F483721
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 858 | 353 | 857 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100004970|Ga0070664_1000049706 |
| Length | 292 |
| Sequence | LATRLKTIMTSSTFWRGLAAIAVFLILWEIGARSKQWLAPEFFAPFKSLLGAMGFKRDYLPWIGAVPAPSTVLATWASVLGQKGYWQSWYMSFFRVMSGFIAAMIIGIPFGLMLAVSRMTRWVAFPVFEVLRPIPPLAWVPASIIFWPTQELAITFITFLGAFYTIVINVLGGARSIDVRYFQAAQSMGSSRWDIFRRIILPGTLPSIVVGSAVGMGITWEVVVAAEMISGGGASGTIGSGGGLGFFIWNSYVGGSYEQIVVGMISIGIAGFASSELLRWLGRYATPWLKAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 2 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 91 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 92 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 201 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 205 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 209 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 210 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 212 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 213 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 214 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 218 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 221 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 232 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 235 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 236 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 246 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 247 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 248 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 249 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 250 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 251 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 252 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 253 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 254 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 255 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 256 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 257 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 294 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 295 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 306 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 307 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 308 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 312 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 313 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 315 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 318 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 322 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 327 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 328 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 332 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 334 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 335 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 336 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 337 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 338 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 339 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 340 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 341 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 342 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 343 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 344 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 350 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 351 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.88 |
| Metatranscriptomes | 0 |
| Isolates | 0.12 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.8 |
| Nodule | 0 |
| Rhizoplane | 3.85 |
| Rhizosphere | 93.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1015502 | 3300003792 | Bacteria | 2214 |
| 2 | Ga0070658_10071004 | 3300005327 | Bacteria | 2852 |
| 3 | Ga0070676_10070698 | 3300005328 | Bacteria | 2094 |
| 4 | Ga0070683_100015486 | 3300005329 | Bacteria | 6701 |
| 5 | Ga0070683_100119018 | 3300005329 | Bacteria | 2494 |
| 6 | Ga0070690_100000203 | 3300005330 | Bacteria | 31114 |
| 7 | Ga0070690_100285679 | 3300005330 | Bacteria | 1178 |
| 8 | Ga0070670_100004185 | 3300005331 | Bacteria | 12074 |
| 9 | Ga0070670_100005005 | 3300005331 | Bacteria | 11150 |
| 10 | Ga0070670_100014743 | 3300005331 | Bacteria | 6710 |
| 11 | Ga0070670_100094772 | 3300005331 | Bacteria | 2567 |
| 12 | Ga0070670_100264476 | 3300005331 | Bacteria | 1500 |
| 13 | Ga0068869_100002662 | 3300005334 | Bacteria | 10793 |
| 14 | Ga0070666_10002242 | 3300005335 | Bacteria | 11684 |
| 15 | Ga0070666_10027520 | 3300005335 | Bacteria | 3724 |
| 16 | Ga0070666_10032343 | 3300005335 | Bacteria | 3455 |
| 17 | Ga0070680_100039626 | 3300005336 | Bacteria | 3811 |
| 18 | Ga0070680_100155873 | 3300005336 | Bacteria | 1918 |
| 19 | Ga0070680_100431741 | 3300005336 | Bacteria | 1124 |
| 20 | Ga0070682_100017282 | 3300005337 | Bacteria | 4204 |
| 21 | Ga0070682_100018133 | 3300005337 | Bacteria | 4109 |
| 22 | Ga0070682_100021570 | 3300005337 | Unclassified | 3804 |
| 23 | Ga0070682_100070693 | 3300005337 | Bacteria | 2232 |
| 24 | Ga0068868_100000697 | 3300005338 | Bacteria | 22578 |
| 25 | Ga0068868_100001118 | 3300005338 | Bacteria | 18377 |
| 26 | Ga0068868_100097101 | 3300005338 | Bacteria | 2380 |
| 27 | Ga0068868_100158734 | 3300005338 | Bacteria | 1866 |
| 28 | Ga0070660_100068667 | 3300005339 | Bacteria | 2763 |
| 29 | Ga0070660_100290891 | 3300005339 | Bacteria | 1338 |
| 30 | Ga0070689_100004178 | 3300005340 | Bacteria | 9730 |
| 31 | Ga0070689_100018375 | 3300005340 | Bacteria | 5148 |
| 32 | Ga0070689_100079732 | 3300005340 | Bacteria | 2569 |
| 33 | Ga0070689_100245162 | 3300005340 | Bacteria | 1477 |
| 34 | Ga0070691_10000395 | 3300005341 | Bacteria | 15848 |
| 35 | Ga0070687_100000070 | 3300005343 | Bacteria | 33041 |
| 36 | Ga0070687_100081094 | 3300005343 | Unclassified | 1770 |
| 37 | Ga0070661_100021176 | 3300005344 | Bacteria | 4640 |
| 38 | Ga0070692_10001807 | 3300005345 | Bacteria | 7998 |
| 39 | Ga0070668_100081957 | 3300005347 | Bacteria | 2530 |
| 40 | Ga0070668_100174746 | 3300005347 | Bacteria | 1751 |
| 41 | Ga0070669_100059891 | 3300005353 | Bacteria | 2796 |
| 42 | Ga0070669_100168370 | 3300005353 | Bacteria | 1707 |
| 43 | Ga0070675_100124885 | 3300005354 | Bacteria | 2189 |
| 44 | Ga0070675_100124977 | 3300005354 | Bacteria | 2188 |
| 45 | Ga0070675_100292557 | 3300005354 | Bacteria | 1433 |
| 46 | Ga0070675_100393389 | 3300005354 | Bacteria | 1235 |
| 47 | Ga0070671_100006600 | 3300005355 | Bacteria | 9276 |
| 48 | Ga0070671_100014099 | 3300005355 | Bacteria | 6453 |
| 49 | Ga0070671_100051418 | 3300005355 | Bacteria | 3427 |
| 50 | Ga0070674_100090083 | 3300005356 | Bacteria | 2212 |
| 51 | Ga0070674_100237459 | 3300005356 | Bacteria | 1425 |
| 52 | Ga0070674_100401996 | 3300005356 | Bacteria | 1119 |
| 53 | Ga0070673_100003763 | 3300005364 | Bacteria | 9513 |
| 54 | Ga0070673_100003942 | 3300005364 | Bacteria | 9326 |
| 55 | Ga0070673_100011403 | 3300005364 | Bacteria | 6063 |
| 56 | Ga0070673_100023398 | 3300005364 | Bacteria | 4513 |
| 57 | Ga0070688_100027633 | 3300005365 | Bacteria | 3380 |
| 58 | Ga0070688_100031648 | 3300005365 | Bacteria | 3184 |
| 59 | Ga0070688_100263483 | 3300005365 | Bacteria | 1232 |
| 60 | Ga0070659_100084851 | 3300005366 | Bacteria | 2533 |
| 61 | Ga0070659_100174146 | 3300005366 | Bacteria | 1764 |
| 62 | Ga0070667_100023816 | 3300005367 | Bacteria | 5083 |
| 63 | Ga0070667_100040607 | 3300005367 | Bacteria | 3901 |
| 64 | Ga0070667_100059389 | 3300005367 | Bacteria | 3235 |
| 65 | Ga0070667_100171496 | 3300005367 | Bacteria | 1915 |
| 66 | Ga0070703_10012874 | 3300005406 | Bacteria | 2371 |
| 67 | Ga0070703_10020671 | 3300005406 | Bacteria | 1918 |
| 68 | Ga0070703_10058243 | 3300005406 | Bacteria | 1257 |
| 69 | Ga0070709_10002182 | 3300005434 | Bacteria | 10602 |
| 70 | Ga0070709_10002448 | 3300005434 | Bacteria | 10058 |
| 71 | Ga0070709_10004334 | 3300005434 | Bacteria | 7646 |
| 72 | Ga0070714_100007793 | 3300005435 | Bacteria | 8342 |
| 73 | Ga0070714_100033480 | 3300005435 | Bacteria | 4295 |
| 74 | Ga0070714_100259916 | 3300005435 | Bacteria | 1608 |
| 75 | Ga0070713_100000728 | 3300005436 | Bacteria | 21169 |
| 76 | Ga0070713_100000923 | 3300005436 | Bacteria | 18738 |
| 77 | Ga0070713_100010653 | 3300005436 | Bacteria | 6654 |
| 78 | Ga0070710_10003961 | 3300005437 | Bacteria | 7020 |
| 79 | Ga0070710_10007113 | 3300005437 | Bacteria | 5407 |
| 80 | Ga0070710_10018012 | 3300005437 | Bacteria | 3627 |
| 81 | Ga0070710_10041867 | 3300005437 | Bacteria | 2530 |
| 82 | Ga0070710_10202533 | 3300005437 | Bacteria | 1254 |
| 83 | Ga0070701_10000579 | 3300005438 | Bacteria | 12750 |
| 84 | Ga0070711_100001151 | 3300005439 | Bacteria | 14210 |
| 85 | Ga0070711_100013544 | 3300005439 | Bacteria | 5121 |
| 86 | Ga0070711_100033220 | 3300005439 | Bacteria | 3435 |
| 87 | Ga0070711_100176471 | 3300005439 | Bacteria | 1632 |
| 88 | Ga0070711_100187816 | 3300005439 | Bacteria | 1586 |
| 89 | Ga0070705_100000586 | 3300005440 | Bacteria | 21191 |
| 90 | Ga0070705_100017884 | 3300005440 | Bacteria | 3707 |
| 91 | Ga0070705_100165039 | 3300005440 | Bacteria | 1485 |
| 92 | Ga0070700_100005942 | 3300005441 | Bacteria | 6486 |
| 93 | Ga0070700_100106605 | 3300005441 | Bacteria | 1855 |
| 94 | Ga0070700_100227770 | 3300005441 | Bacteria | 1325 |
| 95 | Ga0070700_100244945 | 3300005441 | Bacteria | 1283 |
| 96 | Ga0070694_100000527 | 3300005444 | Bacteria | 21062 |
| 97 | Ga0070694_100011467 | 3300005444 | Bacteria | 5490 |
| 98 | Ga0070708_100032334 | 3300005445 | Bacteria | 4537 |
| 99 | Ga0070708_100038741 | 3300005445 | Bacteria | 4166 |
| 100 | Ga0070678_100011697 | 3300005456 | Bacteria | 5426 |
| 101 | Ga0070678_100070947 | 3300005456 | Bacteria | 2606 |
| 102 | Ga0070678_100099155 | 3300005456 | Bacteria | 2254 |
| 103 | Ga0070678_100250801 | 3300005456 | Bacteria | 1484 |
| 104 | Ga0070662_100047455 | 3300005457 | Bacteria | 3089 |
| 105 | Ga0070662_100130680 | 3300005457 | Bacteria | 1936 |
| 106 | Ga0070662_100251067 | 3300005457 | Bacteria | 1422 |
| 107 | Ga0070681_10009213 | 3300005458 | Bacteria | 9703 |
| 108 | Ga0068867_100000775 | 3300005459 | Bacteria | 21581 |
| 109 | Ga0068867_100010066 | 3300005459 | Bacteria | 6664 |
| 110 | Ga0070685_10002556 | 3300005466 | Bacteria | 9320 |
| 111 | Ga0070685_10009466 | 3300005466 | Bacteria | 5037 |
| 112 | Ga0070706_100043168 | 3300005467 | Bacteria | 4165 |
| 113 | Ga0070706_100059044 | 3300005467 | Bacteria | 3540 |
| 114 | Ga0070706_100087501 | 3300005467 | Bacteria | 2888 |
| 115 | Ga0070707_100036230 | 3300005468 | Bacteria | 4707 |
| 116 | Ga0070707_100156964 | 3300005468 | Bacteria | 2217 |
| 117 | Ga0070698_100010044 | 3300005471 | Bacteria | 10109 |
| 118 | Ga0070698_100113269 | 3300005471 | Bacteria | 2677 |
| 119 | Ga0070698_100258343 | 3300005471 | Bacteria | 1674 |
| 120 | Ga0070698_100259826 | 3300005471 | Bacteria | 1669 |
| 121 | Ga0070699_100032485 | 3300005518 | Bacteria | 4507 |
| 122 | Ga0070699_100065163 | 3300005518 | Bacteria | 3161 |
| 123 | Ga0070699_100097904 | 3300005518 | Bacteria | 2570 |
| 124 | Ga0070699_100285853 | 3300005518 | Bacteria | 1478 |
| 125 | Ga0070679_100001447 | 3300005530 | Bacteria | 21006 |
| 126 | Ga0070697_100005988 | 3300005536 | Bacteria | 9403 |
| 127 | Ga0070697_100064432 | 3300005536 | Bacteria | 2993 |
| 128 | Ga0068853_100036955 | 3300005539 | Bacteria | 4154 |
| 129 | Ga0068853_100135040 | 3300005539 | Bacteria | 2211 |
| 130 | Ga0068853_100139987 | 3300005539 | Bacteria | 2172 |
| 131 | Ga0070672_100010810 | 3300005543 | Bacteria | 6344 |
| 132 | Ga0070672_100018605 | 3300005543 | Bacteria | 5027 |
| 133 | Ga0070672_100030866 | 3300005543 | Bacteria | 4030 |
| 134 | Ga0070672_100092046 | 3300005543 | Bacteria | 2447 |
| 135 | Ga0070686_100000240 | 3300005544 | Bacteria | 37313 |
| 136 | Ga0070686_100002912 | 3300005544 | Bacteria | 9391 |
| 137 | Ga0070686_100018776 | 3300005544 | Bacteria | 4064 |
| 138 | Ga0070695_100000374 | 3300005545 | Bacteria | 22964 |
| 139 | Ga0070695_100006942 | 3300005545 | Bacteria | 6707 |
| 140 | Ga0070696_100046543 | 3300005546 | Bacteria | 3008 |
| 141 | Ga0070696_100057902 | 3300005546 | Bacteria | 2705 |
| 142 | Ga0070696_100070857 | 3300005546 | Bacteria | 2453 |
| 143 | Ga0070693_100000298 | 3300005547 | Bacteria | 23135 |
| 144 | Ga0070693_100031068 | 3300005547 | Bacteria | 2925 |
| 145 | Ga0070693_100102273 | 3300005547 | Bacteria | 1748 |
| 146 | Ga0070693_100148512 | 3300005547 | Bacteria | 1482 |
| 147 | Ga0070665_100054754 | 3300005548 | Bacteria | 4000 |
| 148 | Ga0070665_100149235 | 3300005548 | Bacteria | 2341 |
| 149 | Ga0070665_100192032 | 3300005548 | Bacteria | 2043 |
| 150 | Ga0070704_100000864 | 3300005549 | Bacteria | 15175 |
| 151 | Ga0070704_100002844 | 3300005549 | Bacteria | 9810 |
| 152 | Ga0070704_100167467 | 3300005549 | Bacteria | 1744 |
| 153 | Ga0070704_100291453 | 3300005549 | Bacteria | 1356 |
| 154 | Ga0068855_100001747 | 3300005563 | Bacteria | 27121 |
| 155 | Ga0068855_100163255 | 3300005563 | Bacteria | 2527 |
| 156 | Ga0070664_100004970 | 3300005564 | Bacteria | 10652 |
| 157 | Ga0070664_100009313 | 3300005564 | Bacteria | 7969 |
| 158 | Ga0070664_100178728 | 3300005564 | Bacteria | 1885 |
| 159 | Ga0068857_100011942 | 3300005577 | Bacteria | 7552 |
| 160 | Ga0068857_100017390 | 3300005577 | Bacteria | 6300 |
| 161 | Ga0068857_100284506 | 3300005577 | Bacteria | 1521 |
| 162 | Ga0068857_100311309 | 3300005577 | Bacteria | 1453 |
| 163 | Ga0068857_100371705 | 3300005577 | Bacteria | 1326 |
| 164 | Ga0068854_100009390 | 3300005578 | Bacteria | 6316 |
| 165 | Ga0068854_100013725 | 3300005578 | Bacteria | 5325 |
| 166 | Ga0068856_100002249 | 3300005614 | Bacteria | 19936 |
| 167 | Ga0068856_100005249 | 3300005614 | Bacteria | 12779 |
| 168 | Ga0068856_100114006 | 3300005614 | Bacteria | 2702 |
| 169 | Ga0068856_100128107 | 3300005614 | Bacteria | 2542 |
| 170 | Ga0068856_100180823 | 3300005614 | Bacteria | 2122 |
| 171 | Ga0070702_100000032 | 3300005615 | Bacteria | 37311 |
| 172 | Ga0070702_100003828 | 3300005615 | Bacteria | 6807 |
| 173 | Ga0068852_100002813 | 3300005616 | Bacteria | 12058 |
| 174 | Ga0068852_100328246 | 3300005616 | Bacteria | 1488 |
| 175 | Ga0068859_100000445 | 3300005617 | Bacteria | 41359 |
| 176 | Ga0068859_100384724 | 3300005617 | Bacteria | 1498 |
| 177 | Ga0068859_100397785 | 3300005617 | Bacteria | 1473 |
| 178 | Ga0068859_100474806 | 3300005617 | Bacteria | 1346 |
| 179 | Ga0068859_100585168 | 3300005617 | Bacteria | 1210 |
| 180 | Ga0068864_100002011 | 3300005618 | Bacteria | 16757 |
| 181 | Ga0068864_100024740 | 3300005618 | Bacteria | 5052 |
| 182 | Ga0068864_100025381 | 3300005618 | Bacteria | 4990 |
| 183 | Ga0068864_100058934 | 3300005618 | Bacteria | 3320 |
| 184 | Ga0068864_100235242 | 3300005618 | Bacteria | 1695 |
| 185 | Ga0068866_10000116 | 3300005718 | Bacteria | 34637 |
| 186 | Ga0068866_10028751 | 3300005718 | Bacteria | 2652 |
| 187 | Ga0068866_10049630 | 3300005718 | Bacteria | 2128 |
| 188 | Ga0068861_100000246 | 3300005719 | Bacteria | 29867 |
| 189 | Ga0068861_100018105 | 3300005719 | Bacteria | 5010 |
| 190 | Ga0068851_10074651 | 3300005834 | Bacteria | 1761 |
| 191 | Ga0068851_10121109 | 3300005834 | Bacteria | 1406 |
| 192 | Ga0068870_10061183 | 3300005840 | Bacteria | 2023 |
| 193 | Ga0068863_100005304 | 3300005841 | Bacteria | 12729 |
| 194 | Ga0068863_100033888 | 3300005841 | Bacteria | 4865 |
| 195 | Ga0068863_100090339 | 3300005841 | Bacteria | 2904 |
| 196 | Ga0068858_100002515 | 3300005842 | Bacteria | 18480 |
| 197 | Ga0068858_100017399 | 3300005842 | Bacteria | 6743 |
| 198 | Ga0068858_100018324 | 3300005842 | Bacteria | 6556 |
| 199 | Ga0068858_100040889 | 3300005842 | Bacteria | 4300 |
| 200 | Ga0068858_100178830 | 3300005842 | Bacteria | 2002 |
| 201 | Ga0068860_100001848 | 3300005843 | Bacteria | 22537 |
| 202 | Ga0068860_100042508 | 3300005843 | Bacteria | 4339 |
| 203 | Ga0068860_100050695 | 3300005843 | Bacteria | 3951 |
| 204 | Ga0068860_100183500 | 3300005843 | Bacteria | 2022 |
| 205 | Ga0068860_100305529 | 3300005843 | Bacteria | 1559 |
| 206 | Ga0068862_100000668 | 3300005844 | Bacteria | 35204 |
| 207 | Ga0068862_100039981 | 3300005844 | Bacteria | 3985 |
| 208 | Ga0068862_100130975 | 3300005844 | Bacteria | 2218 |
| 209 | Ga0081455_10015177 | 3300005937 | Bacteria | 7496 |
| 210 | Ga0081538_10024245 | 3300005981 | Bacteria | 4327 |
| 211 | Ga0081540_1010843 | 3300005983 | Bacteria | 6125 |
| 212 | Ga0081540_1028009 | 3300005983 | Bacteria | 3176 |
| 213 | Ga0081539_10073191 | 3300005985 | Bacteria | 1829 |
| 214 | Ga0070717_10001498 | 3300006028 | Bacteria | 16148 |
| 215 | Ga0070717_10035489 | 3300006028 | Bacteria | 4036 |
| 216 | Ga0075365_10060622 | 3300006038 | Bacteria | 2525 |
| 217 | Ga0075365_10256914 | 3300006038 | Bacteria | 1228 |
| 218 | Ga0075368_10004179 | 3300006042 | Bacteria | 4862 |
| 219 | Ga0075363_100010127 | 3300006048 | Bacteria | 4459 |
| 220 | Ga0075363_100030547 | 3300006048 | Bacteria | 2789 |
| 221 | Ga0075364_10038812 | 3300006051 | Bacteria | 3085 |
| 222 | Ga0075364_10063907 | 3300006051 | Bacteria | 2416 |
| 223 | Ga0070715_10002107 | 3300006163 | Bacteria | 6015 |
| 224 | Ga0070715_10004223 | 3300006163 | Bacteria | 4685 |
| 225 | Ga0070715_10007541 | 3300006163 | Bacteria | 3751 |
| 226 | Ga0070716_100016547 | 3300006173 | Bacteria | 3809 |
| 227 | Ga0070716_100028363 | 3300006173 | Bacteria | 3016 |
| 228 | Ga0070716_100151267 | 3300006173 | Bacteria | 1493 |
| 229 | Ga0070712_100000583 | 3300006175 | Bacteria | 21284 |
| 230 | Ga0070712_100020847 | 3300006175 | Bacteria | 4295 |
| 231 | Ga0070712_100022345 | 3300006175 | Bacteria | 4167 |
| 232 | Ga0070712_100309581 | 3300006175 | Bacteria | 1281 |
| 233 | Ga0075362_10021946 | 3300006177 | Bacteria | 2686 |
| 234 | Ga0075367_10004347 | 3300006178 | Bacteria | 6902 |
| 235 | Ga0075367_10005237 | 3300006178 | Bacteria | 6411 |
| 236 | Ga0075367_10021955 | 3300006178 | Bacteria | 3573 |
| 237 | Ga0097621_100001462 | 3300006237 | Bacteria | 16168 |
| 238 | Ga0097621_100005520 | 3300006237 | Bacteria | 8907 |
| 239 | Ga0097621_100006628 | 3300006237 | Bacteria | 8228 |
| 240 | Ga0097621_100120740 | 3300006237 | Bacteria | 2222 |
| 241 | Ga0068871_100000271 | 3300006358 | Bacteria | 35626 |
| 242 | Ga0068871_100008291 | 3300006358 | Bacteria | 7467 |
| 243 | Ga0068871_100008770 | 3300006358 | Bacteria | 7281 |
| 244 | Ga0068871_100010111 | 3300006358 | Bacteria | 6865 |
| 245 | Ga0075428_100033779 | 3300006844 | Bacteria | 5644 |
| 246 | Ga0075428_100169633 | 3300006844 | Bacteria | 2366 |
| 247 | Ga0075428_100191665 | 3300006844 | Bacteria | 2211 |
| 248 | Ga0075430_100101350 | 3300006846 | Bacteria | 2404 |
| 249 | Ga0075430_100351607 | 3300006846 | Bacteria | 1217 |
| 250 | Ga0075431_100025020 | 3300006847 | Bacteria | 6120 |
| 251 | Ga0075431_100217743 | 3300006847 | Bacteria | 1948 |
| 252 | Ga0075431_100505993 | 3300006847 | Bacteria | 1198 |
| 253 | Ga0075431_100681312 | 3300006847 | Bacteria | 1007 |
| 254 | Ga0075434_100032733 | 3300006871 | Bacteria | 5127 |
| 255 | Ga0075434_100037726 | 3300006871 | Bacteria | 4784 |
| 256 | Ga0075434_100173991 | 3300006871 | Bacteria | 2172 |
| 257 | Ga0075434_100311482 | 3300006871 | Bacteria | 1594 |
| 258 | Ga0075434_100495421 | 3300006871 | Bacteria | 1243 |
| 259 | Ga0075429_100001221 | 3300006880 | Bacteria | 20864 |
| 260 | Ga0075429_100219011 | 3300006880 | Bacteria | 1668 |
| 261 | Ga0068865_100000421 | 3300006881 | Bacteria | 23671 |
| 262 | Ga0068865_100032427 | 3300006881 | Bacteria | 3489 |
| 263 | Ga0068865_100070194 | 3300006881 | Bacteria | 2481 |
| 264 | Ga0068865_100111768 | 3300006881 | Bacteria | 2016 |
| 265 | Ga0068865_100229031 | 3300006881 | Bacteria | 1457 |
| 266 | Ga0075436_100000576 | 3300006914 | Bacteria | 24015 |
| 267 | Ga0075436_100009986 | 3300006914 | Bacteria | 6495 |
| 268 | Ga0075436_100012193 | 3300006914 | Bacteria | 5889 |
| 269 | Ga0075436_100078353 | 3300006914 | Bacteria | 2289 |
| 270 | Ga0097620_100000445 | 3300006931 | Bacteria | 41359 |
| 271 | Ga0097620_100384737 | 3300006931 | Bacteria | 1498 |
| 272 | Ga0097620_100397801 | 3300006931 | Bacteria | 1473 |
| 273 | Ga0097620_100474748 | 3300006931 | Bacteria | 1346 |
| 274 | Ga0097620_100585197 | 3300006931 | Bacteria | 1210 |
| 275 | Ga0075435_100017108 | 3300007076 | Bacteria | 5479 |
| 276 | Ga0075435_100026846 | 3300007076 | Bacteria | 4497 |
| 277 | Ga0075435_100031243 | 3300007076 | Bacteria | 4193 |
| 278 | Ga0075435_100062865 | 3300007076 | Bacteria | 3014 |
| 279 | Ga0075435_100269344 | 3300007076 | Bacteria | 1452 |
| 280 | Ga0105251_10027231 | 3300009011 | Bacteria | 2901 |
| 281 | Ga0105250_10100585 | 3300009092 | Bacteria | 1179 |
| 282 | Ga0105240_10050363 | 3300009093 | Bacteria | 5251 |
| 283 | Ga0111539_10126181 | 3300009094 | Bacteria | 2998 |
| 284 | Ga0111539_10305410 | 3300009094 | Bacteria | 1852 |
| 285 | Ga0111539_10349487 | 3300009094 | Bacteria | 1721 |
| 286 | Ga0105245_10000464 | 3300009098 | Bacteria | 37217 |
| 287 | Ga0105245_10124373 | 3300009098 | Bacteria | 2412 |
| 288 | Ga0105245_10231708 | 3300009098 | Bacteria | 1786 |
| 289 | Ga0105247_10158256 | 3300009101 | Bacteria | 1498 |
| 290 | Ga0114129_10047869 | 3300009147 | Bacteria | 6006 |
| 291 | Ga0114129_10110457 | 3300009147 | Bacteria | 3795 |
| 292 | Ga0114129_10179967 | 3300009147 | Bacteria | 2878 |
| 293 | Ga0105243_10000963 | 3300009148 | Bacteria | 26916 |
| 294 | Ga0105243_10013045 | 3300009148 | Bacteria | 6278 |
| 295 | Ga0105243_10060899 | 3300009148 | Bacteria | 3016 |
| 296 | Ga0105243_10201041 | 3300009148 | Bacteria | 1747 |
| 297 | Ga0105243_10318433 | 3300009148 | Bacteria | 1416 |
| 298 | Ga0105241_10012298 | 3300009174 | Bacteria | 6277 |
| 299 | Ga0105241_10034371 | 3300009174 | Bacteria | 3808 |
| 300 | Ga0105242_10000689 | 3300009176 | Bacteria | 26484 |
| 301 | Ga0105242_10010686 | 3300009176 | Bacteria | 7047 |
| 302 | Ga0105242_10028524 | 3300009176 | Bacteria | 4446 |
| 303 | Ga0105242_10123212 | 3300009176 | Bacteria | 2228 |
| 304 | Ga0105248_10029119 | 3300009177 | Bacteria | 6157 |
| 305 | Ga0105248_10119211 | 3300009177 | Bacteria | 2976 |
| 306 | Ga0105248_10224378 | 3300009177 | Bacteria | 2115 |
| 307 | Ga0105248_10285797 | 3300009177 | Bacteria | 1857 |
| 308 | Ga0105237_10016674 | 3300009545 | Bacteria | 7629 |
| 309 | Ga0105237_10559730 | 3300009545 | Bacteria | 1150 |
| 310 | Ga0105238_10038648 | 3300009551 | Bacteria | 4845 |
| 311 | Ga0105238_10050721 | 3300009551 | Bacteria | 4176 |
| 312 | Ga0105249_10051274 | 3300009553 | Bacteria | 3763 |
| 313 | Ga0105249_10144737 | 3300009553 | Bacteria | 2282 |
| 314 | Ga0105249_10272310 | 3300009553 | Bacteria | 1687 |
| 315 | Ga0105249_10364176 | 3300009553 | Bacteria | 1468 |
| 316 | Ga0105249_10971621 | 3300009553 | Bacteria | 918 |
| 317 | Ga0105239_10098006 | 3300010375 | Bacteria | 3240 |
| 318 | Ga0105239_10330369 | 3300010375 | Bacteria | 1720 |
| 319 | Ga0105246_10226213 | 3300011119 | Archaea | 1470 |
| 320 | Ga0157373_10256476 | 3300013100 | Bacteria | 1237 |
| 321 | Ga0157370_10035367 | 3300013104 | Bacteria | 4856 |
| 322 | Ga0157370_10298162 | 3300013104 | Bacteria | 1488 |
| 323 | Ga0157369_10001331 | 3300013105 | Bacteria | 30563 |
| 324 | Ga0157374_10041491 | 3300013296 | Bacteria | 4241 |
| 325 | Ga0157374_10167755 | 3300013296 | Bacteria | 2140 |
| 326 | Ga0157374_10214238 | 3300013296 | Bacteria | 1889 |
| 327 | Ga0157374_10282222 | 3300013296 | Bacteria | 1640 |
| 328 | Ga0157374_10458998 | 3300013296 | Bacteria | 1276 |
| 329 | Ga0157378_10000816 | 3300013297 | Bacteria | 28980 |
| 330 | Ga0157378_10020683 | 3300013297 | Bacteria | 5788 |
| 331 | Ga0163162_10021862 | 3300013306 | Bacteria | 6303 |
| 332 | Ga0163162_10024952 | 3300013306 | Bacteria | 5906 |
| 333 | Ga0163162_10092410 | 3300013306 | Bacteria | 3109 |
| 334 | Ga0157372_10002054 | 3300013307 | Bacteria | 21896 |
| 335 | Ga0157372_10053532 | 3300013307 | Bacteria | 4499 |
| 336 | Ga0157375_10054080 | 3300013308 | Bacteria | 3953 |
| 337 | Ga0157375_10227796 | 3300013308 | Bacteria | 2023 |
| 338 | Ga0157375_10329409 | 3300013308 | Bacteria | 1692 |
| 339 | Ga0163163_10150523 | 3300014325 | Bacteria | 2371 |
| 340 | Ga0163163_10159503 | 3300014325 | Bacteria | 2301 |
| 341 | Ga0163163_10563459 | 3300014325 | Bacteria | 1202 |
| 342 | Ga0157380_10054837 | 3300014326 | Bacteria | 3165 |
| 343 | Ga0157380_10299203 | 3300014326 | Bacteria | 1481 |
| 344 | Ga0157380_10542118 | 3300014326 | Bacteria | 1139 |
| 345 | Ga0157379_10039794 | 3300014968 | Bacteria | 4195 |
| 346 | Ga0157379_10064941 | 3300014968 | Bacteria | 3262 |
| 347 | Ga0157379_10082960 | 3300014968 | Bacteria | 2872 |
| 348 | Ga0157379_10143967 | 3300014968 | Bacteria | 2149 |
| 349 | Ga0157379_10414388 | 3300014968 | Bacteria | 1240 |
| 350 | Ga0157376_10003015 | 3300014969 | Bacteria | 11553 |
| 351 | Ga0157376_10025415 | 3300014969 | Bacteria | 4664 |
| 352 | Ga0157376_10053312 | 3300014969 | Bacteria | 3367 |
| 353 | Ga0157376_10070584 | 3300014969 | Bacteria | 2965 |
| 354 | Ga0163161_10071785 | 3300017792 | Bacteria | 2534 |
| 355 | Ga0163161_10161789 | 3300017792 | Bacteria | 1707 |
| 356 | Ga0209051_1000843 | 3300025303 | Bacteria | 31536 |
| 357 | Ga0207653_10003327 | 3300025885 | Bacteria | 5077 |
| 358 | Ga0207682_10005564 | 3300025893 | Bacteria | 5126 |
| 359 | Ga0207682_10044778 | 3300025893 | Bacteria | 1815 |
| 360 | Ga0207692_10000698 | 3300025898 | Bacteria | 11799 |
| 361 | Ga0207692_10008507 | 3300025898 | Bacteria | 4248 |
| 362 | Ga0207692_10028808 | 3300025898 | Bacteria | 2632 |
| 363 | Ga0207692_10030650 | 3300025898 | Bacteria | 2567 |
| 364 | Ga0207692_10177135 | 3300025898 | Bacteria | 1240 |
| 365 | Ga0207642_10000116 | 3300025899 | Bacteria | 21558 |
| 366 | Ga0207642_10041146 | 3300025899 | Bacteria | 2021 |
| 367 | Ga0207710_10074631 | 3300025900 | Bacteria | 1562 |
| 368 | Ga0207688_10004733 | 3300025901 | Bacteria | 7413 |
| 369 | Ga0207688_10042004 | 3300025901 | Bacteria | 2545 |
| 370 | Ga0207688_10055087 | 3300025901 | Bacteria | 2231 |
| 371 | Ga0207680_10006540 | 3300025903 | Bacteria | 5646 |
| 372 | Ga0207680_10014768 | 3300025903 | Bacteria | 4055 |
| 373 | Ga0207685_10000567 | 3300025905 | Bacteria | 6423 |
| 374 | Ga0207685_10003068 | 3300025905 | Bacteria | 3983 |
| 375 | Ga0207699_10000822 | 3300025906 | Bacteria | 14781 |
| 376 | Ga0207699_10001488 | 3300025906 | Bacteria | 11131 |
| 377 | Ga0207699_10002688 | 3300025906 | Bacteria | 8403 |
| 378 | Ga0207645_10025955 | 3300025907 | Bacteria | 3789 |
| 379 | Ga0207645_10029738 | 3300025907 | Bacteria | 3521 |
| 380 | Ga0207645_10213644 | 3300025907 | Bacteria | 1271 |
| 381 | Ga0207643_10008782 | 3300025908 | Bacteria | 5420 |
| 382 | Ga0207643_10323391 | 3300025908 | Bacteria | 964 |
| 383 | Ga0207684_10025646 | 3300025910 | Bacteria | 5023 |
| 384 | Ga0207684_10027322 | 3300025910 | Bacteria | 4864 |
| 385 | Ga0207684_10169254 | 3300025910 | Bacteria | 1883 |
| 386 | Ga0207684_10195268 | 3300025910 | Bacteria | 1746 |
| 387 | Ga0207684_10409375 | 3300025910 | Bacteria | 1166 |
| 388 | Ga0207707_10152267 | 3300025912 | Bacteria | 2022 |
| 389 | Ga0207707_10186611 | 3300025912 | Bacteria | 1810 |
| 390 | Ga0207671_10047151 | 3300025914 | Bacteria | 3189 |
| 391 | Ga0207671_10110886 | 3300025914 | Bacteria | 2087 |
| 392 | Ga0207693_10001134 | 3300025915 | Bacteria | 23870 |
| 393 | Ga0207693_10013884 | 3300025915 | Bacteria | 6486 |
| 394 | Ga0207693_10021730 | 3300025915 | Bacteria | 5101 |
| 395 | Ga0207693_10026285 | 3300025915 | Bacteria | 4607 |
| 396 | Ga0207693_10149563 | 3300025915 | Bacteria | 1836 |
| 397 | Ga0207663_10002244 | 3300025916 | Bacteria | 9244 |
| 398 | Ga0207663_10179120 | 3300025916 | Bacteria | 1512 |
| 399 | Ga0207663_10185393 | 3300025916 | Bacteria | 1489 |
| 400 | Ga0207660_10002745 | 3300025917 | Bacteria | 11530 |
| 401 | Ga0207660_10073078 | 3300025917 | Bacteria | 2499 |
| 402 | Ga0207662_10000088 | 3300025918 | Bacteria | 43438 |
| 403 | Ga0207662_10134869 | 3300025918 | Bacteria | 1560 |
| 404 | Ga0207657_10114009 | 3300025919 | Bacteria | 2230 |
| 405 | Ga0207649_10004361 | 3300025920 | Bacteria | 7678 |
| 406 | Ga0207652_10003045 | 3300025921 | Bacteria | 13979 |
| 407 | Ga0207652_10337676 | 3300025921 | Unclassified | 1360 |
| 408 | Ga0207646_10067088 | 3300025922 | Bacteria | 3203 |
| 409 | Ga0207681_10037558 | 3300025923 | Bacteria | 3202 |
| 410 | Ga0207694_10003253 | 3300025924 | Bacteria | 12938 |
| 411 | Ga0207694_10039906 | 3300025924 | Bacteria | 3614 |
| 412 | Ga0207694_10065189 | 3300025924 | Bacteria | 2840 |
| 413 | Ga0207650_10005227 | 3300025925 | Bacteria | 8851 |
| 414 | Ga0207650_10022869 | 3300025925 | Bacteria | 4429 |
| 415 | Ga0207650_10065243 | 3300025925 | Bacteria | 2727 |
| 416 | Ga0207650_10113728 | 3300025925 | Bacteria | 2099 |
| 417 | Ga0207650_10135870 | 3300025925 | Bacteria | 1928 |
| 418 | Ga0207650_10159716 | 3300025925 | Bacteria | 1785 |
| 419 | Ga0207659_10006995 | 3300025926 | Bacteria | 6926 |
| 420 | Ga0207659_10017851 | 3300025926 | Bacteria | 4643 |
| 421 | Ga0207659_10197430 | 3300025926 | Bacteria | 1605 |
| 422 | Ga0207687_10000349 | 3300025927 | Bacteria | 30723 |
| 423 | Ga0207687_10018771 | 3300025927 | Bacteria | 4571 |
| 424 | Ga0207700_10000698 | 3300025928 | Bacteria | 19482 |
| 425 | Ga0207700_10001949 | 3300025928 | Bacteria | 11741 |
| 426 | Ga0207700_10108800 | 3300025928 | Bacteria | 2226 |
| 427 | Ga0207664_10001209 | 3300025929 | Bacteria | 17138 |
| 428 | Ga0207664_10002965 | 3300025929 | Bacteria | 11271 |
| 429 | Ga0207664_10072520 | 3300025929 | Bacteria | 2776 |
| 430 | Ga0207664_10074370 | 3300025929 | Bacteria | 2745 |
| 431 | Ga0207664_10362367 | 3300025929 | Bacteria | 1284 |
| 432 | Ga0207644_10003123 | 3300025931 | Bacteria | 10662 |
| 433 | Ga0207644_10008637 | 3300025931 | Bacteria | 6664 |
| 434 | Ga0207644_10132743 | 3300025931 | Bacteria | 1908 |
| 435 | Ga0207644_10188769 | 3300025931 | Bacteria | 1619 |
| 436 | Ga0207690_10052966 | 3300025932 | Bacteria | 2721 |
| 437 | Ga0207690_10077234 | 3300025932 | Unclassified | 2314 |
| 438 | Ga0207706_10021136 | 3300025933 | Bacteria | 5848 |
| 439 | Ga0207706_10033477 | 3300025933 | Bacteria | 4574 |
| 440 | Ga0207686_10001742 | 3300025934 | Bacteria | 12095 |
| 441 | Ga0207686_10024813 | 3300025934 | Bacteria | 3479 |
| 442 | Ga0207686_10030369 | 3300025934 | Bacteria | 3198 |
| 443 | Ga0207686_10066308 | 3300025934 | Bacteria | 2305 |
| 444 | Ga0207709_10001642 | 3300025935 | Bacteria | 15151 |
| 445 | Ga0207709_10059711 | 3300025935 | Bacteria | 2375 |
| 446 | Ga0207709_10125327 | 3300025935 | Unclassified | 1741 |
| 447 | Ga0207670_10028340 | 3300025936 | Bacteria | 3554 |
| 448 | Ga0207670_10047961 | 3300025936 | Bacteria | 2847 |
| 449 | Ga0207670_10050624 | 3300025936 | Bacteria | 2785 |
| 450 | Ga0207670_10210691 | 3300025936 | Bacteria | 1482 |
| 451 | Ga0207669_10116448 | 3300025937 | Bacteria | 1804 |
| 452 | Ga0207669_10268270 | 3300025937 | Unclassified | 1280 |
| 453 | Ga0207704_10007405 | 3300025938 | Bacteria | 5183 |
| 454 | Ga0207704_10032287 | 3300025938 | Bacteria | 2961 |
| 455 | Ga0207704_10048652 | 3300025938 | Bacteria | 2544 |
| 456 | Ga0207665_10000223 | 3300025939 | Bacteria | 38647 |
| 457 | Ga0207665_10001570 | 3300025939 | Bacteria | 15409 |
| 458 | Ga0207665_10002070 | 3300025939 | Bacteria | 13532 |
| 459 | Ga0207691_10002229 | 3300025940 | Bacteria | 18967 |
| 460 | Ga0207691_10023242 | 3300025940 | Bacteria | 5836 |
| 461 | Ga0207691_10049499 | 3300025940 | Bacteria | 3850 |
| 462 | Ga0207691_10151495 | 3300025940 | Bacteria | 2039 |
| 463 | Ga0207691_10271889 | 3300025940 | Bacteria | 1459 |
| 464 | Ga0207711_10013945 | 3300025941 | Bacteria | 6673 |
| 465 | Ga0207711_10021061 | 3300025941 | Bacteria | 5445 |
| 466 | Ga0207711_10021522 | 3300025941 | Bacteria | 5388 |
| 467 | Ga0207711_10157291 | 3300025941 | Bacteria | 2055 |
| 468 | Ga0207711_10400333 | 3300025941 | Bacteria | 1275 |
| 469 | Ga0207689_10000079 | 3300025942 | Bacteria | 78891 |
| 470 | Ga0207689_10031906 | 3300025942 | Bacteria | 4381 |
| 471 | Ga0207689_10045851 | 3300025942 | Bacteria | 3614 |
| 472 | Ga0207661_10014893 | 3300025944 | Bacteria | 5706 |
| 473 | Ga0207661_10094204 | 3300025944 | Bacteria | 2501 |
| 474 | Ga0207679_10004969 | 3300025945 | Bacteria | 8299 |
| 475 | Ga0207679_10005906 | 3300025945 | Bacteria | 7698 |
| 476 | Ga0207667_10003261 | 3300025949 | Bacteria | 20028 |
| 477 | Ga0207667_10055873 | 3300025949 | Bacteria | 4148 |
| 478 | Ga0207667_10493159 | 3300025949 | Unclassified | 1243 |
| 479 | Ga0207651_10021675 | 3300025960 | Bacteria | 3910 |
| 480 | Ga0207651_10093894 | 3300025960 | Bacteria | 2204 |
| 481 | Ga0207651_10251025 | 3300025960 | Bacteria | 1447 |
| 482 | Ga0207712_10086944 | 3300025961 | Bacteria | 2291 |
| 483 | Ga0207668_10048878 | 3300025972 | Bacteria | 2905 |
| 484 | Ga0207668_10147306 | 3300025972 | Bacteria | 1818 |
| 485 | Ga0207668_10278751 | 3300025972 | Bacteria | 1370 |
| 486 | Ga0207640_10001480 | 3300025981 | Bacteria | 12669 |
| 487 | Ga0207658_10052827 | 3300025986 | Bacteria | 3000 |
| 488 | Ga0207658_10053591 | 3300025986 | Bacteria | 2981 |
| 489 | Ga0207658_10107073 | 3300025986 | Bacteria | 2202 |
| 490 | Ga0207658_10175512 | 3300025986 | Bacteria | 1769 |
| 491 | Ga0207677_10092023 | 3300026023 | Bacteria | 2207 |
| 492 | Ga0207677_10408641 | 3300026023 | Bacteria | 1153 |
| 493 | Ga0207703_10005469 | 3300026035 | Bacteria | 10211 |
| 494 | Ga0207703_10013825 | 3300026035 | Bacteria | 6290 |
| 495 | Ga0207703_10029632 | 3300026035 | Bacteria | 4320 |
| 496 | Ga0207639_10052452 | 3300026041 | Unclassified | 3108 |
| 497 | Ga0207639_10154562 | 3300026041 | Bacteria | 1926 |
| 498 | Ga0207639_10305578 | 3300026041 | Bacteria | 1407 |
| 499 | Ga0207678_10007013 | 3300026067 | Bacteria | 10002 |
| 500 | Ga0207678_10065925 | 3300026067 | Bacteria | 3109 |
| 501 | Ga0207708_10000326 | 3300026075 | Bacteria | 37674 |
| 502 | Ga0207708_10005792 | 3300026075 | Bacteria | 9136 |
| 503 | Ga0207702_10005592 | 3300026078 | Bacteria | 10973 |
| 504 | Ga0207702_10008239 | 3300026078 | Bacteria | 8811 |
| 505 | Ga0207641_10003133 | 3300026088 | Bacteria | 14858 |
| 506 | Ga0207641_10021698 | 3300026088 | Bacteria | 5277 |
| 507 | Ga0207641_10076106 | 3300026088 | Bacteria | 2900 |
| 508 | Ga0207641_10593720 | 3300026088 | Bacteria | 1083 |
| 509 | Ga0207648_10000071 | 3300026089 | Bacteria | 95176 |
| 510 | Ga0207648_10041704 | 3300026089 | Bacteria | 4031 |
| 511 | Ga0207648_10131467 | 3300026089 | Bacteria | 2203 |
| 512 | Ga0207648_10256514 | 3300026089 | Bacteria | 1559 |
| 513 | Ga0207648_10344928 | 3300026089 | Bacteria | 1342 |
| 514 | Ga0207676_10002203 | 3300026095 | Bacteria | 14060 |
| 515 | Ga0207676_10016808 | 3300026095 | Bacteria | 5297 |
| 516 | Ga0207676_10037914 | 3300026095 | Bacteria | 3677 |
| 517 | Ga0207674_10038326 | 3300026116 | Bacteria | 4976 |
| 518 | Ga0207674_10099214 | 3300026116 | Bacteria | 2895 |
| 519 | Ga0207675_100000040 | 3300026118 | Bacteria | 91299 |
| 520 | Ga0207675_100019931 | 3300026118 | Bacteria | 6260 |
| 521 | Ga0207675_100395210 | 3300026118 | Bacteria | 1361 |
| 522 | Ga0207683_10005345 | 3300026121 | Bacteria | 11016 |
| 523 | Ga0207683_10010098 | 3300026121 | Bacteria | 8055 |
| 524 | Ga0207683_10012990 | 3300026121 | Bacteria | 7108 |
| 525 | Ga0207683_10157578 | 3300026121 | Bacteria | 2051 |
| 526 | Ga0207698_10012247 | 3300026142 | Bacteria | 5604 |
| 527 | Ga0207698_10109793 | 3300026142 | Bacteria | 2309 |
| 528 | Ga0209996_1004442 | 3300027395 | Bacteria | 1778 |
| 529 | Ga0209968_1000985 | 3300027526 | Bacteria | 4381 |
| 530 | Ga0209966_1000011 | 3300027695 | Bacteria | 83449 |
| 531 | Ga0209813_10000439 | 3300027866 | Bacteria | 10134 |
| 532 | Ga0209813_10006227 | 3300027866 | Bacteria | 2939 |
| 533 | Ga0207428_10071999 | 3300027907 | Bacteria | 2714 |
| 534 | Ga0207428_10230542 | 3300027907 | Bacteria | 1386 |
| 535 | Ga0268266_10005657 | 3300028379 | Bacteria | 11593 |
| 536 | Ga0268266_10029298 | 3300028379 | Bacteria | 4680 |
| 537 | Ga0268265_10002113 | 3300028380 | Bacteria | 15414 |
| 538 | Ga0268265_10274614 | 3300028380 | Bacteria | 1505 |
| 539 | Ga0268264_10000527 | 3300028381 | Bacteria | 48430 |
| 540 | Ga0268264_10090588 | 3300028381 | Bacteria | 2636 |
| 541 | Ga0268264_10106633 | 3300028381 | Bacteria | 2446 |
| 542 | Ga0268264_10263090 | 3300028381 | Bacteria | 1608 |
| 543 | Ga0268264_10730789 | 3300028381 | Bacteria | 985 |
| 544 | Ga0265334_10013031 | 3300028573 | Bacteria | 3487 |
| 545 | Ga0265318_10000392 | 3300028577 | Bacteria | 34150 |
| 546 | Ga0265318_10001252 | 3300028577 | Bacteria | 15378 |
| 547 | Ga0265318_10019415 | 3300028577 | Bacteria | 2757 |
| 548 | Ga0265338_10025744 | 3300028800 | Bacteria | 5960 |
| 549 | Ga0265338_10116388 | 3300028800 | Bacteria | 2141 |
| 550 | Ga0265330_10000900 | 3300031235 | Bacteria | 18381 |
| 551 | Ga0265330_10001096 | 3300031235 | Bacteria | 16300 |
| 552 | Ga0265332_10000362 | 3300031238 | Bacteria | 33750 |
| 553 | Ga0265332_10000671 | 3300031238 | Bacteria | 22075 |
| 554 | Ga0265332_10021677 | 3300031238 | Bacteria | 2837 |
| 555 | Ga0265328_10001141 | 3300031239 | Bacteria | 12239 |
| 556 | Ga0265328_10060572 | 3300031239 | Unclassified | 1389 |
| 557 | Ga0265320_10000221 | 3300031240 | Bacteria | 46329 |
| 558 | Ga0265320_10002328 | 3300031240 | Bacteria | 13334 |
| 559 | Ga0265320_10008165 | 3300031240 | Bacteria | 6428 |
| 560 | Ga0265320_10021757 | 3300031240 | Bacteria | 3444 |
| 561 | Ga0265325_10000004 | 3300031241 | Bacteria | 347347 |
| 562 | Ga0265329_10000367 | 3300031242 | Bacteria | 23949 |
| 563 | Ga0265339_10014115 | 3300031249 | Bacteria | 4822 |
| 564 | Ga0265331_10000378 | 3300031250 | Bacteria | 46319 |
| 565 | Ga0265331_10001846 | 3300031250 | Bacteria | 14983 |
| 566 | Ga0265331_10002218 | 3300031250 | Bacteria | 13324 |
| 567 | Ga0265316_10002329 | 3300031344 | Bacteria | 19856 |
| 568 | Ga0265316_10030450 | 3300031344 | Bacteria | 4423 |
| 569 | Ga0265316_10161324 | 3300031344 | Bacteria | 1676 |
| 570 | Ga0307408_100034887 | 3300031548 | Bacteria | 3527 |
| 571 | Ga0265313_10000196 | 3300031595 | Bacteria | 64798 |
| 572 | Ga0265313_10011134 | 3300031595 | Bacteria | 5610 |
| 573 | Ga0265313_10048632 | 3300031595 | Bacteria | 2045 |
| 574 | Ga0265313_10049261 | 3300031595 | Bacteria | 2028 |
| 575 | Ga0265314_10000455 | 3300031711 | Bacteria | 54619 |
| 576 | Ga0265314_10000555 | 3300031711 | Bacteria | 47583 |
| 577 | Ga0265314_10016082 | 3300031711 | Bacteria | 5923 |
| 578 | Ga0265314_10151558 | 3300031711 | Bacteria | 1421 |
| 579 | Ga0265342_10000058 | 3300031712 | Bacteria | 118791 |
| 580 | Ga0265342_10002058 | 3300031712 | Bacteria | 17860 |
| 581 | Ga0265342_10005768 | 3300031712 | Bacteria | 9360 |
| 582 | Ga0265342_10010977 | 3300031712 | Bacteria | 6225 |
| 583 | Ga0307416_100079727 | 3300032002 | Bacteria | 2761 |
| 584 | Ga0307415_100341247 | 3300032126 | Bacteria | 1257 |
| 585 | Ga0307415_100575368 | 3300032126 | Bacteria | 998 |
| 586 | Ga0373938_0022516 | 3300034957 | Archaea | 1288 |
| 587 | Ga0373926_0000062 | 3300035083 | Bacteria | 19600 |
| 588 | Ga0373928_0001281 | 3300035084 | Bacteria | 4948 |
| 589 | Ga0373940_0013954 | 3300035088 | Bacteria | 1953 |
| 590 | Ga0373940_0024817 | 3300035088 | Bacteria | 1557 |
| 591 | Ga0373944_0002899 | 3300035089 | Bacteria | 4399 |
| 592 | Ga0373944_0031160 | 3300035089 | Bacteria | 1603 |
| 593 | Ga0373949_0002553 | 3300035090 | Bacteria | 4630 |
| 594 | Ga0373951_0046185 | 3300035091 | Bacteria | 1061 |
| 595 | Ga0373952_0002199 | 3300035092 | Bacteria | 3512 |
| 596 | Ga0373923_0120124 | 3300035111 | Unclassified | 1174 |
| 597 | Ga0373936_0000882 | 3300035113 | Bacteria | 10713 |
| 598 | Ga0373939_0013091 | 3300035114 | Bacteria | 2127 |
| 599 | Ga0373941_0004067 | 3300035115 | Bacteria | 3354 |
| 600 | Ga0373945_0000333 | 3300035116 | Bacteria | 13441 |
| 601 | Ga0373945_0010944 | 3300035116 | Bacteria | 2992 |
| 602 | Ga0373945_0148515 | 3300035116 | Unclassified | 949 |
| 603 | Ga0373943_0007142 | 3300035170 | Bacteria | 5010 |
| 604 | Ga0373943_0009126 | 3300035170 | Unclassified | 4446 |
| 605 | Ga0373943_0011856 | 3300035170 | Bacteria | 3922 |
| 606 | Ga0373943_0046676 | 3300035170 | Bacteria | 2115 |
| 607 | Ga0373946_0000768 | 3300035171 | Bacteria | 10925 |
| 608 | Ga0373946_0010572 | 3300035171 | Bacteria | 3419 |
| 609 | Ga0373946_0021725 | 3300035171 | Unclassified | 2491 |
| 610 | Ga0373942_0022075 | 3300035207 | Bacteria | 1612 |
| 611 | Ga0373962_0011926 | 3300035242 | Bacteria | 2185 |
| 612 | Ga0316574_0123080 | 3300035398 | Bacteria | 1666 |
| 613 | Ga0373924_0051051 | 3300035410 | Unclassified | 1714 |
| 614 | Ga0373931_0010262 | 3300035691 | Bacteria | 4499 |
| 615 | Ga0373931_0106700 | 3300035691 | Bacteria | 1583 |
| 616 | Ga0373935_0008836 | 3300035692 | Bacteria | 6032 |
| 617 | Ga0373935_0260617 | 3300035692 | Bacteria | 1216 |
| 618 | Ga0373927_0000912 | 3300035695 | Bacteria | 22465 |
| 619 | Ga0373927_0017863 | 3300035695 | Bacteria | 4664 |
| 620 | Ga0373927_0037618 | 3300035695 | Bacteria | 3144 |
| 621 | Ga0373927_0041185 | 3300035695 | Bacteria | 2996 |
| 622 | Ga0373947_0003408 | 3300035725 | Bacteria | 9408 |
| 623 | Ga0373947_0009374 | 3300035725 | Bacteria | 5623 |
| 624 | Ga0373947_0010706 | 3300035725 | Bacteria | 5265 |
| 625 | Ga0373947_0162057 | 3300035725 | Bacteria | 1447 |
| 626 | Ga0373947_0357662 | 3300035725 | Bacteria | 980 |
| 627 | Ga0373937_0146975 | 3300036401 | Bacteria | 2207 |
| 628 | Ga0373925_0003003 | 3300037068 | Bacteria | 13268 |
| 629 | Ga0373925_0006268 | 3300037068 | Bacteria | 8768 |
| 630 | Ga0373925_0017846 | 3300037068 | Bacteria | 5150 |
| 631 | Ga0373925_0024972 | 3300037068 | Bacteria | 4364 |
| 632 | Ga0373925_0055489 | 3300037068 | Bacteria | 2966 |
| 633 | Ga0373925_0191401 | 3300037068 | Bacteria | 1623 |
| 634 | Ga0436360_0438289 | 3300039438 | Bacteria | 8975 |
| 635 | Ga0436362_0386476 | 3300039453 | Bacteria | 2374 |
| 636 | Ga0451853_1019298 | 3300041512 | Bacteria | 1855 |
| 637 | Ga0439441_000085 | 3300042001 | Bacteria | 7319 |
| 638 | Ga0439443_000239 | 3300042003 | Bacteria | 4281 |
| 639 | Ga0439432_061079 | 3300042006 | Bacteria | 1162 |
| 640 | Ga0439451_006053 | 3300042009 | Bacteria | 2472 |
| 641 | Ga0439435_0000004 | 3300042436 | Bacteria | 26852 |
| 642 | Ga0439444_0012156 | 3300042437 | Bacteria | 1406 |
| 643 | Ga0439460_0000794 | 3300042461 | Bacteria | 7152 |
| 644 | Ga0453684_0258849 | 3300044712 | Bacteria | 1994 |
| 645 | Ga0451576_0003049 | 3300045051 | Bacteria | 23602 |
| 646 | Ga0451576_0121961 | 3300045051 | Bacteria | 2714 |
| 647 | Ga0451576_0206182 | 3300045051 | Bacteria | 2053 |
| 648 | Ga0466958_0018276 | 3300045836 | Bacteria | 4067 |
| 649 | Ga0466967_0340268 | 3300045976 | Bacteria | 1451 |
| 650 | Ga0495592_0136006 | 3300046454 | Unclassified | 1714 |
| 651 | Ga0495603_0003334 | 3300046455 | Bacteria | 9565 |
| 652 | Ga0495603_0006586 | 3300046455 | Bacteria | 6966 |
| 653 | Ga0495603_0015201 | 3300046455 | Bacteria | 4657 |
| 654 | Ga0495603_0016798 | 3300046455 | Bacteria | 4428 |
| 655 | Ga0495591_052461 | 3300046458 | Bacteria | 1109 |
| 656 | Ga0495629_0003983 | 3300046459 | Bacteria | 11105 |
| 657 | Ga0495629_0022638 | 3300046459 | Bacteria | 4479 |
| 658 | Ga0495629_0041822 | 3300046459 | Bacteria | 3222 |
| 659 | Ga0495641_0020474 | 3300046461 | Bacteria | 3354 |
| 660 | Ga0495641_0038866 | 3300046461 | Bacteria | 2222 |
| 661 | Ga0495641_0062461 | 3300046461 | Bacteria | 1680 |
| 662 | Ga0495641_0064667 | 3300046461 | Unclassified | 1647 |
| 663 | Ga0495580_0004546 | 3300046472 | Bacteria | 11650 |
| 664 | Ga0495580_0041816 | 3300046472 | Bacteria | 3267 |
| 665 | Ga0495580_0159070 | 3300046472 | Unclassified | 1564 |
| 666 | Ga0495582_0001069 | 3300046473 | Bacteria | 15376 |
| 667 | Ga0495582_0008317 | 3300046473 | Bacteria | 5727 |
| 668 | Ga0495582_0013701 | 3300046473 | Bacteria | 4464 |
| 669 | Ga0495582_0065952 | 3300046473 | Bacteria | 2000 |
| 670 | Ga0495639_0006547 | 3300046475 | Bacteria | 5010 |
| 671 | Ga0495639_0019886 | 3300046475 | Bacteria | 2932 |
| 672 | Ga0495594_0003710 | 3300046499 | Bacteria | 7838 |
| 673 | Ga0495618_0014907 | 3300046514 | Bacteria | 4741 |
| 674 | Ga0495618_0040372 | 3300046514 | Bacteria | 2937 |
| 675 | Ga0495630_0032264 | 3300046517 | Bacteria | 3902 |
| 676 | Ga0495666_0007272 | 3300046526 | Bacteria | 5555 |
| 677 | Ga0495652_0013021 | 3300046529 | Bacteria | 7497 |
| 678 | Ga0495665_0045900 | 3300046531 | Unclassified | 2321 |
| 679 | Ga0495640_0021596 | 3300046533 | Bacteria | 4720 |
| 680 | Ga0495640_0051067 | 3300046533 | Bacteria | 2844 |
| 681 | Ga0495586_0001686 | 3300046535 | Bacteria | 12121 |
| 682 | Ga0495621_0005832 | 3300046539 | Bacteria | 3563 |
| 683 | Ga0495621_0040636 | 3300046539 | Bacteria | 1631 |
| 684 | Ga0495668_0035307 | 3300046616 | Bacteria | 2803 |
| 685 | Ga0495634_0015705 | 3300046642 | Bacteria | 5429 |
| 686 | Ga0495634_0440580 | 3300046642 | Unclassified | 770 |
| 687 | Ga0495635_0132523 | 3300046663 | Unclassified | 1699 |
| 688 | Ga0495588_0025171 | 3300046674 | Bacteria | 2963 |
| 689 | Ga0495588_0113067 | 3300046674 | Bacteria | 1430 |
| 690 | Ga0495647_0000076 | 3300046681 | Bacteria | 23834 |
| 691 | Ga0495647_0004324 | 3300046681 | Bacteria | 4604 |
| 692 | Ga0495647_0013460 | 3300046681 | Bacteria | 2834 |
| 693 | Ga0495647_0083328 | 3300046681 | Bacteria | 1300 |
| 694 | Ga0495658_0001192 | 3300046683 | Bacteria | 13702 |
| 695 | Ga0495658_0004279 | 3300046683 | Bacteria | 7027 |
| 696 | Ga0495658_0005839 | 3300046683 | Bacteria | 6043 |
| 697 | Ga0495658_0028301 | 3300046683 | Bacteria | 3024 |
| 698 | Ga0495613_0004531 | 3300046689 | Bacteria | 10419 |
| 699 | Ga0495613_0010219 | 3300046689 | Bacteria | 6973 |
| 700 | Ga0495613_0013849 | 3300046689 | Bacteria | 5983 |
| 701 | Ga0495624_0022443 | 3300046690 | Bacteria | 4172 |
| 702 | Ga0495600_0087950 | 3300046809 | Unclassified | 2027 |
| 703 | Ga0495581_0006657 | 3300047315 | Bacteria | 6696 |
| 704 | Ga0495581_0228735 | 3300047315 | Bacteria | 1088 |
| 705 | Ga0495674_0018069 | 3300047319 | Bacteria | 6564 |
| 706 | Ga0495676_0019750 | 3300047321 | Bacteria | 5924 |
| 707 | Ga0495676_0046166 | 3300047321 | Bacteria | 3538 |
| 708 | Ga0495676_0088122 | 3300047321 | Bacteria | 2329 |
| 709 | Ga0495676_0155299 | 3300047321 | Unclassified | 1624 |
| 710 | Ga0495680_0008064 | 3300047322 | Bacteria | 9601 |
| 711 | Ga0495680_0137622 | 3300047322 | Bacteria | 1789 |
| 712 | Ga0495684_0025601 | 3300047471 | Bacteria | 4533 |
| 713 | Ga0495686_0000702 | 3300047472 | Bacteria | 45195 |
| 714 | Ga0495593_0029417 | 3300047673 | Bacteria | 3012 |
| 715 | Ga0495593_0037677 | 3300047673 | Unclassified | 2614 |
| 716 | Ga0495614_0037593 | 3300048089 | Bacteria | 2077 |
| 717 | Ga0495614_0093128 | 3300048089 | Bacteria | 1312 |
| 718 | Ga0496100_0114658 | 3300048903 | Bacteria | 1877 |
| 719 | Ga0496100_0450729 | 3300048903 | Bacteria | 986 |
| 720 | Ga0496101_0013743 | 3300048904 | Bacteria | 5430 |
| 721 | Ga0496102_0065442 | 3300048905 | Bacteria | 3332 |
| 722 | Ga0496104_0000951 | 3300048907 | Bacteria | 24933 |
| 723 | Ga0496104_0091895 | 3300048907 | Bacteria | 2902 |
| 724 | Ga0496104_0186029 | 3300048907 | Bacteria | 1987 |
| 725 | Ga0496104_0223878 | 3300048907 | Bacteria | 1793 |
| 726 | Ga0496104_0294806 | 3300048907 | Bacteria | 1534 |
| 727 | Ga0496105_0034626 | 3300048908 | Bacteria | 4154 |
| 728 | Ga0496105_0043687 | 3300048908 | Bacteria | 3696 |
| 729 | Ga0496105_0327098 | 3300048908 | Bacteria | 1227 |
| 730 | Ga0496107_0030058 | 3300048910 | Bacteria | 3870 |
| 731 | Ga0496107_0266625 | 3300048910 | Unclassified | 1274 |
| 732 | Ga0496108_0011350 | 3300048911 | Bacteria | 7241 |
| 733 | Ga0496108_0022008 | 3300048911 | Bacteria | 5240 |
| 734 | Ga0496108_0222672 | 3300048911 | Bacteria | 1639 |
| 735 | Ga0496109_0009383 | 3300048912 | Bacteria | 8337 |
| 736 | Ga0496109_0083508 | 3300048912 | Bacteria | 2946 |
| 737 | Ga0496109_0144682 | 3300048912 | Bacteria | 2223 |
| 738 | Ga0496109_0597036 | 3300048912 | Bacteria | 1040 |
| 739 | Ga0496110_0085587 | 3300048913 | Bacteria | 2813 |
| 740 | Ga0496110_0236915 | 3300048913 | Unclassified | 1660 |
| 741 | Ga0496111_0033731 | 3300048914 | Bacteria | 3652 |
| 742 | Ga0496112_0060211 | 3300048915 | Bacteria | 3741 |
| 743 | Ga0496112_0403040 | 3300048915 | Bacteria | 1307 |
| 744 | Ga0496113_0241084 | 3300048916 | Bacteria | 1443 |
| 745 | Ga0496114_0005459 | 3300048917 | Bacteria | 9945 |
| 746 | Ga0496114_0106279 | 3300048917 | Bacteria | 2401 |
| 747 | Ga0496114_0437062 | 3300048917 | Bacteria | 1159 |
| 748 | Ga0496115_0028148 | 3300048918 | Bacteria | 4402 |
| 749 | Ga0496115_0040660 | 3300048918 | Bacteria | 3697 |
| 750 | Ga0496115_0053463 | 3300048918 | Bacteria | 3241 |
| 751 | Ga0496121_0022269 | 3300048924 | Bacteria | 6162 |
| 752 | Ga0501299_056013 | 3300049522 | Bacteria | 825 |
| 753 | Ga0501031_0192950 | 3300049568 | Bacteria | 1330 |
| 754 | Ga0501033_0127879 | 3300049570 | Bacteria | 1842 |
| 755 | Ga0501036_0026934 | 3300049572 | Bacteria | 4858 |
| 756 | Ga0501036_0189859 | 3300049572 | Bacteria | 1729 |
| 757 | Ga0501038_0085860 | 3300049574 | Bacteria | 2645 |
| 758 | Ga0501039_0046400 | 3300049575 | Bacteria | 3356 |
| 759 | Ga0501039_0049162 | 3300049575 | Bacteria | 3260 |
| 760 | Ga0501040_0110699 | 3300049576 | Bacteria | 1920 |
| 761 | Ga0501040_0178300 | 3300049576 | Bacteria | 1506 |
| 762 | Ga0501040_0272034 | 3300049576 | Bacteria | 1209 |
| 763 | Ga0501041_0002402 | 3300049577 | Bacteria | 10604 |
| 764 | Ga0501041_0026329 | 3300049577 | Bacteria | 3498 |
| 765 | Ga0501041_0138857 | 3300049577 | Bacteria | 1515 |
| 766 | Ga0501041_0166089 | 3300049577 | Bacteria | 1381 |
| 767 | Ga0501041_0337078 | 3300049577 | Bacteria | 952 |
| 768 | Ga0501042_0014537 | 3300049578 | Bacteria | 5375 |
| 769 | Ga0501042_0179047 | 3300049578 | Bacteria | 1529 |
| 770 | Ga0501046_0124644 | 3300049580 | Bacteria | 1958 |
| 771 | Ga0501047_0000924 | 3300049581 | Bacteria | 30063 |
| 772 | Ga0501048_0091038 | 3300049582 | Bacteria | 2152 |
| 773 | Ga0501048_0107988 | 3300049582 | Bacteria | 1965 |
| 774 | Ga0501048_0120869 | 3300049582 | Bacteria | 1851 |
| 775 | Ga0501048_0512680 | 3300049582 | Bacteria | 860 |
| 776 | Ga0501068_0000452 | 3300049584 | Bacteria | 20843 |
| 777 | Ga0501068_0189337 | 3300049584 | Bacteria | 1303 |
| 778 | Ga0501069_0052941 | 3300049585 | Bacteria | 2261 |
| 779 | Ga0501070_0077166 | 3300049586 | Bacteria | 2758 |
| 780 | Ga0501070_0243853 | 3300049586 | Bacteria | 1471 |
| 781 | Ga0501071_0004700 | 3300049587 | Bacteria | 8679 |
| 782 | Ga0501072_0000006 | 3300049588 | Bacteria | 245475 |
| 783 | Ga0501072_0039589 | 3300049588 | Bacteria | 3700 |
| 784 | Ga0501072_0058850 | 3300049588 | Bacteria | 3029 |
| 785 | Ga0501072_0273859 | 3300049588 | Bacteria | 1343 |
| 786 | Ga0501073_0028960 | 3300049589 | Bacteria | 3956 |
| 787 | Ga0501074_0018854 | 3300049590 | Bacteria | 5011 |
| 788 | Ga0501074_0066098 | 3300049590 | Bacteria | 2601 |
| 789 | Ga0501075_0009298 | 3300049591 | Bacteria | 6878 |
| 790 | Ga0501075_0228713 | 3300049591 | Bacteria | 1418 |
| 791 | Ga0501076_0074483 | 3300049592 | Bacteria | 2720 |
| 792 | Ga0501076_0176281 | 3300049592 | Bacteria | 1742 |
| 793 | Ga0501076_0241119 | 3300049592 | Bacteria | 1479 |
| 794 | Ga0501077_0073378 | 3300049593 | Bacteria | 2168 |
| 795 | Ga0501077_0136503 | 3300049593 | Bacteria | 1555 |
| 796 | Ga0501079_0003564 | 3300049741 | Bacteria | 11449 |
| 797 | Ga0501079_0006593 | 3300049741 | Bacteria | 8733 |
| 798 | Ga0501079_0040252 | 3300049741 | Bacteria | 3605 |
| 799 | Ga0501080_0063673 | 3300049742 | Bacteria | 3431 |
| 800 | Ga0501080_0071622 | 3300049742 | Bacteria | 3224 |
| 801 | Ga0501081_0010246 | 3300049743 | Bacteria | 6120 |
| 802 | Ga0501081_0054646 | 3300049743 | Bacteria | 2759 |
| 803 | Ga0501081_0247782 | 3300049743 | Bacteria | 1300 |
| 804 | Ga0501083_0007775 | 3300049744 | Bacteria | 7594 |
| 805 | Ga0501083_0262113 | 3300049744 | Bacteria | 1124 |
| 806 | Ga0501045_0002003 | 3300049824 | Bacteria | 13762 |
| 807 | Ga0501045_0069668 | 3300049824 | Bacteria | 2586 |
| 808 | nmdc:mga03n38_1014_c1 | 3300050490 | Bacteria | 7689 |
| 809 | nmdc:mga03n38_1867_c1 | 3300050490 | Bacteria | 6296 |
| 810 | nmdc:mga00v17_166394_c1 | 3300050491 | Bacteria | 1421 |
| 811 | nmdc:mga0yw44_43238_c1 | 3300050492 | Bacteria | 2689 |
| 812 | nmdc:mga06z11_1371_c1 | 3300050494 | Bacteria | 9016 |
| 813 | nmdc:mga06z11_5195_c1 | 3300050494 | Bacteria | 5201 |
| 814 | nmdc:mga04h51_1352_c1 | 3300050495 | Bacteria | 5649 |
| 815 | nmdc:mga05p37_183426_c1 | 3300050507 | Bacteria | 2545 |
| 816 | nmdc:mga05p37_355_c1 | 3300050507 | Bacteria | 49150 |
| 817 | nmdc:mga09592_1014_c1 | 3300050508 | Bacteria | 22323 |
| 818 | nmdc:mga09592_131363_c1 | 3300050508 | Bacteria | 2155 |
| 819 | nmdc:mga0qj67_125782_c1 | 3300050509 | Bacteria | 2075 |
| 820 | nmdc:mga0qj67_4152_c1 | 3300050509 | Bacteria | 10503 |
| 821 | nmdc:mga0qj67_97384_c1 | 3300050509 | Bacteria | 2369 |
| 822 | nmdc:mga06r32_235640_c1 | 3300050510 | Bacteria | 1818 |
| 823 | nmdc:mga06r32_299307_c1 | 3300050510 | Bacteria | 1595 |
| 824 | nmdc:mga06r32_53517_c1 | 3300050510 | Bacteria | 3867 |
| 825 | nmdc:mga08y16_134330_c1 | 3300050511 | Bacteria | 2571 |
| 826 | nmdc:mga08y16_180713_c1 | 3300050511 | Unclassified | 2190 |
| 827 | nmdc:mga0n895_28879_c1 | 3300050512 | Bacteria | 5281 |
| 828 | nmdc:mga0n895_33893_c1 | 3300050512 | Bacteria | 4911 |
| 829 | nmdc:mga0n895_360594_c1 | 3300050512 | Bacteria | 1472 |
| 830 | nmdc:mga0n895_467992_c1 | 3300050512 | Bacteria | 1272 |
| 831 | nmdc:mga0n895_68170_c1 | 3300050512 | Bacteria | 3524 |
| 832 | nmdc:mga0n895_726460_c1 | 3300050512 | Bacteria | 988 |
| 833 | nmdc:mga0n895_84026_c1 | 3300050512 | Bacteria | 3176 |
| 834 | nmdc:mga0rr50_101402_c1 | 3300050513 | Bacteria | 2263 |
| 835 | nmdc:mga0rr50_140887_c1 | 3300050513 | Bacteria | 1940 |
| 836 | nmdc:mga0rr50_188246_c1 | 3300050513 | Bacteria | 1690 |
| 837 | nmdc:mga08x19_2443_c1 | 3300050514 | Bacteria | 11287 |
| 838 | nmdc:mga08x19_48491_c1 | 3300050514 | Bacteria | 2721 |
| 839 | nmdc:mga08x19_74258_c1 | 3300050514 | Bacteria | 2221 |
| 840 | nmdc:mga08x19_91074_c1 | 3300050514 | Bacteria | 2013 |
| 841 | nmdc:mga0a205_207992_c1 | 3300050515 | Bacteria | 1846 |
| 842 | Ga0495601_0013688 | 3300053077 | Bacteria | 4880 |
| 843 | Ga0495601_0166421 | 3300053077 | Unclassified | 1441 |
| 844 | Ga0495619_0003421 | 3300053085 | Bacteria | 10245 |
| 845 | Ga0495619_0008732 | 3300053085 | Bacteria | 6408 |
| 846 | Ga0495619_0020795 | 3300053085 | Bacteria | 4185 |
| 847 | Ga0495619_0050305 | 3300053085 | Bacteria | 2750 |
| 848 | Ga0500555_046926 | 3300053103 | Unclassified | 1190 |
| 849 | Ga0500614_014279 | 3300053123 | Bacteria | 1757 |
| 850 | Ga0501084_0009922 | 3300054114 | Bacteria | 7871 |
| 851 | Ga0501084_0011694 | 3300054114 | Bacteria | 7266 |
| 852 | Ga0501084_0237093 | 3300054114 | Bacteria | 1540 |
| 853 | Ga0501082_0003950 | 3300060353 | Bacteria | 12942 |
| 854 | Ga0501082_0083255 | 3300060353 | Bacteria | 2760 |
| 855 | Ga0530510_0006184 | 3300061734 | Bacteria | 8321 |
| 856 | Ga0530510_0160733 | 3300061734 | Bacteria | 1661 |
| 857 | Ga0530510_0401196 | 3300061734 | Bacteria | 1033 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025938 | Ga0207704_10048652 | Ga0207704_100486521 | 184 |
| 2 | 3300034957 | Ga0373938_0022516 | Ga0373938_0022516_593_1273 | 201 |
| 3 | 3300028381 | Ga0268264_10730789 | Ga0268264_107307892 | 203 |
| 4 | 3300046642 | Ga0495634_0440580 | Ga0495634_0440580_22_726 | 222 |
| 5 | 3300049522 | Ga0501299_056013 | Ga0501299_056013_21_788 | 222 |
| 6 | 3300006048 | Ga0075363_100030547 | Ga0075363_1000305472 | 224 |
| 7 | 3300006178 | Ga0075367_10004347 | Ga0075367_100043476 | 224 |
| 8 | 3300027866 | Ga0209813_10006227 | Ga0209813_100062272 | 224 |
| 9 | 3300050490 | nmdc:mga03n38_1867_c1 | nmdc:mga03n38_1867_c1_998_1780 | 224 |
| 10 | 3300050494 | nmdc:mga06z11_5195_c1 | nmdc:mga06z11_5195_c1_2644_3426 | 224 |
| 11 | 3300005539 | Ga0068853_100139987 | Ga0068853_1001399872 | 225 |
| 12 | 3300026041 | Ga0207639_10305578 | Ga0207639_103055782 | 225 |
| 13 | 3300050512 | nmdc:mga0n895_28879_c1 | nmdc:mga0n895_28879_c1_668_1435 | 228 |
| 14 | 3300005329 | Ga0070683_100015486 | Ga0070683_1000154862 | 230 |
| 15 | 3300005335 | Ga0070666_10002242 | Ga0070666_100022427 | 230 |
| 16 | 3300005337 | Ga0070682_100070693 | Ga0070682_1000706933 | 230 |
| 17 | 3300005338 | Ga0068868_100097101 | Ga0068868_1000971012 | 230 |
| 18 | 3300005339 | Ga0070660_100290891 | Ga0070660_1002908912 | 230 |
| 19 | 3300005340 | Ga0070689_100079732 | Ga0070689_1000797322 | 230 |
| 20 | 3300005355 | Ga0070671_100051418 | Ga0070671_1000514183 | 230 |
| 21 | 3300005364 | Ga0070673_100011403 | Ga0070673_1000114037 | 230 |
| 22 | 3300005367 | Ga0070667_100059389 | Ga0070667_1000593893 | 230 |
| 23 | 3300005434 | Ga0070709_10004334 | Ga0070709_100043345 | 230 |
| 24 | 3300005436 | Ga0070713_100000923 | Ga0070713_10000092318 | 230 |
| 25 | 3300005437 | Ga0070710_10007113 | Ga0070710_100071132 | 230 |
| 26 | 3300005437 | Ga0070710_10018012 | Ga0070710_100180122 | 230 |
| 27 | 3300005439 | Ga0070711_100033220 | Ga0070711_1000332202 | 230 |
| 28 | 3300005439 | Ga0070711_100176471 | Ga0070711_1001764712 | 230 |
| 29 | 3300005439 | Ga0070711_100187816 | Ga0070711_1001878162 | 230 |
| 30 | 3300005456 | Ga0070678_100099155 | Ga0070678_1000991552 | 230 |
| 31 | 3300005466 | Ga0070685_10009466 | Ga0070685_100094663 | 230 |
| 32 | 3300005544 | Ga0070686_100018776 | Ga0070686_1000187763 | 230 |
| 33 | 3300005547 | Ga0070693_100102273 | Ga0070693_1001022732 | 230 |
| 34 | 3300005564 | Ga0070664_100178728 | Ga0070664_1001787282 | 230 |
| 35 | 3300005614 | Ga0068856_100128107 | Ga0068856_1001281073 | 230 |
| 36 | 3300005618 | Ga0068864_100024740 | Ga0068864_1000247403 | 230 |
| 37 | 3300005842 | Ga0068858_100018324 | Ga0068858_1000183243 | 230 |
| 38 | 3300005843 | Ga0068860_100042508 | Ga0068860_1000425084 | 230 |
| 39 | 3300006028 | Ga0070717_10035489 | Ga0070717_100354894 | 230 |
| 40 | 3300006163 | Ga0070715_10007541 | Ga0070715_100075413 | 230 |
| 41 | 3300006173 | Ga0070716_100151267 | Ga0070716_1001512672 | 230 |
| 42 | 3300006175 | Ga0070712_100022345 | Ga0070712_1000223453 | 230 |
| 43 | 3300006175 | Ga0070712_100309581 | Ga0070712_1003095811 | 230 |
| 44 | 3300006237 | Ga0097621_100006628 | Ga0097621_10000662811 | 230 |
| 45 | 3300006358 | Ga0068871_100008291 | Ga0068871_1000082917 | 230 |
| 46 | 3300006871 | Ga0075434_100032733 | Ga0075434_1000327332 | 230 |
| 47 | 3300006881 | Ga0068865_100070194 | Ga0068865_1000701941 | 230 |
| 48 | 3300007076 | Ga0075435_100017108 | Ga0075435_1000171084 | 230 |
| 49 | 3300007076 | Ga0075435_100062865 | Ga0075435_1000628653 | 230 |
| 50 | 3300009098 | Ga0105245_10124373 | Ga0105245_101243732 | 230 |
| 51 | 3300009148 | Ga0105243_10013045 | Ga0105243_100130457 | 230 |
| 52 | 3300009176 | Ga0105242_10010686 | Ga0105242_100106862 | 230 |
| 53 | 3300009545 | Ga0105237_10559730 | Ga0105237_105597302 | 230 |
| 54 | 3300009553 | Ga0105249_10144737 | Ga0105249_101447372 | 230 |
| 55 | 3300010375 | Ga0105239_10098006 | Ga0105239_100980063 | 230 |
| 56 | 3300013296 | Ga0157374_10167755 | Ga0157374_101677552 | 230 |
| 57 | 3300013296 | Ga0157374_10282222 | Ga0157374_102822222 | 230 |
| 58 | 3300013297 | Ga0157378_10020683 | Ga0157378_100206835 | 230 |
| 59 | 3300013306 | Ga0163162_10021862 | Ga0163162_100218623 | 230 |
| 60 | 3300013308 | Ga0157375_10054080 | Ga0157375_100540802 | 230 |
| 61 | 3300013308 | Ga0157375_10227796 | Ga0157375_102277962 | 230 |
| 62 | 3300014325 | Ga0163163_10150523 | Ga0163163_101505232 | 230 |
| 63 | 3300014968 | Ga0157379_10064941 | Ga0157379_100649412 | 230 |
| 64 | 3300014968 | Ga0157379_10143967 | Ga0157379_101439672 | 230 |
| 65 | 3300017792 | Ga0163161_10071785 | Ga0163161_100717852 | 230 |
| 66 | 3300025898 | Ga0207692_10008507 | Ga0207692_100085074 | 230 |
| 67 | 3300025898 | Ga0207692_10030650 | Ga0207692_100306502 | 230 |
| 68 | 3300025906 | Ga0207699_10002688 | Ga0207699_100026885 | 230 |
| 69 | 3300025907 | Ga0207645_10213644 | Ga0207645_102136442 | 230 |
| 70 | 3300025914 | Ga0207671_10110886 | Ga0207671_101108862 | 230 |
| 71 | 3300025915 | Ga0207693_10013884 | Ga0207693_100138843 | 230 |
| 72 | 3300025915 | Ga0207693_10149563 | Ga0207693_101495632 | 230 |
| 73 | 3300025916 | Ga0207663_10179120 | Ga0207663_101791202 | 230 |
| 74 | 3300025916 | Ga0207663_10185393 | Ga0207663_101853932 | 230 |
| 75 | 3300025919 | Ga0207657_10114009 | Ga0207657_101140092 | 230 |
| 76 | 3300025928 | Ga0207700_10108800 | Ga0207700_101088002 | 230 |
| 77 | 3300025929 | Ga0207664_10362367 | Ga0207664_103623671 | 230 |
| 78 | 3300025931 | Ga0207644_10003123 | Ga0207644_1000312310 | 230 |
| 79 | 3300025934 | Ga0207686_10066308 | Ga0207686_100663083 | 230 |
| 80 | 3300025935 | Ga0207709_10059711 | Ga0207709_100597112 | 230 |
| 81 | 3300025936 | Ga0207670_10047961 | Ga0207670_100479612 | 230 |
| 82 | 3300025939 | Ga0207665_10000223 | Ga0207665_1000022327 | 230 |
| 83 | 3300025941 | Ga0207711_10021061 | Ga0207711_100210615 | 230 |
| 84 | 3300025986 | Ga0207658_10053591 | Ga0207658_100535912 | 230 |
| 85 | 3300026067 | Ga0207678_10065925 | Ga0207678_100659253 | 230 |
| 86 | 3300026088 | Ga0207641_10021698 | Ga0207641_100216982 | 230 |
| 87 | 3300026121 | Ga0207683_10012990 | Ga0207683_100129905 | 230 |
| 88 | 3300027907 | Ga0207428_10230542 | Ga0207428_102305422 | 230 |
| 89 | 3300028379 | Ga0268266_10029298 | Ga0268266_100292982 | 230 |
| 90 | 3300028381 | Ga0268264_10106633 | Ga0268264_101066332 | 230 |
| 91 | 3300031241 | Ga0265325_10000004 | Ga0265325_10000004273 | 230 |
| 92 | 3300031595 | Ga0265313_10011134 | Ga0265313_100111343 | 230 |
| 93 | 3300035084 | Ga0373928_0001281 | Ga0373928_0001281_1425_2273 | 230 |
| 94 | 3300035088 | Ga0373940_0024817 | Ga0373940_0024817_443_1291 | 230 |
| 95 | 3300035089 | Ga0373944_0031160 | Ga0373944_0031160_57_905 | 230 |
| 96 | 3300035111 | Ga0373923_0120124 | Ga0373923_0120124_186_1034 | 230 |
| 97 | 3300035115 | Ga0373941_0004067 | Ga0373941_0004067_39_887 | 230 |
| 98 | 3300035116 | Ga0373945_0010944 | Ga0373945_0010944_781_1629 | 230 |
| 99 | 3300035170 | Ga0373943_0011856 | Ga0373943_0011856_761_1609 | 230 |
| 100 | 3300035170 | Ga0373943_0046676 | Ga0373943_0046676_265_1113 | 230 |
| 101 | 3300035171 | Ga0373946_0010572 | Ga0373946_0010572_368_1216 | 230 |
| 102 | 3300035410 | Ga0373924_0051051 | Ga0373924_0051051_802_1650 | 230 |
| 103 | 3300035691 | Ga0373931_0010262 | Ga0373931_0010262_2632_3480 | 230 |
| 104 | 3300035695 | Ga0373927_0037618 | Ga0373927_0037618_22_870 | 230 |
| 105 | 3300035695 | Ga0373927_0041185 | Ga0373927_0041185_1081_1929 | 230 |
| 106 | 3300035725 | Ga0373947_0009374 | Ga0373947_0009374_1665_2513 | 230 |
| 107 | 3300035725 | Ga0373947_0010706 | Ga0373947_0010706_2458_3306 | 230 |
| 108 | 3300035725 | Ga0373947_0357662 | Ga0373947_0357662_79_927 | 230 |
| 109 | 3300037068 | Ga0373925_0006268 | Ga0373925_0006268_2789_3637 | 230 |
| 110 | 3300037068 | Ga0373925_0055489 | Ga0373925_0055489_1900_2748 | 230 |
| 111 | 3300046454 | Ga0495592_0136006 | Ga0495592_0136006_70_918 | 230 |
| 112 | 3300046455 | Ga0495603_0015201 | Ga0495603_0015201_2330_3178 | 230 |
| 113 | 3300046455 | Ga0495603_0016798 | Ga0495603_0016798_1658_2506 | 230 |
| 114 | 3300046459 | Ga0495629_0022638 | Ga0495629_0022638_2831_3679 | 230 |
| 115 | 3300046459 | Ga0495629_0041822 | Ga0495629_0041822_1272_2120 | 230 |
| 116 | 3300046461 | Ga0495641_0020474 | Ga0495641_0020474_1753_2601 | 230 |
| 117 | 3300046461 | Ga0495641_0062461 | Ga0495641_0062461_152_1000 | 230 |
| 118 | 3300046472 | Ga0495580_0041816 | Ga0495580_0041816_621_1469 | 230 |
| 119 | 3300046473 | Ga0495582_0008317 | Ga0495582_0008317_139_987 | 230 |
| 120 | 3300046473 | Ga0495582_0013701 | Ga0495582_0013701_1426_2274 | 230 |
| 121 | 3300046473 | Ga0495582_0065952 | Ga0495582_0065952_1114_1962 | 230 |
| 122 | 3300046514 | Ga0495618_0014907 | Ga0495618_0014907_1245_2093 | 230 |
| 123 | 3300046514 | Ga0495618_0040372 | Ga0495618_0040372_1131_1979 | 230 |
| 124 | 3300046517 | Ga0495630_0032264 | Ga0495630_0032264_2368_3216 | 230 |
| 125 | 3300046526 | Ga0495666_0007272 | Ga0495666_0007272_2054_2902 | 230 |
| 126 | 3300046529 | Ga0495652_0013021 | Ga0495652_0013021_4018_4866 | 230 |
| 127 | 3300046531 | Ga0495665_0045900 | Ga0495665_0045900_147_995 | 230 |
| 128 | 3300046533 | Ga0495640_0021596 | Ga0495640_0021596_1315_2163 | 230 |
| 129 | 3300046533 | Ga0495640_0051067 | Ga0495640_0051067_1198_2046 | 230 |
| 130 | 3300046642 | Ga0495634_0015705 | Ga0495634_0015705_2403_3251 | 230 |
| 131 | 3300046663 | Ga0495635_0132523 | Ga0495635_0132523_51_899 | 230 |
| 132 | 3300046674 | Ga0495588_0025171 | Ga0495588_0025171_1647_2495 | 230 |
| 133 | 3300046681 | Ga0495647_0004324 | Ga0495647_0004324_921_1769 | 230 |
| 134 | 3300046681 | Ga0495647_0013460 | Ga0495647_0013460_1746_2594 | 230 |
| 135 | 3300046683 | Ga0495658_0004279 | Ga0495658_0004279_1366_2214 | 230 |
| 136 | 3300046689 | Ga0495613_0004531 | Ga0495613_0004531_8543_9391 | 230 |
| 137 | 3300046689 | Ga0495613_0013849 | Ga0495613_0013849_2786_3634 | 230 |
| 138 | 3300046690 | Ga0495624_0022443 | Ga0495624_0022443_2166_3014 | 230 |
| 139 | 3300047315 | Ga0495581_0006657 | Ga0495581_0006657_2842_3690 | 230 |
| 140 | 3300047315 | Ga0495581_0228735 | Ga0495581_0228735_253_1077 | 230 |
| 141 | 3300047319 | Ga0495674_0018069 | Ga0495674_0018069_2361_3209 | 230 |
| 142 | 3300047321 | Ga0495676_0046166 | Ga0495676_0046166_2452_3300 | 230 |
| 143 | 3300047322 | Ga0495680_0137622 | Ga0495680_0137622_710_1558 | 230 |
| 144 | 3300047471 | Ga0495684_0025601 | Ga0495684_0025601_2379_3227 | 230 |
| 145 | 3300047673 | Ga0495593_0029417 | Ga0495593_0029417_1362_2210 | 230 |
| 146 | 3300048089 | Ga0495614_0037593 | Ga0495614_0037593_499_1347 | 230 |
| 147 | 3300048903 | Ga0496100_0450729 | Ga0496100_0450729_34_882 | 230 |
| 148 | 3300048904 | Ga0496101_0013743 | Ga0496101_0013743_2983_3831 | 230 |
| 149 | 3300048905 | Ga0496102_0065442 | Ga0496102_0065442_1643_2491 | 230 |
| 150 | 3300048907 | Ga0496104_0223878 | Ga0496104_0223878_780_1628 | 230 |
| 151 | 3300048907 | Ga0496104_0294806 | Ga0496104_0294806_36_884 | 230 |
| 152 | 3300048908 | Ga0496105_0034626 | Ga0496105_0034626_1713_2561 | 230 |
| 153 | 3300048910 | Ga0496107_0266625 | Ga0496107_0266625_357_1205 | 230 |
| 154 | 3300048915 | Ga0496112_0403040 | Ga0496112_0403040_199_1047 | 230 |
| 155 | 3300048917 | Ga0496114_0005459 | Ga0496114_0005459_717_1565 | 230 |
| 156 | 3300048918 | Ga0496115_0040660 | Ga0496115_0040660_959_1807 | 230 |
| 157 | 3300048918 | Ga0496115_0053463 | Ga0496115_0053463_789_1637 | 230 |
| 158 | 3300050512 | nmdc:mga0n895_360594_c1 | nmdc:mga0n895_360594_c1_201_1049 | 230 |
| 159 | 3300050512 | nmdc:mga0n895_467992_c1 | nmdc:mga0n895_467992_c1_272_1120 | 230 |
| 160 | 3300050513 | nmdc:mga0rr50_188246_c1 | nmdc:mga0rr50_188246_c1_250_1017 | 230 |
| 161 | 3300050514 | nmdc:mga08x19_74258_c1 | nmdc:mga08x19_74258_c1_272_1120 | 230 |
| 162 | 3300053085 | Ga0495619_0003421 | Ga0495619_0003421_1953_2801 | 230 |
| 163 | 3300053085 | Ga0495619_0020795 | Ga0495619_0020795_66_914 | 230 |
| 164 | 3300053085 | Ga0495619_0050305 | Ga0495619_0050305_1058_1906 | 230 |
| 165 | 3300005471 | Ga0070698_100259826 | Ga0070698_1002598262 | 231 |
| 166 | 3300048089 | Ga0495614_0093128 | Ga0495614_0093128_346_1128 | 231 |
| 167 | 3300049574 | Ga0501038_0085860 | Ga0501038_0085860_1661_2470 | 231 |
| 168 | 3300049576 | Ga0501040_0110699 | Ga0501040_0110699_735_1544 | 231 |
| 169 | 3300035116 | Ga0373945_0148515 | Ga0373945_0148515_64_846 | 232 |
| 170 | 3300035170 | Ga0373943_0009126 | Ga0373943_0009126_807_1589 | 232 |
| 171 | 3300035171 | Ga0373946_0021725 | Ga0373946_0021725_699_1481 | 232 |
| 172 | 3300035692 | Ga0373935_0008836 | Ga0373935_0008836_2368_3150 | 232 |
| 173 | 3300035695 | Ga0373927_0017863 | Ga0373927_0017863_3429_4211 | 232 |
| 174 | 3300035725 | Ga0373947_0003408 | Ga0373947_0003408_6537_7319 | 232 |
| 175 | 3300037068 | Ga0373925_0017846 | Ga0373925_0017846_3515_4297 | 232 |
| 176 | 3300046455 | Ga0495603_0003334 | Ga0495603_0003334_7044_7826 | 232 |
| 177 | 3300046459 | Ga0495629_0003983 | Ga0495629_0003983_7975_8757 | 232 |
| 178 | 3300046472 | Ga0495580_0159070 | Ga0495580_0159070_719_1501 | 232 |
| 179 | 3300046473 | Ga0495582_0001069 | Ga0495582_0001069_12172_12954 | 232 |
| 180 | 3300046475 | Ga0495639_0006547 | Ga0495639_0006547_1932_2714 | 232 |
| 181 | 3300046499 | Ga0495594_0003710 | Ga0495594_0003710_1520_2302 | 232 |
| 182 | 3300046683 | Ga0495658_0001192 | Ga0495658_0001192_9431_10213 | 232 |
| 183 | 3300046689 | Ga0495613_0010219 | Ga0495613_0010219_4690_5472 | 232 |
| 184 | 3300046809 | Ga0495600_0087950 | Ga0495600_0087950_425_1207 | 232 |
| 185 | 3300047321 | Ga0495676_0155299 | Ga0495676_0155299_800_1582 | 232 |
| 186 | 3300047322 | Ga0495680_0008064 | Ga0495680_0008064_6489_7271 | 232 |
| 187 | 3300047673 | Ga0495593_0037677 | Ga0495593_0037677_1328_2110 | 232 |
| 188 | 3300049577 | Ga0501041_0002402 | Ga0501041_0002402_49_861 | 232 |
| 189 | 3300049582 | Ga0501048_0512680 | Ga0501048_0512680_20_832 | 232 |
| 190 | 3300050511 | nmdc:mga08y16_180713_c1 | nmdc:mga08y16_180713_c1_985_1767 | 232 |
| 191 | 3300053085 | Ga0495619_0008732 | Ga0495619_0008732_1191_1973 | 232 |
| 192 | 3300032126 | Ga0307415_100575368 | Ga0307415_1005753682 | 233 |
| 193 | 3300048907 | Ga0496104_0000951 | Ga0496104_0000951_8932_9780 | 233 |
| 194 | 3300048917 | Ga0496114_0437062 | Ga0496114_0437062_25_873 | 233 |
| 195 | 3300049577 | Ga0501041_0337078 | Ga0501041_0337078_65_901 | 233 |
| 196 | 3300050509 | nmdc:mga0qj67_97384_c1 | nmdc:mga0qj67_97384_c1_852_1691 | 233 |
| 197 | 3300035398 | Ga0316574_0123080 | Ga0316574_0123080_575_1342 | 236 |
| 198 | 3300028577 | Ga0265318_10001252 | Ga0265318_100012528 | 237 |
| 199 | 3300031235 | Ga0265330_10000900 | Ga0265330_100009005 | 237 |
| 200 | 3300031240 | Ga0265320_10002328 | Ga0265320_1000232810 | 237 |
| 201 | 3300031242 | Ga0265329_10000367 | Ga0265329_100003672 | 237 |
| 202 | 3300031250 | Ga0265331_10001846 | Ga0265331_100018462 | 237 |
| 203 | 3300031344 | Ga0265316_10002329 | Ga0265316_1000232914 | 237 |
| 204 | 3300031712 | Ga0265342_10002058 | Ga0265342_100020585 | 237 |
| 205 | 3300028800 | Ga0265338_10116388 | Ga0265338_101163883 | 238 |
| 206 | 3300039453 | Ga0436362_0386476 | Ga0436362_0386476_1010_1861 | 238 |
| 207 | 3300039438 | Ga0436360_0438289 | Ga0436360_0438289_2158_3009 | 239 |
| 208 | 3300006038 | Ga0075365_10256914 | Ga0075365_102569142 | 240 |
| 209 | 3300006871 | Ga0075434_100173991 | Ga0075434_1001739912 | 240 |
| 210 | 3300050512 | nmdc:mga0n895_84026_c1 | nmdc:mga0n895_84026_c1_56_877 | 240 |
| 211 | 3300005518 | Ga0070699_100065163 | Ga0070699_1000651634 | 241 |
| 212 | 3300006846 | Ga0075430_100351607 | Ga0075430_1003516072 | 241 |
| 213 | 3300025917 | Ga0207660_10073078 | Ga0207660_100730784 | 241 |
| 214 | 3300005336 | Ga0070680_100155873 | Ga0070680_1001558732 | 244 |
| 215 | 3300005406 | Ga0070703_10058243 | Ga0070703_100582432 | 244 |
| 216 | 3300005435 | Ga0070714_100259916 | Ga0070714_1002599162 | 244 |
| 217 | 3300005440 | Ga0070705_100165039 | Ga0070705_1001650392 | 244 |
| 218 | 3300005441 | Ga0070700_100244945 | Ga0070700_1002449452 | 244 |
| 219 | 3300005444 | Ga0070694_100011467 | Ga0070694_1000114679 | 244 |
| 220 | 3300005468 | Ga0070707_100156964 | Ga0070707_1001569642 | 244 |
| 221 | 3300005518 | Ga0070699_100097904 | Ga0070699_1000979043 | 244 |
| 222 | 3300005546 | Ga0070696_100057902 | Ga0070696_1000579022 | 244 |
| 223 | 3300005546 | Ga0070696_100070857 | Ga0070696_1000708572 | 244 |
| 224 | 3300005577 | Ga0068857_100284506 | Ga0068857_1002845062 | 244 |
| 225 | 3300005617 | Ga0068859_100585168 | Ga0068859_1005851682 | 244 |
| 226 | 3300005985 | Ga0081539_10073191 | Ga0081539_100731912 | 244 |
| 227 | 3300006871 | Ga0075434_100495421 | Ga0075434_1004954212 | 244 |
| 228 | 3300006914 | Ga0075436_100000576 | Ga0075436_10000057625 | 244 |
| 229 | 3300006914 | Ga0075436_100009986 | Ga0075436_1000099866 | 244 |
| 230 | 3300006931 | Ga0097620_100585197 | Ga0097620_1005851972 | 244 |
| 231 | 3300009553 | Ga0105249_10051274 | Ga0105249_100512743 | 244 |
| 232 | 3300025922 | Ga0207646_10067088 | Ga0207646_100670882 | 244 |
| 233 | 3300025929 | Ga0207664_10072520 | Ga0207664_100725202 | 244 |
| 234 | 3300028573 | Ga0265334_10013031 | Ga0265334_100130312 | 244 |
| 235 | 3300031238 | Ga0265332_10000671 | Ga0265332_1000067116 | 244 |
| 236 | 3300035083 | Ga0373926_0000062 | Ga0373926_0000062_10785_11621 | 244 |
| 237 | 3300035089 | Ga0373944_0002899 | Ga0373944_0002899_3468_4304 | 244 |
| 238 | 3300035113 | Ga0373936_0000882 | Ga0373936_0000882_7160_7996 | 244 |
| 239 | 3300035116 | Ga0373945_0000333 | Ga0373945_0000333_4203_5039 | 244 |
| 240 | 3300035170 | Ga0373943_0007142 | Ga0373943_0007142_1455_2291 | 244 |
| 241 | 3300035171 | Ga0373946_0000768 | Ga0373946_0000768_678_1514 | 244 |
| 242 | 3300035695 | Ga0373927_0000912 | Ga0373927_0000912_11920_12756 | 244 |
| 243 | 3300037068 | Ga0373925_0003003 | Ga0373925_0003003_4421_5257 | 244 |
| 244 | 3300045051 | Ga0451576_0121961 | Ga0451576_0121961_865_1701 | 244 |
| 245 | 3300046455 | Ga0495603_0006586 | Ga0495603_0006586_1476_2312 | 244 |
| 246 | 3300046472 | Ga0495580_0004546 | Ga0495580_0004546_10136_10972 | 244 |
| 247 | 3300046535 | Ga0495586_0001686 | Ga0495586_0001686_3353_4189 | 244 |
| 248 | 3300046674 | Ga0495588_0113067 | Ga0495588_0113067_152_988 | 244 |
| 249 | 3300046681 | Ga0495647_0000076 | Ga0495647_0000076_21104_21940 | 244 |
| 250 | 3300046683 | Ga0495658_0005839 | Ga0495658_0005839_4304_5140 | 244 |
| 251 | 3300047321 | Ga0495676_0019750 | Ga0495676_0019750_3396_4232 | 244 |
| 252 | 3300049581 | Ga0501047_0000924 | Ga0501047_0000924_11408_12205 | 244 |
| 253 | 3300049584 | Ga0501068_0000452 | Ga0501068_0000452_11317_12114 | 244 |
| 254 | 3300049585 | Ga0501069_0052941 | Ga0501069_0052941_514_1311 | 244 |
| 255 | 3300049586 | Ga0501070_0077166 | Ga0501070_0077166_978_1775 | 244 |
| 256 | 3300049588 | Ga0501072_0000006 | Ga0501072_0000006_107244_108041 | 244 |
| 257 | 3300049589 | Ga0501073_0028960 | Ga0501073_0028960_2453_3250 | 244 |
| 258 | 3300049590 | Ga0501074_0018854 | Ga0501074_0018854_4118_4915 | 244 |
| 259 | 3300049592 | Ga0501076_0176281 | Ga0501076_0176281_180_977 | 244 |
| 260 | 3300049741 | Ga0501079_0006593 | Ga0501079_0006593_7582_8379 | 244 |
| 261 | 3300049742 | Ga0501080_0063673 | Ga0501080_0063673_1707_2504 | 244 |
| 262 | 3300049744 | Ga0501083_0007775 | Ga0501083_0007775_5021_5818 | 244 |
| 263 | 3300050511 | nmdc:mga08y16_134330_c1 | nmdc:mga08y16_134330_c1_176_988 | 244 |
| 264 | 3300050514 | nmdc:mga08x19_2443_c1 | nmdc:mga08x19_2443_c1_608_1444 | 244 |
| 265 | 3300054114 | Ga0501084_0009922 | Ga0501084_0009922_3289_4086 | 244 |
| 266 | 3300060353 | Ga0501082_0003950 | Ga0501082_0003950_6459_7256 | 244 |
| 267 | 3300005327 | Ga0070658_10071004 | Ga0070658_100710043 | 245 |
| 268 | 3300005328 | Ga0070676_10070698 | Ga0070676_100706982 | 245 |
| 269 | 3300005329 | Ga0070683_100119018 | Ga0070683_1001190182 | 245 |
| 270 | 3300005330 | Ga0070690_100000203 | Ga0070690_10000020327 | 245 |
| 271 | 3300005330 | Ga0070690_100285679 | Ga0070690_1002856791 | 245 |
| 272 | 3300005331 | Ga0070670_100014743 | Ga0070670_1000147437 | 245 |
| 273 | 3300005334 | Ga0068869_100002662 | Ga0068869_1000026627 | 245 |
| 274 | 3300005335 | Ga0070666_10027520 | Ga0070666_100275202 | 245 |
| 275 | 3300005336 | Ga0070680_100039626 | Ga0070680_1000396264 | 245 |
| 276 | 3300005336 | Ga0070680_100431741 | Ga0070680_1004317411 | 245 |
| 277 | 3300005337 | Ga0070682_100017282 | Ga0070682_1000172823 | 245 |
| 278 | 3300005337 | Ga0070682_100018133 | Ga0070682_1000181333 | 245 |
| 279 | 3300005337 | Ga0070682_100021570 | Ga0070682_1000215705 | 245 |
| 280 | 3300005338 | Ga0068868_100000697 | Ga0068868_10000069713 | 245 |
| 281 | 3300005338 | Ga0068868_100158734 | Ga0068868_1001587342 | 245 |
| 282 | 3300005339 | Ga0070660_100068667 | Ga0070660_1000686672 | 245 |
| 283 | 3300005340 | Ga0070689_100004178 | Ga0070689_10000417813 | 245 |
| 284 | 3300005340 | Ga0070689_100018375 | Ga0070689_1000183757 | 245 |
| 285 | 3300005340 | Ga0070689_100245162 | Ga0070689_1002451622 | 245 |
| 286 | 3300005341 | Ga0070691_10000395 | Ga0070691_1000039517 | 245 |
| 287 | 3300005343 | Ga0070687_100000070 | Ga0070687_10000007023 | 245 |
| 288 | 3300005343 | Ga0070687_100081094 | Ga0070687_1000810942 | 245 |
| 289 | 3300005345 | Ga0070692_10001807 | Ga0070692_100018075 | 245 |
| 290 | 3300005347 | Ga0070668_100174746 | Ga0070668_1001747462 | 245 |
| 291 | 3300005353 | Ga0070669_100168370 | Ga0070669_1001683702 | 245 |
| 292 | 3300005354 | Ga0070675_100124885 | Ga0070675_1001248852 | 245 |
| 293 | 3300005354 | Ga0070675_100124977 | Ga0070675_1001249773 | 245 |
| 294 | 3300005355 | Ga0070671_100006600 | Ga0070671_1000066005 | 245 |
| 295 | 3300005356 | Ga0070674_100090083 | Ga0070674_1000900832 | 245 |
| 296 | 3300005364 | Ga0070673_100023398 | Ga0070673_1000233982 | 245 |
| 297 | 3300005365 | Ga0070688_100031648 | Ga0070688_1000316482 | 245 |
| 298 | 3300005365 | Ga0070688_100263483 | Ga0070688_1002634832 | 245 |
| 299 | 3300005366 | Ga0070659_100084851 | Ga0070659_1000848512 | 245 |
| 300 | 3300005367 | Ga0070667_100023816 | Ga0070667_1000238166 | 245 |
| 301 | 3300005406 | Ga0070703_10012874 | Ga0070703_100128744 | 245 |
| 302 | 3300005434 | Ga0070709_10002182 | Ga0070709_1000218212 | 245 |
| 303 | 3300005435 | Ga0070714_100007793 | Ga0070714_1000077935 | 245 |
| 304 | 3300005436 | Ga0070713_100000728 | Ga0070713_10000072813 | 245 |
| 305 | 3300005437 | Ga0070710_10003961 | Ga0070710_100039618 | 245 |
| 306 | 3300005437 | Ga0070710_10202533 | Ga0070710_102025332 | 245 |
| 307 | 3300005438 | Ga0070701_10000579 | Ga0070701_1000057914 | 245 |
| 308 | 3300005439 | Ga0070711_100013544 | Ga0070711_1000135444 | 245 |
| 309 | 3300005440 | Ga0070705_100000586 | Ga0070705_10000058613 | 245 |
| 310 | 3300005440 | Ga0070705_100017884 | Ga0070705_1000178845 | 245 |
| 311 | 3300005441 | Ga0070700_100005942 | Ga0070700_1000059427 | 245 |
| 312 | 3300005444 | Ga0070694_100000527 | Ga0070694_10000052721 | 245 |
| 313 | 3300005456 | Ga0070678_100011697 | Ga0070678_1000116977 | 245 |
| 314 | 3300005456 | Ga0070678_100250801 | Ga0070678_1002508012 | 245 |
| 315 | 3300005457 | Ga0070662_100251067 | Ga0070662_1002510672 | 245 |
| 316 | 3300005459 | Ga0068867_100000775 | Ga0068867_10000077513 | 245 |
| 317 | 3300005466 | Ga0070685_10002556 | Ga0070685_100025569 | 245 |
| 318 | 3300005471 | Ga0070698_100258343 | Ga0070698_1002583432 | 245 |
| 319 | 3300005530 | Ga0070679_100001447 | Ga0070679_10000144713 | 245 |
| 320 | 3300005539 | Ga0068853_100036955 | Ga0068853_1000369553 | 245 |
| 321 | 3300005539 | Ga0068853_100135040 | Ga0068853_1001350402 | 245 |
| 322 | 3300005543 | Ga0070672_100092046 | Ga0070672_1000920463 | 245 |
| 323 | 3300005544 | Ga0070686_100000240 | Ga0070686_10000024014 | 245 |
| 324 | 3300005544 | Ga0070686_100002912 | Ga0070686_1000029127 | 245 |
| 325 | 3300005545 | Ga0070695_100000374 | Ga0070695_10000037417 | 245 |
| 326 | 3300005547 | Ga0070693_100000298 | Ga0070693_10000029813 | 245 |
| 327 | 3300005547 | Ga0070693_100031068 | Ga0070693_1000310685 | 245 |
| 328 | 3300005549 | Ga0070704_100000864 | Ga0070704_10000086413 | 245 |
| 329 | 3300005549 | Ga0070704_100002844 | Ga0070704_1000028442 | 245 |
| 330 | 3300005563 | Ga0068855_100001747 | Ga0068855_10000174721 | 245 |
| 331 | 3300005563 | Ga0068855_100163255 | Ga0068855_1001632553 | 245 |
| 332 | 3300005577 | Ga0068857_100371705 | Ga0068857_1003717052 | 245 |
| 333 | 3300005578 | Ga0068854_100013725 | Ga0068854_1000137254 | 245 |
| 334 | 3300005614 | Ga0068856_100005249 | Ga0068856_1000052496 | 245 |
| 335 | 3300005614 | Ga0068856_100180823 | Ga0068856_1001808232 | 245 |
| 336 | 3300005615 | Ga0070702_100000032 | Ga0070702_10000003214 | 245 |
| 337 | 3300005615 | Ga0070702_100003828 | Ga0070702_1000038282 | 245 |
| 338 | 3300005616 | Ga0068852_100328246 | Ga0068852_1003282462 | 245 |
| 339 | 3300005617 | Ga0068859_100000445 | Ga0068859_10000044531 | 245 |
| 340 | 3300005617 | Ga0068859_100397785 | Ga0068859_1003977852 | 245 |
| 341 | 3300005618 | Ga0068864_100058934 | Ga0068864_1000589343 | 245 |
| 342 | 3300005718 | Ga0068866_10000116 | Ga0068866_1000011629 | 245 |
| 343 | 3300005718 | Ga0068866_10049630 | Ga0068866_100496302 | 245 |
| 344 | 3300005719 | Ga0068861_100000246 | Ga0068861_10000024626 | 245 |
| 345 | 3300005841 | Ga0068863_100033888 | Ga0068863_1000338883 | 245 |
| 346 | 3300005842 | Ga0068858_100002515 | Ga0068858_10000251511 | 245 |
| 347 | 3300005842 | Ga0068858_100017399 | Ga0068858_1000173996 | 245 |
| 348 | 3300005842 | Ga0068858_100040889 | Ga0068858_1000408893 | 245 |
| 349 | 3300005843 | Ga0068860_100001848 | Ga0068860_10000184816 | 245 |
| 350 | 3300005843 | Ga0068860_100183500 | Ga0068860_1001835002 | 245 |
| 351 | 3300005844 | Ga0068862_100000668 | Ga0068862_10000066823 | 245 |
| 352 | 3300005937 | Ga0081455_10015177 | Ga0081455_100151775 | 245 |
| 353 | 3300006028 | Ga0070717_10001498 | Ga0070717_100014986 | 245 |
| 354 | 3300006163 | Ga0070715_10004223 | Ga0070715_100042233 | 245 |
| 355 | 3300006173 | Ga0070716_100028363 | Ga0070716_1000283632 | 245 |
| 356 | 3300006175 | Ga0070712_100000583 | Ga0070712_10000058313 | 245 |
| 357 | 3300006237 | Ga0097621_100001462 | Ga0097621_10000146213 | 245 |
| 358 | 3300006237 | Ga0097621_100005520 | Ga0097621_10000552010 | 245 |
| 359 | 3300006358 | Ga0068871_100000271 | Ga0068871_10000027113 | 245 |
| 360 | 3300006871 | Ga0075434_100037726 | Ga0075434_1000377264 | 245 |
| 361 | 3300006881 | Ga0068865_100000421 | Ga0068865_10000042118 | 245 |
| 362 | 3300006881 | Ga0068865_100032427 | Ga0068865_1000324274 | 245 |
| 363 | 3300006914 | Ga0075436_100078353 | Ga0075436_1000783532 | 245 |
| 364 | 3300006931 | Ga0097620_100000445 | Ga0097620_10000044516 | 245 |
| 365 | 3300006931 | Ga0097620_100397801 | Ga0097620_1003978012 | 245 |
| 366 | 3300007076 | Ga0075435_100031243 | Ga0075435_1000312433 | 245 |
| 367 | 3300009011 | Ga0105251_10027231 | Ga0105251_100272313 | 245 |
| 368 | 3300009092 | Ga0105250_10100585 | Ga0105250_101005852 | 245 |
| 369 | 3300009093 | Ga0105240_10050363 | Ga0105240_100503634 | 245 |
| 370 | 3300009094 | Ga0111539_10305410 | Ga0111539_103054102 | 245 |
| 371 | 3300009098 | Ga0105245_10000464 | Ga0105245_1000046433 | 245 |
| 372 | 3300009098 | Ga0105245_10231708 | Ga0105245_102317082 | 245 |
| 373 | 3300009101 | Ga0105247_10158256 | Ga0105247_101582562 | 245 |
| 374 | 3300009148 | Ga0105243_10000963 | Ga0105243_1000096313 | 245 |
| 375 | 3300009148 | Ga0105243_10201041 | Ga0105243_102010412 | 245 |
| 376 | 3300009174 | Ga0105241_10012298 | Ga0105241_100122982 | 245 |
| 377 | 3300009174 | Ga0105241_10034371 | Ga0105241_100343712 | 245 |
| 378 | 3300009176 | Ga0105242_10000689 | Ga0105242_1000068921 | 245 |
| 379 | 3300009176 | Ga0105242_10028524 | Ga0105242_100285243 | 245 |
| 380 | 3300009177 | Ga0105248_10285797 | Ga0105248_102857972 | 245 |
| 381 | 3300009551 | Ga0105238_10038648 | Ga0105238_100386484 | 245 |
| 382 | 3300009553 | Ga0105249_10272310 | Ga0105249_102723102 | 245 |
| 383 | 3300009553 | Ga0105249_10364176 | Ga0105249_103641763 | 245 |
| 384 | 3300009553 | Ga0105249_10971621 | Ga0105249_109716211 | 245 |
| 385 | 3300010375 | Ga0105239_10330369 | Ga0105239_103303692 | 245 |
| 386 | 3300011119 | Ga0105246_10226213 | Ga0105246_102262132 | 245 |
| 387 | 3300013100 | Ga0157373_10256476 | Ga0157373_102564762 | 245 |
| 388 | 3300013104 | Ga0157370_10035367 | Ga0157370_100353674 | 245 |
| 389 | 3300013104 | Ga0157370_10298162 | Ga0157370_102981622 | 245 |
| 390 | 3300013105 | Ga0157369_10001331 | Ga0157369_1000133130 | 245 |
| 391 | 3300013296 | Ga0157374_10214238 | Ga0157374_102142382 | 245 |
| 392 | 3300013297 | Ga0157378_10000816 | Ga0157378_100008162 | 245 |
| 393 | 3300013307 | Ga0157372_10002054 | Ga0157372_100020548 | 245 |
| 394 | 3300013307 | Ga0157372_10053532 | Ga0157372_100535323 | 245 |
| 395 | 3300014326 | Ga0157380_10054837 | Ga0157380_100548372 | 245 |
| 396 | 3300014326 | Ga0157380_10542118 | Ga0157380_105421181 | 245 |
| 397 | 3300014968 | Ga0157379_10082960 | Ga0157379_100829602 | 245 |
| 398 | 3300014969 | Ga0157376_10003015 | Ga0157376_100030155 | 245 |
| 399 | 3300014969 | Ga0157376_10070584 | Ga0157376_100705842 | 245 |
| 400 | 3300025885 | Ga0207653_10003327 | Ga0207653_100033275 | 245 |
| 401 | 3300025898 | Ga0207692_10028808 | Ga0207692_100288082 | 245 |
| 402 | 3300025898 | Ga0207692_10177135 | Ga0207692_101771352 | 245 |
| 403 | 3300025899 | Ga0207642_10000116 | Ga0207642_100001162 | 245 |
| 404 | 3300025899 | Ga0207642_10041146 | Ga0207642_100411462 | 245 |
| 405 | 3300025900 | Ga0207710_10074631 | Ga0207710_100746312 | 245 |
| 406 | 3300025901 | Ga0207688_10042004 | Ga0207688_100420043 | 245 |
| 407 | 3300025901 | Ga0207688_10055087 | Ga0207688_100550872 | 245 |
| 408 | 3300025903 | Ga0207680_10014768 | Ga0207680_100147685 | 245 |
| 409 | 3300025905 | Ga0207685_10000567 | Ga0207685_100005677 | 245 |
| 410 | 3300025906 | Ga0207699_10000822 | Ga0207699_100008228 | 245 |
| 411 | 3300025907 | Ga0207645_10025955 | Ga0207645_100259553 | 245 |
| 412 | 3300025915 | Ga0207693_10001134 | Ga0207693_1000113411 | 245 |
| 413 | 3300025915 | Ga0207693_10021730 | Ga0207693_100217302 | 245 |
| 414 | 3300025917 | Ga0207660_10002745 | Ga0207660_100027457 | 245 |
| 415 | 3300025918 | Ga0207662_10000088 | Ga0207662_1000008823 | 245 |
| 416 | 3300025921 | Ga0207652_10003045 | Ga0207652_1000304512 | 245 |
| 417 | 3300025924 | Ga0207694_10039906 | Ga0207694_100399064 | 245 |
| 418 | 3300025924 | Ga0207694_10065189 | Ga0207694_100651892 | 245 |
| 419 | 3300025925 | Ga0207650_10135870 | Ga0207650_101358702 | 245 |
| 420 | 3300025926 | Ga0207659_10197430 | Ga0207659_101974301 | 245 |
| 421 | 3300025927 | Ga0207687_10000349 | Ga0207687_1000034916 | 245 |
| 422 | 3300025927 | Ga0207687_10018771 | Ga0207687_100187713 | 245 |
| 423 | 3300025928 | Ga0207700_10000698 | Ga0207700_1000069813 | 245 |
| 424 | 3300025929 | Ga0207664_10002965 | Ga0207664_100029656 | 245 |
| 425 | 3300025931 | Ga0207644_10008637 | Ga0207644_100086378 | 245 |
| 426 | 3300025932 | Ga0207690_10052966 | Ga0207690_100529662 | 245 |
| 427 | 3300025932 | Ga0207690_10077234 | Ga0207690_100772344 | 245 |
| 428 | 3300025934 | Ga0207686_10001742 | Ga0207686_1000174210 | 245 |
| 429 | 3300025934 | Ga0207686_10024813 | Ga0207686_100248134 | 245 |
| 430 | 3300025935 | Ga0207709_10001642 | Ga0207709_100016424 | 245 |
| 431 | 3300025935 | Ga0207709_10125327 | Ga0207709_101253272 | 245 |
| 432 | 3300025936 | Ga0207670_10028340 | Ga0207670_100283402 | 245 |
| 433 | 3300025936 | Ga0207670_10050624 | Ga0207670_100506243 | 245 |
| 434 | 3300025936 | Ga0207670_10210691 | Ga0207670_102106912 | 245 |
| 435 | 3300025938 | Ga0207704_10007405 | Ga0207704_100074054 | 245 |
| 436 | 3300025938 | Ga0207704_10032287 | Ga0207704_100322872 | 245 |
| 437 | 3300025939 | Ga0207665_10001570 | Ga0207665_1000157021 | 245 |
| 438 | 3300025940 | Ga0207691_10271889 | Ga0207691_102718892 | 245 |
| 439 | 3300025941 | Ga0207711_10013945 | Ga0207711_100139459 | 245 |
| 440 | 3300025942 | Ga0207689_10000079 | Ga0207689_1000007914 | 245 |
| 441 | 3300025942 | Ga0207689_10045851 | Ga0207689_100458515 | 245 |
| 442 | 3300025944 | Ga0207661_10094204 | Ga0207661_100942042 | 245 |
| 443 | 3300025949 | Ga0207667_10003261 | Ga0207667_1000326113 | 245 |
| 444 | 3300025949 | Ga0207667_10055873 | Ga0207667_100558732 | 245 |
| 445 | 3300025949 | Ga0207667_10493159 | Ga0207667_104931592 | 245 |
| 446 | 3300025981 | Ga0207640_10001480 | Ga0207640_100014807 | 245 |
| 447 | 3300025986 | Ga0207658_10107073 | Ga0207658_101070732 | 245 |
| 448 | 3300026023 | Ga0207677_10092023 | Ga0207677_100920233 | 245 |
| 449 | 3300026035 | Ga0207703_10005469 | Ga0207703_1000546911 | 245 |
| 450 | 3300026035 | Ga0207703_10013825 | Ga0207703_100138253 | 245 |
| 451 | 3300026035 | Ga0207703_10029632 | Ga0207703_100296325 | 245 |
| 452 | 3300026041 | Ga0207639_10052452 | Ga0207639_100524523 | 245 |
| 453 | 3300026041 | Ga0207639_10154562 | Ga0207639_101545623 | 245 |
| 454 | 3300026067 | Ga0207678_10007013 | Ga0207678_100070136 | 245 |
| 455 | 3300026075 | Ga0207708_10000326 | Ga0207708_1000032624 | 245 |
| 456 | 3300026078 | Ga0207702_10008239 | Ga0207702_1000823913 | 245 |
| 457 | 3300026088 | Ga0207641_10076106 | Ga0207641_100761062 | 245 |
| 458 | 3300026089 | Ga0207648_10000071 | Ga0207648_1000007170 | 245 |
| 459 | 3300026089 | Ga0207648_10344928 | Ga0207648_103449281 | 245 |
| 460 | 3300026095 | Ga0207676_10002203 | Ga0207676_100022038 | 245 |
| 461 | 3300026118 | Ga0207675_100000040 | Ga0207675_10000004027 | 245 |
| 462 | 3300026121 | Ga0207683_10010098 | Ga0207683_100100988 | 245 |
| 463 | 3300026121 | Ga0207683_10157578 | Ga0207683_101575782 | 245 |
| 464 | 3300026142 | Ga0207698_10012247 | Ga0207698_100122474 | 245 |
| 465 | 3300026142 | Ga0207698_10109793 | Ga0207698_101097933 | 245 |
| 466 | 3300028379 | Ga0268266_10005657 | Ga0268266_100056576 | 245 |
| 467 | 3300028380 | Ga0268265_10002113 | Ga0268265_100021134 | 245 |
| 468 | 3300028381 | Ga0268264_10000527 | Ga0268264_1000052724 | 245 |
| 469 | 3300035088 | Ga0373940_0013954 | Ga0373940_0013954_656_1438 | 245 |
| 470 | 3300035090 | Ga0373949_0002553 | Ga0373949_0002553_626_1408 | 245 |
| 471 | 3300035091 | Ga0373951_0046185 | Ga0373951_0046185_48_830 | 245 |
| 472 | 3300035114 | Ga0373939_0013091 | Ga0373939_0013091_518_1300 | 245 |
| 473 | 3300035207 | Ga0373942_0022075 | Ga0373942_0022075_194_1030 | 245 |
| 474 | 3300035242 | Ga0373962_0011926 | Ga0373962_0011926_1349_2131 | 245 |
| 475 | 3300035692 | Ga0373935_0260617 | Ga0373935_0260617_335_1123 | 245 |
| 476 | 3300035725 | Ga0373947_0162057 | Ga0373947_0162057_236_1072 | 245 |
| 477 | 3300037068 | Ga0373925_0024972 | Ga0373925_0024972_1322_2158 | 245 |
| 478 | 3300037068 | Ga0373925_0191401 | Ga0373925_0191401_708_1496 | 245 |
| 479 | 3300045051 | Ga0451576_0003049 | Ga0451576_0003049_2116_2955 | 245 |
| 480 | 3300045976 | Ga0466967_0340268 | Ga0466967_0340268_441_1277 | 245 |
| 481 | 3300046461 | Ga0495641_0038866 | Ga0495641_0038866_872_1660 | 245 |
| 482 | 3300046461 | Ga0495641_0064667 | Ga0495641_0064667_196_978 | 245 |
| 483 | 3300046475 | Ga0495639_0019886 | Ga0495639_0019886_1736_2524 | 245 |
| 484 | 3300047321 | Ga0495676_0088122 | Ga0495676_0088122_167_955 | 245 |
| 485 | 3300048903 | Ga0496100_0114658 | Ga0496100_0114658_642_1424 | 245 |
| 486 | 3300048907 | Ga0496104_0091895 | Ga0496104_0091895_43_825 | 245 |
| 487 | 3300048907 | Ga0496104_0186029 | Ga0496104_0186029_11_793 | 245 |
| 488 | 3300048908 | Ga0496105_0043687 | Ga0496105_0043687_1448_2230 | 245 |
| 489 | 3300048908 | Ga0496105_0327098 | Ga0496105_0327098_11_793 | 245 |
| 490 | 3300048910 | Ga0496107_0030058 | Ga0496107_0030058_2986_3768 | 245 |
| 491 | 3300048911 | Ga0496108_0011350 | Ga0496108_0011350_642_1424 | 245 |
| 492 | 3300048911 | Ga0496108_0222672 | Ga0496108_0222672_591_1373 | 245 |
| 493 | 3300048912 | Ga0496109_0083508 | Ga0496109_0083508_722_1504 | 245 |
| 494 | 3300048912 | Ga0496109_0144682 | Ga0496109_0144682_591_1373 | 245 |
| 495 | 3300048913 | Ga0496110_0236915 | Ga0496110_0236915_15_797 | 245 |
| 496 | 3300048914 | Ga0496111_0033731 | Ga0496111_0033731_307_1089 | 245 |
| 497 | 3300048915 | Ga0496112_0060211 | Ga0496112_0060211_1467_2249 | 245 |
| 498 | 3300048917 | Ga0496114_0106279 | Ga0496114_0106279_1134_1916 | 245 |
| 499 | 3300048918 | Ga0496115_0028148 | Ga0496115_0028148_1035_1817 | 245 |
| 500 | 3300049584 | Ga0501068_0189337 | Ga0501068_0189337_220_1059 | 245 |
| 501 | 3300050512 | nmdc:mga0n895_33893_c1 | nmdc:mga0n895_33893_c1_1777_2559 | 245 |
| 502 | 3300050512 | nmdc:mga0n895_726460_c1 | nmdc:mga0n895_726460_c1_190_972 | 245 |
| 503 | 3300050513 | nmdc:mga0rr50_101402_c1 | nmdc:mga0rr50_101402_c1_548_1330 | 245 |
| 504 | 3300050514 | nmdc:mga08x19_91074_c1 | nmdc:mga08x19_91074_c1_478_1260 | 245 |
| 505 | 3300053077 | Ga0495601_0013688 | Ga0495601_0013688_1069_1860 | 245 |
| 506 | 3300053103 | Ga0500555_046926 | Ga0500555_046926_261_1148 | 245 |
| 507 | 3300005536 | Ga0070697_100005988 | Ga0070697_1000059889 | 246 |
| 508 | 3300049568 | Ga0501031_0192950 | Ga0501031_0192950_323_1177 | 246 |
| 509 | 3300049572 | Ga0501036_0026934 | Ga0501036_0026934_593_1447 | 246 |
| 510 | 3300049575 | Ga0501039_0046400 | Ga0501039_0046400_1708_2562 | 246 |
| 511 | 3300049578 | Ga0501042_0014537 | Ga0501042_0014537_324_1178 | 246 |
| 512 | 3300049580 | Ga0501046_0124644 | Ga0501046_0124644_690_1544 | 246 |
| 513 | 3300049586 | Ga0501070_0243853 | Ga0501070_0243853_30_884 | 246 |
| 514 | 3300049587 | Ga0501071_0004700 | Ga0501071_0004700_4138_4992 | 246 |
| 515 | 3300049590 | Ga0501074_0066098 | Ga0501074_0066098_470_1324 | 246 |
| 516 | 3300049591 | Ga0501075_0009298 | Ga0501075_0009298_449_1303 | 246 |
| 517 | 3300049741 | Ga0501079_0003564 | Ga0501079_0003564_3942_4796 | 246 |
| 518 | 3300049742 | Ga0501080_0071622 | Ga0501080_0071622_2072_2926 | 246 |
| 519 | 3300049743 | Ga0501081_0010246 | Ga0501081_0010246_1059_1913 | 246 |
| 520 | 3300049744 | Ga0501083_0262113 | Ga0501083_0262113_89_943 | 246 |
| 521 | 3300049824 | Ga0501045_0002003 | Ga0501045_0002003_5469_6323 | 246 |
| 522 | 3300050514 | nmdc:mga08x19_48491_c1 | nmdc:mga08x19_48491_c1_1025_1882 | 246 |
| 523 | 3300054114 | Ga0501084_0011694 | Ga0501084_0011694_5562_6416 | 246 |
| 524 | 3300060353 | Ga0501082_0083255 | Ga0501082_0083255_1889_2743 | 246 |
| 525 | 3300061734 | Ga0530510_0006184 | Ga0530510_0006184_677_1531 | 246 |
| 526 | 3300005331 | Ga0070670_100264476 | Ga0070670_1002644762 | 247 |
| 527 | 3300005347 | Ga0070668_100081957 | Ga0070668_1000819573 | 247 |
| 528 | 3300005353 | Ga0070669_100059891 | Ga0070669_1000598912 | 247 |
| 529 | 3300005356 | Ga0070674_100401996 | Ga0070674_1004019962 | 247 |
| 530 | 3300009148 | Ga0105243_10318433 | Ga0105243_103184331 | 247 |
| 531 | 3300014326 | Ga0157380_10299203 | Ga0157380_102992032 | 247 |
| 532 | 3300017792 | Ga0163161_10161789 | Ga0163161_101617892 | 247 |
| 533 | 3300025893 | Ga0207682_10044778 | Ga0207682_100447782 | 247 |
| 534 | 3300025923 | Ga0207681_10037558 | Ga0207681_100375582 | 247 |
| 535 | 3300025925 | Ga0207650_10065243 | Ga0207650_100652433 | 247 |
| 536 | 3300025940 | Ga0207691_10151495 | Ga0207691_101514951 | 247 |
| 537 | 3300025972 | Ga0207668_10048878 | Ga0207668_100488782 | 247 |
| 538 | 3300031548 | Ga0307408_100034887 | Ga0307408_1000348872 | 247 |
| 539 | 3300032002 | Ga0307416_100079727 | Ga0307416_1000797272 | 247 |
| 540 | 3300032126 | Ga0307415_100341247 | Ga0307415_1003412471 | 247 |
| 541 | 3300046539 | Ga0495621_0005832 | Ga0495621_0005832_2590_3411 | 247 |
| 542 | 3300005458 | Ga0070681_10009213 | Ga0070681_1000921310 | 248 |
| 543 | 3300005467 | Ga0070706_100059044 | Ga0070706_1000590443 | 248 |
| 544 | 3300005545 | Ga0070695_100006942 | Ga0070695_1000069425 | 248 |
| 545 | 3300005546 | Ga0070696_100046543 | Ga0070696_1000465433 | 248 |
| 546 | 3300005577 | Ga0068857_100011942 | Ga0068857_1000119422 | 248 |
| 547 | 3300005614 | Ga0068856_100114006 | Ga0068856_1001140063 | 248 |
| 548 | 3300025912 | Ga0207707_10186611 | Ga0207707_101866112 | 248 |
| 549 | 3300026116 | Ga0207674_10038326 | Ga0207674_100383262 | 248 |
| 550 | 3300048924 | Ga0496121_0022269 | Ga0496121_0022269_627_1457 | 248 |
| 551 | 3300053077 | Ga0495601_0166421 | Ga0495601_0166421_73_918 | 248 |
| 552 | 3300006846 | Ga0075430_100101350 | Ga0075430_1001013502 | 249 |
| 553 | 3300006847 | Ga0075431_100025020 | Ga0075431_1000250207 | 249 |
| 554 | 3300006847 | Ga0075431_100217743 | Ga0075431_1002177432 | 249 |
| 555 | 3300006880 | Ga0075429_100219011 | Ga0075429_1002190112 | 249 |
| 556 | 3300025910 | Ga0207684_10409375 | Ga0207684_104093751 | 249 |
| 557 | 3300035691 | Ga0373931_0106700 | Ga0373931_0106700_175_1038 | 249 |
| 558 | 3300042001 | Ga0439441_000085 | Ga0439441_000085_1793_2656 | 249 |
| 559 | 3300042003 | Ga0439443_000239 | Ga0439443_000239_1422_2285 | 249 |
| 560 | 3300042009 | Ga0439451_006053 | Ga0439451_006053_419_1282 | 249 |
| 561 | 3300042436 | Ga0439435_0000004 | Ga0439435_0000004_10336_11199 | 249 |
| 562 | 3300042437 | Ga0439444_0012156 | Ga0439444_0012156_194_1057 | 249 |
| 563 | 3300042461 | Ga0439460_0000794 | Ga0439460_0000794_3410_4273 | 249 |
| 564 | 3300045051 | Ga0451576_0206182 | Ga0451576_0206182_864_1727 | 249 |
| 565 | 3300046539 | Ga0495621_0040636 | Ga0495621_0040636_133_996 | 249 |
| 566 | 3300049570 | Ga0501033_0127879 | Ga0501033_0127879_693_1556 | 249 |
| 567 | 3300049575 | Ga0501039_0049162 | Ga0501039_0049162_1949_2812 | 249 |
| 568 | 3300049576 | Ga0501040_0272034 | Ga0501040_0272034_298_1161 | 249 |
| 569 | 3300049577 | Ga0501041_0026329 | Ga0501041_0026329_580_1443 | 249 |
| 570 | 3300049578 | Ga0501042_0179047 | Ga0501042_0179047_408_1271 | 249 |
| 571 | 3300049582 | Ga0501048_0120869 | Ga0501048_0120869_885_1748 | 249 |
| 572 | 3300049588 | Ga0501072_0039589 | Ga0501072_0039589_19_882 | 249 |
| 573 | 3300049588 | Ga0501072_0058850 | Ga0501072_0058850_99_962 | 249 |
| 574 | 3300049593 | Ga0501077_0136503 | Ga0501077_0136503_19_894 | 249 |
| 575 | 3300050508 | nmdc:mga09592_131363_c1 | nmdc:mga09592_131363_c1_924_1787 | 249 |
| 576 | 3300050509 | nmdc:mga0qj67_125782_c1 | nmdc:mga0qj67_125782_c1_602_1465 | 249 |
| 577 | 3300050509 | nmdc:mga0qj67_4152_c1 | nmdc:mga0qj67_4152_c1_6676_7539 | 249 |
| 578 | 3300050510 | nmdc:mga06r32_299307_c1 | nmdc:mga06r32_299307_c1_488_1351 | 249 |
| 579 | 3300050510 | nmdc:mga06r32_53517_c1 | nmdc:mga06r32_53517_c1_1633_2496 | 249 |
| 580 | 3300053123 | Ga0500614_014279 | Ga0500614_014279_238_1086 | 249 |
| 581 | 3300005331 | Ga0070670_100005005 | Ga0070670_10000500515 | 250 |
| 582 | 3300005331 | Ga0070670_100094772 | Ga0070670_1000947722 | 250 |
| 583 | 3300005367 | Ga0070667_100040607 | Ga0070667_1000406074 | 250 |
| 584 | 3300005435 | Ga0070714_100033480 | Ga0070714_1000334806 | 250 |
| 585 | 3300005441 | Ga0070700_100227770 | Ga0070700_1002277701 | 250 |
| 586 | 3300005445 | Ga0070708_100038741 | Ga0070708_1000387413 | 250 |
| 587 | 3300005457 | Ga0070662_100130680 | Ga0070662_1001306802 | 250 |
| 588 | 3300005467 | Ga0070706_100043168 | Ga0070706_1000431683 | 250 |
| 589 | 3300005467 | Ga0070706_100087501 | Ga0070706_1000875013 | 250 |
| 590 | 3300005518 | Ga0070699_100285853 | Ga0070699_1002858532 | 250 |
| 591 | 3300005543 | Ga0070672_100010810 | Ga0070672_1000108104 | 250 |
| 592 | 3300005548 | Ga0070665_100192032 | Ga0070665_1001920322 | 250 |
| 593 | 3300005549 | Ga0070704_100291453 | Ga0070704_1002914532 | 250 |
| 594 | 3300005618 | Ga0068864_100002011 | Ga0068864_10000201120 | 250 |
| 595 | 3300005719 | Ga0068861_100018105 | Ga0068861_1000181052 | 250 |
| 596 | 3300005834 | Ga0068851_10121109 | Ga0068851_101211092 | 250 |
| 597 | 3300005841 | Ga0068863_100005304 | Ga0068863_10000530413 | 250 |
| 598 | 3300005843 | Ga0068860_100050695 | Ga0068860_1000506952 | 250 |
| 599 | 3300005844 | Ga0068862_100039981 | Ga0068862_1000399812 | 250 |
| 600 | 3300006881 | Ga0068865_100229031 | Ga0068865_1002290311 | 250 |
| 601 | 3300007076 | Ga0075435_100269344 | Ga0075435_1002693441 | 250 |
| 602 | 3300009177 | Ga0105248_10224378 | Ga0105248_102243782 | 250 |
| 603 | 3300009545 | Ga0105237_10016674 | Ga0105237_100166747 | 250 |
| 604 | 3300013296 | Ga0157374_10458998 | Ga0157374_104589982 | 250 |
| 605 | 3300013306 | Ga0163162_10024952 | Ga0163162_100249524 | 250 |
| 606 | 3300014325 | Ga0163163_10159503 | Ga0163163_101595031 | 250 |
| 607 | 3300025910 | Ga0207684_10027322 | Ga0207684_100273224 | 250 |
| 608 | 3300025910 | Ga0207684_10169254 | Ga0207684_101692542 | 250 |
| 609 | 3300025912 | Ga0207707_10152267 | Ga0207707_101522672 | 250 |
| 610 | 3300025914 | Ga0207671_10047151 | Ga0207671_100471512 | 250 |
| 611 | 3300025925 | Ga0207650_10005227 | Ga0207650_100052272 | 250 |
| 612 | 3300025925 | Ga0207650_10113728 | Ga0207650_101137282 | 250 |
| 613 | 3300025925 | Ga0207650_10159716 | Ga0207650_101597162 | 250 |
| 614 | 3300025929 | Ga0207664_10074370 | Ga0207664_100743703 | 250 |
| 615 | 3300025933 | Ga0207706_10021136 | Ga0207706_100211365 | 250 |
| 616 | 3300025940 | Ga0207691_10023242 | Ga0207691_100232424 | 250 |
| 617 | 3300025941 | Ga0207711_10400333 | Ga0207711_104003332 | 250 |
| 618 | 3300025960 | Ga0207651_10093894 | Ga0207651_100938942 | 250 |
| 619 | 3300025986 | Ga0207658_10175512 | Ga0207658_101755122 | 250 |
| 620 | 3300026023 | Ga0207677_10408641 | Ga0207677_104086412 | 250 |
| 621 | 3300026088 | Ga0207641_10003133 | Ga0207641_1000313315 | 250 |
| 622 | 3300026088 | Ga0207641_10593720 | Ga0207641_105937201 | 250 |
| 623 | 3300026095 | Ga0207676_10016808 | Ga0207676_100168084 | 250 |
| 624 | 3300027395 | Ga0209996_1004442 | Ga0209996_10044422 | 250 |
| 625 | 3300027526 | Ga0209968_1000985 | Ga0209968_10009853 | 250 |
| 626 | 3300027695 | Ga0209966_1000011 | Ga0209966_100001139 | 250 |
| 627 | 3300028380 | Ga0268265_10274614 | Ga0268265_102746142 | 250 |
| 628 | 3300028381 | Ga0268264_10090588 | Ga0268264_100905882 | 250 |
| 629 | 3300028577 | Ga0265318_10000392 | Ga0265318_1000039224 | 250 |
| 630 | 3300031235 | Ga0265330_10001096 | Ga0265330_1000109612 | 250 |
| 631 | 3300031238 | Ga0265332_10000362 | Ga0265332_100003625 | 250 |
| 632 | 3300031240 | Ga0265320_10000221 | Ga0265320_1000022135 | 250 |
| 633 | 3300031240 | Ga0265320_10008165 | Ga0265320_100081653 | 250 |
| 634 | 3300031250 | Ga0265331_10000378 | Ga0265331_100003786 | 250 |
| 635 | 3300031344 | Ga0265316_10030450 | Ga0265316_100304502 | 250 |
| 636 | 3300031595 | Ga0265313_10000196 | Ga0265313_100001966 | 250 |
| 637 | 3300031711 | Ga0265314_10000555 | Ga0265314_1000055537 | 250 |
| 638 | 3300031711 | Ga0265314_10016082 | Ga0265314_100160823 | 250 |
| 639 | 3300031711 | Ga0265314_10151558 | Ga0265314_101515582 | 250 |
| 640 | 3300031712 | Ga0265342_10000058 | Ga0265342_1000005898 | 250 |
| 641 | 3300031712 | Ga0265342_10005768 | Ga0265342_100057683 | 250 |
| 642 | 3300036401 | Ga0373937_0146975 | Ga0373937_0146975_428_1297 | 250 |
| 643 | 3300048912 | Ga0496109_0597036 | Ga0496109_0597036_41_889 | 250 |
| 644 | 3300048916 | Ga0496113_0241084 | Ga0496113_0241084_157_1026 | 250 |
| 645 | 3300003792 | Ga0055540_1015502 | Ga0055540_10155022 | 251 |
| 646 | 3300005331 | Ga0070670_100004185 | Ga0070670_1000041854 | 251 |
| 647 | 3300005335 | Ga0070666_10032343 | Ga0070666_100323433 | 251 |
| 648 | 3300005338 | Ga0068868_100001118 | Ga0068868_10000111811 | 251 |
| 649 | 3300005344 | Ga0070661_100021176 | Ga0070661_1000211764 | 251 |
| 650 | 3300005354 | Ga0070675_100292557 | Ga0070675_1002925572 | 251 |
| 651 | 3300005354 | Ga0070675_100393389 | Ga0070675_1003933892 | 251 |
| 652 | 3300005355 | Ga0070671_100014099 | Ga0070671_1000140996 | 251 |
| 653 | 3300005356 | Ga0070674_100237459 | Ga0070674_1002374591 | 251 |
| 654 | 3300005364 | Ga0070673_100003763 | Ga0070673_10000376310 | 251 |
| 655 | 3300005364 | Ga0070673_100003942 | Ga0070673_10000394211 | 251 |
| 656 | 3300005365 | Ga0070688_100027633 | Ga0070688_1000276332 | 251 |
| 657 | 3300005366 | Ga0070659_100174146 | Ga0070659_1001741462 | 251 |
| 658 | 3300005367 | Ga0070667_100171496 | Ga0070667_1001714962 | 251 |
| 659 | 3300005406 | Ga0070703_10020671 | Ga0070703_100206712 | 251 |
| 660 | 3300005434 | Ga0070709_10002448 | Ga0070709_100024485 | 251 |
| 661 | 3300005436 | Ga0070713_100010653 | Ga0070713_1000106532 | 251 |
| 662 | 3300005437 | Ga0070710_10041867 | Ga0070710_100418672 | 251 |
| 663 | 3300005439 | Ga0070711_100001151 | Ga0070711_1000011514 | 251 |
| 664 | 3300005441 | Ga0070700_100106605 | Ga0070700_1001066052 | 251 |
| 665 | 3300005445 | Ga0070708_100032334 | Ga0070708_1000323344 | 251 |
| 666 | 3300005456 | Ga0070678_100070947 | Ga0070678_1000709474 | 251 |
| 667 | 3300005457 | Ga0070662_100047455 | Ga0070662_1000474552 | 251 |
| 668 | 3300005459 | Ga0068867_100010066 | Ga0068867_1000100666 | 251 |
| 669 | 3300005468 | Ga0070707_100036230 | Ga0070707_1000362304 | 251 |
| 670 | 3300005471 | Ga0070698_100010044 | Ga0070698_10001004410 | 251 |
| 671 | 3300005471 | Ga0070698_100113269 | Ga0070698_1001132692 | 251 |
| 672 | 3300005518 | Ga0070699_100032485 | Ga0070699_1000324851 | 251 |
| 673 | 3300005536 | Ga0070697_100064432 | Ga0070697_1000644323 | 251 |
| 674 | 3300005543 | Ga0070672_100018605 | Ga0070672_1000186054 | 251 |
| 675 | 3300005543 | Ga0070672_100030866 | Ga0070672_1000308666 | 251 |
| 676 | 3300005547 | Ga0070693_100148512 | Ga0070693_1001485122 | 251 |
| 677 | 3300005548 | Ga0070665_100054754 | Ga0070665_1000547545 | 251 |
| 678 | 3300005548 | Ga0070665_100149235 | Ga0070665_1001492352 | 251 |
| 679 | 3300005549 | Ga0070704_100167467 | Ga0070704_1001674672 | 251 |
| 680 | 3300005564 | Ga0070664_100004970 | Ga0070664_1000049706 | 251 |
| 681 | 3300005564 | Ga0070664_100009313 | Ga0070664_1000093134 | 251 |
| 682 | 3300005577 | Ga0068857_100017390 | Ga0068857_1000173906 | 251 |
| 683 | 3300005577 | Ga0068857_100311309 | Ga0068857_1003113092 | 251 |
| 684 | 3300005578 | Ga0068854_100009390 | Ga0068854_1000093905 | 251 |
| 685 | 3300005614 | Ga0068856_100002249 | Ga0068856_10000224911 | 251 |
| 686 | 3300005616 | Ga0068852_100002813 | Ga0068852_10000281310 | 251 |
| 687 | 3300005617 | Ga0068859_100384724 | Ga0068859_1003847242 | 251 |
| 688 | 3300005617 | Ga0068859_100474806 | Ga0068859_1004748062 | 251 |
| 689 | 3300005618 | Ga0068864_100025381 | Ga0068864_1000253813 | 251 |
| 690 | 3300005618 | Ga0068864_100235242 | Ga0068864_1002352422 | 251 |
| 691 | 3300005718 | Ga0068866_10028751 | Ga0068866_100287513 | 251 |
| 692 | 3300005834 | Ga0068851_10074651 | Ga0068851_100746512 | 251 |
| 693 | 3300005840 | Ga0068870_10061183 | Ga0068870_100611832 | 251 |
| 694 | 3300005841 | Ga0068863_100090339 | Ga0068863_1000903394 | 251 |
| 695 | 3300005842 | Ga0068858_100178830 | Ga0068858_1001788303 | 251 |
| 696 | 3300005843 | Ga0068860_100305529 | Ga0068860_1003055291 | 251 |
| 697 | 3300005844 | Ga0068862_100130975 | Ga0068862_1001309752 | 251 |
| 698 | 3300005981 | Ga0081538_10024245 | Ga0081538_100242453 | 251 |
| 699 | 3300005983 | Ga0081540_1010843 | Ga0081540_10108435 | 251 |
| 700 | 3300005983 | Ga0081540_1028009 | Ga0081540_10280093 | 251 |
| 701 | 3300006038 | Ga0075365_10060622 | Ga0075365_100606223 | 251 |
| 702 | 3300006042 | Ga0075368_10004179 | Ga0075368_100041793 | 251 |
| 703 | 3300006048 | Ga0075363_100010127 | Ga0075363_1000101274 | 251 |
| 704 | 3300006051 | Ga0075364_10038812 | Ga0075364_100388122 | 251 |
| 705 | 3300006051 | Ga0075364_10063907 | Ga0075364_100639071 | 251 |
| 706 | 3300006163 | Ga0070715_10002107 | Ga0070715_100021072 | 251 |
| 707 | 3300006173 | Ga0070716_100016547 | Ga0070716_1000165475 | 251 |
| 708 | 3300006175 | Ga0070712_100020847 | Ga0070712_1000208472 | 251 |
| 709 | 3300006177 | Ga0075362_10021946 | Ga0075362_100219464 | 251 |
| 710 | 3300006178 | Ga0075367_10005237 | Ga0075367_100052373 | 251 |
| 711 | 3300006178 | Ga0075367_10021955 | Ga0075367_100219552 | 251 |
| 712 | 3300006237 | Ga0097621_100120740 | Ga0097621_1001207401 | 251 |
| 713 | 3300006358 | Ga0068871_100008770 | Ga0068871_1000087706 | 251 |
| 714 | 3300006358 | Ga0068871_100010111 | Ga0068871_1000101119 | 251 |
| 715 | 3300006844 | Ga0075428_100033779 | Ga0075428_1000337795 | 251 |
| 716 | 3300006844 | Ga0075428_100169633 | Ga0075428_1001696333 | 251 |
| 717 | 3300006844 | Ga0075428_100191665 | Ga0075428_1001916653 | 251 |
| 718 | 3300006847 | Ga0075431_100505993 | Ga0075431_1005059932 | 251 |
| 719 | 3300006847 | Ga0075431_100681312 | Ga0075431_1006813121 | 251 |
| 720 | 3300006871 | Ga0075434_100311482 | Ga0075434_1003114822 | 251 |
| 721 | 3300006880 | Ga0075429_100001221 | Ga0075429_10000122112 | 251 |
| 722 | 3300006881 | Ga0068865_100111768 | Ga0068865_1001117682 | 251 |
| 723 | 3300006914 | Ga0075436_100012193 | Ga0075436_1000121938 | 251 |
| 724 | 3300006931 | Ga0097620_100384737 | Ga0097620_1003847372 | 251 |
| 725 | 3300006931 | Ga0097620_100474748 | Ga0097620_1004747482 | 251 |
| 726 | 3300007076 | Ga0075435_100026846 | Ga0075435_1000268463 | 251 |
| 727 | 3300009094 | Ga0111539_10126181 | Ga0111539_101261813 | 251 |
| 728 | 3300009094 | Ga0111539_10349487 | Ga0111539_103494872 | 251 |
| 729 | 3300009147 | Ga0114129_10047869 | Ga0114129_100478696 | 251 |
| 730 | 3300009147 | Ga0114129_10110457 | Ga0114129_101104573 | 251 |
| 731 | 3300009147 | Ga0114129_10179967 | Ga0114129_101799673 | 251 |
| 732 | 3300009148 | Ga0105243_10060899 | Ga0105243_100608992 | 251 |
| 733 | 3300009176 | Ga0105242_10123212 | Ga0105242_101232122 | 251 |
| 734 | 3300009177 | Ga0105248_10029119 | Ga0105248_100291196 | 251 |
| 735 | 3300009177 | Ga0105248_10119211 | Ga0105248_101192113 | 251 |
| 736 | 3300009551 | Ga0105238_10050721 | Ga0105238_100507214 | 251 |
| 737 | 3300013296 | Ga0157374_10041491 | Ga0157374_100414912 | 251 |
| 738 | 3300013306 | Ga0163162_10092410 | Ga0163162_100924105 | 251 |
| 739 | 3300013308 | Ga0157375_10329409 | Ga0157375_103294091 | 251 |
| 740 | 3300014325 | Ga0163163_10563459 | Ga0163163_105634591 | 251 |
| 741 | 3300014968 | Ga0157379_10039794 | Ga0157379_100397945 | 251 |
| 742 | 3300014968 | Ga0157379_10414388 | Ga0157379_104143882 | 251 |
| 743 | 3300014969 | Ga0157376_10025415 | Ga0157376_100254152 | 251 |
| 744 | 3300014969 | Ga0157376_10053312 | Ga0157376_100533124 | 251 |
| 745 | 3300025303 | Ga0209051_1000843 | Ga0209051_10008436 | 251 |
| 746 | 3300025893 | Ga0207682_10005564 | Ga0207682_100055646 | 251 |
| 747 | 3300025898 | Ga0207692_10000698 | Ga0207692_100006989 | 251 |
| 748 | 3300025901 | Ga0207688_10004733 | Ga0207688_100047332 | 251 |
| 749 | 3300025903 | Ga0207680_10006540 | Ga0207680_100065405 | 251 |
| 750 | 3300025905 | Ga0207685_10003068 | Ga0207685_100030684 | 251 |
| 751 | 3300025906 | Ga0207699_10001488 | Ga0207699_100014884 | 251 |
| 752 | 3300025907 | Ga0207645_10029738 | Ga0207645_100297384 | 251 |
| 753 | 3300025908 | Ga0207643_10008782 | Ga0207643_100087823 | 251 |
| 754 | 3300025908 | Ga0207643_10323391 | Ga0207643_103233911 | 251 |
| 755 | 3300025910 | Ga0207684_10025646 | Ga0207684_100256463 | 251 |
| 756 | 3300025910 | Ga0207684_10195268 | Ga0207684_101952681 | 251 |
| 757 | 3300025915 | Ga0207693_10026285 | Ga0207693_100262854 | 251 |
| 758 | 3300025916 | Ga0207663_10002244 | Ga0207663_100022449 | 251 |
| 759 | 3300025918 | Ga0207662_10134869 | Ga0207662_101348692 | 251 |
| 760 | 3300025920 | Ga0207649_10004361 | Ga0207649_100043619 | 251 |
| 761 | 3300025921 | Ga0207652_10337676 | Ga0207652_103376762 | 251 |
| 762 | 3300025924 | Ga0207694_10003253 | Ga0207694_1000325312 | 251 |
| 763 | 3300025925 | Ga0207650_10022869 | Ga0207650_100228694 | 251 |
| 764 | 3300025926 | Ga0207659_10006995 | Ga0207659_100069952 | 251 |
| 765 | 3300025926 | Ga0207659_10017851 | Ga0207659_100178514 | 251 |
| 766 | 3300025928 | Ga0207700_10001949 | Ga0207700_100019498 | 251 |
| 767 | 3300025929 | Ga0207664_10001209 | Ga0207664_1000120915 | 251 |
| 768 | 3300025931 | Ga0207644_10132743 | Ga0207644_101327433 | 251 |
| 769 | 3300025931 | Ga0207644_10188769 | Ga0207644_101887692 | 251 |
| 770 | 3300025933 | Ga0207706_10033477 | Ga0207706_100334774 | 251 |
| 771 | 3300025934 | Ga0207686_10030369 | Ga0207686_100303692 | 251 |
| 772 | 3300025937 | Ga0207669_10116448 | Ga0207669_101164482 | 251 |
| 773 | 3300025937 | Ga0207669_10268270 | Ga0207669_102682702 | 251 |
| 774 | 3300025939 | Ga0207665_10002070 | Ga0207665_100020704 | 251 |
| 775 | 3300025940 | Ga0207691_10002229 | Ga0207691_1000222911 | 251 |
| 776 | 3300025940 | Ga0207691_10049499 | Ga0207691_100494996 | 251 |
| 777 | 3300025941 | Ga0207711_10021522 | Ga0207711_100215224 | 251 |
| 778 | 3300025941 | Ga0207711_10157291 | Ga0207711_101572912 | 251 |
| 779 | 3300025942 | Ga0207689_10031906 | Ga0207689_100319064 | 251 |
| 780 | 3300025944 | Ga0207661_10014893 | Ga0207661_100148933 | 251 |
| 781 | 3300025945 | Ga0207679_10004969 | Ga0207679_100049696 | 251 |
| 782 | 3300025945 | Ga0207679_10005906 | Ga0207679_100059065 | 251 |
| 783 | 3300025960 | Ga0207651_10021675 | Ga0207651_100216754 | 251 |
| 784 | 3300025960 | Ga0207651_10251025 | Ga0207651_102510252 | 251 |
| 785 | 3300025961 | Ga0207712_10086944 | Ga0207712_100869442 | 251 |
| 786 | 3300025972 | Ga0207668_10147306 | Ga0207668_101473062 | 251 |
| 787 | 3300025972 | Ga0207668_10278751 | Ga0207668_102787512 | 251 |
| 788 | 3300025986 | Ga0207658_10052827 | Ga0207658_100528275 | 251 |
| 789 | 3300026075 | Ga0207708_10005792 | Ga0207708_100057922 | 251 |
| 790 | 3300026078 | Ga0207702_10005592 | Ga0207702_1000559210 | 251 |
| 791 | 3300026089 | Ga0207648_10041704 | Ga0207648_100417042 | 251 |
| 792 | 3300026089 | Ga0207648_10131467 | Ga0207648_101314672 | 251 |
| 793 | 3300026089 | Ga0207648_10256514 | Ga0207648_102565141 | 251 |
| 794 | 3300026095 | Ga0207676_10037914 | Ga0207676_100379144 | 251 |
| 795 | 3300026116 | Ga0207674_10099214 | Ga0207674_100992144 | 251 |
| 796 | 3300026118 | Ga0207675_100019931 | Ga0207675_1000199312 | 251 |
| 797 | 3300026118 | Ga0207675_100395210 | Ga0207675_1003952102 | 251 |
| 798 | 3300026121 | Ga0207683_10005345 | Ga0207683_100053454 | 251 |
| 799 | 3300027866 | Ga0209813_10000439 | Ga0209813_1000043910 | 251 |
| 800 | 3300027907 | Ga0207428_10071999 | Ga0207428_100719992 | 251 |
| 801 | 3300028381 | Ga0268264_10263090 | Ga0268264_102630902 | 251 |
| 802 | 3300028577 | Ga0265318_10019415 | Ga0265318_100194153 | 251 |
| 803 | 3300028800 | Ga0265338_10025744 | Ga0265338_100257446 | 251 |
| 804 | 3300031238 | Ga0265332_10021677 | Ga0265332_100216772 | 251 |
| 805 | 3300031239 | Ga0265328_10001141 | Ga0265328_100011413 | 251 |
| 806 | 3300031239 | Ga0265328_10060572 | Ga0265328_100605722 | 251 |
| 807 | 3300031240 | Ga0265320_10021757 | Ga0265320_100217572 | 251 |
| 808 | 3300031249 | Ga0265339_10014115 | Ga0265339_100141152 | 251 |
| 809 | 3300031250 | Ga0265331_10002218 | Ga0265331_1000221812 | 251 |
| 810 | 3300031344 | Ga0265316_10161324 | Ga0265316_101613242 | 251 |
| 811 | 3300031595 | Ga0265313_10048632 | Ga0265313_100486323 | 251 |
| 812 | 3300031595 | Ga0265313_10049261 | Ga0265313_100492612 | 251 |
| 813 | 3300031711 | Ga0265314_10000455 | Ga0265314_1000045525 | 251 |
| 814 | 3300031712 | Ga0265342_10010977 | Ga0265342_100109776 | 251 |
| 815 | 3300035092 | Ga0373952_0002199 | Ga0373952_0002199_1246_2118 | 251 |
| 816 | 3300041512 | Ga0451853_1019298 | Ga0451853_1019298_943_1818 | 251 |
| 817 | 3300042006 | Ga0439432_061079 | Ga0439432_061079_195_1019 | 251 |
| 818 | 3300044712 | Ga0453684_0258849 | Ga0453684_0258849_548_1372 | 251 |
| 819 | 3300045836 | Ga0466958_0018276 | Ga0466958_0018276_1695_2522 | 251 |
| 820 | 3300046458 | Ga0495591_052461 | Ga0495591_052461_22_897 | 251 |
| 821 | 3300046616 | Ga0495668_0035307 | Ga0495668_0035307_1708_2568 | 251 |
| 822 | 3300046681 | Ga0495647_0083328 | Ga0495647_0083328_353_1228 | 251 |
| 823 | 3300046683 | Ga0495658_0028301 | Ga0495658_0028301_503_1378 | 251 |
| 824 | 3300047472 | Ga0495686_0000702 | Ga0495686_0000702_20924_21748 | 251 |
| 825 | 3300048911 | Ga0496108_0022008 | Ga0496108_0022008_3141_4016 | 251 |
| 826 | 3300048912 | Ga0496109_0009383 | Ga0496109_0009383_254_1129 | 251 |
| 827 | 3300048913 | Ga0496110_0085587 | Ga0496110_0085587_300_1160 | 251 |
| 828 | 3300049572 | Ga0501036_0189859 | Ga0501036_0189859_536_1396 | 251 |
| 829 | 3300049576 | Ga0501040_0178300 | Ga0501040_0178300_84_944 | 251 |
| 830 | 3300049577 | Ga0501041_0138857 | Ga0501041_0138857_283_1143 | 251 |
| 831 | 3300049577 | Ga0501041_0166089 | Ga0501041_0166089_212_1072 | 251 |
| 832 | 3300049582 | Ga0501048_0091038 | Ga0501048_0091038_946_1806 | 251 |
| 833 | 3300049582 | Ga0501048_0107988 | Ga0501048_0107988_354_1214 | 251 |
| 834 | 3300049588 | Ga0501072_0273859 | Ga0501072_0273859_32_892 | 251 |
| 835 | 3300049591 | Ga0501075_0228713 | Ga0501075_0228713_333_1193 | 251 |
| 836 | 3300049592 | Ga0501076_0074483 | Ga0501076_0074483_341_1201 | 251 |
| 837 | 3300049592 | Ga0501076_0241119 | Ga0501076_0241119_306_1166 | 251 |
| 838 | 3300049593 | Ga0501077_0073378 | Ga0501077_0073378_249_1109 | 251 |
| 839 | 3300049741 | Ga0501079_0040252 | Ga0501079_0040252_1640_2500 | 251 |
| 840 | 3300049743 | Ga0501081_0054646 | Ga0501081_0054646_1069_1929 | 251 |
| 841 | 3300049743 | Ga0501081_0247782 | Ga0501081_0247782_89_949 | 251 |
| 842 | 3300049824 | Ga0501045_0069668 | Ga0501045_0069668_777_1637 | 251 |
| 843 | 3300050490 | nmdc:mga03n38_1014_c1 | nmdc:mga03n38_1014_c1_1287_2147 | 251 |
| 844 | 3300050491 | nmdc:mga00v17_166394_c1 | nmdc:mga00v17_166394_c1_471_1331 | 251 |
| 845 | 3300050492 | nmdc:mga0yw44_43238_c1 | nmdc:mga0yw44_43238_c1_370_1230 | 251 |
| 846 | 3300050494 | nmdc:mga06z11_1371_c1 | nmdc:mga06z11_1371_c1_5927_6787 | 251 |
| 847 | 3300050495 | nmdc:mga04h51_1352_c1 | nmdc:mga04h51_1352_c1_154_1014 | 251 |
| 848 | 3300050507 | nmdc:mga05p37_183426_c1 | nmdc:mga05p37_183426_c1_1423_2283 | 251 |
| 849 | 3300050507 | nmdc:mga05p37_355_c1 | nmdc:mga05p37_355_c1_39990_40862 | 251 |
| 850 | 3300050508 | nmdc:mga09592_1014_c1 | nmdc:mga09592_1014_c1_952_1824 | 251 |
| 851 | 3300050510 | nmdc:mga06r32_235640_c1 | nmdc:mga06r32_235640_c1_473_1333 | 251 |
| 852 | 3300050512 | nmdc:mga0n895_68170_c1 | nmdc:mga0n895_68170_c1_536_1396 | 251 |
| 853 | 3300050513 | nmdc:mga0rr50_140887_c1 | nmdc:mga0rr50_140887_c1_883_1743 | 251 |
| 854 | 3300050515 | nmdc:mga0a205_207992_c1 | nmdc:mga0a205_207992_c1_342_1202 | 251 |
| 855 | 3300054114 | Ga0501084_0237093 | Ga0501084_0237093_588_1448 | 251 |
| 856 | 3300061734 | Ga0530510_0160733 | Ga0530510_0160733_467_1327 | 251 |
| 857 | 3300061734 | Ga0530510_0401196 | Ga0530510_0401196_25_885 | 251 |
| 858 | iso_pu_bacteria | 2643221660 | 2644340520 | 251 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
107
291
0.95
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7ahh-assembly1.cif.gz_B | opua inhibited inward-facing, sbd docked | 0.7365 | 15 | 240 |
| 3tuz-assembly2.cif.gz_F | inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form | 0.7158 | 60 | 245 |
| 7ahh-assembly1.cif.gz_A | opua inhibited inward-facing, sbd docked | 0.714 | 15 | 241 |
| 3tui-assembly2.cif.gz_E | inward facing conformations of the metni methionine abc transporter: cy5 native crystal form | 0.7132 | 60 | 245 |
| 7mc0-assembly1.cif.gz_B | inward facing conformation of the metni methionine abc transporter | 0.7112 | 50 | 236 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57856_64_258_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9095 | 69 | 240 | 1.10.3720.10 |
| af_P75851_53_247_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9074 | 65 | 240 | 1.10.3720.10 |
| af_Q47539_71_268_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9032 | 69 | 244 | 1.10.3720.10 |
| af_P14176_140_330_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8757 | 65 | 240 | 1.10.3720.10 |
| af_Q2FVH1_15_213_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8728 | 65 | 245 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A536U9N4-F1-model_v4 | ABC transporter permease | 0.9465 | 39 | 247 |
GO:0005886
GO:0055085 |
| AF-A0A2S6UQ86-F1-model_v4 | Bicarbonate transport system permease protein CmpB | 0.9393 | 37 | 250 |
GO:0005886
GO:0055085 |
| AF-B1A4J7-F1-model_v4 | Binding-protein-dependent transport-like protein | 0.9305 | 45 | 246 |
GO:0005886
GO:0055085 |
| AF-A0A7I8CNJ3-F1-model_v4 | ABC transporter permease | 0.9291 | 45 | 247 |
GO:0005886
GO:0055085 |
| AF-A0A0A8XG95-F1-model_v4 | Nitrate ABC transporter, permease protein | 0.9275 | 45 | 246 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar