Ga0496116_0389809
1587 Ga0496118_0142211
1588 Ga0496119_0107633
1589 Ga0496121_0001325
1590 Ga0496121_0059773
1591 Ga0496121_0128579
1592 Ga0496121_0457757
1593 Ga0496121_0489472
1594 Ga0496121_0646283
1595 Ga0496121_0842180
1596 Ga0496124_0083976
1597 Ga0496124_0432504
1598 Ga0496125_0407090
1599 Ga0496125_0601277
1600 Ga0496126_0004556
1601 Ga0496126_0227009
1602 Ga0496126_0294954
1603 Ga0496126_0302083
1604 Ga0496126_0776741
1605 Ga0496126_0777863
1606 Ga0496126_0910722
1607 Ga0495678_084097
1608 Ga0495682_0056931
1609 Ga0495682_0291080
1610 Ga0501032_0000165
1611 Ga0501033_0002872
1612 Ga0501034_0000058
1613 Ga0501036_0000020
1614 Ga0501037_0000250
1615 Ga0501038_0000050
1616 Ga0501039_0038472
1617 Ga0501040_1122620
1618 Ga0501041_0548310
1619 Ga0501042_0073310
1620 Ga0501043_0000547
1621 Ga0501046_0006778
1622 Ga0501047_0000538
1623 Ga0501048_0000129
1624 Ga0501067_0000809
1625 Ga0501068_0011201
1626 Ga0501068_0675619
1627 Ga0501069_0011385
1628 Ga0501070_0021764
1629 Ga0501071_0172499
1630 Ga0501072_0006764
1631 Ga0501073_0000061
1632 Ga0501074_0000022
1633 Ga0501076_0974049
1634 Ga0501077_0631181
1635 Ga0501079_0020096
1636 Ga0501080_0000226
1637 Ga0501083_0002631
1638 Ga0501035_0006960
1639 Ga0501044_0000145
1640 Ga0501045_0017567
1641 nmdc:mga03683_251343_c1
1642 nmdc:mga03683_41591_c1
1643 nmdc:mga03n38_168931_c1
1644 nmdc:mga00v17_334169_c1
1645 nmdc:mga0yw44_10576_c1
1646 nmdc:mga0yw44_162919_c1
1647 nmdc:mga0yw44_23830_c1
1648 nmdc:mga0k408_288078_c1
1649 nmdc:mga0k408_33186_c1
1650 nmdc:mga0k408_780946_c1
1651 nmdc:mga06z11_110946_c1
1652 nmdc:mga06z11_227600_c1
1653 nmdc:mga06z11_29040_c1
1654 nmdc:mga04h51_30879_c1
1655 nmdc:mga04h51_327682_c1
1656 nmdc:mga07m45_20657_c1
1657 nmdc:mga06r32_560655_c1
1658 nmdc:mga08y16_1273151_c1
1659 nmdc:mga08y16_62788_c1
1660 nmdc:mga08y16_647800_c1
1661 nmdc:mga0n895_1354211_c1
1662 nmdc:mga0a205_273018_c1
1663 Ga0495601_0269751
1664 Ga0500635_0000616
1665 Ga0500635_0365823
1666 Ga0495619_0246341
1667 Ga0500646_0116339
1668 Ga0500646_0203961
1669 Ga0500583_0164079
1670 Ga0500651_0532548
1671 Ga0500566_0001933
1672 Ga0500641_0014721
1673 Ga0500641_0029430
1674 Ga0500554_008444
1675 Ga0500554_010427
1676 Ga0500556_0181655
1677 Ga0500592_082408
1678 Ga0500594_0015392
1679 Ga0500594_0196515
1680 Ga0500595_000149
1681 Ga0500595_025744
1682 Ga0500614_048713
1683 Ga0500642_0454930
1684 Ga0500642_0503903
1685 Ga0500652_063878
1686 Ga0500655_127075
1687 Ga0500559_0216552
1688 Ga0500568_0029216
1689 Ga0500577_0178583
1690 Ga0500589_108323
1691 Ga0500603_000534
1692 Ga0500633_0298481
1693 Ga0500634_0075985
1694 Ga0500634_0266726
1695 Ga0500638_002269
1696 Ga0500638_067299
1697 Ga0500636_0207954
1698 Ga0500637_0000079
1699 Ga0500637_0167057
1700 Ga0500637_0273710
1701 Ga0500645_051333
1702 Ga0500609_008736
1703 Ga0500656_048173
1704 Ga0500587_063335
1705 Ga0501084_0006118
1706 Ga0501084_0646711
1707 Ga0500661_000500
1708 Ga0590071_116622
1709 Ga0501082_0004306
1710 Ga0530510_0379938
1711 2723849464
1712 2879112955
1713 2889035730
1714 2922364207
1715 2922392777
1716 8006989136
1717 8007000094
1718 8056677819

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.7494 56 96
5hun-assembly1.cif.gz_A the crystal structure of neuraminidase from a/gyrfalcon/washington/41088-6/2014 influenza virus 0.7415 69 105
4mjv-assembly1.cif.gz_A influenza neuraminidase in complex with a novel antiviral compound 0.7409 69 105
6d7k-assembly1.cif.gz_H complex structure of methane monooxygenase hydroxylase in complex with inhibitory subunit 0.7384 61 109
2ht5-assembly1.cif.gz_A n8 neuraminidase 0.7295 69 105
ID Description Score Start End Superfamily
af_Q22128_182_308_3.40.630.90 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase; 0.897 89 105 3.40.630.90
3wqtB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.7465 89 105 3.30.420.40
1jtgB01 Alpha Beta;2-Layer Sandwich;Beta-lactamase Inhibitory Protein; Chain:B, domain 1; 0.7379 45 105 3.30.1450.10
af_Q4E1T2_492_580_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.7218 70 105 3.30.160.20
4luaA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.719 87 105 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A517Y815-F1-model_v4 Uncharacterized protein 0.9121 44 106
AF-A0A845ALQ0-F1-model_v4 Penicillin-binding protein activator LpoB 0.8664 46 105 GO:0030288
AF-A0A4U3BA06-F1-model_v4 deleted 0.8642 44 105
AF-A0A2H6LR04-F1-model_v4 Transient receptor potential channel C 0.8371 44 105 GO:0016020
AF-A0A6N1YE04-F1-model_v4 Lipoprotein 0.8262 47 105

Map