F483721

General Info

Members Datasets Scaffolds Average Seq Length
858 353 857 262

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100004970|Ga0070664_1000049706
Length 292
Sequence LATRLKTIMTSSTFWRGLAAIAVFLILWEIGARSKQWLAPEFFAPFKSLLGAMGFKRDYLPWIGAVPAPSTVLATWASVLGQKGYWQSWYMSFFRVMSGFIAAMIIGIPFGLMLAVSRMTRWVAFPVFEVLRPIPPLAWVPASIIFWPTQELAITFITFLGAFYTIVINVLGGARSIDVRYFQAAQSMGSSRWDIFRRIILPGTLPSIVVGSAVGMGITWEVVVAAEMISGGGASGTIGSGGGLGFFIWNSYVGGSYEQIVVGMISIGIAGFASSELLRWLGRYATPWLKAR

Samples

Sample ID Description Type Environment
1 2643221660 Methylibium sp. Root1272 Isolate Unclassified
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
91 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
92 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
93 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
201 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
202 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
203 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
204 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
205 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
209 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
212 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
213 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
218 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
219 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
220 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
221 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
222 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
223 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
226 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
227 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
235 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
236 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
241 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
243 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
246 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
247 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
248 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
249 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
250 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
251 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
252 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
255 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
256 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
265 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
266 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
267 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
274 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
275 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
276 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
277 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
278 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
279 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
283 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
284 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
285 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
286 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
287 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
288 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
289 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
295 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
306 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
307 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
318 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
319 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
320 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
321 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
322 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
325 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
326 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
327 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
328 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
329 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
330 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
331 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
332 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
333 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
337 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
338 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
339 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
340 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
343 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
344 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
345 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
346 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
349 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
350 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
353 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.88
Metatranscriptomes 0
Isolates 0.12

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.8
Nodule 0
Rhizoplane 3.85
Rhizosphere 93.01
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1015502 3300003792 Bacteria 2214
2 Ga0070658_10071004 3300005327 Bacteria 2852
3 Ga0070676_10070698 3300005328 Bacteria 2094
4 Ga0070683_100015486 3300005329 Bacteria 6701
5 Ga0070683_100119018 3300005329 Bacteria 2494
6 Ga0070690_100000203 3300005330 Bacteria 31114
7 Ga0070690_100285679 3300005330 Bacteria 1178
8 Ga0070670_100004185 3300005331 Bacteria 12074
9 Ga0070670_100005005 3300005331 Bacteria 11150
10 Ga0070670_100014743 3300005331 Bacteria 6710
11 Ga0070670_100094772 3300005331 Bacteria 2567
12 Ga0070670_100264476 3300005331 Bacteria 1500
13 Ga0068869_100002662 3300005334 Bacteria 10793
14 Ga0070666_10002242 3300005335 Bacteria 11684
15 Ga0070666_10027520 3300005335 Bacteria 3724
16 Ga0070666_10032343 3300005335 Bacteria 3455
17 Ga0070680_100039626 3300005336 Bacteria 3811
18 Ga0070680_100155873 3300005336 Bacteria 1918
19 Ga0070680_100431741 3300005336 Bacteria 1124
20 Ga0070682_100017282 3300005337 Bacteria 4204
21 Ga0070682_100018133 3300005337 Bacteria 4109
22 Ga0070682_100021570 3300005337 Unclassified 3804
23 Ga0070682_100070693 3300005337 Bacteria 2232
24 Ga0068868_100000697 3300005338 Bacteria 22578
25 Ga0068868_100001118 3300005338 Bacteria 18377
26 Ga0068868_100097101 3300005338 Bacteria 2380
27 Ga0068868_100158734 3300005338 Bacteria 1866
28 Ga0070660_100068667 3300005339 Bacteria 2763
29 Ga0070660_100290891 3300005339 Bacteria 1338
30 Ga0070689_100004178 3300005340 Bacteria 9730
31 Ga0070689_100018375 3300005340 Bacteria 5148
32 Ga0070689_100079732 3300005340 Bacteria 2569
33 Ga0070689_100245162 3300005340 Bacteria 1477
34 Ga0070691_10000395 3300005341 Bacteria 15848
35 Ga0070687_100000070 3300005343 Bacteria 33041
36 Ga0070687_100081094 3300005343 Unclassified 1770
37 Ga0070661_100021176 3300005344 Bacteria 4640
38 Ga0070692_10001807 3300005345 Bacteria 7998
39 Ga0070668_100081957 3300005347 Bacteria 2530
40 Ga0070668_100174746 3300005347 Bacteria 1751
41 Ga0070669_100059891 3300005353 Bacteria 2796
42 Ga0070669_100168370 3300005353 Bacteria 1707
43 Ga0070675_100124885 3300005354 Bacteria 2189
44 Ga0070675_100124977 3300005354 Bacteria 2188
45 Ga0070675_100292557 3300005354 Bacteria 1433
46 Ga0070675_100393389 3300005354 Bacteria 1235
47 Ga0070671_100006600 3300005355 Bacteria 9276
48 Ga0070671_100014099 3300005355 Bacteria 6453
49 Ga0070671_100051418 3300005355 Bacteria 3427
50 Ga0070674_100090083 3300005356 Bacteria 2212
51 Ga0070674_100237459 3300005356 Bacteria 1425
52 Ga0070674_100401996 3300005356 Bacteria 1119
53 Ga0070673_100003763 3300005364 Bacteria 9513
54 Ga0070673_100003942 3300005364 Bacteria 9326
55 Ga0070673_100011403 3300005364 Bacteria 6063
56 Ga0070673_100023398 3300005364 Bacteria 4513
57 Ga0070688_100027633 3300005365 Bacteria 3380
58 Ga0070688_100031648 3300005365 Bacteria 3184
59 Ga0070688_100263483 3300005365 Bacteria 1232
60 Ga0070659_100084851 3300005366 Bacteria 2533
61 Ga0070659_100174146 3300005366 Bacteria 1764
62 Ga0070667_100023816 3300005367 Bacteria 5083
63 Ga0070667_100040607 3300005367 Bacteria 3901
64 Ga0070667_100059389 3300005367 Bacteria 3235
65 Ga0070667_100171496 3300005367 Bacteria 1915
66 Ga0070703_10012874 3300005406 Bacteria 2371
67 Ga0070703_10020671 3300005406 Bacteria 1918
68 Ga0070703_10058243 3300005406 Bacteria 1257
69 Ga0070709_10002182 3300005434 Bacteria 10602
70 Ga0070709_10002448 3300005434 Bacteria 10058
71 Ga0070709_10004334 3300005434 Bacteria 7646
72 Ga0070714_100007793 3300005435 Bacteria 8342
73 Ga0070714_100033480 3300005435 Bacteria 4295
74 Ga0070714_100259916 3300005435 Bacteria 1608
75 Ga0070713_100000728 3300005436 Bacteria 21169
76 Ga0070713_100000923 3300005436 Bacteria 18738
77 Ga0070713_100010653 3300005436 Bacteria 6654
78 Ga0070710_10003961 3300005437 Bacteria 7020
79 Ga0070710_10007113 3300005437 Bacteria 5407
80 Ga0070710_10018012 3300005437 Bacteria 3627
81 Ga0070710_10041867 3300005437 Bacteria 2530
82 Ga0070710_10202533 3300005437 Bacteria 1254
83 Ga0070701_10000579 3300005438 Bacteria 12750
84 Ga0070711_100001151 3300005439 Bacteria 14210
85 Ga0070711_100013544 3300005439 Bacteria 5121
86 Ga0070711_100033220 3300005439 Bacteria 3435
87 Ga0070711_100176471 3300005439 Bacteria 1632
88 Ga0070711_100187816 3300005439 Bacteria 1586
89 Ga0070705_100000586 3300005440 Bacteria 21191
90 Ga0070705_100017884 3300005440 Bacteria 3707
91 Ga0070705_100165039 3300005440 Bacteria 1485
92 Ga0070700_100005942 3300005441 Bacteria 6486
93 Ga0070700_100106605 3300005441 Bacteria 1855
94 Ga0070700_100227770 3300005441 Bacteria 1325
95 Ga0070700_100244945 3300005441 Bacteria 1283
96 Ga0070694_100000527 3300005444 Bacteria 21062
97 Ga0070694_100011467 3300005444 Bacteria 5490
98 Ga0070708_100032334 3300005445 Bacteria 4537
99 Ga0070708_100038741 3300005445 Bacteria 4166
100 Ga0070678_100011697 3300005456 Bacteria 5426
101 Ga0070678_100070947 3300005456 Bacteria 2606
102 Ga0070678_100099155 3300005456 Bacteria 2254
103 Ga0070678_100250801 3300005456 Bacteria 1484
104 Ga0070662_100047455 3300005457 Bacteria 3089
105 Ga0070662_100130680 3300005457 Bacteria 1936
106 Ga0070662_100251067 3300005457 Bacteria 1422
107 Ga0070681_10009213 3300005458 Bacteria 9703
108 Ga0068867_100000775 3300005459 Bacteria 21581
109 Ga0068867_100010066 3300005459 Bacteria 6664
110 Ga0070685_10002556 3300005466 Bacteria 9320
111 Ga0070685_10009466 3300005466 Bacteria 5037
112 Ga0070706_100043168 3300005467 Bacteria 4165
113 Ga0070706_100059044 3300005467 Bacteria 3540
114 Ga0070706_100087501 3300005467 Bacteria 2888
115 Ga0070707_100036230 3300005468 Bacteria 4707
116 Ga0070707_100156964 3300005468 Bacteria 2217
117 Ga0070698_100010044 3300005471 Bacteria 10109
118 Ga0070698_100113269 3300005471 Bacteria 2677
119 Ga0070698_100258343 3300005471 Bacteria 1674
120 Ga0070698_100259826 3300005471 Bacteria 1669
121 Ga0070699_100032485 3300005518 Bacteria 4507
122 Ga0070699_100065163 3300005518 Bacteria 3161
123 Ga0070699_100097904 3300005518 Bacteria 2570
124 Ga0070699_100285853 3300005518 Bacteria 1478
125 Ga0070679_100001447 3300005530 Bacteria 21006
126 Ga0070697_100005988 3300005536 Bacteria 9403
127 Ga0070697_100064432 3300005536 Bacteria 2993
128 Ga0068853_100036955 3300005539 Bacteria 4154
129 Ga0068853_100135040 3300005539 Bacteria 2211
130 Ga0068853_100139987 3300005539 Bacteria 2172
131 Ga0070672_100010810 3300005543 Bacteria 6344
132 Ga0070672_100018605 3300005543 Bacteria 5027
133 Ga0070672_100030866 3300005543 Bacteria 4030
134 Ga0070672_100092046 3300005543 Bacteria 2447
135 Ga0070686_100000240 3300005544 Bacteria 37313
136 Ga0070686_100002912 3300005544 Bacteria 9391
137 Ga0070686_100018776 3300005544 Bacteria 4064
138 Ga0070695_100000374 3300005545 Bacteria 22964
139 Ga0070695_100006942 3300005545 Bacteria 6707
140 Ga0070696_100046543 3300005546 Bacteria 3008
141 Ga0070696_100057902 3300005546 Bacteria 2705
142 Ga0070696_100070857 3300005546 Bacteria 2453
143 Ga0070693_100000298 3300005547 Bacteria 23135
144 Ga0070693_100031068 3300005547 Bacteria 2925
145 Ga0070693_100102273 3300005547 Bacteria 1748
146 Ga0070693_100148512 3300005547 Bacteria 1482
147 Ga0070665_100054754 3300005548 Bacteria 4000
148 Ga0070665_100149235 3300005548 Bacteria 2341
149 Ga0070665_100192032 3300005548 Bacteria 2043
150 Ga0070704_100000864 3300005549 Bacteria 15175
151 Ga0070704_100002844 3300005549 Bacteria 9810
152 Ga0070704_100167467 3300005549 Bacteria 1744
153 Ga0070704_100291453 3300005549 Bacteria 1356
154 Ga0068855_100001747 3300005563 Bacteria 27121
155 Ga0068855_100163255 3300005563 Bacteria 2527
156 Ga0070664_100004970 3300005564 Bacteria 10652
157 Ga0070664_100009313 3300005564 Bacteria 7969
158 Ga0070664_100178728 3300005564 Bacteria 1885
159 Ga0068857_100011942 3300005577 Bacteria 7552
160 Ga0068857_100017390 3300005577 Bacteria 6300
161 Ga0068857_100284506 3300005577 Bacteria 1521
162 Ga0068857_100311309 3300005577 Bacteria 1453
163 Ga0068857_100371705 3300005577 Bacteria 1326
164 Ga0068854_100009390 3300005578 Bacteria 6316
165 Ga0068854_100013725 3300005578 Bacteria 5325
166 Ga0068856_100002249 3300005614 Bacteria 19936
167 Ga0068856_100005249 3300005614 Bacteria 12779
168 Ga0068856_100114006 3300005614 Bacteria 2702
169 Ga0068856_100128107 3300005614 Bacteria 2542
170 Ga0068856_100180823 3300005614 Bacteria 2122
171 Ga0070702_100000032 3300005615 Bacteria 37311
172 Ga0070702_100003828 3300005615 Bacteria 6807
173 Ga0068852_100002813 3300005616 Bacteria 12058
174 Ga0068852_100328246 3300005616 Bacteria 1488
175 Ga0068859_100000445 3300005617 Bacteria 41359
176 Ga0068859_100384724 3300005617 Bacteria 1498
177 Ga0068859_100397785 3300005617 Bacteria 1473
178 Ga0068859_100474806 3300005617 Bacteria 1346
179 Ga0068859_100585168 3300005617 Bacteria 1210
180 Ga0068864_100002011 3300005618 Bacteria 16757
181 Ga0068864_100024740 3300005618 Bacteria 5052
182 Ga0068864_100025381 3300005618 Bacteria 4990
183 Ga0068864_100058934 3300005618 Bacteria 3320
184 Ga0068864_100235242 3300005618 Bacteria 1695
185 Ga0068866_10000116 3300005718 Bacteria 34637
186 Ga0068866_10028751 3300005718 Bacteria 2652
187 Ga0068866_10049630 3300005718 Bacteria 2128
188 Ga0068861_100000246 3300005719 Bacteria 29867
189 Ga0068861_100018105 3300005719 Bacteria 5010
190 Ga0068851_10074651 3300005834 Bacteria 1761
191 Ga0068851_10121109 3300005834 Bacteria 1406
192 Ga0068870_10061183 3300005840 Bacteria 2023
193 Ga0068863_100005304 3300005841 Bacteria 12729
194 Ga0068863_100033888 3300005841 Bacteria 4865
195 Ga0068863_100090339 3300005841 Bacteria 2904
196 Ga0068858_100002515 3300005842 Bacteria 18480
197 Ga0068858_100017399 3300005842 Bacteria 6743
198 Ga0068858_100018324 3300005842 Bacteria 6556
199 Ga0068858_100040889 3300005842 Bacteria 4300
200 Ga0068858_100178830 3300005842 Bacteria 2002
201 Ga0068860_100001848 3300005843 Bacteria 22537
202 Ga0068860_100042508 3300005843 Bacteria 4339
203 Ga0068860_100050695 3300005843 Bacteria 3951
204 Ga0068860_100183500 3300005843 Bacteria 2022
205 Ga0068860_100305529 3300005843 Bacteria 1559
206 Ga0068862_100000668 3300005844 Bacteria 35204
207 Ga0068862_100039981 3300005844 Bacteria 3985
208 Ga0068862_100130975 3300005844 Bacteria 2218
209 Ga0081455_10015177 3300005937 Bacteria 7496
210 Ga0081538_10024245 3300005981 Bacteria 4327
211 Ga0081540_1010843 3300005983 Bacteria 6125
212 Ga0081540_1028009 3300005983 Bacteria 3176
213 Ga0081539_10073191 3300005985 Bacteria 1829
214 Ga0070717_10001498 3300006028 Bacteria 16148
215 Ga0070717_10035489 3300006028 Bacteria 4036
216 Ga0075365_10060622 3300006038 Bacteria 2525
217 Ga0075365_10256914 3300006038 Bacteria 1228
218 Ga0075368_10004179 3300006042 Bacteria 4862
219 Ga0075363_100010127 3300006048 Bacteria 4459
220 Ga0075363_100030547 3300006048 Bacteria 2789
221 Ga0075364_10038812 3300006051 Bacteria 3085
222 Ga0075364_10063907 3300006051 Bacteria 2416
223 Ga0070715_10002107 3300006163 Bacteria 6015
224 Ga0070715_10004223 3300006163 Bacteria 4685
225 Ga0070715_10007541 3300006163 Bacteria 3751
226 Ga0070716_100016547 3300006173 Bacteria 3809
227 Ga0070716_100028363 3300006173 Bacteria 3016
228 Ga0070716_100151267 3300006173 Bacteria 1493
229 Ga0070712_100000583 3300006175 Bacteria 21284
230 Ga0070712_100020847 3300006175 Bacteria 4295
231 Ga0070712_100022345 3300006175 Bacteria 4167
232 Ga0070712_100309581 3300006175 Bacteria 1281
233 Ga0075362_10021946 3300006177 Bacteria 2686
234 Ga0075367_10004347 3300006178 Bacteria 6902
235 Ga0075367_10005237 3300006178 Bacteria 6411
236 Ga0075367_10021955 3300006178 Bacteria 3573
237 Ga0097621_100001462 3300006237 Bacteria 16168
238 Ga0097621_100005520 3300006237 Bacteria 8907
239 Ga0097621_100006628 3300006237 Bacteria 8228
240 Ga0097621_100120740 3300006237 Bacteria 2222
241 Ga0068871_100000271 3300006358 Bacteria 35626
242 Ga0068871_100008291 3300006358 Bacteria 7467
243 Ga0068871_100008770 3300006358 Bacteria 7281
244 Ga0068871_100010111 3300006358 Bacteria 6865
245 Ga0075428_100033779 3300006844 Bacteria 5644
246 Ga0075428_100169633 3300006844 Bacteria 2366
247 Ga0075428_100191665 3300006844 Bacteria 2211
248 Ga0075430_100101350 3300006846 Bacteria 2404
249 Ga0075430_100351607 3300006846 Bacteria 1217
250 Ga0075431_100025020 3300006847 Bacteria 6120
251 Ga0075431_100217743 3300006847 Bacteria 1948
252 Ga0075431_100505993 3300006847 Bacteria 1198
253 Ga0075431_100681312 3300006847 Bacteria 1007
254 Ga0075434_100032733 3300006871 Bacteria 5127
255 Ga0075434_100037726 3300006871 Bacteria 4784
256 Ga0075434_100173991 3300006871 Bacteria 2172
257 Ga0075434_100311482 3300006871 Bacteria 1594
258 Ga0075434_100495421 3300006871 Bacteria 1243
259 Ga0075429_100001221 3300006880 Bacteria 20864
260 Ga0075429_100219011 3300006880 Bacteria 1668
261 Ga0068865_100000421 3300006881 Bacteria 23671
262 Ga0068865_100032427 3300006881 Bacteria 3489
263 Ga0068865_100070194 3300006881 Bacteria 2481
264 Ga0068865_100111768 3300006881 Bacteria 2016
265 Ga0068865_100229031 3300006881 Bacteria 1457
266 Ga0075436_100000576 3300006914 Bacteria 24015
267 Ga0075436_100009986 3300006914 Bacteria 6495
268 Ga0075436_100012193 3300006914 Bacteria 5889
269 Ga0075436_100078353 3300006914 Bacteria 2289
270 Ga0097620_100000445 3300006931 Bacteria 41359
271 Ga0097620_100384737 3300006931 Bacteria 1498
272 Ga0097620_100397801 3300006931 Bacteria 1473
273 Ga0097620_100474748 3300006931 Bacteria 1346
274 Ga0097620_100585197 3300006931 Bacteria 1210
275 Ga0075435_100017108 3300007076 Bacteria 5479
276 Ga0075435_100026846 3300007076 Bacteria 4497
277 Ga0075435_100031243 3300007076 Bacteria 4193
278 Ga0075435_100062865 3300007076 Bacteria 3014
279 Ga0075435_100269344 3300007076 Bacteria 1452
280 Ga0105251_10027231 3300009011 Bacteria 2901
281 Ga0105250_10100585 3300009092 Bacteria 1179
282 Ga0105240_10050363 3300009093 Bacteria 5251
283 Ga0111539_10126181 3300009094 Bacteria 2998
284 Ga0111539_10305410 3300009094 Bacteria 1852
285 Ga0111539_10349487 3300009094 Bacteria 1721
286 Ga0105245_10000464 3300009098 Bacteria 37217
287 Ga0105245_10124373 3300009098 Bacteria 2412
288 Ga0105245_10231708 3300009098 Bacteria 1786
289 Ga0105247_10158256 3300009101 Bacteria 1498
290 Ga0114129_10047869 3300009147 Bacteria 6006
291 Ga0114129_10110457 3300009147 Bacteria 3795
292 Ga0114129_10179967 3300009147 Bacteria 2878
293 Ga0105243_10000963 3300009148 Bacteria 26916
294 Ga0105243_10013045 3300009148 Bacteria 6278
295 Ga0105243_10060899 3300009148 Bacteria 3016
296 Ga0105243_10201041 3300009148 Bacteria 1747
297 Ga0105243_10318433 3300009148 Bacteria 1416
298 Ga0105241_10012298 3300009174 Bacteria 6277
299 Ga0105241_10034371 3300009174 Bacteria 3808
300 Ga0105242_10000689 3300009176 Bacteria 26484
301 Ga0105242_10010686 3300009176 Bacteria 7047
302 Ga0105242_10028524 3300009176 Bacteria 4446
303 Ga0105242_10123212 3300009176 Bacteria 2228
304 Ga0105248_10029119 3300009177 Bacteria 6157
305 Ga0105248_10119211 3300009177 Bacteria 2976
306 Ga0105248_10224378 3300009177 Bacteria 2115
307 Ga0105248_10285797 3300009177 Bacteria 1857
308 Ga0105237_10016674 3300009545 Bacteria 7629
309 Ga0105237_10559730 3300009545 Bacteria 1150
310 Ga0105238_10038648 3300009551 Bacteria 4845
311 Ga0105238_10050721 3300009551 Bacteria 4176
312 Ga0105249_10051274 3300009553 Bacteria 3763
313 Ga0105249_10144737 3300009553 Bacteria 2282
314 Ga0105249_10272310 3300009553 Bacteria 1687
315 Ga0105249_10364176 3300009553 Bacteria 1468
316 Ga0105249_10971621 3300009553 Bacteria 918
317 Ga0105239_10098006 3300010375 Bacteria 3240
318 Ga0105239_10330369 3300010375 Bacteria 1720
319 Ga0105246_10226213 3300011119 Archaea 1470
320 Ga0157373_10256476 3300013100 Bacteria 1237
321 Ga0157370_10035367 3300013104 Bacteria 4856
322 Ga0157370_10298162 3300013104 Bacteria 1488
323 Ga0157369_10001331 3300013105 Bacteria 30563
324 Ga0157374_10041491 3300013296 Bacteria 4241
325 Ga0157374_10167755 3300013296 Bacteria 2140
326 Ga0157374_10214238 3300013296 Bacteria 1889
327 Ga0157374_10282222 3300013296 Bacteria 1640
328 Ga0157374_10458998 3300013296 Bacteria 1276
329 Ga0157378_10000816 3300013297 Bacteria 28980
330 Ga0157378_10020683 3300013297 Bacteria 5788
331 Ga0163162_10021862 3300013306 Bacteria 6303
332 Ga0163162_10024952 3300013306 Bacteria 5906
333 Ga0163162_10092410 3300013306 Bacteria 3109
334 Ga0157372_10002054 3300013307 Bacteria 21896
335 Ga0157372_10053532 3300013307 Bacteria 4499
336 Ga0157375_10054080 3300013308 Bacteria 3953
337 Ga0157375_10227796 3300013308 Bacteria 2023
338 Ga0157375_10329409 3300013308 Bacteria 1692
339 Ga0163163_10150523 3300014325 Bacteria 2371
340 Ga0163163_10159503 3300014325 Bacteria 2301
341 Ga0163163_10563459 3300014325 Bacteria 1202
342 Ga0157380_10054837 3300014326 Bacteria 3165
343 Ga0157380_10299203 3300014326 Bacteria 1481
344 Ga0157380_10542118 3300014326 Bacteria 1139
345 Ga0157379_10039794 3300014968 Bacteria 4195
346 Ga0157379_10064941 3300014968 Bacteria 3262
347 Ga0157379_10082960 3300014968 Bacteria 2872
348 Ga0157379_10143967 3300014968 Bacteria 2149
349 Ga0157379_10414388 3300014968 Bacteria 1240
350 Ga0157376_10003015 3300014969 Bacteria 11553
351 Ga0157376_10025415 3300014969 Bacteria 4664
352 Ga0157376_10053312 3300014969 Bacteria 3367
353 Ga0157376_10070584 3300014969 Bacteria 2965
354 Ga0163161_10071785 3300017792 Bacteria 2534
355 Ga0163161_10161789 3300017792 Bacteria 1707
356 Ga0209051_1000843 3300025303 Bacteria 31536
357 Ga0207653_10003327 3300025885 Bacteria 5077
358 Ga0207682_10005564 3300025893 Bacteria 5126
359 Ga0207682_10044778 3300025893 Bacteria 1815
360 Ga0207692_10000698 3300025898 Bacteria 11799
361 Ga0207692_10008507 3300025898 Bacteria 4248
362 Ga0207692_10028808 3300025898 Bacteria 2632
363 Ga0207692_10030650 3300025898 Bacteria 2567
364 Ga0207692_10177135 3300025898 Bacteria 1240
365 Ga0207642_10000116 3300025899 Bacteria 21558
366 Ga0207642_10041146 3300025899 Bacteria 2021
367 Ga0207710_10074631 3300025900 Bacteria 1562
368 Ga0207688_10004733 3300025901 Bacteria 7413
369 Ga0207688_10042004 3300025901 Bacteria 2545
370 Ga0207688_10055087 3300025901 Bacteria 2231
371 Ga0207680_10006540 3300025903 Bacteria 5646
372 Ga0207680_10014768 3300025903 Bacteria 4055
373 Ga0207685_10000567 3300025905 Bacteria 6423
374 Ga0207685_10003068 3300025905 Bacteria 3983
375 Ga0207699_10000822 3300025906 Bacteria 14781
376 Ga0207699_10001488 3300025906 Bacteria 11131
377 Ga0207699_10002688 3300025906 Bacteria 8403
378 Ga0207645_10025955 3300025907 Bacteria 3789
379 Ga0207645_10029738 3300025907 Bacteria 3521
380 Ga0207645_10213644 3300025907 Bacteria 1271
381 Ga0207643_10008782 3300025908 Bacteria 5420
382 Ga0207643_10323391 3300025908 Bacteria 964
383 Ga0207684_10025646 3300025910 Bacteria 5023
384 Ga0207684_10027322 3300025910 Bacteria 4864
385 Ga0207684_10169254 3300025910 Bacteria 1883
386 Ga0207684_10195268 3300025910 Bacteria 1746
387 Ga0207684_10409375 3300025910 Bacteria 1166
388 Ga0207707_10152267 3300025912 Bacteria 2022
389 Ga0207707_10186611 3300025912 Bacteria 1810
390 Ga0207671_10047151 3300025914 Bacteria 3189
391 Ga0207671_10110886 3300025914 Bacteria 2087
392 Ga0207693_10001134 3300025915 Bacteria 23870
393 Ga0207693_10013884 3300025915 Bacteria 6486
394 Ga0207693_10021730 3300025915 Bacteria 5101
395 Ga0207693_10026285 3300025915 Bacteria 4607
396 Ga0207693_10149563 3300025915 Bacteria 1836
397 Ga0207663_10002244 3300025916 Bacteria 9244
398 Ga0207663_10179120 3300025916 Bacteria 1512
399 Ga0207663_10185393 3300025916 Bacteria 1489
400 Ga0207660_10002745 3300025917 Bacteria 11530
401 Ga0207660_10073078 3300025917 Bacteria 2499
402 Ga0207662_10000088 3300025918 Bacteria 43438
403 Ga0207662_10134869 3300025918 Bacteria 1560
404 Ga0207657_10114009 3300025919 Bacteria 2230
405 Ga0207649_10004361 3300025920 Bacteria 7678
406 Ga0207652_10003045 3300025921 Bacteria 13979
407 Ga0207652_10337676 3300025921 Unclassified 1360
408 Ga0207646_10067088 3300025922 Bacteria 3203
409 Ga0207681_10037558 3300025923 Bacteria 3202
410 Ga0207694_10003253 3300025924 Bacteria 12938
411 Ga0207694_10039906 3300025924 Bacteria 3614
412 Ga0207694_10065189 3300025924 Bacteria 2840
413 Ga0207650_10005227 3300025925 Bacteria 8851
414 Ga0207650_10022869 3300025925 Bacteria 4429
415 Ga0207650_10065243 3300025925 Bacteria 2727
416 Ga0207650_10113728 3300025925 Bacteria 2099
417 Ga0207650_10135870 3300025925 Bacteria 1928
418 Ga0207650_10159716 3300025925 Bacteria 1785
419 Ga0207659_10006995 3300025926 Bacteria 6926
420 Ga0207659_10017851 3300025926 Bacteria 4643
421 Ga0207659_10197430 3300025926 Bacteria 1605
422 Ga0207687_10000349 3300025927 Bacteria 30723
423 Ga0207687_10018771 3300025927 Bacteria 4571
424 Ga0207700_10000698 3300025928 Bacteria 19482
425 Ga0207700_10001949 3300025928 Bacteria 11741
426 Ga0207700_10108800 3300025928 Bacteria 2226
427 Ga0207664_10001209 3300025929 Bacteria 17138
428 Ga0207664_10002965 3300025929 Bacteria 11271
429 Ga0207664_10072520 3300025929 Bacteria 2776
430 Ga0207664_10074370 3300025929 Bacteria 2745
431 Ga0207664_10362367 3300025929 Bacteria 1284
432 Ga0207644_10003123 3300025931 Bacteria 10662
433 Ga0207644_10008637 3300025931 Bacteria 6664
434 Ga0207644_10132743 3300025931 Bacteria 1908
435 Ga0207644_10188769 3300025931 Bacteria 1619
436 Ga0207690_10052966 3300025932 Bacteria 2721
437 Ga0207690_10077234 3300025932 Unclassified 2314
438 Ga0207706_10021136 3300025933 Bacteria 5848
439 Ga0207706_10033477 3300025933 Bacteria 4574
440 Ga0207686_10001742 3300025934 Bacteria 12095
441 Ga0207686_10024813 3300025934 Bacteria 3479
442 Ga0207686_10030369 3300025934 Bacteria 3198
443 Ga0207686_10066308 3300025934 Bacteria 2305
444 Ga0207709_10001642 3300025935 Bacteria 15151
445 Ga0207709_10059711 3300025935 Bacteria 2375
446 Ga0207709_10125327 3300025935 Unclassified 1741
447 Ga0207670_10028340 3300025936 Bacteria 3554
448 Ga0207670_10047961 3300025936 Bacteria 2847
449 Ga0207670_10050624 3300025936 Bacteria 2785
450 Ga0207670_10210691 3300025936 Bacteria 1482
451 Ga0207669_10116448 3300025937 Bacteria 1804
452 Ga0207669_10268270 3300025937 Unclassified 1280
453 Ga0207704_10007405 3300025938 Bacteria 5183
454 Ga0207704_10032287 3300025938 Bacteria 2961
455 Ga0207704_10048652 3300025938 Bacteria 2544
456 Ga0207665_10000223 3300025939 Bacteria 38647
457 Ga0207665_10001570 3300025939 Bacteria 15409
458 Ga0207665_10002070 3300025939 Bacteria 13532
459 Ga0207691_10002229 3300025940 Bacteria 18967
460 Ga0207691_10023242 3300025940 Bacteria 5836
461 Ga0207691_10049499 3300025940 Bacteria 3850
462 Ga0207691_10151495 3300025940 Bacteria 2039
463 Ga0207691_10271889 3300025940 Bacteria 1459
464 Ga0207711_10013945 3300025941 Bacteria 6673
465 Ga0207711_10021061 3300025941 Bacteria 5445
466 Ga0207711_10021522 3300025941 Bacteria 5388
467 Ga0207711_10157291 3300025941 Bacteria 2055
468 Ga0207711_10400333 3300025941 Bacteria 1275
469 Ga0207689_10000079 3300025942 Bacteria 78891
470 Ga0207689_10031906 3300025942 Bacteria 4381
471 Ga0207689_10045851 3300025942 Bacteria 3614
472 Ga0207661_10014893 3300025944 Bacteria 5706
473 Ga0207661_10094204 3300025944 Bacteria 2501
474 Ga0207679_10004969 3300025945 Bacteria 8299
475 Ga0207679_10005906 3300025945 Bacteria 7698
476 Ga0207667_10003261 3300025949 Bacteria 20028
477 Ga0207667_10055873 3300025949 Bacteria 4148
478 Ga0207667_10493159 3300025949 Unclassified 1243
479 Ga0207651_10021675 3300025960 Bacteria 3910
480 Ga0207651_10093894 3300025960 Bacteria 2204
481 Ga0207651_10251025 3300025960 Bacteria 1447
482 Ga0207712_10086944 3300025961 Bacteria 2291
483 Ga0207668_10048878 3300025972 Bacteria 2905
484 Ga0207668_10147306 3300025972 Bacteria 1818
485 Ga0207668_10278751 3300025972 Bacteria 1370
486 Ga0207640_10001480 3300025981 Bacteria 12669
487 Ga0207658_10052827 3300025986 Bacteria 3000
488 Ga0207658_10053591 3300025986 Bacteria 2981
489 Ga0207658_10107073 3300025986 Bacteria 2202
490 Ga0207658_10175512 3300025986 Bacteria 1769
491 Ga0207677_10092023 3300026023 Bacteria 2207
492 Ga0207677_10408641 3300026023 Bacteria 1153
493 Ga0207703_10005469 3300026035 Bacteria 10211
494 Ga0207703_10013825 3300026035 Bacteria 6290
495 Ga0207703_10029632 3300026035 Bacteria 4320
496 Ga0207639_10052452 3300026041 Unclassified 3108
497 Ga0207639_10154562 3300026041 Bacteria 1926
498 Ga0207639_10305578 3300026041 Bacteria 1407
499 Ga0207678_10007013 3300026067 Bacteria 10002
500 Ga0207678_10065925 3300026067 Bacteria 3109
501 Ga0207708_10000326 3300026075 Bacteria 37674
502 Ga0207708_10005792 3300026075 Bacteria 9136
503 Ga0207702_10005592 3300026078 Bacteria 10973
504 Ga0207702_10008239 3300026078 Bacteria 8811
505 Ga0207641_10003133 3300026088 Bacteria 14858
506 Ga0207641_10021698 3300026088 Bacteria 5277
507 Ga0207641_10076106 3300026088 Bacteria 2900
508 Ga0207641_10593720 3300026088 Bacteria 1083
509 Ga0207648_10000071 3300026089 Bacteria 95176
510 Ga0207648_10041704 3300026089 Bacteria 4031
511 Ga0207648_10131467 3300026089 Bacteria 2203
512 Ga0207648_10256514 3300026089 Bacteria 1559
513 Ga0207648_10344928 3300026089 Bacteria 1342
514 Ga0207676_10002203 3300026095 Bacteria 14060
515 Ga0207676_10016808 3300026095 Bacteria 5297
516 Ga0207676_10037914 3300026095 Bacteria 3677
517 Ga0207674_10038326 3300026116 Bacteria 4976
518 Ga0207674_10099214 3300026116 Bacteria 2895
519 Ga0207675_100000040 3300026118 Bacteria 91299
520 Ga0207675_100019931 3300026118 Bacteria 6260
521 Ga0207675_100395210 3300026118 Bacteria 1361
522 Ga0207683_10005345 3300026121 Bacteria 11016
523 Ga0207683_10010098 3300026121 Bacteria 8055
524 Ga0207683_10012990 3300026121 Bacteria 7108
525 Ga0207683_10157578 3300026121 Bacteria 2051
526 Ga0207698_10012247 3300026142 Bacteria 5604
527 Ga0207698_10109793 3300026142 Bacteria 2309
528 Ga0209996_1004442 3300027395 Bacteria 1778
529 Ga0209968_1000985 3300027526 Bacteria 4381
530 Ga0209966_1000011 3300027695 Bacteria 83449
531 Ga0209813_10000439 3300027866 Bacteria 10134
532 Ga0209813_10006227 3300027866 Bacteria 2939
533 Ga0207428_10071999 3300027907 Bacteria 2714
534 Ga0207428_10230542 3300027907 Bacteria 1386
535 Ga0268266_10005657 3300028379 Bacteria 11593
536 Ga0268266_10029298 3300028379 Bacteria 4680
537 Ga0268265_10002113 3300028380 Bacteria 15414
538 Ga0268265_10274614 3300028380 Bacteria 1505
539 Ga0268264_10000527 3300028381 Bacteria 48430
540 Ga0268264_10090588 3300028381 Bacteria 2636
541 Ga0268264_10106633 3300028381 Bacteria 2446
542 Ga0268264_10263090 3300028381 Bacteria 1608
543 Ga0268264_10730789 3300028381 Bacteria 985
544 Ga0265334_10013031 3300028573 Bacteria 3487
545 Ga0265318_10000392 3300028577 Bacteria 34150
546 Ga0265318_10001252 3300028577 Bacteria 15378
547 Ga0265318_10019415 3300028577 Bacteria 2757
548 Ga0265338_10025744 3300028800 Bacteria 5960
549 Ga0265338_10116388 3300028800 Bacteria 2141
550 Ga0265330_10000900 3300031235 Bacteria 18381
551 Ga0265330_10001096 3300031235 Bacteria 16300
552 Ga0265332_10000362 3300031238 Bacteria 33750
553 Ga0265332_10000671 3300031238 Bacteria 22075
554 Ga0265332_10021677 3300031238 Bacteria 2837
555 Ga0265328_10001141 3300031239 Bacteria 12239
556 Ga0265328_10060572 3300031239 Unclassified 1389
557 Ga0265320_10000221 3300031240 Bacteria 46329
558 Ga0265320_10002328 3300031240 Bacteria 13334
559 Ga0265320_10008165 3300031240 Bacteria 6428
560 Ga0265320_10021757 3300031240 Bacteria 3444
561 Ga0265325_10000004 3300031241 Bacteria 347347
562 Ga0265329_10000367 3300031242 Bacteria 23949
563 Ga0265339_10014115 3300031249 Bacteria 4822
564 Ga0265331_10000378 3300031250 Bacteria 46319
565 Ga0265331_10001846 3300031250 Bacteria 14983
566 Ga0265331_10002218 3300031250 Bacteria 13324
567 Ga0265316_10002329 3300031344 Bacteria 19856
568 Ga0265316_10030450 3300031344 Bacteria 4423
569 Ga0265316_10161324 3300031344 Bacteria 1676
570 Ga0307408_100034887 3300031548 Bacteria 3527
571 Ga0265313_10000196 3300031595 Bacteria 64798
572 Ga0265313_10011134 3300031595 Bacteria 5610
573 Ga0265313_10048632 3300031595 Bacteria 2045
574 Ga0265313_10049261 3300031595 Bacteria 2028
575 Ga0265314_10000455 3300031711 Bacteria 54619
576 Ga0265314_10000555 3300031711 Bacteria 47583
577 Ga0265314_10016082 3300031711 Bacteria 5923
578 Ga0265314_10151558 3300031711 Bacteria 1421
579 Ga0265342_10000058 3300031712 Bacteria 118791
580 Ga0265342_10002058 3300031712 Bacteria 17860
581 Ga0265342_10005768 3300031712 Bacteria 9360
582 Ga0265342_10010977 3300031712 Bacteria 6225
583 Ga0307416_100079727 3300032002 Bacteria 2761
584 Ga0307415_100341247 3300032126 Bacteria 1257
585 Ga0307415_100575368 3300032126 Bacteria 998
586 Ga0373938_0022516 3300034957 Archaea 1288
587 Ga0373926_0000062 3300035083 Bacteria 19600
588 Ga0373928_0001281 3300035084 Bacteria 4948
589 Ga0373940_0013954 3300035088 Bacteria 1953
590 Ga0373940_0024817 3300035088 Bacteria 1557
591 Ga0373944_0002899 3300035089 Bacteria 4399
592 Ga0373944_0031160 3300035089 Bacteria 1603
593 Ga0373949_0002553 3300035090 Bacteria 4630
594 Ga0373951_0046185 3300035091 Bacteria 1061
595 Ga0373952_0002199 3300035092 Bacteria 3512
596 Ga0373923_0120124 3300035111 Unclassified 1174
597 Ga0373936_0000882 3300035113 Bacteria 10713
598 Ga0373939_0013091 3300035114 Bacteria 2127
599 Ga0373941_0004067 3300035115 Bacteria 3354
600 Ga0373945_0000333 3300035116 Bacteria 13441
601 Ga0373945_0010944 3300035116 Bacteria 2992
602 Ga0373945_0148515 3300035116 Unclassified 949
603 Ga0373943_0007142 3300035170 Bacteria 5010
604 Ga0373943_0009126 3300035170 Unclassified 4446
605 Ga0373943_0011856 3300035170 Bacteria 3922
606 Ga0373943_0046676 3300035170 Bacteria 2115
607 Ga0373946_0000768 3300035171 Bacteria 10925
608 Ga0373946_0010572 3300035171 Bacteria 3419
609 Ga0373946_0021725 3300035171 Unclassified 2491
610 Ga0373942_0022075 3300035207 Bacteria 1612
611 Ga0373962_0011926 3300035242 Bacteria 2185
612 Ga0316574_0123080 3300035398 Bacteria 1666
613 Ga0373924_0051051 3300035410 Unclassified 1714
614 Ga0373931_0010262 3300035691 Bacteria 4499
615 Ga0373931_0106700 3300035691 Bacteria 1583
616 Ga0373935_0008836 3300035692 Bacteria 6032
617 Ga0373935_0260617 3300035692 Bacteria 1216
618 Ga0373927_0000912 3300035695 Bacteria 22465
619 Ga0373927_0017863 3300035695 Bacteria 4664
620 Ga0373927_0037618 3300035695 Bacteria 3144
621 Ga0373927_0041185 3300035695 Bacteria 2996
622 Ga0373947_0003408 3300035725 Bacteria 9408
623 Ga0373947_0009374 3300035725 Bacteria 5623
624 Ga0373947_0010706 3300035725 Bacteria 5265
625 Ga0373947_0162057 3300035725 Bacteria 1447
626 Ga0373947_0357662 3300035725 Bacteria 980
627 Ga0373937_0146975 3300036401 Bacteria 2207
628 Ga0373925_0003003 3300037068 Bacteria 13268
629 Ga0373925_0006268 3300037068 Bacteria 8768
630 Ga0373925_0017846 3300037068 Bacteria 5150
631 Ga0373925_0024972 3300037068 Bacteria 4364
632 Ga0373925_0055489 3300037068 Bacteria 2966
633 Ga0373925_0191401 3300037068 Bacteria 1623
634 Ga0436360_0438289 3300039438 Bacteria 8975
635 Ga0436362_0386476 3300039453 Bacteria 2374
636 Ga0451853_1019298 3300041512 Bacteria 1855
637 Ga0439441_000085 3300042001 Bacteria 7319
638 Ga0439443_000239 3300042003 Bacteria 4281
639 Ga0439432_061079 3300042006 Bacteria 1162
640 Ga0439451_006053 3300042009 Bacteria 2472
641 Ga0439435_0000004 3300042436 Bacteria 26852
642 Ga0439444_0012156 3300042437 Bacteria 1406
643 Ga0439460_0000794 3300042461 Bacteria 7152
644 Ga0453684_0258849 3300044712 Bacteria 1994
645 Ga0451576_0003049 3300045051 Bacteria 23602
646 Ga0451576_0121961 3300045051 Bacteria 2714
647 Ga0451576_0206182 3300045051 Bacteria 2053
648 Ga0466958_0018276 3300045836 Bacteria 4067
649 Ga0466967_0340268 3300045976 Bacteria 1451
650 Ga0495592_0136006 3300046454 Unclassified 1714
651 Ga0495603_0003334 3300046455 Bacteria 9565
652 Ga0495603_0006586 3300046455 Bacteria 6966
653 Ga0495603_0015201 3300046455 Bacteria 4657
654 Ga0495603_0016798 3300046455 Bacteria 4428
655 Ga0495591_052461 3300046458 Bacteria 1109
656 Ga0495629_0003983 3300046459 Bacteria 11105
657 Ga0495629_0022638 3300046459 Bacteria 4479
658 Ga0495629_0041822 3300046459 Bacteria 3222
659 Ga0495641_0020474 3300046461 Bacteria 3354
660 Ga0495641_0038866 3300046461 Bacteria 2222
661 Ga0495641_0062461 3300046461 Bacteria 1680
662 Ga0495641_0064667 3300046461 Unclassified 1647
663 Ga0495580_0004546 3300046472 Bacteria 11650
664 Ga0495580_0041816 3300046472 Bacteria 3267
665 Ga0495580_0159070 3300046472 Unclassified 1564
666 Ga0495582_0001069 3300046473 Bacteria 15376
667 Ga0495582_0008317 3300046473 Bacteria 5727
668 Ga0495582_0013701 3300046473 Bacteria 4464
669 Ga0495582_0065952 3300046473 Bacteria 2000
670 Ga0495639_0006547 3300046475 Bacteria 5010
671 Ga0495639_0019886 3300046475 Bacteria 2932
672 Ga0495594_0003710 3300046499 Bacteria 7838
673 Ga0495618_0014907 3300046514 Bacteria 4741
674 Ga0495618_0040372 3300046514 Bacteria 2937
675 Ga0495630_0032264 3300046517 Bacteria 3902
676 Ga0495666_0007272 3300046526 Bacteria 5555
677 Ga0495652_0013021 3300046529 Bacteria 7497
678 Ga0495665_0045900 3300046531 Unclassified 2321
679 Ga0495640_0021596 3300046533 Bacteria 4720
680 Ga0495640_0051067 3300046533 Bacteria 2844
681 Ga0495586_0001686 3300046535 Bacteria 12121
682 Ga0495621_0005832 3300046539 Bacteria 3563
683 Ga0495621_0040636 3300046539 Bacteria 1631
684 Ga0495668_0035307 3300046616 Bacteria 2803
685 Ga0495634_0015705 3300046642 Bacteria 5429
686 Ga0495634_0440580 3300046642 Unclassified 770
687 Ga0495635_0132523 3300046663 Unclassified 1699
688 Ga0495588_0025171 3300046674 Bacteria 2963
689 Ga0495588_0113067 3300046674 Bacteria 1430
690 Ga0495647_0000076 3300046681 Bacteria 23834
691 Ga0495647_0004324 3300046681 Bacteria 4604
692 Ga0495647_0013460 3300046681 Bacteria 2834
693 Ga0495647_0083328 3300046681 Bacteria 1300
694 Ga0495658_0001192 3300046683 Bacteria 13702
695 Ga0495658_0004279 3300046683 Bacteria 7027
696 Ga0495658_0005839 3300046683 Bacteria 6043
697 Ga0495658_0028301 3300046683 Bacteria 3024
698 Ga0495613_0004531 3300046689 Bacteria 10419
699 Ga0495613_0010219 3300046689 Bacteria 6973
700 Ga0495613_0013849 3300046689 Bacteria 5983
701 Ga0495624_0022443 3300046690 Bacteria 4172
702 Ga0495600_0087950 3300046809 Unclassified 2027
703 Ga0495581_0006657 3300047315 Bacteria 6696
704 Ga0495581_0228735 3300047315 Bacteria 1088
705 Ga0495674_0018069 3300047319 Bacteria 6564
706 Ga0495676_0019750 3300047321 Bacteria 5924
707 Ga0495676_0046166 3300047321 Bacteria 3538
708 Ga0495676_0088122 3300047321 Bacteria 2329
709 Ga0495676_0155299 3300047321 Unclassified 1624
710 Ga0495680_0008064 3300047322 Bacteria 9601
711 Ga0495680_0137622 3300047322 Bacteria 1789
712 Ga0495684_0025601 3300047471 Bacteria 4533
713 Ga0495686_0000702 3300047472 Bacteria 45195
714 Ga0495593_0029417 3300047673 Bacteria 3012
715 Ga0495593_0037677 3300047673 Unclassified 2614
716 Ga0495614_0037593 3300048089 Bacteria 2077
717 Ga0495614_0093128 3300048089 Bacteria 1312
718 Ga0496100_0114658 3300048903 Bacteria 1877
719 Ga0496100_0450729 3300048903 Bacteria 986
720 Ga0496101_0013743 3300048904 Bacteria 5430
721 Ga0496102_0065442 3300048905 Bacteria 3332
722 Ga0496104_0000951 3300048907 Bacteria 24933
723 Ga0496104_0091895 3300048907 Bacteria 2902
724 Ga0496104_0186029 3300048907 Bacteria 1987
725 Ga0496104_0223878 3300048907 Bacteria 1793
726 Ga0496104_0294806 3300048907 Bacteria 1534
727 Ga0496105_0034626 3300048908 Bacteria 4154
728 Ga0496105_0043687 3300048908 Bacteria 3696
729 Ga0496105_0327098 3300048908 Bacteria 1227
730 Ga0496107_0030058 3300048910 Bacteria 3870
731 Ga0496107_0266625 3300048910 Unclassified 1274
732 Ga0496108_0011350 3300048911 Bacteria 7241
733 Ga0496108_0022008 3300048911 Bacteria 5240
734 Ga0496108_0222672 3300048911 Bacteria 1639
735 Ga0496109_0009383 3300048912 Bacteria 8337
736 Ga0496109_0083508 3300048912 Bacteria 2946
737 Ga0496109_0144682 3300048912 Bacteria 2223
738 Ga0496109_0597036 3300048912 Bacteria 1040
739 Ga0496110_0085587 3300048913 Bacteria 2813
740 Ga0496110_0236915 3300048913 Unclassified 1660
741 Ga0496111_0033731 3300048914 Bacteria 3652
742 Ga0496112_0060211 3300048915 Bacteria 3741
743 Ga0496112_0403040 3300048915 Bacteria 1307
744 Ga0496113_0241084 3300048916 Bacteria 1443
745 Ga0496114_0005459 3300048917 Bacteria 9945
746 Ga0496114_0106279 3300048917 Bacteria 2401
747 Ga0496114_0437062 3300048917 Bacteria 1159
748 Ga0496115_0028148 3300048918 Bacteria 4402
749 Ga0496115_0040660 3300048918 Bacteria 3697
750 Ga0496115_0053463 3300048918 Bacteria 3241
751 Ga0496121_0022269 3300048924 Bacteria 6162
752 Ga0501299_056013 3300049522 Bacteria 825
753 Ga0501031_0192950 3300049568 Bacteria 1330
754 Ga0501033_0127879 3300049570 Bacteria 1842
755 Ga0501036_0026934 3300049572 Bacteria 4858
756 Ga0501036_0189859 3300049572 Bacteria 1729
757 Ga0501038_0085860 3300049574 Bacteria 2645
758 Ga0501039_0046400 3300049575 Bacteria 3356
759 Ga0501039_0049162 3300049575 Bacteria 3260
760 Ga0501040_0110699 3300049576 Bacteria 1920
761 Ga0501040_0178300 3300049576 Bacteria 1506
762 Ga0501040_0272034 3300049576 Bacteria 1209
763 Ga0501041_0002402 3300049577 Bacteria 10604
764 Ga0501041_0026329 3300049577 Bacteria 3498
765 Ga0501041_0138857 3300049577 Bacteria 1515
766 Ga0501041_0166089 3300049577 Bacteria 1381
767 Ga0501041_0337078 3300049577 Bacteria 952
768 Ga0501042_0014537 3300049578 Bacteria 5375
769 Ga0501042_0179047 3300049578 Bacteria 1529
770 Ga0501046_0124644 3300049580 Bacteria 1958
771 Ga0501047_0000924 3300049581 Bacteria 30063
772 Ga0501048_0091038 3300049582 Bacteria 2152
773 Ga0501048_0107988 3300049582 Bacteria 1965
774 Ga0501048_0120869 3300049582 Bacteria 1851
775 Ga0501048_0512680 3300049582 Bacteria 860
776 Ga0501068_0000452 3300049584 Bacteria 20843
777 Ga0501068_0189337 3300049584 Bacteria 1303
778 Ga0501069_0052941 3300049585 Bacteria 2261
779 Ga0501070_0077166 3300049586 Bacteria 2758
780 Ga0501070_0243853 3300049586 Bacteria 1471
781 Ga0501071_0004700 3300049587 Bacteria 8679
782 Ga0501072_0000006 3300049588 Bacteria 245475
783 Ga0501072_0039589 3300049588 Bacteria 3700
784 Ga0501072_0058850 3300049588 Bacteria 3029
785 Ga0501072_0273859 3300049588 Bacteria 1343
786 Ga0501073_0028960 3300049589 Bacteria 3956
787 Ga0501074_0018854 3300049590 Bacteria 5011
788 Ga0501074_0066098 3300049590 Bacteria 2601
789 Ga0501075_0009298 3300049591 Bacteria 6878
790 Ga0501075_0228713 3300049591 Bacteria 1418
791 Ga0501076_0074483 3300049592 Bacteria 2720
792 Ga0501076_0176281 3300049592 Bacteria 1742
793 Ga0501076_0241119 3300049592 Bacteria 1479
794 Ga0501077_0073378 3300049593 Bacteria 2168
795 Ga0501077_0136503 3300049593 Bacteria 1555
796 Ga0501079_0003564 3300049741 Bacteria 11449
797 Ga0501079_0006593 3300049741 Bacteria 8733
798 Ga0501079_0040252 3300049741 Bacteria 3605
799 Ga0501080_0063673 3300049742 Bacteria 3431
800 Ga0501080_0071622 3300049742 Bacteria 3224
801 Ga0501081_0010246 3300049743 Bacteria 6120
802 Ga0501081_0054646 3300049743 Bacteria 2759
803 Ga0501081_0247782 3300049743 Bacteria 1300
804 Ga0501083_0007775 3300049744 Bacteria 7594
805 Ga0501083_0262113 3300049744 Bacteria 1124
806 Ga0501045_0002003 3300049824 Bacteria 13762
807 Ga0501045_0069668 3300049824 Bacteria 2586
808 nmdc:mga03n38_1014_c1 3300050490 Bacteria 7689
809 nmdc:mga03n38_1867_c1 3300050490 Bacteria 6296
810 nmdc:mga00v17_166394_c1 3300050491 Bacteria 1421
811 nmdc:mga0yw44_43238_c1 3300050492 Bacteria 2689
812 nmdc:mga06z11_1371_c1 3300050494 Bacteria 9016
813 nmdc:mga06z11_5195_c1 3300050494 Bacteria 5201
814 nmdc:mga04h51_1352_c1 3300050495 Bacteria 5649
815 nmdc:mga05p37_183426_c1 3300050507 Bacteria 2545
816 nmdc:mga05p37_355_c1 3300050507 Bacteria 49150
817 nmdc:mga09592_1014_c1 3300050508 Bacteria 22323
818 nmdc:mga09592_131363_c1 3300050508 Bacteria 2155
819 nmdc:mga0qj67_125782_c1 3300050509 Bacteria 2075
820 nmdc:mga0qj67_4152_c1 3300050509 Bacteria 10503
821 nmdc:mga0qj67_97384_c1 3300050509 Bacteria 2369
822 nmdc:mga06r32_235640_c1 3300050510 Bacteria 1818
823 nmdc:mga06r32_299307_c1 3300050510 Bacteria 1595
824 nmdc:mga06r32_53517_c1 3300050510 Bacteria 3867
825 nmdc:mga08y16_134330_c1 3300050511 Bacteria 2571
826 nmdc:mga08y16_180713_c1 3300050511 Unclassified 2190
827 nmdc:mga0n895_28879_c1 3300050512 Bacteria 5281
828 nmdc:mga0n895_33893_c1 3300050512 Bacteria 4911
829 nmdc:mga0n895_360594_c1 3300050512 Bacteria 1472
830 nmdc:mga0n895_467992_c1 3300050512 Bacteria 1272
831 nmdc:mga0n895_68170_c1 3300050512 Bacteria 3524
832 nmdc:mga0n895_726460_c1 3300050512 Bacteria 988
833 nmdc:mga0n895_84026_c1 3300050512 Bacteria 3176
834 nmdc:mga0rr50_101402_c1 3300050513 Bacteria 2263
835 nmdc:mga0rr50_140887_c1 3300050513 Bacteria 1940
836 nmdc:mga0rr50_188246_c1 3300050513 Bacteria 1690
837 nmdc:mga08x19_2443_c1 3300050514 Bacteria 11287
838 nmdc:mga08x19_48491_c1 3300050514 Bacteria 2721
839 nmdc:mga08x19_74258_c1 3300050514 Bacteria 2221
840 nmdc:mga08x19_91074_c1 3300050514 Bacteria 2013
841 nmdc:mga0a205_207992_c1 3300050515 Bacteria 1846
842 Ga0495601_0013688 3300053077 Bacteria 4880
843 Ga0495601_0166421 3300053077 Unclassified 1441
844 Ga0495619_0003421 3300053085 Bacteria 10245
845 Ga0495619_0008732 3300053085 Bacteria 6408
846 Ga0495619_0020795 3300053085 Bacteria 4185
847 Ga0495619_0050305 3300053085 Bacteria 2750
848 Ga0500555_046926 3300053103 Unclassified 1190
849 Ga0500614_014279 3300053123 Bacteria 1757
850 Ga0501084_0009922 3300054114 Bacteria 7871
851 Ga0501084_0011694 3300054114 Bacteria 7266
852 Ga0501084_0237093 3300054114 Bacteria 1540
853 Ga0501082_0003950 3300060353 Bacteria 12942
854 Ga0501082_0083255 3300060353 Bacteria 2760
855 Ga0530510_0006184 3300061734 Bacteria 8321
856 Ga0530510_0160733 3300061734 Bacteria 1661
857 Ga0530510_0401196 3300061734 Bacteria 1033

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025938 Ga0207704_10048652 Ga0207704_100486521 184
2 3300034957 Ga0373938_0022516 Ga0373938_0022516_593_1273 201
3 3300028381 Ga0268264_10730789 Ga0268264_107307892 203
4 3300046642 Ga0495634_0440580 Ga0495634_0440580_22_726 222
5 3300049522 Ga0501299_056013 Ga0501299_056013_21_788 222
6 3300006048 Ga0075363_100030547 Ga0075363_1000305472 224
7 3300006178 Ga0075367_10004347 Ga0075367_100043476 224
8 3300027866 Ga0209813_10006227 Ga0209813_100062272 224
9 3300050490 nmdc:mga03n38_1867_c1 nmdc:mga03n38_1867_c1_998_1780 224
10 3300050494 nmdc:mga06z11_5195_c1 nmdc:mga06z11_5195_c1_2644_3426 224
11 3300005539 Ga0068853_100139987 Ga0068853_1001399872 225
12 3300026041 Ga0207639_10305578 Ga0207639_103055782 225
13 3300050512 nmdc:mga0n895_28879_c1 nmdc:mga0n895_28879_c1_668_1435 228
14 3300005329 Ga0070683_100015486 Ga0070683_1000154862 230
15 3300005335 Ga0070666_10002242 Ga0070666_100022427 230
16 3300005337 Ga0070682_100070693 Ga0070682_1000706933 230
17 3300005338 Ga0068868_100097101 Ga0068868_1000971012 230
18 3300005339 Ga0070660_100290891 Ga0070660_1002908912 230
19 3300005340 Ga0070689_100079732 Ga0070689_1000797322 230
20 3300005355 Ga0070671_100051418 Ga0070671_1000514183 230
21 3300005364 Ga0070673_100011403 Ga0070673_1000114037 230
22 3300005367 Ga0070667_100059389 Ga0070667_1000593893 230
23 3300005434 Ga0070709_10004334 Ga0070709_100043345 230
24 3300005436 Ga0070713_100000923 Ga0070713_10000092318 230
25 3300005437 Ga0070710_10007113 Ga0070710_100071132 230
26 3300005437 Ga0070710_10018012 Ga0070710_100180122 230
27 3300005439 Ga0070711_100033220 Ga0070711_1000332202 230
28 3300005439 Ga0070711_100176471 Ga0070711_1001764712 230
29 3300005439 Ga0070711_100187816 Ga0070711_1001878162 230
30 3300005456 Ga0070678_100099155 Ga0070678_1000991552 230
31 3300005466 Ga0070685_10009466 Ga0070685_100094663 230
32 3300005544 Ga0070686_100018776 Ga0070686_1000187763 230
33 3300005547 Ga0070693_100102273 Ga0070693_1001022732 230
34 3300005564 Ga0070664_100178728 Ga0070664_1001787282 230
35 3300005614 Ga0068856_100128107 Ga0068856_1001281073 230
36 3300005618 Ga0068864_100024740 Ga0068864_1000247403 230
37 3300005842 Ga0068858_100018324 Ga0068858_1000183243 230
38 3300005843 Ga0068860_100042508 Ga0068860_1000425084 230
39 3300006028 Ga0070717_10035489 Ga0070717_100354894 230
40 3300006163 Ga0070715_10007541 Ga0070715_100075413 230
41 3300006173 Ga0070716_100151267 Ga0070716_1001512672 230
42 3300006175 Ga0070712_100022345 Ga0070712_1000223453 230
43 3300006175 Ga0070712_100309581 Ga0070712_1003095811 230
44 3300006237 Ga0097621_100006628 Ga0097621_10000662811 230
45 3300006358 Ga0068871_100008291 Ga0068871_1000082917 230
46 3300006871 Ga0075434_100032733 Ga0075434_1000327332 230
47 3300006881 Ga0068865_100070194 Ga0068865_1000701941 230
48 3300007076 Ga0075435_100017108 Ga0075435_1000171084 230
49 3300007076 Ga0075435_100062865 Ga0075435_1000628653 230
50 3300009098 Ga0105245_10124373 Ga0105245_101243732 230
51 3300009148 Ga0105243_10013045 Ga0105243_100130457 230
52 3300009176 Ga0105242_10010686 Ga0105242_100106862 230
53 3300009545 Ga0105237_10559730 Ga0105237_105597302 230
54 3300009553 Ga0105249_10144737 Ga0105249_101447372 230
55 3300010375 Ga0105239_10098006 Ga0105239_100980063 230
56 3300013296 Ga0157374_10167755 Ga0157374_101677552 230
57 3300013296 Ga0157374_10282222 Ga0157374_102822222 230
58 3300013297 Ga0157378_10020683 Ga0157378_100206835 230
59 3300013306 Ga0163162_10021862 Ga0163162_100218623 230
60 3300013308 Ga0157375_10054080 Ga0157375_100540802 230
61 3300013308 Ga0157375_10227796 Ga0157375_102277962 230
62 3300014325 Ga0163163_10150523 Ga0163163_101505232 230
63 3300014968 Ga0157379_10064941 Ga0157379_100649412 230
64 3300014968 Ga0157379_10143967 Ga0157379_101439672 230
65 3300017792 Ga0163161_10071785 Ga0163161_100717852 230
66 3300025898 Ga0207692_10008507 Ga0207692_100085074 230
67 3300025898 Ga0207692_10030650 Ga0207692_100306502 230
68 3300025906 Ga0207699_10002688 Ga0207699_100026885 230
69 3300025907 Ga0207645_10213644 Ga0207645_102136442 230
70 3300025914 Ga0207671_10110886 Ga0207671_101108862 230
71 3300025915 Ga0207693_10013884 Ga0207693_100138843 230
72 3300025915 Ga0207693_10149563 Ga0207693_101495632 230
73 3300025916 Ga0207663_10179120 Ga0207663_101791202 230
74 3300025916 Ga0207663_10185393 Ga0207663_101853932 230
75 3300025919 Ga0207657_10114009 Ga0207657_101140092 230
76 3300025928 Ga0207700_10108800 Ga0207700_101088002 230
77 3300025929 Ga0207664_10362367 Ga0207664_103623671 230
78 3300025931 Ga0207644_10003123 Ga0207644_1000312310 230
79 3300025934 Ga0207686_10066308 Ga0207686_100663083 230
80 3300025935 Ga0207709_10059711 Ga0207709_100597112 230
81 3300025936 Ga0207670_10047961 Ga0207670_100479612 230
82 3300025939 Ga0207665_10000223 Ga0207665_1000022327 230
83 3300025941 Ga0207711_10021061 Ga0207711_100210615 230
84 3300025986 Ga0207658_10053591 Ga0207658_100535912 230
85 3300026067 Ga0207678_10065925 Ga0207678_100659253 230
86 3300026088 Ga0207641_10021698 Ga0207641_100216982 230
87 3300026121 Ga0207683_10012990 Ga0207683_100129905 230
88 3300027907 Ga0207428_10230542 Ga0207428_102305422 230
89 3300028379 Ga0268266_10029298 Ga0268266_100292982 230
90 3300028381 Ga0268264_10106633 Ga0268264_101066332 230
91 3300031241 Ga0265325_10000004 Ga0265325_10000004273 230
92 3300031595 Ga0265313_10011134 Ga0265313_100111343 230
93 3300035084 Ga0373928_0001281 Ga0373928_0001281_1425_2273 230
94 3300035088 Ga0373940_0024817 Ga0373940_0024817_443_1291 230
95 3300035089 Ga0373944_0031160 Ga0373944_0031160_57_905 230
96 3300035111 Ga0373923_0120124 Ga0373923_0120124_186_1034 230
97 3300035115 Ga0373941_0004067 Ga0373941_0004067_39_887 230
98 3300035116 Ga0373945_0010944 Ga0373945_0010944_781_1629 230
99 3300035170 Ga0373943_0011856 Ga0373943_0011856_761_1609 230
100 3300035170 Ga0373943_0046676 Ga0373943_0046676_265_1113 230
101 3300035171 Ga0373946_0010572 Ga0373946_0010572_368_1216 230
102 3300035410 Ga0373924_0051051 Ga0373924_0051051_802_1650 230
103 3300035691 Ga0373931_0010262 Ga0373931_0010262_2632_3480 230
104 3300035695 Ga0373927_0037618 Ga0373927_0037618_22_870 230
105 3300035695 Ga0373927_0041185 Ga0373927_0041185_1081_1929 230
106 3300035725 Ga0373947_0009374 Ga0373947_0009374_1665_2513 230
107 3300035725 Ga0373947_0010706 Ga0373947_0010706_2458_3306 230
108 3300035725 Ga0373947_0357662 Ga0373947_0357662_79_927 230
109 3300037068 Ga0373925_0006268 Ga0373925_0006268_2789_3637 230
110 3300037068 Ga0373925_0055489 Ga0373925_0055489_1900_2748 230
111 3300046454 Ga0495592_0136006 Ga0495592_0136006_70_918 230
112 3300046455 Ga0495603_0015201 Ga0495603_0015201_2330_3178 230
113 3300046455 Ga0495603_0016798 Ga0495603_0016798_1658_2506 230
114 3300046459 Ga0495629_0022638 Ga0495629_0022638_2831_3679 230
115 3300046459 Ga0495629_0041822 Ga0495629_0041822_1272_2120 230
116 3300046461 Ga0495641_0020474 Ga0495641_0020474_1753_2601 230
117 3300046461 Ga0495641_0062461 Ga0495641_0062461_152_1000 230
118 3300046472 Ga0495580_0041816 Ga0495580_0041816_621_1469 230
119 3300046473 Ga0495582_0008317 Ga0495582_0008317_139_987 230
120 3300046473 Ga0495582_0013701 Ga0495582_0013701_1426_2274 230
121 3300046473 Ga0495582_0065952 Ga0495582_0065952_1114_1962 230
122 3300046514 Ga0495618_0014907 Ga0495618_0014907_1245_2093 230
123 3300046514 Ga0495618_0040372 Ga0495618_0040372_1131_1979 230
124 3300046517 Ga0495630_0032264 Ga0495630_0032264_2368_3216 230
125 3300046526 Ga0495666_0007272 Ga0495666_0007272_2054_2902 230
126 3300046529 Ga0495652_0013021 Ga0495652_0013021_4018_4866 230
127 3300046531 Ga0495665_0045900 Ga0495665_0045900_147_995 230
128 3300046533 Ga0495640_0021596 Ga0495640_0021596_1315_2163 230
129 3300046533 Ga0495640_0051067 Ga0495640_0051067_1198_2046 230
130 3300046642 Ga0495634_0015705 Ga0495634_0015705_2403_3251 230
131 3300046663 Ga0495635_0132523 Ga0495635_0132523_51_899 230
132 3300046674 Ga0495588_0025171 Ga0495588_0025171_1647_2495 230
133 3300046681 Ga0495647_0004324 Ga0495647_0004324_921_1769 230
134 3300046681 Ga0495647_0013460 Ga0495647_0013460_1746_2594 230
135 3300046683 Ga0495658_0004279 Ga0495658_0004279_1366_2214 230
136 3300046689 Ga0495613_0004531 Ga0495613_0004531_8543_9391 230
137 3300046689 Ga0495613_0013849 Ga0495613_0013849_2786_3634 230
138 3300046690 Ga0495624_0022443 Ga0495624_0022443_2166_3014 230
139 3300047315 Ga0495581_0006657 Ga0495581_0006657_2842_3690 230
140 3300047315 Ga0495581_0228735 Ga0495581_0228735_253_1077 230
141 3300047319 Ga0495674_0018069 Ga0495674_0018069_2361_3209 230
142 3300047321 Ga0495676_0046166 Ga0495676_0046166_2452_3300 230
143 3300047322 Ga0495680_0137622 Ga0495680_0137622_710_1558 230
144 3300047471 Ga0495684_0025601 Ga0495684_0025601_2379_3227 230
145 3300047673 Ga0495593_0029417 Ga0495593_0029417_1362_2210 230
146 3300048089 Ga0495614_0037593 Ga0495614_0037593_499_1347 230
147 3300048903 Ga0496100_0450729 Ga0496100_0450729_34_882 230
148 3300048904 Ga0496101_0013743 Ga0496101_0013743_2983_3831 230
149 3300048905 Ga0496102_0065442 Ga0496102_0065442_1643_2491 230
150 3300048907 Ga0496104_0223878 Ga0496104_0223878_780_1628 230
151 3300048907 Ga0496104_0294806 Ga0496104_0294806_36_884 230
152 3300048908 Ga0496105_0034626 Ga0496105_0034626_1713_2561 230
153 3300048910 Ga0496107_0266625 Ga0496107_0266625_357_1205 230
154 3300048915 Ga0496112_0403040 Ga0496112_0403040_199_1047 230
155 3300048917 Ga0496114_0005459 Ga0496114_0005459_717_1565 230
156 3300048918 Ga0496115_0040660 Ga0496115_0040660_959_1807 230
157 3300048918 Ga0496115_0053463 Ga0496115_0053463_789_1637 230
158 3300050512 nmdc:mga0n895_360594_c1 nmdc:mga0n895_360594_c1_201_1049 230
159 3300050512 nmdc:mga0n895_467992_c1 nmdc:mga0n895_467992_c1_272_1120 230
160 3300050513 nmdc:mga0rr50_188246_c1 nmdc:mga0rr50_188246_c1_250_1017 230
161 3300050514 nmdc:mga08x19_74258_c1 nmdc:mga08x19_74258_c1_272_1120 230
162 3300053085 Ga0495619_0003421 Ga0495619_0003421_1953_2801 230
163 3300053085 Ga0495619_0020795 Ga0495619_0020795_66_914 230
164 3300053085 Ga0495619_0050305 Ga0495619_0050305_1058_1906 230
165 3300005471 Ga0070698_100259826 Ga0070698_1002598262 231
166 3300048089 Ga0495614_0093128 Ga0495614_0093128_346_1128 231
167 3300049574 Ga0501038_0085860 Ga0501038_0085860_1661_2470 231
168 3300049576 Ga0501040_0110699 Ga0501040_0110699_735_1544 231
169 3300035116 Ga0373945_0148515 Ga0373945_0148515_64_846 232
170 3300035170 Ga0373943_0009126 Ga0373943_0009126_807_1589 232
171 3300035171 Ga0373946_0021725 Ga0373946_0021725_699_1481 232
172 3300035692 Ga0373935_0008836 Ga0373935_0008836_2368_3150 232
173 3300035695 Ga0373927_0017863 Ga0373927_0017863_3429_4211 232
174 3300035725 Ga0373947_0003408 Ga0373947_0003408_6537_7319 232
175 3300037068 Ga0373925_0017846 Ga0373925_0017846_3515_4297 232
176 3300046455 Ga0495603_0003334 Ga0495603_0003334_7044_7826 232
177 3300046459 Ga0495629_0003983 Ga0495629_0003983_7975_8757 232
178 3300046472 Ga0495580_0159070 Ga0495580_0159070_719_1501 232
179 3300046473 Ga0495582_0001069 Ga0495582_0001069_12172_12954 232
180 3300046475 Ga0495639_0006547 Ga0495639_0006547_1932_2714 232
181 3300046499 Ga0495594_0003710 Ga0495594_0003710_1520_2302 232
182 3300046683 Ga0495658_0001192 Ga0495658_0001192_9431_10213 232
183 3300046689 Ga0495613_0010219 Ga0495613_0010219_4690_5472 232
184 3300046809 Ga0495600_0087950 Ga0495600_0087950_425_1207 232
185 3300047321 Ga0495676_0155299 Ga0495676_0155299_800_1582 232
186 3300047322 Ga0495680_0008064 Ga0495680_0008064_6489_7271 232
187 3300047673 Ga0495593_0037677 Ga0495593_0037677_1328_2110 232
188 3300049577 Ga0501041_0002402 Ga0501041_0002402_49_861 232
189 3300049582 Ga0501048_0512680 Ga0501048_0512680_20_832 232
190 3300050511 nmdc:mga08y16_180713_c1 nmdc:mga08y16_180713_c1_985_1767 232
191 3300053085 Ga0495619_0008732 Ga0495619_0008732_1191_1973 232
192 3300032126 Ga0307415_100575368 Ga0307415_1005753682 233
193 3300048907 Ga0496104_0000951 Ga0496104_0000951_8932_9780 233
194 3300048917 Ga0496114_0437062 Ga0496114_0437062_25_873 233
195 3300049577 Ga0501041_0337078 Ga0501041_0337078_65_901 233
196 3300050509 nmdc:mga0qj67_97384_c1 nmdc:mga0qj67_97384_c1_852_1691 233
197 3300035398 Ga0316574_0123080 Ga0316574_0123080_575_1342 236
198 3300028577 Ga0265318_10001252 Ga0265318_100012528 237
199 3300031235 Ga0265330_10000900 Ga0265330_100009005 237
200 3300031240 Ga0265320_10002328 Ga0265320_1000232810 237
201 3300031242 Ga0265329_10000367 Ga0265329_100003672 237
202 3300031250 Ga0265331_10001846 Ga0265331_100018462 237
203 3300031344 Ga0265316_10002329 Ga0265316_1000232914 237
204 3300031712 Ga0265342_10002058 Ga0265342_100020585 237
205 3300028800 Ga0265338_10116388 Ga0265338_101163883 238
206 3300039453 Ga0436362_0386476 Ga0436362_0386476_1010_1861 238
207 3300039438 Ga0436360_0438289 Ga0436360_0438289_2158_3009 239
208 3300006038 Ga0075365_10256914 Ga0075365_102569142 240
209 3300006871 Ga0075434_100173991 Ga0075434_1001739912 240
210 3300050512 nmdc:mga0n895_84026_c1 nmdc:mga0n895_84026_c1_56_877 240
211 3300005518 Ga0070699_100065163 Ga0070699_1000651634 241
212 3300006846 Ga0075430_100351607 Ga0075430_1003516072 241
213 3300025917 Ga0207660_10073078 Ga0207660_100730784 241
214 3300005336 Ga0070680_100155873 Ga0070680_1001558732 244
215 3300005406 Ga0070703_10058243 Ga0070703_100582432 244
216 3300005435 Ga0070714_100259916 Ga0070714_1002599162 244
217 3300005440 Ga0070705_100165039 Ga0070705_1001650392 244
218 3300005441 Ga0070700_100244945 Ga0070700_1002449452 244
219 3300005444 Ga0070694_100011467 Ga0070694_1000114679 244
220 3300005468 Ga0070707_100156964 Ga0070707_1001569642 244
221 3300005518 Ga0070699_100097904 Ga0070699_1000979043 244
222 3300005546 Ga0070696_100057902 Ga0070696_1000579022 244
223 3300005546 Ga0070696_100070857 Ga0070696_1000708572 244
224 3300005577 Ga0068857_100284506 Ga0068857_1002845062 244
225 3300005617 Ga0068859_100585168 Ga0068859_1005851682 244
226 3300005985 Ga0081539_10073191 Ga0081539_100731912 244
227 3300006871 Ga0075434_100495421 Ga0075434_1004954212 244
228 3300006914 Ga0075436_100000576 Ga0075436_10000057625 244
229 3300006914 Ga0075436_100009986 Ga0075436_1000099866 244
230 3300006931 Ga0097620_100585197 Ga0097620_1005851972 244
231 3300009553 Ga0105249_10051274 Ga0105249_100512743 244
232 3300025922 Ga0207646_10067088 Ga0207646_100670882 244
233 3300025929 Ga0207664_10072520 Ga0207664_100725202 244
234 3300028573 Ga0265334_10013031 Ga0265334_100130312 244
235 3300031238 Ga0265332_10000671 Ga0265332_1000067116 244
236 3300035083 Ga0373926_0000062 Ga0373926_0000062_10785_11621 244
237 3300035089 Ga0373944_0002899 Ga0373944_0002899_3468_4304 244
238 3300035113 Ga0373936_0000882 Ga0373936_0000882_7160_7996 244
239 3300035116 Ga0373945_0000333 Ga0373945_0000333_4203_5039 244
240 3300035170 Ga0373943_0007142 Ga0373943_0007142_1455_2291 244
241 3300035171 Ga0373946_0000768 Ga0373946_0000768_678_1514 244
242 3300035695 Ga0373927_0000912 Ga0373927_0000912_11920_12756 244
243 3300037068 Ga0373925_0003003 Ga0373925_0003003_4421_5257 244
244 3300045051 Ga0451576_0121961 Ga0451576_0121961_865_1701 244
245 3300046455 Ga0495603_0006586 Ga0495603_0006586_1476_2312 244
246 3300046472 Ga0495580_0004546 Ga0495580_0004546_10136_10972 244
247 3300046535 Ga0495586_0001686 Ga0495586_0001686_3353_4189 244
248 3300046674 Ga0495588_0113067 Ga0495588_0113067_152_988 244
249 3300046681 Ga0495647_0000076 Ga0495647_0000076_21104_21940 244
250 3300046683 Ga0495658_0005839 Ga0495658_0005839_4304_5140 244
251 3300047321 Ga0495676_0019750 Ga0495676_0019750_3396_4232 244
252 3300049581 Ga0501047_0000924 Ga0501047_0000924_11408_12205 244
253 3300049584 Ga0501068_0000452 Ga0501068_0000452_11317_12114 244
254 3300049585 Ga0501069_0052941 Ga0501069_0052941_514_1311 244
255 3300049586 Ga0501070_0077166 Ga0501070_0077166_978_1775 244
256 3300049588 Ga0501072_0000006 Ga0501072_0000006_107244_108041 244
257 3300049589 Ga0501073_0028960 Ga0501073_0028960_2453_3250 244
258 3300049590 Ga0501074_0018854 Ga0501074_0018854_4118_4915 244
259 3300049592 Ga0501076_0176281 Ga0501076_0176281_180_977 244
260 3300049741 Ga0501079_0006593 Ga0501079_0006593_7582_8379 244
261 3300049742 Ga0501080_0063673 Ga0501080_0063673_1707_2504 244
262 3300049744 Ga0501083_0007775 Ga0501083_0007775_5021_5818 244
263 3300050511 nmdc:mga08y16_134330_c1 nmdc:mga08y16_134330_c1_176_988 244
264 3300050514 nmdc:mga08x19_2443_c1 nmdc:mga08x19_2443_c1_608_1444 244
265 3300054114 Ga0501084_0009922 Ga0501084_0009922_3289_4086 244
266 3300060353 Ga0501082_0003950 Ga0501082_0003950_6459_7256 244
267 3300005327 Ga0070658_10071004 Ga0070658_100710043 245
268 3300005328 Ga0070676_10070698 Ga0070676_100706982 245
269 3300005329 Ga0070683_100119018 Ga0070683_1001190182 245
270 3300005330 Ga0070690_100000203 Ga0070690_10000020327 245
271 3300005330 Ga0070690_100285679 Ga0070690_1002856791 245
272 3300005331 Ga0070670_100014743 Ga0070670_1000147437 245
273 3300005334 Ga0068869_100002662 Ga0068869_1000026627 245
274 3300005335 Ga0070666_10027520 Ga0070666_100275202 245
275 3300005336 Ga0070680_100039626 Ga0070680_1000396264 245
276 3300005336 Ga0070680_100431741 Ga0070680_1004317411 245
277 3300005337 Ga0070682_100017282 Ga0070682_1000172823 245
278 3300005337 Ga0070682_100018133 Ga0070682_1000181333 245
279 3300005337 Ga0070682_100021570 Ga0070682_1000215705 245
280 3300005338 Ga0068868_100000697 Ga0068868_10000069713 245
281 3300005338 Ga0068868_100158734 Ga0068868_1001587342 245
282 3300005339 Ga0070660_100068667 Ga0070660_1000686672 245
283 3300005340 Ga0070689_100004178 Ga0070689_10000417813 245
284 3300005340 Ga0070689_100018375 Ga0070689_1000183757 245
285 3300005340 Ga0070689_100245162 Ga0070689_1002451622 245
286 3300005341 Ga0070691_10000395 Ga0070691_1000039517 245
287 3300005343 Ga0070687_100000070 Ga0070687_10000007023 245
288 3300005343 Ga0070687_100081094 Ga0070687_1000810942 245
289 3300005345 Ga0070692_10001807 Ga0070692_100018075 245
290 3300005347 Ga0070668_100174746 Ga0070668_1001747462 245
291 3300005353 Ga0070669_100168370 Ga0070669_1001683702 245
292 3300005354 Ga0070675_100124885 Ga0070675_1001248852 245
293 3300005354 Ga0070675_100124977 Ga0070675_1001249773 245
294 3300005355 Ga0070671_100006600 Ga0070671_1000066005 245
295 3300005356 Ga0070674_100090083 Ga0070674_1000900832 245
296 3300005364 Ga0070673_100023398 Ga0070673_1000233982 245
297 3300005365 Ga0070688_100031648 Ga0070688_1000316482 245
298 3300005365 Ga0070688_100263483 Ga0070688_1002634832 245
299 3300005366 Ga0070659_100084851 Ga0070659_1000848512 245
300 3300005367 Ga0070667_100023816 Ga0070667_1000238166 245
301 3300005406 Ga0070703_10012874 Ga0070703_100128744 245
302 3300005434 Ga0070709_10002182 Ga0070709_1000218212 245
303 3300005435 Ga0070714_100007793 Ga0070714_1000077935 245
304 3300005436 Ga0070713_100000728 Ga0070713_10000072813 245
305 3300005437 Ga0070710_10003961 Ga0070710_100039618 245
306 3300005437 Ga0070710_10202533 Ga0070710_102025332 245
307 3300005438 Ga0070701_10000579 Ga0070701_1000057914 245
308 3300005439 Ga0070711_100013544 Ga0070711_1000135444 245
309 3300005440 Ga0070705_100000586 Ga0070705_10000058613 245
310 3300005440 Ga0070705_100017884 Ga0070705_1000178845 245
311 3300005441 Ga0070700_100005942 Ga0070700_1000059427 245
312 3300005444 Ga0070694_100000527 Ga0070694_10000052721 245
313 3300005456 Ga0070678_100011697 Ga0070678_1000116977 245
314 3300005456 Ga0070678_100250801 Ga0070678_1002508012 245
315 3300005457 Ga0070662_100251067 Ga0070662_1002510672 245
316 3300005459 Ga0068867_100000775 Ga0068867_10000077513 245
317 3300005466 Ga0070685_10002556 Ga0070685_100025569 245
318 3300005471 Ga0070698_100258343 Ga0070698_1002583432 245
319 3300005530 Ga0070679_100001447 Ga0070679_10000144713 245
320 3300005539 Ga0068853_100036955 Ga0068853_1000369553 245
321 3300005539 Ga0068853_100135040 Ga0068853_1001350402 245
322 3300005543 Ga0070672_100092046 Ga0070672_1000920463 245
323 3300005544 Ga0070686_100000240 Ga0070686_10000024014 245
324 3300005544 Ga0070686_100002912 Ga0070686_1000029127 245
325 3300005545 Ga0070695_100000374 Ga0070695_10000037417 245
326 3300005547 Ga0070693_100000298 Ga0070693_10000029813 245
327 3300005547 Ga0070693_100031068 Ga0070693_1000310685 245
328 3300005549 Ga0070704_100000864 Ga0070704_10000086413 245
329 3300005549 Ga0070704_100002844 Ga0070704_1000028442 245
330 3300005563 Ga0068855_100001747 Ga0068855_10000174721 245
331 3300005563 Ga0068855_100163255 Ga0068855_1001632553 245
332 3300005577 Ga0068857_100371705 Ga0068857_1003717052 245
333 3300005578 Ga0068854_100013725 Ga0068854_1000137254 245
334 3300005614 Ga0068856_100005249 Ga0068856_1000052496 245
335 3300005614 Ga0068856_100180823 Ga0068856_1001808232 245
336 3300005615 Ga0070702_100000032 Ga0070702_10000003214 245
337 3300005615 Ga0070702_100003828 Ga0070702_1000038282 245
338 3300005616 Ga0068852_100328246 Ga0068852_1003282462 245
339 3300005617 Ga0068859_100000445 Ga0068859_10000044531 245
340 3300005617 Ga0068859_100397785 Ga0068859_1003977852 245
341 3300005618 Ga0068864_100058934 Ga0068864_1000589343 245
342 3300005718 Ga0068866_10000116 Ga0068866_1000011629 245
343 3300005718 Ga0068866_10049630 Ga0068866_100496302 245
344 3300005719 Ga0068861_100000246 Ga0068861_10000024626 245
345 3300005841 Ga0068863_100033888 Ga0068863_1000338883 245
346 3300005842 Ga0068858_100002515 Ga0068858_10000251511 245
347 3300005842 Ga0068858_100017399 Ga0068858_1000173996 245
348 3300005842 Ga0068858_100040889 Ga0068858_1000408893 245
349 3300005843 Ga0068860_100001848 Ga0068860_10000184816 245
350 3300005843 Ga0068860_100183500 Ga0068860_1001835002 245
351 3300005844 Ga0068862_100000668 Ga0068862_10000066823 245
352 3300005937 Ga0081455_10015177 Ga0081455_100151775 245
353 3300006028 Ga0070717_10001498 Ga0070717_100014986 245
354 3300006163 Ga0070715_10004223 Ga0070715_100042233 245
355 3300006173 Ga0070716_100028363 Ga0070716_1000283632 245
356 3300006175 Ga0070712_100000583 Ga0070712_10000058313 245
357 3300006237 Ga0097621_100001462 Ga0097621_10000146213 245
358 3300006237 Ga0097621_100005520 Ga0097621_10000552010 245
359 3300006358 Ga0068871_100000271 Ga0068871_10000027113 245
360 3300006871 Ga0075434_100037726 Ga0075434_1000377264 245
361 3300006881 Ga0068865_100000421 Ga0068865_10000042118 245
362 3300006881 Ga0068865_100032427 Ga0068865_1000324274 245
363 3300006914 Ga0075436_100078353 Ga0075436_1000783532 245
364 3300006931 Ga0097620_100000445 Ga0097620_10000044516 245
365 3300006931 Ga0097620_100397801 Ga0097620_1003978012 245
366 3300007076 Ga0075435_100031243 Ga0075435_1000312433 245
367 3300009011 Ga0105251_10027231 Ga0105251_100272313 245
368 3300009092 Ga0105250_10100585 Ga0105250_101005852 245
369 3300009093 Ga0105240_10050363 Ga0105240_100503634 245
370 3300009094 Ga0111539_10305410 Ga0111539_103054102 245
371 3300009098 Ga0105245_10000464 Ga0105245_1000046433 245
372 3300009098 Ga0105245_10231708 Ga0105245_102317082 245
373 3300009101 Ga0105247_10158256 Ga0105247_101582562 245
374 3300009148 Ga0105243_10000963 Ga0105243_1000096313 245
375 3300009148 Ga0105243_10201041 Ga0105243_102010412 245
376 3300009174 Ga0105241_10012298 Ga0105241_100122982 245
377 3300009174 Ga0105241_10034371 Ga0105241_100343712 245
378 3300009176 Ga0105242_10000689 Ga0105242_1000068921 245
379 3300009176 Ga0105242_10028524 Ga0105242_100285243 245
380 3300009177 Ga0105248_10285797 Ga0105248_102857972 245
381 3300009551 Ga0105238_10038648 Ga0105238_100386484 245
382 3300009553 Ga0105249_10272310 Ga0105249_102723102 245
383 3300009553 Ga0105249_10364176 Ga0105249_103641763 245
384 3300009553 Ga0105249_10971621 Ga0105249_109716211 245
385 3300010375 Ga0105239_10330369 Ga0105239_103303692 245
386 3300011119 Ga0105246_10226213 Ga0105246_102262132 245
387 3300013100 Ga0157373_10256476 Ga0157373_102564762 245
388 3300013104 Ga0157370_10035367 Ga0157370_100353674 245
389 3300013104 Ga0157370_10298162 Ga0157370_102981622 245
390 3300013105 Ga0157369_10001331 Ga0157369_1000133130 245
391 3300013296 Ga0157374_10214238 Ga0157374_102142382 245
392 3300013297 Ga0157378_10000816 Ga0157378_100008162 245
393 3300013307 Ga0157372_10002054 Ga0157372_100020548 245
394 3300013307 Ga0157372_10053532 Ga0157372_100535323 245
395 3300014326 Ga0157380_10054837 Ga0157380_100548372 245
396 3300014326 Ga0157380_10542118 Ga0157380_105421181 245
397 3300014968 Ga0157379_10082960 Ga0157379_100829602 245
398 3300014969 Ga0157376_10003015 Ga0157376_100030155 245
399 3300014969 Ga0157376_10070584 Ga0157376_100705842 245
400 3300025885 Ga0207653_10003327 Ga0207653_100033275 245
401 3300025898 Ga0207692_10028808 Ga0207692_100288082 245
402 3300025898 Ga0207692_10177135 Ga0207692_101771352 245
403 3300025899 Ga0207642_10000116 Ga0207642_100001162 245
404 3300025899 Ga0207642_10041146 Ga0207642_100411462 245
405 3300025900 Ga0207710_10074631 Ga0207710_100746312 245
406 3300025901 Ga0207688_10042004 Ga0207688_100420043 245
407 3300025901 Ga0207688_10055087 Ga0207688_100550872 245
408 3300025903 Ga0207680_10014768 Ga0207680_100147685 245
409 3300025905 Ga0207685_10000567 Ga0207685_100005677 245
410 3300025906 Ga0207699_10000822 Ga0207699_100008228 245
411 3300025907 Ga0207645_10025955 Ga0207645_100259553 245
412 3300025915 Ga0207693_10001134 Ga0207693_1000113411 245
413 3300025915 Ga0207693_10021730 Ga0207693_100217302 245
414 3300025917 Ga0207660_10002745 Ga0207660_100027457 245
415 3300025918 Ga0207662_10000088 Ga0207662_1000008823 245
416 3300025921 Ga0207652_10003045 Ga0207652_1000304512 245
417 3300025924 Ga0207694_10039906 Ga0207694_100399064 245
418 3300025924 Ga0207694_10065189 Ga0207694_100651892 245
419 3300025925 Ga0207650_10135870 Ga0207650_101358702 245
420 3300025926 Ga0207659_10197430 Ga0207659_101974301 245
421 3300025927 Ga0207687_10000349 Ga0207687_1000034916 245
422 3300025927 Ga0207687_10018771 Ga0207687_100187713 245
423 3300025928 Ga0207700_10000698 Ga0207700_1000069813 245
424 3300025929 Ga0207664_10002965 Ga0207664_100029656 245
425 3300025931 Ga0207644_10008637 Ga0207644_100086378 245
426 3300025932 Ga0207690_10052966 Ga0207690_100529662 245
427 3300025932 Ga0207690_10077234 Ga0207690_100772344 245
428 3300025934 Ga0207686_10001742 Ga0207686_1000174210 245
429 3300025934 Ga0207686_10024813 Ga0207686_100248134 245
430 3300025935 Ga0207709_10001642 Ga0207709_100016424 245
431 3300025935 Ga0207709_10125327 Ga0207709_101253272 245
432 3300025936 Ga0207670_10028340 Ga0207670_100283402 245
433 3300025936 Ga0207670_10050624 Ga0207670_100506243 245
434 3300025936 Ga0207670_10210691 Ga0207670_102106912 245
435 3300025938 Ga0207704_10007405 Ga0207704_100074054 245
436 3300025938 Ga0207704_10032287 Ga0207704_100322872 245
437 3300025939 Ga0207665_10001570 Ga0207665_1000157021 245
438 3300025940 Ga0207691_10271889 Ga0207691_102718892 245
439 3300025941 Ga0207711_10013945 Ga0207711_100139459 245
440 3300025942 Ga0207689_10000079 Ga0207689_1000007914 245
441 3300025942 Ga0207689_10045851 Ga0207689_100458515 245
442 3300025944 Ga0207661_10094204 Ga0207661_100942042 245
443 3300025949 Ga0207667_10003261 Ga0207667_1000326113 245
444 3300025949 Ga0207667_10055873 Ga0207667_100558732 245
445 3300025949 Ga0207667_10493159 Ga0207667_104931592 245
446 3300025981 Ga0207640_10001480 Ga0207640_100014807 245
447 3300025986 Ga0207658_10107073 Ga0207658_101070732 245
448 3300026023 Ga0207677_10092023 Ga0207677_100920233 245
449 3300026035 Ga0207703_10005469 Ga0207703_1000546911 245
450 3300026035 Ga0207703_10013825 Ga0207703_100138253 245
451 3300026035 Ga0207703_10029632 Ga0207703_100296325 245
452 3300026041 Ga0207639_10052452 Ga0207639_100524523 245
453 3300026041 Ga0207639_10154562 Ga0207639_101545623 245
454 3300026067 Ga0207678_10007013 Ga0207678_100070136 245
455 3300026075 Ga0207708_10000326 Ga0207708_1000032624 245
456 3300026078 Ga0207702_10008239 Ga0207702_1000823913 245
457 3300026088 Ga0207641_10076106 Ga0207641_100761062 245
458 3300026089 Ga0207648_10000071 Ga0207648_1000007170 245
459 3300026089 Ga0207648_10344928 Ga0207648_103449281 245
460 3300026095 Ga0207676_10002203 Ga0207676_100022038 245
461 3300026118 Ga0207675_100000040 Ga0207675_10000004027 245
462 3300026121 Ga0207683_10010098 Ga0207683_100100988 245
463 3300026121 Ga0207683_10157578 Ga0207683_101575782 245
464 3300026142 Ga0207698_10012247 Ga0207698_100122474 245
465 3300026142 Ga0207698_10109793 Ga0207698_101097933 245
466 3300028379 Ga0268266_10005657 Ga0268266_100056576 245
467 3300028380 Ga0268265_10002113 Ga0268265_100021134 245
468 3300028381 Ga0268264_10000527 Ga0268264_1000052724 245
469 3300035088 Ga0373940_0013954 Ga0373940_0013954_656_1438 245
470 3300035090 Ga0373949_0002553 Ga0373949_0002553_626_1408 245
471 3300035091 Ga0373951_0046185 Ga0373951_0046185_48_830 245
472 3300035114 Ga0373939_0013091 Ga0373939_0013091_518_1300 245
473 3300035207 Ga0373942_0022075 Ga0373942_0022075_194_1030 245
474 3300035242 Ga0373962_0011926 Ga0373962_0011926_1349_2131 245
475 3300035692 Ga0373935_0260617 Ga0373935_0260617_335_1123 245
476 3300035725 Ga0373947_0162057 Ga0373947_0162057_236_1072 245
477 3300037068 Ga0373925_0024972 Ga0373925_0024972_1322_2158 245
478 3300037068 Ga0373925_0191401 Ga0373925_0191401_708_1496 245
479 3300045051 Ga0451576_0003049 Ga0451576_0003049_2116_2955 245
480 3300045976 Ga0466967_0340268 Ga0466967_0340268_441_1277 245
481 3300046461 Ga0495641_0038866 Ga0495641_0038866_872_1660 245
482 3300046461 Ga0495641_0064667 Ga0495641_0064667_196_978 245
483 3300046475 Ga0495639_0019886 Ga0495639_0019886_1736_2524 245
484 3300047321 Ga0495676_0088122 Ga0495676_0088122_167_955 245
485 3300048903 Ga0496100_0114658 Ga0496100_0114658_642_1424 245
486 3300048907 Ga0496104_0091895 Ga0496104_0091895_43_825 245
487 3300048907 Ga0496104_0186029 Ga0496104_0186029_11_793 245
488 3300048908 Ga0496105_0043687 Ga0496105_0043687_1448_2230 245
489 3300048908 Ga0496105_0327098 Ga0496105_0327098_11_793 245
490 3300048910 Ga0496107_0030058 Ga0496107_0030058_2986_3768 245
491 3300048911 Ga0496108_0011350 Ga0496108_0011350_642_1424 245
492 3300048911 Ga0496108_0222672 Ga0496108_0222672_591_1373 245
493 3300048912 Ga0496109_0083508 Ga0496109_0083508_722_1504 245
494 3300048912 Ga0496109_0144682 Ga0496109_0144682_591_1373 245
495 3300048913 Ga0496110_0236915 Ga0496110_0236915_15_797 245
496 3300048914 Ga0496111_0033731 Ga0496111_0033731_307_1089 245
497 3300048915 Ga0496112_0060211 Ga0496112_0060211_1467_2249 245
498 3300048917 Ga0496114_0106279 Ga0496114_0106279_1134_1916 245
499 3300048918 Ga0496115_0028148 Ga0496115_0028148_1035_1817 245
500 3300049584 Ga0501068_0189337 Ga0501068_0189337_220_1059 245
501 3300050512 nmdc:mga0n895_33893_c1 nmdc:mga0n895_33893_c1_1777_2559 245
502 3300050512 nmdc:mga0n895_726460_c1 nmdc:mga0n895_726460_c1_190_972 245
503 3300050513 nmdc:mga0rr50_101402_c1 nmdc:mga0rr50_101402_c1_548_1330 245
504 3300050514 nmdc:mga08x19_91074_c1 nmdc:mga08x19_91074_c1_478_1260 245
505 3300053077 Ga0495601_0013688 Ga0495601_0013688_1069_1860 245
506 3300053103 Ga0500555_046926 Ga0500555_046926_261_1148 245
507 3300005536 Ga0070697_100005988 Ga0070697_1000059889 246
508 3300049568 Ga0501031_0192950 Ga0501031_0192950_323_1177 246
509 3300049572 Ga0501036_0026934 Ga0501036_0026934_593_1447 246
510 3300049575 Ga0501039_0046400 Ga0501039_0046400_1708_2562 246
511 3300049578 Ga0501042_0014537 Ga0501042_0014537_324_1178 246
512 3300049580 Ga0501046_0124644 Ga0501046_0124644_690_1544 246
513 3300049586 Ga0501070_0243853 Ga0501070_0243853_30_884 246
514 3300049587 Ga0501071_0004700 Ga0501071_0004700_4138_4992 246
515 3300049590 Ga0501074_0066098 Ga0501074_0066098_470_1324 246
516 3300049591 Ga0501075_0009298 Ga0501075_0009298_449_1303 246
517 3300049741 Ga0501079_0003564 Ga0501079_0003564_3942_4796 246
518 3300049742 Ga0501080_0071622 Ga0501080_0071622_2072_2926 246
519 3300049743 Ga0501081_0010246 Ga0501081_0010246_1059_1913 246
520 3300049744 Ga0501083_0262113 Ga0501083_0262113_89_943 246
521 3300049824 Ga0501045_0002003 Ga0501045_0002003_5469_6323 246
522 3300050514 nmdc:mga08x19_48491_c1 nmdc:mga08x19_48491_c1_1025_1882 246
523 3300054114 Ga0501084_0011694 Ga0501084_0011694_5562_6416 246
524 3300060353 Ga0501082_0083255 Ga0501082_0083255_1889_2743 246
525 3300061734 Ga0530510_0006184 Ga0530510_0006184_677_1531 246
526 3300005331 Ga0070670_100264476 Ga0070670_1002644762 247
527 3300005347 Ga0070668_100081957 Ga0070668_1000819573 247
528 3300005353 Ga0070669_100059891 Ga0070669_1000598912 247
529 3300005356 Ga0070674_100401996 Ga0070674_1004019962 247
530 3300009148 Ga0105243_10318433 Ga0105243_103184331 247
531 3300014326 Ga0157380_10299203 Ga0157380_102992032 247
532 3300017792 Ga0163161_10161789 Ga0163161_101617892 247
533 3300025893 Ga0207682_10044778 Ga0207682_100447782 247
534 3300025923 Ga0207681_10037558 Ga0207681_100375582 247
535 3300025925 Ga0207650_10065243 Ga0207650_100652433 247
536 3300025940 Ga0207691_10151495 Ga0207691_101514951 247
537 3300025972 Ga0207668_10048878 Ga0207668_100488782 247
538 3300031548 Ga0307408_100034887 Ga0307408_1000348872 247
539 3300032002 Ga0307416_100079727 Ga0307416_1000797272 247
540 3300032126 Ga0307415_100341247 Ga0307415_1003412471 247
541 3300046539 Ga0495621_0005832 Ga0495621_0005832_2590_3411 247
542 3300005458 Ga0070681_10009213 Ga0070681_1000921310 248
543 3300005467 Ga0070706_100059044 Ga0070706_1000590443 248
544 3300005545 Ga0070695_100006942 Ga0070695_1000069425 248
545 3300005546 Ga0070696_100046543 Ga0070696_1000465433 248
546 3300005577 Ga0068857_100011942 Ga0068857_1000119422 248
547 3300005614 Ga0068856_100114006 Ga0068856_1001140063 248
548 3300025912 Ga0207707_10186611 Ga0207707_101866112 248
549 3300026116 Ga0207674_10038326 Ga0207674_100383262 248
550 3300048924 Ga0496121_0022269 Ga0496121_0022269_627_1457 248
551 3300053077 Ga0495601_0166421 Ga0495601_0166421_73_918 248
552 3300006846 Ga0075430_100101350 Ga0075430_1001013502 249
553 3300006847 Ga0075431_100025020 Ga0075431_1000250207 249
554 3300006847 Ga0075431_100217743 Ga0075431_1002177432 249
555 3300006880 Ga0075429_100219011 Ga0075429_1002190112 249
556 3300025910 Ga0207684_10409375 Ga0207684_104093751 249
557 3300035691 Ga0373931_0106700 Ga0373931_0106700_175_1038 249
558 3300042001 Ga0439441_000085 Ga0439441_000085_1793_2656 249
559 3300042003 Ga0439443_000239 Ga0439443_000239_1422_2285 249
560 3300042009 Ga0439451_006053 Ga0439451_006053_419_1282 249
561 3300042436 Ga0439435_0000004 Ga0439435_0000004_10336_11199 249
562 3300042437 Ga0439444_0012156 Ga0439444_0012156_194_1057 249
563 3300042461 Ga0439460_0000794 Ga0439460_0000794_3410_4273 249
564 3300045051 Ga0451576_0206182 Ga0451576_0206182_864_1727 249
565 3300046539 Ga0495621_0040636 Ga0495621_0040636_133_996 249
566 3300049570 Ga0501033_0127879 Ga0501033_0127879_693_1556 249
567 3300049575 Ga0501039_0049162 Ga0501039_0049162_1949_2812 249
568 3300049576 Ga0501040_0272034 Ga0501040_0272034_298_1161 249
569 3300049577 Ga0501041_0026329 Ga0501041_0026329_580_1443 249
570 3300049578 Ga0501042_0179047 Ga0501042_0179047_408_1271 249
571 3300049582 Ga0501048_0120869 Ga0501048_0120869_885_1748 249
572 3300049588 Ga0501072_0039589 Ga0501072_0039589_19_882 249
573 3300049588 Ga0501072_0058850 Ga0501072_0058850_99_962 249
574 3300049593 Ga0501077_0136503 Ga0501077_0136503_19_894 249
575 3300050508 nmdc:mga09592_131363_c1 nmdc:mga09592_131363_c1_924_1787 249
576 3300050509 nmdc:mga0qj67_125782_c1 nmdc:mga0qj67_125782_c1_602_1465 249
577 3300050509 nmdc:mga0qj67_4152_c1 nmdc:mga0qj67_4152_c1_6676_7539 249
578 3300050510 nmdc:mga06r32_299307_c1 nmdc:mga06r32_299307_c1_488_1351 249
579 3300050510 nmdc:mga06r32_53517_c1 nmdc:mga06r32_53517_c1_1633_2496 249
580 3300053123 Ga0500614_014279 Ga0500614_014279_238_1086 249
581 3300005331 Ga0070670_100005005 Ga0070670_10000500515 250
582 3300005331 Ga0070670_100094772 Ga0070670_1000947722 250
583 3300005367 Ga0070667_100040607 Ga0070667_1000406074 250
584 3300005435 Ga0070714_100033480 Ga0070714_1000334806 250
585 3300005441 Ga0070700_100227770 Ga0070700_1002277701 250
586 3300005445 Ga0070708_100038741 Ga0070708_1000387413 250
587 3300005457 Ga0070662_100130680 Ga0070662_1001306802 250
588 3300005467 Ga0070706_100043168 Ga0070706_1000431683 250
589 3300005467 Ga0070706_100087501 Ga0070706_1000875013 250
590 3300005518 Ga0070699_100285853 Ga0070699_1002858532 250
591 3300005543 Ga0070672_100010810 Ga0070672_1000108104 250
592 3300005548 Ga0070665_100192032 Ga0070665_1001920322 250
593 3300005549 Ga0070704_100291453 Ga0070704_1002914532 250
594 3300005618 Ga0068864_100002011 Ga0068864_10000201120 250
595 3300005719 Ga0068861_100018105 Ga0068861_1000181052 250
596 3300005834 Ga0068851_10121109 Ga0068851_101211092 250
597 3300005841 Ga0068863_100005304 Ga0068863_10000530413 250
598 3300005843 Ga0068860_100050695 Ga0068860_1000506952 250
599 3300005844 Ga0068862_100039981 Ga0068862_1000399812 250
600 3300006881 Ga0068865_100229031 Ga0068865_1002290311 250
601 3300007076 Ga0075435_100269344 Ga0075435_1002693441 250
602 3300009177 Ga0105248_10224378 Ga0105248_102243782 250
603 3300009545 Ga0105237_10016674 Ga0105237_100166747 250
604 3300013296 Ga0157374_10458998 Ga0157374_104589982 250
605 3300013306 Ga0163162_10024952 Ga0163162_100249524 250
606 3300014325 Ga0163163_10159503 Ga0163163_101595031 250
607 3300025910 Ga0207684_10027322 Ga0207684_100273224 250
608 3300025910 Ga0207684_10169254 Ga0207684_101692542 250
609 3300025912 Ga0207707_10152267 Ga0207707_101522672 250
610 3300025914 Ga0207671_10047151 Ga0207671_100471512 250
611 3300025925 Ga0207650_10005227 Ga0207650_100052272 250
612 3300025925 Ga0207650_10113728 Ga0207650_101137282 250
613 3300025925 Ga0207650_10159716 Ga0207650_101597162 250
614 3300025929 Ga0207664_10074370 Ga0207664_100743703 250
615 3300025933 Ga0207706_10021136 Ga0207706_100211365 250
616 3300025940 Ga0207691_10023242 Ga0207691_100232424 250
617 3300025941 Ga0207711_10400333 Ga0207711_104003332 250
618 3300025960 Ga0207651_10093894 Ga0207651_100938942 250
619 3300025986 Ga0207658_10175512 Ga0207658_101755122 250
620 3300026023 Ga0207677_10408641 Ga0207677_104086412 250
621 3300026088 Ga0207641_10003133 Ga0207641_1000313315 250
622 3300026088 Ga0207641_10593720 Ga0207641_105937201 250
623 3300026095 Ga0207676_10016808 Ga0207676_100168084 250
624 3300027395 Ga0209996_1004442 Ga0209996_10044422 250
625 3300027526 Ga0209968_1000985 Ga0209968_10009853 250
626 3300027695 Ga0209966_1000011 Ga0209966_100001139 250
627 3300028380 Ga0268265_10274614 Ga0268265_102746142 250
628 3300028381 Ga0268264_10090588 Ga0268264_100905882 250
629 3300028577 Ga0265318_10000392 Ga0265318_1000039224 250
630 3300031235 Ga0265330_10001096 Ga0265330_1000109612 250
631 3300031238 Ga0265332_10000362 Ga0265332_100003625 250
632 3300031240 Ga0265320_10000221 Ga0265320_1000022135 250
633 3300031240 Ga0265320_10008165 Ga0265320_100081653 250
634 3300031250 Ga0265331_10000378 Ga0265331_100003786 250
635 3300031344 Ga0265316_10030450 Ga0265316_100304502 250
636 3300031595 Ga0265313_10000196 Ga0265313_100001966 250
637 3300031711 Ga0265314_10000555 Ga0265314_1000055537 250
638 3300031711 Ga0265314_10016082 Ga0265314_100160823 250
639 3300031711 Ga0265314_10151558 Ga0265314_101515582 250
640 3300031712 Ga0265342_10000058 Ga0265342_1000005898 250
641 3300031712 Ga0265342_10005768 Ga0265342_100057683 250
642 3300036401 Ga0373937_0146975 Ga0373937_0146975_428_1297 250
643 3300048912 Ga0496109_0597036 Ga0496109_0597036_41_889 250
644 3300048916 Ga0496113_0241084 Ga0496113_0241084_157_1026 250
645 3300003792 Ga0055540_1015502 Ga0055540_10155022 251
646 3300005331 Ga0070670_100004185 Ga0070670_1000041854 251
647 3300005335 Ga0070666_10032343 Ga0070666_100323433 251
648 3300005338 Ga0068868_100001118 Ga0068868_10000111811 251
649 3300005344 Ga0070661_100021176 Ga0070661_1000211764 251
650 3300005354 Ga0070675_100292557 Ga0070675_1002925572 251
651 3300005354 Ga0070675_100393389 Ga0070675_1003933892 251
652 3300005355 Ga0070671_100014099 Ga0070671_1000140996 251
653 3300005356 Ga0070674_100237459 Ga0070674_1002374591 251
654 3300005364 Ga0070673_100003763 Ga0070673_10000376310 251
655 3300005364 Ga0070673_100003942 Ga0070673_10000394211 251
656 3300005365 Ga0070688_100027633 Ga0070688_1000276332 251
657 3300005366 Ga0070659_100174146 Ga0070659_1001741462 251
658 3300005367 Ga0070667_100171496 Ga0070667_1001714962 251
659 3300005406 Ga0070703_10020671 Ga0070703_100206712 251
660 3300005434 Ga0070709_10002448 Ga0070709_100024485 251
661 3300005436 Ga0070713_100010653 Ga0070713_1000106532 251
662 3300005437 Ga0070710_10041867 Ga0070710_100418672 251
663 3300005439 Ga0070711_100001151 Ga0070711_1000011514 251
664 3300005441 Ga0070700_100106605 Ga0070700_1001066052 251
665 3300005445 Ga0070708_100032334 Ga0070708_1000323344 251
666 3300005456 Ga0070678_100070947 Ga0070678_1000709474 251
667 3300005457 Ga0070662_100047455 Ga0070662_1000474552 251
668 3300005459 Ga0068867_100010066 Ga0068867_1000100666 251
669 3300005468 Ga0070707_100036230 Ga0070707_1000362304 251
670 3300005471 Ga0070698_100010044 Ga0070698_10001004410 251
671 3300005471 Ga0070698_100113269 Ga0070698_1001132692 251
672 3300005518 Ga0070699_100032485 Ga0070699_1000324851 251
673 3300005536 Ga0070697_100064432 Ga0070697_1000644323 251
674 3300005543 Ga0070672_100018605 Ga0070672_1000186054 251
675 3300005543 Ga0070672_100030866 Ga0070672_1000308666 251
676 3300005547 Ga0070693_100148512 Ga0070693_1001485122 251
677 3300005548 Ga0070665_100054754 Ga0070665_1000547545 251
678 3300005548 Ga0070665_100149235 Ga0070665_1001492352 251
679 3300005549 Ga0070704_100167467 Ga0070704_1001674672 251
680 3300005564 Ga0070664_100004970 Ga0070664_1000049706 251
681 3300005564 Ga0070664_100009313 Ga0070664_1000093134 251
682 3300005577 Ga0068857_100017390 Ga0068857_1000173906 251
683 3300005577 Ga0068857_100311309 Ga0068857_1003113092 251
684 3300005578 Ga0068854_100009390 Ga0068854_1000093905 251
685 3300005614 Ga0068856_100002249 Ga0068856_10000224911 251
686 3300005616 Ga0068852_100002813 Ga0068852_10000281310 251
687 3300005617 Ga0068859_100384724 Ga0068859_1003847242 251
688 3300005617 Ga0068859_100474806 Ga0068859_1004748062 251
689 3300005618 Ga0068864_100025381 Ga0068864_1000253813 251
690 3300005618 Ga0068864_100235242 Ga0068864_1002352422 251
691 3300005718 Ga0068866_10028751 Ga0068866_100287513 251
692 3300005834 Ga0068851_10074651 Ga0068851_100746512 251
693 3300005840 Ga0068870_10061183 Ga0068870_100611832 251
694 3300005841 Ga0068863_100090339 Ga0068863_1000903394 251
695 3300005842 Ga0068858_100178830 Ga0068858_1001788303 251
696 3300005843 Ga0068860_100305529 Ga0068860_1003055291 251
697 3300005844 Ga0068862_100130975 Ga0068862_1001309752 251
698 3300005981 Ga0081538_10024245 Ga0081538_100242453 251
699 3300005983 Ga0081540_1010843 Ga0081540_10108435 251
700 3300005983 Ga0081540_1028009 Ga0081540_10280093 251
701 3300006038 Ga0075365_10060622 Ga0075365_100606223 251
702 3300006042 Ga0075368_10004179 Ga0075368_100041793 251
703 3300006048 Ga0075363_100010127 Ga0075363_1000101274 251
704 3300006051 Ga0075364_10038812 Ga0075364_100388122 251
705 3300006051 Ga0075364_10063907 Ga0075364_100639071 251
706 3300006163 Ga0070715_10002107 Ga0070715_100021072 251
707 3300006173 Ga0070716_100016547 Ga0070716_1000165475 251
708 3300006175 Ga0070712_100020847 Ga0070712_1000208472 251
709 3300006177 Ga0075362_10021946 Ga0075362_100219464 251
710 3300006178 Ga0075367_10005237 Ga0075367_100052373 251
711 3300006178 Ga0075367_10021955 Ga0075367_100219552 251
712 3300006237 Ga0097621_100120740 Ga0097621_1001207401 251
713 3300006358 Ga0068871_100008770 Ga0068871_1000087706 251
714 3300006358 Ga0068871_100010111 Ga0068871_1000101119 251
715 3300006844 Ga0075428_100033779 Ga0075428_1000337795 251
716 3300006844 Ga0075428_100169633 Ga0075428_1001696333 251
717 3300006844 Ga0075428_100191665 Ga0075428_1001916653 251
718 3300006847 Ga0075431_100505993 Ga0075431_1005059932 251
719 3300006847 Ga0075431_100681312 Ga0075431_1006813121 251
720 3300006871 Ga0075434_100311482 Ga0075434_1003114822 251
721 3300006880 Ga0075429_100001221 Ga0075429_10000122112 251
722 3300006881 Ga0068865_100111768 Ga0068865_1001117682 251
723 3300006914 Ga0075436_100012193 Ga0075436_1000121938 251
724 3300006931 Ga0097620_100384737 Ga0097620_1003847372 251
725 3300006931 Ga0097620_100474748 Ga0097620_1004747482 251
726 3300007076 Ga0075435_100026846 Ga0075435_1000268463 251
727 3300009094 Ga0111539_10126181 Ga0111539_101261813 251
728 3300009094 Ga0111539_10349487 Ga0111539_103494872 251
729 3300009147 Ga0114129_10047869 Ga0114129_100478696 251
730 3300009147 Ga0114129_10110457 Ga0114129_101104573 251
731 3300009147 Ga0114129_10179967 Ga0114129_101799673 251
732 3300009148 Ga0105243_10060899 Ga0105243_100608992 251
733 3300009176 Ga0105242_10123212 Ga0105242_101232122 251
734 3300009177 Ga0105248_10029119 Ga0105248_100291196 251
735 3300009177 Ga0105248_10119211 Ga0105248_101192113 251
736 3300009551 Ga0105238_10050721 Ga0105238_100507214 251
737 3300013296 Ga0157374_10041491 Ga0157374_100414912 251
738 3300013306 Ga0163162_10092410 Ga0163162_100924105 251
739 3300013308 Ga0157375_10329409 Ga0157375_103294091 251
740 3300014325 Ga0163163_10563459 Ga0163163_105634591 251
741 3300014968 Ga0157379_10039794 Ga0157379_100397945 251
742 3300014968 Ga0157379_10414388 Ga0157379_104143882 251
743 3300014969 Ga0157376_10025415 Ga0157376_100254152 251
744 3300014969 Ga0157376_10053312 Ga0157376_100533124 251
745 3300025303 Ga0209051_1000843 Ga0209051_10008436 251
746 3300025893 Ga0207682_10005564 Ga0207682_100055646 251
747 3300025898 Ga0207692_10000698 Ga0207692_100006989 251
748 3300025901 Ga0207688_10004733 Ga0207688_100047332 251
749 3300025903 Ga0207680_10006540 Ga0207680_100065405 251
750 3300025905 Ga0207685_10003068 Ga0207685_100030684 251
751 3300025906 Ga0207699_10001488 Ga0207699_100014884 251
752 3300025907 Ga0207645_10029738 Ga0207645_100297384 251
753 3300025908 Ga0207643_10008782 Ga0207643_100087823 251
754 3300025908 Ga0207643_10323391 Ga0207643_103233911 251
755 3300025910 Ga0207684_10025646 Ga0207684_100256463 251
756 3300025910 Ga0207684_10195268 Ga0207684_101952681 251
757 3300025915 Ga0207693_10026285 Ga0207693_100262854 251
758 3300025916 Ga0207663_10002244 Ga0207663_100022449 251
759 3300025918 Ga0207662_10134869 Ga0207662_101348692 251
760 3300025920 Ga0207649_10004361 Ga0207649_100043619 251
761 3300025921 Ga0207652_10337676 Ga0207652_103376762 251
762 3300025924 Ga0207694_10003253 Ga0207694_1000325312 251
763 3300025925 Ga0207650_10022869 Ga0207650_100228694 251
764 3300025926 Ga0207659_10006995 Ga0207659_100069952 251
765 3300025926 Ga0207659_10017851 Ga0207659_100178514 251
766 3300025928 Ga0207700_10001949 Ga0207700_100019498 251
767 3300025929 Ga0207664_10001209 Ga0207664_1000120915 251
768 3300025931 Ga0207644_10132743 Ga0207644_101327433 251
769 3300025931 Ga0207644_10188769 Ga0207644_101887692 251
770 3300025933 Ga0207706_10033477 Ga0207706_100334774 251
771 3300025934 Ga0207686_10030369 Ga0207686_100303692 251
772 3300025937 Ga0207669_10116448 Ga0207669_101164482 251
773 3300025937 Ga0207669_10268270 Ga0207669_102682702 251
774 3300025939 Ga0207665_10002070 Ga0207665_100020704 251
775 3300025940 Ga0207691_10002229 Ga0207691_1000222911 251
776 3300025940 Ga0207691_10049499 Ga0207691_100494996 251
777 3300025941 Ga0207711_10021522 Ga0207711_100215224 251
778 3300025941 Ga0207711_10157291 Ga0207711_101572912 251
779 3300025942 Ga0207689_10031906 Ga0207689_100319064 251
780 3300025944 Ga0207661_10014893 Ga0207661_100148933 251
781 3300025945 Ga0207679_10004969 Ga0207679_100049696 251
782 3300025945 Ga0207679_10005906 Ga0207679_100059065 251
783 3300025960 Ga0207651_10021675 Ga0207651_100216754 251
784 3300025960 Ga0207651_10251025 Ga0207651_102510252 251
785 3300025961 Ga0207712_10086944 Ga0207712_100869442 251
786 3300025972 Ga0207668_10147306 Ga0207668_101473062 251
787 3300025972 Ga0207668_10278751 Ga0207668_102787512 251
788 3300025986 Ga0207658_10052827 Ga0207658_100528275 251
789 3300026075 Ga0207708_10005792 Ga0207708_100057922 251
790 3300026078 Ga0207702_10005592 Ga0207702_1000559210 251
791 3300026089 Ga0207648_10041704 Ga0207648_100417042 251
792 3300026089 Ga0207648_10131467 Ga0207648_101314672 251
793 3300026089 Ga0207648_10256514 Ga0207648_102565141 251
794 3300026095 Ga0207676_10037914 Ga0207676_100379144 251
795 3300026116 Ga0207674_10099214 Ga0207674_100992144 251
796 3300026118 Ga0207675_100019931 Ga0207675_1000199312 251
797 3300026118 Ga0207675_100395210 Ga0207675_1003952102 251
798 3300026121 Ga0207683_10005345 Ga0207683_100053454 251
799 3300027866 Ga0209813_10000439 Ga0209813_1000043910 251
800 3300027907 Ga0207428_10071999 Ga0207428_100719992 251
801 3300028381 Ga0268264_10263090 Ga0268264_102630902 251
802 3300028577 Ga0265318_10019415 Ga0265318_100194153 251
803 3300028800 Ga0265338_10025744 Ga0265338_100257446 251
804 3300031238 Ga0265332_10021677 Ga0265332_100216772 251
805 3300031239 Ga0265328_10001141 Ga0265328_100011413 251
806 3300031239 Ga0265328_10060572 Ga0265328_100605722 251
807 3300031240 Ga0265320_10021757 Ga0265320_100217572 251
808 3300031249 Ga0265339_10014115 Ga0265339_100141152 251
809 3300031250 Ga0265331_10002218 Ga0265331_1000221812 251
810 3300031344 Ga0265316_10161324 Ga0265316_101613242 251
811 3300031595 Ga0265313_10048632 Ga0265313_100486323 251
812 3300031595 Ga0265313_10049261 Ga0265313_100492612 251
813 3300031711 Ga0265314_10000455 Ga0265314_1000045525 251
814 3300031712 Ga0265342_10010977 Ga0265342_100109776 251
815 3300035092 Ga0373952_0002199 Ga0373952_0002199_1246_2118 251
816 3300041512 Ga0451853_1019298 Ga0451853_1019298_943_1818 251
817 3300042006 Ga0439432_061079 Ga0439432_061079_195_1019 251
818 3300044712 Ga0453684_0258849 Ga0453684_0258849_548_1372 251
819 3300045836 Ga0466958_0018276 Ga0466958_0018276_1695_2522 251
820 3300046458 Ga0495591_052461 Ga0495591_052461_22_897 251
821 3300046616 Ga0495668_0035307 Ga0495668_0035307_1708_2568 251
822 3300046681 Ga0495647_0083328 Ga0495647_0083328_353_1228 251
823 3300046683 Ga0495658_0028301 Ga0495658_0028301_503_1378 251
824 3300047472 Ga0495686_0000702 Ga0495686_0000702_20924_21748 251
825 3300048911 Ga0496108_0022008 Ga0496108_0022008_3141_4016 251
826 3300048912 Ga0496109_0009383 Ga0496109_0009383_254_1129 251
827 3300048913 Ga0496110_0085587 Ga0496110_0085587_300_1160 251
828 3300049572 Ga0501036_0189859 Ga0501036_0189859_536_1396 251
829 3300049576 Ga0501040_0178300 Ga0501040_0178300_84_944 251
830 3300049577 Ga0501041_0138857 Ga0501041_0138857_283_1143 251
831 3300049577 Ga0501041_0166089 Ga0501041_0166089_212_1072 251
832 3300049582 Ga0501048_0091038 Ga0501048_0091038_946_1806 251
833 3300049582 Ga0501048_0107988 Ga0501048_0107988_354_1214 251
834 3300049588 Ga0501072_0273859 Ga0501072_0273859_32_892 251
835 3300049591 Ga0501075_0228713 Ga0501075_0228713_333_1193 251
836 3300049592 Ga0501076_0074483 Ga0501076_0074483_341_1201 251
837 3300049592 Ga0501076_0241119 Ga0501076_0241119_306_1166 251
838 3300049593 Ga0501077_0073378 Ga0501077_0073378_249_1109 251
839 3300049741 Ga0501079_0040252 Ga0501079_0040252_1640_2500 251
840 3300049743 Ga0501081_0054646 Ga0501081_0054646_1069_1929 251
841 3300049743 Ga0501081_0247782 Ga0501081_0247782_89_949 251
842 3300049824 Ga0501045_0069668 Ga0501045_0069668_777_1637 251
843 3300050490 nmdc:mga03n38_1014_c1 nmdc:mga03n38_1014_c1_1287_2147 251
844 3300050491 nmdc:mga00v17_166394_c1 nmdc:mga00v17_166394_c1_471_1331 251
845 3300050492 nmdc:mga0yw44_43238_c1 nmdc:mga0yw44_43238_c1_370_1230 251
846 3300050494 nmdc:mga06z11_1371_c1 nmdc:mga06z11_1371_c1_5927_6787 251
847 3300050495 nmdc:mga04h51_1352_c1 nmdc:mga04h51_1352_c1_154_1014 251
848 3300050507 nmdc:mga05p37_183426_c1 nmdc:mga05p37_183426_c1_1423_2283 251
849 3300050507 nmdc:mga05p37_355_c1 nmdc:mga05p37_355_c1_39990_40862 251
850 3300050508 nmdc:mga09592_1014_c1 nmdc:mga09592_1014_c1_952_1824 251
851 3300050510 nmdc:mga06r32_235640_c1 nmdc:mga06r32_235640_c1_473_1333 251
852 3300050512 nmdc:mga0n895_68170_c1 nmdc:mga0n895_68170_c1_536_1396 251
853 3300050513 nmdc:mga0rr50_140887_c1 nmdc:mga0rr50_140887_c1_883_1743 251
854 3300050515 nmdc:mga0a205_207992_c1 nmdc:mga0a205_207992_c1_342_1202 251
855 3300054114 Ga0501084_0237093 Ga0501084_0237093_588_1448 251
856 3300061734 Ga0530510_0160733 Ga0530510_0160733_467_1327 251
857 3300061734 Ga0530510_0401196 Ga0530510_0401196_25_885 251
858 iso_pu_bacteria 2643221660 2644340520 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

291

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7365 15 240
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7158 60 245
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.714 15 241
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7132 60 245
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.7112 50 236
ID Description Score Start End Superfamily
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9095 69 240 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9074 65 240 1.10.3720.10
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9032 69 244 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8757 65 240 1.10.3720.10
af_Q2FVH1_15_213_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8728 65 245 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A536U9N4-F1-model_v4 ABC transporter permease 0.9465 39 247 GO:0005886
GO:0055085
AF-A0A2S6UQ86-F1-model_v4 Bicarbonate transport system permease protein CmpB 0.9393 37 250 GO:0005886
GO:0055085
AF-B1A4J7-F1-model_v4 Binding-protein-dependent transport-like protein 0.9305 45 246 GO:0005886
GO:0055085
AF-A0A7I8CNJ3-F1-model_v4 ABC transporter permease 0.9291 45 247 GO:0005886
GO:0055085
AF-A0A0A8XG95-F1-model_v4 Nitrate ABC transporter, permease protein 0.9275 45 246 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
89.48 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map