F483698

General Info

Members Datasets Scaffolds Average Seq Length
857 288 1714 145

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0188518|Ga0466967_0188518_463_936
Length 157
Sequence MDIALRAIFLYAFVVFLMRVMGRRELSSLSAIDLVLLIVLGDAIQQGLTQDDYSVTGAVIAVSTIAAVQVGSSYLSYRSRRMRRVLEGEPIVIVQAGKLIERNMKRERLTEDEVAEEMRTQQIASVGDVEWGILESDGTMSFIPKNPRPTAAGRSWA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
175 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
176 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
177 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
178 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
179 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
183 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
184 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
197 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
210 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
213 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
214 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
222 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
223 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
224 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
225 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
260 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
261 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
262 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
263 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
268 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
269 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
270 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
271 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
272 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
283 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.72
Metatranscriptomes 1.28
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 11.32
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 26.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0188518 3300045976 Unclassified 1948
2 JGI24746J21847_1024597 3300001977 Unclassified 834
3 JGI24751J29686_10084866 3300002459 Unclassified 657
4 Ga0065712_10120415 3300005290 Bacteria 1679
5 Ga0065715_10335807 3300005293 Unclassified 975
6 Ga0070658_10056846 3300005327 Bacteria 3181
7 Ga0070658_10078745 3300005327 Bacteria 2706
8 Ga0070658_10156069 3300005327 Bacteria 1913
9 Ga0070658_10221886 3300005327 Unclassified 1599
10 Ga0070683_100038026 3300005329 Bacteria 4409
11 Ga0070683_100066613 3300005329 Bacteria 3355
12 Ga0070683_100095696 3300005329 Bacteria 2792
13 Ga0070683_100112761 3300005329 Bacteria 2566
14 Ga0070683_100173035 3300005329 Bacteria 2050
15 Ga0070683_100743225 3300005329 Unclassified 940
16 Ga0070690_101099849 3300005330 Unclassified 630
17 Ga0070670_100094769 3300005331 Unclassified 2567
18 Ga0070677_10181137 3300005333 Unclassified 1003
19 Ga0068869_100538551 3300005334 Unclassified 979
20 Ga0070680_100014676 3300005336 Bacteria 6126
21 Ga0070680_100052938 3300005336 Bacteria 3313
22 Ga0070680_100061167 3300005336 Bacteria 3082
23 Ga0070680_100078728 3300005336 Unclassified 2716
24 Ga0070682_100017035 3300005337 Bacteria 4232
25 Ga0070682_100029295 3300005337 Bacteria 3313
26 Ga0070682_100081456 3300005337 Unclassified 2096
27 Ga0070682_100292287 3300005337 Unclassified 1192
28 Ga0070682_101146206 3300005337 Unclassified 653
29 Ga0070682_101257976 3300005337 Unclassified 627
30 Ga0068868_100043392 3300005338 Bacteria 3513
31 Ga0068868_100880038 3300005338 Unclassified 813
32 Ga0070660_100007754 3300005339 Bacteria 7487
33 Ga0070660_100123379 3300005339 Bacteria 2068
34 Ga0070691_10057135 3300005341 Unclassified 1871
35 Ga0070691_10233364 3300005341 Bacteria 980
36 Ga0070691_10827082 3300005341 Unclassified 566
37 Ga0070687_100417177 3300005343 Unclassified 884
38 Ga0070661_100129574 3300005344 Bacteria 1894
39 Ga0070661_100232235 3300005344 Bacteria 1418
40 Ga0070661_100838304 3300005344 Unclassified 756
41 Ga0070661_100994194 3300005344 Bacteria 696
42 Ga0070692_10424487 3300005345 Unclassified 845
43 Ga0070668_100855552 3300005347 Unclassified 811
44 Ga0070668_100952540 3300005347 Unclassified 769
45 Ga0070669_100507769 3300005353 Unclassified 1001
46 Ga0070671_100142316 3300005355 Bacteria 2024
47 Ga0070671_100378232 3300005355 Unclassified 1210
48 Ga0070674_100078318 3300005356 Unclassified 2355
49 Ga0070674_100213567 3300005356 Bacteria 1497
50 Ga0070674_100266839 3300005356 Bacteria 1351
51 Ga0070674_100337825 3300005356 Unclassified 1212
52 Ga0070673_100443304 3300005364 Unclassified 1167
53 Ga0070673_101188583 3300005364 Bacteria 714
54 Ga0070688_100799427 3300005365 Unclassified 737
55 Ga0070659_100056043 3300005366 Bacteria 3107
56 Ga0070659_100554868 3300005366 Unclassified 984
57 Ga0070709_10437401 3300005434 Unclassified 983
58 Ga0070714_100009235 3300005435 Bacteria 7746
59 Ga0070714_100045826 3300005435 Bacteria 3708
60 Ga0070714_100123253 3300005435 Bacteria 2308
61 Ga0070713_100643534 3300005436 Unclassified 1009
62 Ga0070713_101186748 3300005436 Bacteria 739
63 Ga0070701_10140042 3300005438 Unclassified 1382
64 Ga0070711_100048624 3300005439 Bacteria 2902
65 Ga0070705_100521343 3300005440 Unclassified 906
66 Ga0070705_100563056 3300005440 Bacteria 876
67 Ga0070700_100766897 3300005441 Unclassified 773
68 Ga0070700_101240142 3300005441 Unclassified 624
69 Ga0070694_100397165 3300005444 Bacteria 1079
70 Ga0070694_100744267 3300005444 Unclassified 800
71 Ga0070663_100001354 3300005455 Bacteria 13389
72 Ga0070663_100433268 3300005455 Bacteria 1081
73 Ga0070663_101104875 3300005455 Bacteria 693
74 Ga0070663_101152557 3300005455 Unclassified 680
75 Ga0070678_100026290 3300005456 Bacteria 3932
76 Ga0070678_100047140 3300005456 Bacteria 3095
77 Ga0070678_100380900 3300005456 Unclassified 1220
78 Ga0070662_100027753 3300005457 Bacteria 3934
79 Ga0070662_100505282 3300005457 Unclassified 1009
80 Ga0070681_10004088 3300005458 Bacteria 13788
81 Ga0070681_10005202 3300005458 Bacteria 12561
82 Ga0070681_10013493 3300005458 Bacteria 8120
83 Ga0070681_10022680 3300005458 Bacteria 6307
84 Ga0070681_10101498 3300005458 Unclassified 2823
85 Ga0070681_10256807 3300005458 Bacteria 1659
86 Ga0070681_10307627 3300005458 Bacteria 1494
87 Ga0070681_10356307 3300005458 Bacteria 1373
88 Ga0070685_10013576 3300005466 Unclassified 4299
89 Ga0070685_10346423 3300005466 Unclassified 1014
90 Ga0070679_100001302 3300005530 Bacteria 22036
91 Ga0070679_100012229 3300005530 Bacteria 8198
92 Ga0070679_100112115 3300005530 Bacteria 2713
93 Ga0070679_100125296 3300005530 Bacteria 2551
94 Ga0070679_100260684 3300005530 Unclassified 1689
95 Ga0070679_100341246 3300005530 Bacteria 1446
96 Ga0070679_100782114 3300005530 Unclassified 897
97 Ga0070679_101292471 3300005530 Bacteria 675
98 Ga0070684_100003652 3300005535 Bacteria 11603
99 Ga0070684_100039454 3300005535 Bacteria 4061
100 Ga0070684_100113814 3300005535 Bacteria 2428
101 Ga0070684_100523130 3300005535 Bacteria 1099
102 Ga0070684_100537319 3300005535 Bacteria 1084
103 Ga0070684_100987293 3300005535 Unclassified 790
104 Ga0070697_100039698 3300005536 Unclassified 3807
105 Ga0070697_100735848 3300005536 Unclassified 871
106 Ga0068853_100948589 3300005539 Unclassified 827
107 Ga0070672_100122696 3300005543 Unclassified 2128
108 Ga0070686_100402154 3300005544 Bacteria 1042
109 Ga0070686_100583530 3300005544 Unclassified 879
110 Ga0070695_100002173 3300005545 Bacteria 11236
111 Ga0070695_100092348 3300005545 Unclassified 2023
112 Ga0070695_100221164 3300005545 Unclassified 1364
113 Ga0070695_100722385 3300005545 Bacteria 792
114 Ga0070696_100012188 3300005546 Bacteria 5761
115 Ga0070696_100184129 3300005546 Bacteria 1551
116 Ga0070696_100962415 3300005546 Unclassified 711
117 Ga0070696_101461554 3300005546 Bacteria 584
118 Ga0070693_100003297 3300005547 Bacteria 7498
119 Ga0070693_100061708 3300005547 Bacteria 2180
120 Ga0070665_100208549 3300005548 Unclassified 1954
121 Ga0070704_100345547 3300005549 Unclassified 1254
122 Ga0070704_101659601 3300005549 Unclassified 590
123 Ga0068855_100108954 3300005563 Bacteria 3181
124 Ga0068855_100354051 3300005563 Unclassified 1617
125 Ga0068855_101433182 3300005563 Unclassified 711
126 Ga0070664_100188195 3300005564 Bacteria 1838
127 Ga0070664_100414408 3300005564 Unclassified 1233
128 Ga0070664_100530627 3300005564 Unclassified 1087
129 Ga0070664_101287880 3300005564 Unclassified 690
130 Ga0068857_100002399 3300005577 Bacteria 15278
131 Ga0068857_102270773 3300005577 Unclassified 533
132 Ga0068857_102505781 3300005577 Unclassified 506
133 Ga0068854_100519197 3300005578 Bacteria 1006
134 Ga0068854_100871254 3300005578 Bacteria 790
135 Ga0068854_100941431 3300005578 Unclassified 761
136 Ga0068856_100032154 3300005614 Bacteria 5136
137 Ga0068856_100072526 3300005614 Bacteria 3409
138 Ga0068856_100078848 3300005614 Bacteria 3265
139 Ga0068856_100110734 3300005614 Bacteria 2743
140 Ga0068856_100127835 3300005614 Bacteria 2545
141 Ga0068856_100221143 3300005614 Bacteria 1909
142 Ga0068856_100234044 3300005614 Bacteria 1852
143 Ga0068856_100569976 3300005614 Bacteria 1153
144 Ga0068856_101332600 3300005614 Bacteria 733
145 Ga0068852_100117174 3300005616 Bacteria 2432
146 Ga0068852_100941657 3300005616 Bacteria 881
147 Ga0068864_100122839 3300005618 Unclassified 2324
148 Ga0068866_10154714 3300005718 Unclassified 1331
149 Ga0068866_10299247 3300005718 Bacteria 1004
150 Ga0068863_100171806 3300005841 Unclassified 2079
151 Ga0068863_100813460 3300005841 Bacteria 932
152 Ga0068860_100562793 3300005843 Bacteria 1143
153 Ga0081539_10018807 3300005985 Unclassified 4765
154 Ga0081539_10043615 3300005985 Bacteria 2597
155 Ga0070717_10007314 3300006028 Bacteria 8193
156 Ga0070717_10020944 3300006028 Bacteria 5148
157 Ga0070716_100651057 3300006173 Bacteria 799
158 Ga0070712_100081037 3300006175 Bacteria 2351
159 Ga0070712_100246004 3300006175 Bacteria 1427
160 Ga0097621_100754588 3300006237 Bacteria 899
161 Ga0075428_100297052 3300006844 Unclassified 1737
162 Ga0075430_100317136 3300006846 Bacteria 1289
163 Ga0075431_100779524 3300006847 Unclassified 930
164 Ga0075433_10013206 3300006852 Bacteria 6705
165 Ga0075433_10303479 3300006852 Bacteria 1414
166 Ga0075433_10912236 3300006852 Bacteria 766
167 Ga0075434_100002825 3300006871 Bacteria 15378
168 Ga0075434_100007883 3300006871 Bacteria 9863
169 Ga0075434_100182047 3300006871 Bacteria 2122
170 Ga0075434_100370031 3300006871 Bacteria 1454
171 Ga0068865_100114685 3300006881 Unclassified 1993
172 Ga0068865_100706932 3300006881 Bacteria 862
173 Ga0075436_100050747 3300006914 Bacteria 2863
174 Ga0075436_100072955 3300006914 Unclassified 2375
175 Ga0075436_100591600 3300006914 Bacteria 817
176 Ga0075435_100083098 3300007076 Unclassified 2632
177 Ga0075435_100100650 3300007076 Unclassified 2394
178 Ga0075435_100212090 3300007076 Bacteria 1643
179 Ga0075435_100217215 3300007076 Bacteria 1623
180 Ga0075435_100306275 3300007076 Bacteria 1359
181 Ga0099795_10508781 3300007788 Unclassified 562
182 Ga0105240_10013540 3300009093 Bacteria 11196
183 Ga0105240_10124766 3300009093 Bacteria 3096
184 Ga0105240_10587452 3300009093 Bacteria 1228
185 Ga0111539_10002777 3300009094 Bacteria 23238
186 Ga0111539_10041358 3300009094 Bacteria 5542
187 Ga0111539_10092843 3300009094 Bacteria 3546
188 Ga0111539_10527759 3300009094 Bacteria 1375
189 Ga0111539_10853207 3300009094 Unclassified 1060
190 Ga0105245_10034907 3300009098 Bacteria 4462
191 Ga0105245_10050771 3300009098 Bacteria 3718
192 Ga0105245_10123449 3300009098 Bacteria 2421
193 Ga0105245_10131498 3300009098 Unclassified 2348
194 Ga0105245_10178243 3300009098 Unclassified 2028
195 Ga0105245_10264020 3300009098 Unclassified 1676
196 Ga0114129_10282382 3300009147 Bacteria 2218
197 Ga0114129_10400255 3300009147 Bacteria 1809
198 Ga0105243_10029991 3300009148 Bacteria 4186
199 Ga0105243_10285175 3300009148 Unclassified 1489
200 Ga0105243_10777349 3300009148 Bacteria 941
201 Ga0105243_11963785 3300009148 Bacteria 619
202 Ga0105241_10034607 3300009174 Bacteria 3796
203 Ga0105241_10614045 3300009174 Bacteria 984
204 Ga0105242_10011248 3300009176 Bacteria 6877
205 Ga0105242_10236200 3300009176 Unclassified 1641
206 Ga0105242_10760862 3300009176 Bacteria 955
207 Ga0105242_10886736 3300009176 Unclassified 891
208 Ga0105242_11478576 3300009176 Bacteria 709
209 Ga0105248_10127892 3300009177 Bacteria 2866
210 Ga0105248_10151731 3300009177 Unclassified 2614
211 Ga0105248_10536607 3300009177 Bacteria 1319
212 Ga0105248_10756973 3300009177 Unclassified 1096
213 Ga0105248_10781677 3300009177 Bacteria 1077
214 Ga0105237_10061228 3300009545 Bacteria 3764
215 Ga0105237_10326261 3300009545 Bacteria 1539
216 Ga0105237_10947321 3300009545 Bacteria 868
217 Ga0105238_10083356 3300009551 Bacteria 3186
218 Ga0105238_10109300 3300009551 Bacteria 2746
219 Ga0105238_10233605 3300009551 Bacteria 1815
220 Ga0105238_10381129 3300009551 Bacteria 1402
221 Ga0105238_10508735 3300009551 Bacteria 1206
222 Ga0105249_10135924 3300009553 Unclassified 2352
223 Ga0105249_10424569 3300009553 Bacteria 1364
224 Ga0105239_10011216 3300010375 Bacteria 10001
225 Ga0105239_10039700 3300010375 Bacteria 5157
226 Ga0105239_10042402 3300010375 Bacteria 4987
227 Ga0105239_10082056 3300010375 Bacteria 3549
228 Ga0105239_10285610 3300010375 Bacteria 1858
229 Ga0105239_10338218 3300010375 Unclassified 1698
230 Ga0105239_10460456 3300010375 Unclassified 1443
231 Ga0105239_11344634 3300010375 Bacteria 824
232 Ga0105239_11355104 3300010375 Unclassified 821
233 Ga0105246_10030372 3300011119 Bacteria 3568
234 Ga0105246_10033922 3300011119 Unclassified 3395
235 Ga0105246_12108905 3300011119 Bacteria 546
236 Ga0157320_1011300 3300012481 Bacteria 701
237 Ga0157371_10221846 3300013102 Bacteria 1358
238 Ga0157371_10234463 3300013102 Bacteria 1319
239 Ga0157371_11390168 3300013102 Bacteria 545
240 Ga0157370_10187652 3300013104 Bacteria 1919
241 Ga0157370_10359089 3300013104 Bacteria 1343
242 Ga0157369_10023673 3300013105 Bacteria 6840
243 Ga0157369_10082298 3300013105 Bacteria 3444
244 Ga0157369_10812863 3300013105 Bacteria 960
245 Ga0157369_10909693 3300013105 Bacteria 902
246 Ga0157369_10919951 3300013105 Bacteria 897
247 Ga0157369_12005403 3300013105 Bacteria 587
248 Ga0157374_10017674 3300013296 Bacteria 6284
249 Ga0157374_10075205 3300013296 Bacteria 3192
250 Ga0157374_11189713 3300013296 Unclassified 783
251 Ga0157378_10150072 3300013297 Unclassified 2171
252 Ga0163162_10182775 3300013306 Bacteria 2223
253 Ga0163162_10386424 3300013306 Bacteria 1533
254 Ga0163162_11711503 3300013306 Unclassified 718
255 Ga0163162_12295425 3300013306 Unclassified 620
256 Ga0157372_10048315 3300013307 Bacteria 4730
257 Ga0157372_10112115 3300013307 Bacteria 3125
258 Ga0157372_10115264 3300013307 Bacteria 3081
259 Ga0157372_10191177 3300013307 Bacteria 2371
260 Ga0157372_10224887 3300013307 Bacteria 2176
261 Ga0157372_10359948 3300013307 Bacteria 1695
262 Ga0157372_10381454 3300013307 Unclassified 1642
263 Ga0157372_10720582 3300013307 Bacteria 1160
264 Ga0157372_11343878 3300013307 Bacteria 824
265 Ga0157372_11894199 3300013307 Bacteria 685
266 Ga0157375_10014286 3300013308 Bacteria 7080
267 Ga0157375_10123813 3300013308 Bacteria 2698
268 Ga0157375_10242929 3300013308 Bacteria 1960
269 Ga0157375_10374382 3300013308 Bacteria 1590
270 Ga0157375_10551564 3300013308 Bacteria 1314
271 Ga0163163_10052869 3300014325 Bacteria 4008
272 Ga0163163_10186191 3300014325 Unclassified 2124
273 Ga0163163_10194136 3300014325 Bacteria 2078
274 Ga0163163_12588381 3300014325 Bacteria 565
275 Ga0157380_10113205 3300014326 Unclassified 2284
276 Ga0157380_11993028 3300014326 Bacteria 642
277 Ga0182008_10261199 3300014497 Bacteria 896
278 Ga0157377_10046768 3300014745 Unclassified 2422
279 Ga0157377_10137012 3300014745 Bacteria 1501
280 Ga0157377_10548486 3300014745 Bacteria 816
281 Ga0157379_10540545 3300014968 Bacteria 1083
282 Ga0157379_11190969 3300014968 Bacteria 732
283 Ga0157376_10075638 3300014969 Bacteria 2874
284 Ga0157376_10177102 3300014969 Unclassified 1946
285 Ga0163161_11401243 3300017792 Bacteria 610
286 Ga0197907_10809293 3300020069 Unclassified 816
287 Ga0206356_11892448 3300020070 Bacteria 3059
288 Ga0206355_1270139 3300020076 Bacteria 967
289 Ga0206354_10299673 3300020081 Bacteria 2684
290 Ga0206353_10059895 3300020082 Unclassified 617
291 Ga0206353_10877554 3300020082 Unclassified 856
292 Ga0213876_10002035 3300021384 Bacteria 12024
293 Ga0224712_10007156 3300022467 Bacteria 3230
294 Ga0224712_10175156 3300022467 Unclassified 964
295 Ga0224712_10188025 3300022467 Bacteria 934
296 Ga0224712_10244316 3300022467 Unclassified 828
297 Ga0207642_10112109 3300025899 Bacteria 1391
298 Ga0207642_10240720 3300025899 Unclassified 1021
299 Ga0207688_10028876 3300025901 Unclassified 3051
300 Ga0207688_10399678 3300025901 Bacteria 852
301 Ga0207699_10134773 3300025906 Unclassified 1616
302 Ga0207699_11152367 3300025906 Bacteria 574
303 Ga0207643_10003437 3300025908 Bacteria 8518
304 Ga0207705_10095069 3300025909 Bacteria 2186
305 Ga0207705_10096644 3300025909 Bacteria 2169
306 Ga0207705_10162124 3300025909 Bacteria 1680
307 Ga0207684_10219608 3300025910 Unclassified 1640
308 Ga0207654_10089438 3300025911 Unclassified 1873
309 Ga0207654_10546675 3300025911 Bacteria 822
310 Ga0207654_11300431 3300025911 Unclassified 530
311 Ga0207707_10004701 3300025912 Bacteria 11981
312 Ga0207707_10020322 3300025912 Bacteria 5799
313 Ga0207707_10023248 3300025912 Bacteria 5424
314 Ga0207707_10073838 3300025912 Bacteria 2974
315 Ga0207707_10100098 3300025912 Bacteria 2533
316 Ga0207707_10609786 3300025912 Bacteria 923
317 Ga0207695_10009334 3300025913 Bacteria 12136
318 Ga0207695_10013582 3300025913 Bacteria 9700
319 Ga0207695_11650563 3300025913 Unclassified 522
320 Ga0207671_10059594 3300025914 Bacteria 2831
321 Ga0207671_10549646 3300025914 Unclassified 921
322 Ga0207693_10093940 3300025915 Bacteria 2351
323 Ga0207693_10155180 3300025915 Bacteria 1800
324 Ga0207660_10023976 3300025917 Bacteria 4126
325 Ga0207660_10106618 3300025917 Unclassified 2101
326 Ga0207660_10278290 3300025917 Bacteria 1327
327 Ga0207660_10331930 3300025917 Unclassified 1216
328 Ga0207662_10670925 3300025918 Unclassified 725
329 Ga0207657_10138275 3300025919 Unclassified 1992
330 Ga0207657_10237473 3300025919 Unclassified 1456
331 Ga0207649_10200783 3300025920 Bacteria 1408
332 Ga0207652_10000283 3300025921 Bacteria 52945
333 Ga0207652_10033729 3300025921 Bacteria 4311
334 Ga0207652_10044714 3300025921 Unclassified 3773
335 Ga0207652_10333599 3300025921 Bacteria 1369
336 Ga0207652_10468371 3300025921 Bacteria 1135
337 Ga0207652_10538930 3300025921 Bacteria 1049
338 Ga0207681_10988577 3300025923 Bacteria 706
339 Ga0207681_11023697 3300025923 Unclassified 693
340 Ga0207694_10069985 3300025924 Bacteria 2741
341 Ga0207694_10382363 3300025924 Bacteria 1169
342 Ga0207694_10443394 3300025924 Bacteria 1083
343 Ga0207694_10456862 3300025924 Bacteria 1067
344 Ga0207650_10078957 3300025925 Unclassified 2491
345 Ga0207650_10692381 3300025925 Bacteria 861
346 Ga0207659_10098446 3300025926 Unclassified 2199
347 Ga0207659_10728915 3300025926 Bacteria 850
348 Ga0207687_10021930 3300025927 Bacteria 4246
349 Ga0207687_10125498 3300025927 Unclassified 1926
350 Ga0207687_10165138 3300025927 Bacteria 1703
351 Ga0207687_10396579 3300025927 Bacteria 1134
352 Ga0207687_10521945 3300025927 Unclassified 993
353 Ga0207687_10545959 3300025927 Bacteria 972
354 Ga0207687_11031617 3300025927 Bacteria 705
355 Ga0207687_11160296 3300025927 Bacteria 664
356 Ga0207700_10041273 3300025928 Bacteria 3374
357 Ga0207700_10226887 3300025928 Unclassified 1586
358 Ga0207700_10525382 3300025928 Unclassified 1049
359 Ga0207700_10655736 3300025928 Bacteria 936
360 Ga0207700_10805772 3300025928 Bacteria 840
361 Ga0207700_10979618 3300025928 Bacteria 757
362 Ga0207664_10001938 3300025929 Bacteria 13599
363 Ga0207644_10276223 3300025931 Bacteria 1348
364 Ga0207644_10581815 3300025931 Bacteria 929
365 Ga0207644_10777748 3300025931 Unclassified 800
366 Ga0207644_10969937 3300025931 Unclassified 713
367 Ga0207690_10164060 3300025932 Bacteria 1659
368 Ga0207690_10671196 3300025932 Unclassified 850
369 Ga0207706_10492641 3300025933 Unclassified 1058
370 Ga0207706_10697905 3300025933 Unclassified 867
371 Ga0207686_10130146 3300025934 Unclassified 1725
372 Ga0207686_10569034 3300025934 Unclassified 888
373 Ga0207686_10948309 3300025934 Unclassified 696
374 Ga0207709_10049473 3300025935 Unclassified 2566
375 Ga0207709_10567370 3300025935 Bacteria 895
376 Ga0207669_10070436 3300025937 Unclassified 2192
377 Ga0207669_10139204 3300025937 Bacteria 1682
378 Ga0207669_10328551 3300025937 Bacteria 1173
379 Ga0207704_10028781 3300025938 Unclassified 3088
380 Ga0207665_10510887 3300025939 Unclassified 929
381 Ga0207691_10076084 3300025940 Unclassified 3025
382 Ga0207711_10245870 3300025941 Bacteria 1641
383 Ga0207711_10417228 3300025941 Bacteria 1248
384 Ga0207711_10564715 3300025941 Unclassified 1061
385 Ga0207711_10843003 3300025941 Unclassified 853
386 Ga0207689_11142484 3300025942 Bacteria 656
387 Ga0207661_10004372 3300025944 Bacteria 9903
388 Ga0207661_10027070 3300025944 Bacteria 4377
389 Ga0207661_10050294 3300025944 Bacteria 3320
390 Ga0207661_10069025 3300025944 Bacteria 2880
391 Ga0207661_10359967 3300025944 Bacteria 1314
392 Ga0207661_11050249 3300025944 Bacteria 750
393 Ga0207661_11261593 3300025944 Bacteria 679
394 Ga0207679_10037399 3300025945 Bacteria 3450
395 Ga0207679_10090402 3300025945 Bacteria 2367
396 Ga0207679_10478832 3300025945 Unclassified 1108
397 Ga0207679_10925767 3300025945 Unclassified 798
398 Ga0207667_10271348 3300025949 Bacteria 1734
399 Ga0207667_10382714 3300025949 Bacteria 1433
400 Ga0207667_10442617 3300025949 Bacteria 1321
401 Ga0207667_11240439 3300025949 Unclassified 724
402 Ga0207651_10298943 3300025960 Unclassified 1338
403 Ga0207651_10608598 3300025960 Bacteria 956
404 Ga0207712_10129338 3300025961 Unclassified 1922
405 Ga0207640_10299915 3300025981 Bacteria 1271
406 Ga0207640_10947620 3300025981 Bacteria 754
407 Ga0207677_10230219 3300026023 Unclassified 1492
408 Ga0207677_10662147 3300026023 Bacteria 923
409 Ga0207677_11385649 3300026023 Unclassified 647
410 Ga0207639_10817826 3300026041 Bacteria 869
411 Ga0207678_10013062 3300026067 Bacteria 7285
412 Ga0207708_10755092 3300026075 Unclassified 835
413 Ga0207708_11190730 3300026075 Bacteria 666
414 Ga0207702_10039544 3300026078 Bacteria 3953
415 Ga0207702_10068719 3300026078 Bacteria 3044
416 Ga0207702_10088160 3300026078 Bacteria 2710
417 Ga0207702_10148985 3300026078 Bacteria 2127
418 Ga0207702_10167498 3300026078 Unclassified 2011
419 Ga0207702_10270940 3300026078 Bacteria 1601
420 Ga0207702_10324224 3300026078 Unclassified 1468
421 Ga0207702_10464061 3300026078 Bacteria 1230
422 Ga0207702_11082209 3300026078 Bacteria 796
423 Ga0207641_10287345 3300026088 Unclassified 1549
424 Ga0207676_10132016 3300026095 Unclassified 2125
425 Ga0207674_10001651 3300026116 Bacteria 28696
426 Ga0207674_10167990 3300026116 Bacteria 2147
427 Ga0207675_102313393 3300026118 Unclassified 551
428 Ga0207683_10025974 3300026121 Bacteria 5056
429 Ga0207683_10032734 3300026121 Bacteria 4516
430 Ga0207683_10070937 3300026121 Bacteria 3078
431 Ga0207698_10118962 3300026142 Bacteria 2232
432 Ga0207428_10010153 3300027907 Bacteria 8421
433 Ga0207428_10264845 3300027907 Bacteria 1279
434 Ga0268264_10361536 3300028381 Bacteria 1385
435 Ga0307408_101032380 3300031548 Bacteria 759
436 Ga0307413_10778497 3300031824 Bacteria 802
437 Ga0307406_10103704 3300031901 Bacteria 1943
438 Ga0307409_100481401 3300031995 Bacteria 1204
439 Ga0307416_100282394 3300032002 Bacteria 1638
440 Ga0307415_100032554 3300032126 Bacteria 3373
441 Ga0373943_0285475 3300035170 Bacteria 934
442 Ga0373935_0105670 3300035692 Bacteria 1862
443 Ga0373947_0823712 3300035725 Bacteria 634
444 Ga0373925_0223348 3300037068 Bacteria 1504
445 Ga0373925_0269930 3300037068 Bacteria 1368
446 Ga0395899_0001741 3300037312 Bacteria 18107
447 Ga0395899_0030651 3300037312 Bacteria 4044
448 Ga0395899_0102604 3300037312 Bacteria 2064
449 Ga0395899_0238490 3300037312 Bacteria 1252
450 Ga0395899_0324208 3300037312 Bacteria 1037
451 Ga0395899_0340715 3300037312 Bacteria 1005
452 Ga0395899_0627842 3300037312 Unclassified 681
453 Ga0395900_0002164 3300037418 Bacteria 21947
454 Ga0395900_0004516 3300037418 Bacteria 14725
455 Ga0395900_0006695 3300037418 Bacteria 11971
456 Ga0395900_0007275 3300037418 Bacteria 11460
457 Ga0395900_0018846 3300037418 Bacteria 7038
458 Ga0395900_0030866 3300037418 Bacteria 5503
459 Ga0395900_0082545 3300037418 Bacteria 3302
460 Ga0395900_0104329 3300037418 Bacteria 2912
461 Ga0395900_0106169 3300037418 Bacteria 2884
462 Ga0395900_0288820 3300037418 Bacteria 1629
463 Ga0395900_0354020 3300037418 Bacteria 1441
464 Ga0395900_0405535 3300037418 Unclassified 1326
465 Ga0395900_0618903 3300037418 Bacteria 1022
466 Ga0395900_0999896 3300037418 Bacteria 756
467 Ga0395900_1016280 3300037418 Bacteria 749
468 Ga0395900_1104513 3300037418 Bacteria 710
469 Ga0395898_0001577 3300037466 Bacteria 31168
470 Ga0395898_0005425 3300037466 Bacteria 13771
471 Ga0395898_0007535 3300037466 Bacteria 11558
472 Ga0395898_0030126 3300037466 Bacteria 5432
473 Ga0395898_0030454 3300037466 Bacteria 5399
474 Ga0395898_0035203 3300037466 Bacteria 4982
475 Ga0395898_0058699 3300037466 Plasmid 3745
476 Ga0395898_0094671 3300037466 Bacteria 2870
477 Ga0395898_0097015 3300037466 Unclassified 2831
478 Ga0395898_0126666 3300037466 Bacteria 2446
479 Ga0395898_0342596 3300037466 Bacteria 1425
480 Ga0395898_0504578 3300037466 Bacteria 1150
481 Ga0395898_0682361 3300037466 Bacteria 969
482 Ga0395898_0954243 3300037466 Bacteria 794
483 Ga0395898_1197200 3300037466 Bacteria 691
484 Ga0395898_1398501 3300037466 Unclassified 627
485 Ga0395898_1575390 3300037466 Bacteria 582
486 Ga0395905_0006618 3300037471 Bacteria 11622
487 Ga0395905_0009307 3300037471 Bacteria 9610
488 Ga0395905_0012963 3300037471 Bacteria 8011
489 Ga0395905_0020243 3300037471 Bacteria 6303
490 Ga0395905_0024781 3300037471 Bacteria 5661
491 Ga0395905_0041203 3300037471 Bacteria 4334
492 Ga0395905_0047735 3300037471 Unclassified 4011
493 Ga0395905_0059517 3300037471 Bacteria 3571
494 Ga0395905_0067701 3300037471 Unclassified 3344
495 Ga0395905_0212780 3300037471 Bacteria 1811
496 Ga0395905_0263688 3300037471 Unclassified 1608
497 Ga0395905_0326111 3300037471 Bacteria 1425
498 Ga0395905_0399492 3300037471 Bacteria 1269
499 Ga0395901_0001505 3300038443 Bacteria 24214
500 Ga0395901_0009295 3300038443 Bacteria 9964
501 Ga0395901_0015931 3300038443 Bacteria 7658
502 Ga0395901_0021606 3300038443 Bacteria 6593
503 Ga0395901_0039136 3300038443 Bacteria 4906
504 Ga0395901_0075359 3300038443 Bacteria 3519
505 Ga0395901_0100335 3300038443 Bacteria 3036
506 Ga0395901_0108322 3300038443 Bacteria 2917
507 Ga0395901_0124416 3300038443 Unclassified 2709
508 Ga0395901_0172774 3300038443 Bacteria 2267
509 Ga0395901_0387745 3300038443 Bacteria 1437
510 Ga0395901_0390206 3300038443 Bacteria 1431
511 Ga0395901_0399229 3300038443 Unclassified 1413
512 Ga0395901_0408408 3300038443 Bacteria 1394
513 Ga0395901_0414952 3300038443 Bacteria 1381
514 Ga0395901_0523368 3300038443 Bacteria 1204
515 Ga0395901_1043595 3300038443 Bacteria 791
516 Ga0436365_1022478 3300039437 Bacteria 15716
517 Ga0436362_0264146 3300039453 Unclassified 683
518 Ga0451798_0738793 3300041458 Unclassified 544
519 Ga0451835_0218292 3300041492 Bacteria 713
520 Ga0451841_1282089 3300041498 Bacteria 752
521 Ga0451849_1111261 3300041505 Bacteria 1094
522 Ga0451853_0559045 3300041512 Bacteria 922
523 Ga0439448_0142075 3300042005 Unclassified 831
524 Ga0466972_0142636 3300044658 Bacteria 1127
525 Ga0466972_0169842 3300044658 Bacteria 1024
526 Ga0466965_0152676 3300044683 Bacteria 1207
527 Ga0466965_0158566 3300044683 Unclassified 1186
528 Ga0466966_0442805 3300044684 Bacteria 781
529 Ga0466966_0492316 3300044684 Unclassified 737
530 Ga0466961_0090187 3300044693 Unclassified 1936
531 Ga0466961_0106071 3300044693 Bacteria 1769
532 Ga0466961_0123189 3300044693 Bacteria 1627
533 Ga0466961_0133362 3300044693 Bacteria 1556
534 Ga0466961_0166251 3300044693 Bacteria 1373
535 Ga0466963_0005318 3300044694 Bacteria 7527
536 Ga0466963_0005817 3300044694 Bacteria 7255
537 Ga0466963_0006073 3300044694 Bacteria 7120
538 Ga0466963_0010084 3300044694 Bacteria 5712
539 Ga0466963_0015500 3300044694 Bacteria 4722
540 Ga0466963_0016239 3300044694 Bacteria 4627
541 Ga0466963_0031404 3300044694 Bacteria 3433
542 Ga0466963_0057844 3300044694 Bacteria 2583
543 Ga0466963_0087244 3300044694 Bacteria 2121
544 Ga0466963_0091595 3300044694 Bacteria 2071
545 Ga0466963_0252037 3300044694 Unclassified 1239
546 Ga0466963_0448784 3300044694 Bacteria 910
547 Ga0466963_0543165 3300044694 Bacteria 821
548 Ga0466964_0000896 3300044706 Bacteria 9763
549 Ga0466964_0003925 3300044706 Bacteria 5465
550 Ga0466964_0005649 3300044706 Bacteria 4650
551 Ga0466964_0010856 3300044706 Bacteria 3440
552 Ga0466964_0024825 3300044706 Bacteria 2337
553 Ga0466964_0086743 3300044706 Bacteria 1354
554 Ga0466964_0098427 3300044706 Bacteria 1285
555 Ga0466964_0258516 3300044706 Bacteria 862
556 Ga0466964_0402877 3300044706 Bacteria 715
557 Ga0466964_0407327 3300044706 Unclassified 712
558 Ga0466964_0433485 3300044706 Bacteria 694
559 Ga0466971_0002294 3300044719 Bacteria 8102
560 Ga0466971_0006146 3300044719 Bacteria 5221
561 Ga0466971_0030631 3300044719 Bacteria 2408
562 Ga0466971_0128744 3300044719 Bacteria 1174
563 Ga0466968_0068749 3300044735 Bacteria 1538
564 Ga0466968_0092903 3300044735 Bacteria 1339
565 Ga0466968_0109208 3300044735 Bacteria 1242
566 Ga0466968_0113957 3300044735 Bacteria 1218
567 Ga0466957_0013495 3300044842 Bacteria 4739
568 Ga0466957_0015637 3300044842 Bacteria 4433
569 Ga0466957_0016847 3300044842 Bacteria 4275
570 Ga0466957_0033339 3300044842 Bacteria 3090
571 Ga0466957_0051471 3300044842 Bacteria 2507
572 Ga0466957_0056404 3300044842 Archaea 2402
573 Ga0466957_0095909 3300044842 Bacteria 1863
574 Ga0466957_0311893 3300044842 Bacteria 1059
575 Ga0466957_0917885 3300044842 Bacteria 626
576 Ga0466960_0012527 3300044901 Bacteria 3581
577 Ga0466960_0043606 3300044901 Bacteria 2135
578 Ga0466960_0109559 3300044901 Bacteria 1433
579 Ga0466960_0137569 3300044901 Unclassified 1294
580 Ga0466960_0165753 3300044901 Unclassified 1189
581 Ga0466960_0505878 3300044901 Unclassified 708
582 Ga0466959_0017423 3300045049 Bacteria 5265
583 Ga0466959_0069429 3300045049 Bacteria 2553
584 Ga0466959_0654162 3300045049 Unclassified 705
585 Ga0466958_0006158 3300045836 Bacteria 6505
586 Ga0466958_0016589 3300045836 Bacteria 4243
587 Ga0466958_0026537 3300045836 Bacteria 3424
588 Ga0466958_0028867 3300045836 Bacteria 3291
589 Ga0466958_0039330 3300045836 Unclassified 2841
590 Ga0466958_0068420 3300045836 Bacteria 2170
591 Ga0466958_0068779 3300045836 Bacteria 2165
592 Ga0466958_0692276 3300045836 Bacteria 664
593 Ga0466967_0004561 3300045976 Bacteria 9379
594 Ga0466967_0005287 3300045976 Bacteria 8910
595 Ga0466967_0008406 3300045976 Bacteria 7558
596 Ga0466967_0019629 3300045976 Bacteria 5441
597 Ga0466967_0025977 3300045976 Bacteria 4840
598 Ga0466967_0026147 3300045976 Bacteria 4828
599 Ga0466967_0056701 3300045976 Bacteria 3456
600 Ga0466967_0069617 3300045976 Unclassified 3145
601 Ga0466967_0144471 3300045976 Bacteria 2218
602 Ga0466967_0202132 3300045976 Archaea 1882
603 Ga0466967_0219360 3300045976 Bacteria 1806
604 Ga0466967_0225392 3300045976 Bacteria 1783
605 Ga0466967_0269239 3300045976 Bacteria 1632
606 Ga0466967_0436916 3300045976 Unclassified 1277
607 Ga0466967_1065507 3300045976 Unclassified 805
608 Ga0466967_2112622 3300045976 Bacteria 559
609 Ga0495603_0132206 3300046455 Unclassified 1453
610 Ga0495603_0713942 3300046455 Bacteria 573
611 Ga0495629_0277374 3300046459 Bacteria 1151
612 Ga0495641_0181306 3300046461 Unclassified 943
613 Ga0495641_0322335 3300046461 Unclassified 697
614 Ga0495651_0099564 3300046462 Bacteria 2168
615 Ga0495653_0031482 3300046463 Bacteria 4216
616 Ga0495605_0065314 3300046474 Unclassified 1731
617 Ga0495584_0104642 3300046491 Bacteria 1431
618 Ga0495584_0106856 3300046491 Unclassified 1415
619 Ga0495584_0174694 3300046491 Bacteria 1092
620 Ga0495616_0289692 3300046513 Bacteria 694
621 Ga0495618_0175520 3300046514 Bacteria 1363
622 Ga0495630_0273075 3300046517 Unclassified 1292
623 Ga0495630_1184355 3300046517 Bacteria 578
624 Ga0495667_0015176 3300046559 Bacteria 5200
625 Ga0495656_0383629 3300046615 Unclassified 733
626 Ga0495635_0149387 3300046663 Bacteria 1590
627 Ga0495661_0130639 3300046665 Bacteria 1377
628 Ga0495588_0542048 3300046674 Unclassified 610
629 Ga0495657_0060907 3300046675 Bacteria 2498
630 Ga0495657_0305090 3300046675 Bacteria 949
631 Ga0495658_0240992 3300046683 Bacteria 1136
632 Ga0495658_0287722 3300046683 Bacteria 1038
633 Ga0495613_0128588 3300046689 Bacteria 1815
634 Ga0495624_0017254 3300046690 Bacteria 4851
635 Ga0495649_0161183 3300046694 Bacteria 1176
636 Ga0495589_0076666 3300046794 Bacteria 1630
637 Ga0495600_0181341 3300046809 Bacteria 1357
638 Ga0495636_0081043 3300047318 Unclassified 1398
639 Ga0495674_1163237 3300047319 Unclassified 585
640 Ga0495676_0179777 3300047321 Bacteria 1483
641 Ga0495676_0224447 3300047321 Bacteria 1293
642 Ga0495676_0635515 3300047321 Bacteria 693
643 Ga0495680_0022776 3300047322 Bacteria 5216
644 Ga0495683_0252367 3300047323 Bacteria 774
645 Ga0495684_0053664 3300047471 Bacteria 3075
646 Ga0495614_0048491 3300048089 Bacteria 1821
647 Ga0495626_0201911 3300048091 Bacteria 815
648 Ga0496100_0008236 3300048903 Bacteria 5808
649 Ga0496100_0101775 3300048903 Bacteria 1981
650 Ga0496100_0612675 3300048903 Bacteria 846
651 Ga0496100_0657791 3300048903 Unclassified 816
652 Ga0496101_0000735 3300048904 Bacteria 19496
653 Ga0496101_0035693 3300048904 Bacteria 3518
654 Ga0496101_0051756 3300048904 Bacteria 2960
655 Ga0496101_0110979 3300048904 Unclassified 2064
656 Ga0496101_0204888 3300048904 Bacteria 1526
657 Ga0496101_0804999 3300048904 Bacteria 741
658 Ga0496101_1516657 3300048904 Unclassified 522
659 Ga0496102_0001216 3300048905 Bacteria 23348
660 Ga0496102_0002713 3300048905 Bacteria 15060
661 Ga0496102_0004949 3300048905 Bacteria 11288
662 Ga0496102_0021825 3300048905 Bacteria 5667
663 Ga0496102_0057297 3300048905 Unclassified 3557
664 Ga0496102_0150169 3300048905 Bacteria 2189
665 Ga0496102_0202002 3300048905 Bacteria 1874
666 Ga0496102_0379833 3300048905 Bacteria 1330
667 Ga0496102_1648303 3300048905 Bacteria 559
668 Ga0496103_0002705 3300048906 Bacteria 11061
669 Ga0496103_0035655 3300048906 Bacteria 3046
670 Ga0496103_0077376 3300048906 Bacteria 2088
671 Ga0496103_0148019 3300048906 Bacteria 1504
672 Ga0496104_0000134 3300048907 Bacteria 68737
673 Ga0496104_0028410 3300048907 Bacteria 5185
674 Ga0496104_0054508 3300048907 Bacteria 3779
675 Ga0496104_0067820 3300048907 Unclassified 3389
676 Ga0496104_0623787 3300048907 Bacteria 988
677 Ga0496104_1271154 3300048907 Bacteria 639
678 Ga0496104_1417344 3300048907 Unclassified 598
679 Ga0496105_0000484 3300048908 Bacteria 26155
680 Ga0496105_0036663 3300048908 Bacteria 4040
681 Ga0496105_0174680 3300048908 Bacteria 1760
682 Ga0496105_0184856 3300048908 Unclassified 1705
683 Ga0496106_0018184 3300048909 Bacteria 5199
684 Ga0496106_0090449 3300048909 Bacteria 2362
685 Ga0496106_0811044 3300048909 Bacteria 742
686 Ga0496106_0990536 3300048909 Bacteria 661
687 Ga0496107_0020634 3300048910 Bacteria 4656
688 Ga0496107_0047392 3300048910 Bacteria 3095
689 Ga0496107_0049850 3300048910 Bacteria 3018
690 Ga0496107_0050199 3300048910 Bacteria 3007
691 Ga0496107_0534218 3300048910 Bacteria 869
692 Ga0496107_0604577 3300048910 Bacteria 810
693 Ga0496107_1174405 3300048910 Unclassified 552
694 Ga0496108_0001238 3300048911 Bacteria 20020
695 Ga0496108_0004984 3300048911 Bacteria 10732
696 Ga0496108_0044538 3300048911 Bacteria 3703
697 Ga0496108_0063188 3300048911 Bacteria 3118
698 Ga0496108_0304533 3300048911 Unclassified 1388
699 Ga0496108_0370652 3300048911 Unclassified 1250
700 Ga0496108_1792805 3300048911 Bacteria 503
701 Ga0496109_0000898 3300048912 Bacteria 24813
702 Ga0496109_0014986 3300048912 Bacteria 6747
703 Ga0496109_0016825 3300048912 Bacteria 6399
704 Ga0496109_0052892 3300048912 Bacteria 3702
705 Ga0496109_0054658 3300048912 Unclassified 3642
706 Ga0496109_0100070 3300048912 Unclassified 2689
707 Ga0496109_0172836 3300048912 Unclassified 2027
708 Ga0496109_0178938 3300048912 Bacteria 1991
709 Ga0496109_0462505 3300048912 Bacteria 1198
710 Ga0496109_0791725 3300048912 Unclassified 886
711 Ga0496110_0000851 3300048913 Bacteria 21507
712 Ga0496110_0000905 3300048913 Bacteria 20843
713 Ga0496110_0005135 3300048913 Bacteria 10229
714 Ga0496110_0134709 3300048913 Bacteria 2232
715 Ga0496110_0358315 3300048913 Unclassified 1329
716 Ga0496110_0714335 3300048913 Unclassified 904
717 Ga0496110_0793199 3300048913 Unclassified 851
718 Ga0496110_0934957 3300048913 Unclassified 773
719 Ga0496111_0013044 3300048914 Bacteria 5642
720 Ga0496111_0042155 3300048914 Bacteria 3276
721 Ga0496111_0171953 3300048914 Bacteria 1610
722 Ga0496111_0255115 3300048914 Bacteria 1301
723 Ga0496111_0388966 3300048914 Unclassified 1031
724 Ga0496111_0455804 3300048914 Unclassified 943
725 Ga0496112_0078305 3300048915 Bacteria 3269
726 Ga0496112_0244434 3300048915 Bacteria 1747
727 Ga0496112_0544835 3300048915 Bacteria 1094
728 Ga0496112_0613310 3300048915 Unclassified 1019
729 Ga0496112_0715941 3300048915 Bacteria 928
730 Ga0496112_0832144 3300048915 Bacteria 847
731 Ga0496113_0017399 3300048916 Bacteria 4989
732 Ga0496113_0070861 3300048916 Bacteria 2651
733 Ga0496113_0165213 3300048916 Bacteria 1751
734 Ga0496113_0374931 3300048916 Unclassified 1142
735 Ga0496113_0482516 3300048916 Unclassified 996
736 Ga0496114_0000597 3300048917 Bacteria 26684
737 Ga0496114_0002596 3300048917 Bacteria 13791
738 Ga0496114_0069746 3300048917 Bacteria 2952
739 Ga0496114_0104528 3300048917 Bacteria 2422
740 Ga0496115_0054617 3300048918 Unclassified 3208
741 Ga0496115_0063108 3300048918 Bacteria 2989
742 Ga0496115_0135744 3300048918 Bacteria 2029
743 Ga0496115_0265491 3300048918 Bacteria 1411
744 Ga0501031_0000784 3300049568 Bacteria 19083
745 Ga0501032_0017056 3300049569 Bacteria 5102
746 Ga0501033_0001741 3300049570 Bacteria 19030
747 Ga0501034_0004685 3300049571 Bacteria 15145
748 Ga0501034_0034868 3300049571 Bacteria 5103
749 Ga0501034_0595828 3300049571 Bacteria 1011
750 Ga0501036_0025762 3300049572 Bacteria 4964
751 Ga0501037_0020117 3300049573 Bacteria 4929
752 Ga0501037_0093043 3300049573 Unclassified 2180
753 Ga0501038_0028184 3300049574 Bacteria 4990
754 Ga0501039_0547254 3300049575 Bacteria 908
755 Ga0501040_0049265 3300049576 Bacteria 2880
756 Ga0501040_0141502 3300049576 Bacteria 1695
757 Ga0501042_0028132 3300049578 Bacteria 3957
758 Ga0501042_0109600 3300049578 Bacteria 1988
759 Ga0501043_0022114 3300049579 Bacteria 4990
760 Ga0501046_0000162 3300049580 Bacteria 69629
761 Ga0501046_0587256 3300049580 Bacteria 791
762 Ga0501047_0001471 3300049581 Bacteria 22975
763 Ga0501047_0037313 3300049581 Bacteria 4699
764 Ga0501047_0311170 3300049581 Bacteria 1416
765 Ga0501048_0001285 3300049582 Bacteria 19040
766 Ga0501067_0007016 3300049583 Bacteria 6255
767 Ga0501067_0008934 3300049583 Bacteria 5552
768 Ga0501067_0010223 3300049583 Bacteria 5190
769 Ga0501067_0037515 3300049583 Bacteria 2692
770 Ga0501067_0092538 3300049583 Bacteria 1679
771 Ga0501067_0516410 3300049583 Bacteria 668
772 Ga0501068_0011568 3300049584 Bacteria 4984
773 Ga0501068_0018378 3300049584 Bacteria 4049
774 Ga0501068_0028736 3300049584 Bacteria 3290
775 Ga0501069_0000428 3300049585 Bacteria 19110
776 Ga0501069_0000856 3300049585 Bacteria 14425
777 Ga0501069_0007926 3300049585 Bacteria 5578
778 Ga0501069_0009520 3300049585 Bacteria 5127
779 Ga0501069_0060440 3300049585 Bacteria 2115
780 Ga0501069_0091416 3300049585 Unclassified 1721
781 Ga0501070_0000032 3300049586 Bacteria 131255
782 Ga0501070_0004474 3300049586 Bacteria 12002
783 Ga0501070_0006018 3300049586 Bacteria 10332
784 Ga0501070_0013992 3300049586 Bacteria 6755
785 Ga0501070_0207431 3300049586 Bacteria 1609
786 Ga0501070_0215280 3300049586 Bacteria 1576
787 Ga0501070_0249793 3300049586 Bacteria 1451
788 Ga0501070_0297653 3300049586 Bacteria 1315
789 Ga0501070_0298971 3300049586 Bacteria 1311
790 Ga0501071_0019931 3300049587 Bacteria 4658
791 Ga0501071_0061168 3300049587 Bacteria 2727
792 Ga0501071_0286356 3300049587 Bacteria 1247
793 Ga0501072_0618279 3300049588 Unclassified 854
794 Ga0501073_0018899 3300049589 Bacteria 4979
795 Ga0501073_0103628 3300049589 Bacteria 1975
796 Ga0501073_0257241 3300049589 Bacteria 1205
797 Ga0501074_0002052 3300049590 Bacteria 13918
798 Ga0501074_0018970 3300049590 Bacteria 4996
799 Ga0501074_0027224 3300049590 Bacteria 4145
800 Ga0501074_0050263 3300049590 Bacteria 3010
801 Ga0501074_0445912 3300049590 Bacteria 918
802 Ga0501075_0747072 3300049591 Bacteria 745
803 Ga0501077_0227761 3300049593 Bacteria 1185
804 Ga0501079_0000154 3300049741 Bacteria 37557
805 Ga0501079_0073348 3300049741 Bacteria 2645
806 Ga0501080_0000096 3300049742 Bacteria 59454
807 Ga0501080_0009066 3300049742 Bacteria 9056
808 Ga0501080_0015468 3300049742 Bacteria 7034
809 Ga0501080_0018304 3300049742 Bacteria 6483
810 Ga0501080_0031976 3300049742 Bacteria 4905
811 Ga0501080_0069360 3300049742 Bacteria 3278
812 Ga0501080_1085927 3300049742 Bacteria 691
813 Ga0501083_0017869 3300049744 Bacteria 4946
814 Ga0501083_0463269 3300049744 Bacteria 825
815 Ga0501035_0001581 3300049822 Bacteria 23115
816 Ga0501035_0194829 3300049822 Bacteria 1741
817 Ga0501044_0000056 3300049823 Bacteria 139804
818 Ga0501044_0002508 3300049823 Bacteria 20936
819 Ga0501044_0078601 3300049823 Bacteria 3343
820 Ga0501044_0970669 3300049823 Bacteria 722
821 Ga0501045_0068121 3300049824 Bacteria 2614
822 nmdc:mga05p37_203949_c1 3300050507 Unclassified 2393
823 nmdc:mga05p37_276541_c1 3300050507 Unclassified 2004
824 nmdc:mga05p37_328065_c1 3300050507 Bacteria 1809
825 nmdc:mga0qj67_165844_c1 3300050509 Unclassified 1793
826 nmdc:mga08y16_121319_c1 3300050511 Bacteria 2720
827 nmdc:mga08y16_13904_c1 3300050511 Bacteria 8470
828 nmdc:mga08y16_371457_c1 3300050511 Bacteria 1467
829 nmdc:mga08y16_419358_c1 3300050511 Bacteria 1368
830 nmdc:mga08y16_645936_c1 3300050511 Unclassified 1063
831 nmdc:mga08y16_887716_c1 3300050511 Unclassified 878
832 nmdc:mga0n895_131085_c1 3300050512 Unclassified 2532
833 nmdc:mga0n895_3007_c1 3300050512 Bacteria 13392
834 nmdc:mga0n895_41130_c1 3300050512 Bacteria 4493
835 nmdc:mga0n895_432754_c1 3300050512 Bacteria 1329
836 nmdc:mga0n895_65495_c1 3300050512 Bacteria 3596
837 nmdc:mga0n895_710568_c1 3300050512 Unclassified 1000
838 nmdc:mga0rr50_13483_c1 3300050513 Bacteria 5323
839 nmdc:mga0rr50_449927_c1 3300050513 Bacteria 1092
840 nmdc:mga0rr50_829541_c1 3300050513 Bacteria 789
841 nmdc:mga08x19_344872_c1 3300050514 Bacteria 1039
842 nmdc:mga08x19_37852_c1 3300050514 Unclassified 3063
843 nmdc:mga08x19_79926_c1 3300050514 Bacteria 2145
844 nmdc:mga0a205_4356_c1 3300050515 Bacteria 12693
845 nmdc:mga0a205_899455_c1 3300050515 Bacteria 732
846 Ga0495655_0032761 3300053083 Bacteria 1274
847 Ga0495595_0022594 3300053084 Bacteria 2762
848 Ga0501084_0361149 3300054114 Bacteria 1227
849 Ga0587073_0192793 3300059492 Unclassified 606
850 Ga0501082_0026821 3300060353 Bacteria 4965
851 Ga0466962_0006257 3300061719 Bacteria 5719
852 Ga0466962_0009425 3300061719 Bacteria 4680
853 Ga0466962_0126676 3300061719 Unclassified 1233
854 Ga0466962_0395624 3300061719 Bacteria 691
855 Ga0530510_0044741 3300061734 Bacteria 3199
856 Ga0530510_0045135 3300061734 Bacteria 3184
857 Ga0530510_0178214 3300061734 Bacteria 1575
858 Ga0466967_0188518
859 JGI24746J21847_1024597
860 JGI24751J29686_10084866
861 Ga0065712_10120415
862 Ga0065715_10335807
863 Ga0070658_10056846
864 Ga0070658_10078745
865 Ga0070658_10156069
866 Ga0070658_10221886
867 Ga0070683_100038026
868 Ga0070683_100066613
869 Ga0070683_100095696
870 Ga0070683_100112761
871 Ga0070683_100173035
872 Ga0070683_100743225
873 Ga0070690_101099849
874 Ga0070670_100094769
875 Ga0070677_10181137
876 Ga0068869_100538551
877 Ga0070680_100014676
878 Ga0070680_100052938
879 Ga0070680_100061167
880 Ga0070680_100078728
881 Ga0070682_100017035
882 Ga0070682_100029295
883 Ga0070682_100081456
884 Ga0070682_100292287
885 Ga0070682_101146206
886 Ga0070682_101257976
887 Ga0068868_100043392
888 Ga0068868_100880038
889 Ga0070660_100007754
890 Ga0070660_100123379
891 Ga0070691_10057135
892 Ga0070691_10233364
893 Ga0070691_10827082
894 Ga0070687_100417177
895 Ga0070661_100129574
896 Ga0070661_100232235
897 Ga0070661_100838304
898 Ga0070661_100994194
899 Ga0070692_10424487
900 Ga0070668_100855552
901 Ga0070668_100952540
902 Ga0070669_100507769
903 Ga0070671_100142316
904 Ga0070671_100378232
905 Ga0070674_100078318
906 Ga0070674_100213567
907 Ga0070674_100266839
908 Ga0070674_100337825
909 Ga0070673_100443304
910 Ga0070673_101188583
911 Ga0070688_100799427
912 Ga0070659_100056043
913 Ga0070659_100554868
914 Ga0070709_10437401
915 Ga0070714_100009235
916 Ga0070714_100045826
917 Ga0070714_100123253
918 Ga0070713_100643534
919 Ga0070713_101186748
920 Ga0070701_10140042
921 Ga0070711_100048624
922 Ga0070705_100521343
923 Ga0070705_100563056
924 Ga0070700_100766897
925 Ga0070700_101240142
926 Ga0070694_100397165
927 Ga0070694_100744267
928 Ga0070663_100001354
929 Ga0070663_100433268
930 Ga0070663_101104875
931 Ga0070663_101152557
932 Ga0070678_100026290
933 Ga0070678_100047140
934 Ga0070678_100380900
935 Ga0070662_100027753
936 Ga0070662_100505282
937 Ga0070681_10004088
938 Ga0070681_10005202
939 Ga0070681_10013493
940 Ga0070681_10022680
941 Ga0070681_10101498
942 Ga0070681_10256807
943 Ga0070681_10307627
944 Ga0070681_10356307
945 Ga0070685_10013576
946 Ga0070685_10346423
947 Ga0070679_100001302
948 Ga0070679_100012229
949 Ga0070679_100112115
950 Ga0070679_100125296
951 Ga0070679_100260684
952 Ga0070679_100341246
953 Ga0070679_100782114
954 Ga0070679_101292471
955 Ga0070684_100003652
956 Ga0070684_100039454
957 Ga0070684_100113814
958 Ga0070684_100523130
959 Ga0070684_100537319
960 Ga0070684_100987293
961 Ga0070697_100039698
962 Ga0070697_100735848
963 Ga0068853_100948589
964 Ga0070672_100122696
965 Ga0070686_100402154
966 Ga0070686_100583530
967 Ga0070695_100002173
968 Ga0070695_100092348
969 Ga0070695_100221164
970 Ga0070695_100722385
971 Ga0070696_100012188
972 Ga0070696_100184129
973 Ga0070696_100962415
974 Ga0070696_101461554
975 Ga0070693_100003297
976 Ga0070693_100061708
977 Ga0070665_100208549
978 Ga0070704_100345547
979 Ga0070704_101659601
980 Ga0068855_100108954
981 Ga0068855_100354051
982 Ga0068855_101433182
983 Ga0070664_100188195
984 Ga0070664_100414408
985 Ga0070664_100530627
986 Ga0070664_101287880
987 Ga0068857_100002399
988 Ga0068857_102270773
989 Ga0068857_102505781
990 Ga0068854_100519197
991 Ga0068854_100871254
992 Ga0068854_100941431
993 Ga0068856_100032154
994 Ga0068856_100072526
995 Ga0068856_100078848
996 Ga0068856_100110734
997 Ga0068856_100127835
998 Ga0068856_100221143
999 Ga0068856_100234044
1000 Ga0068856_100569976
1001 Ga0068856_101332600
1002 Ga0068852_100117174
1003 Ga0068852_100941657
1004 Ga0068864_100122839
1005 Ga0068866_10154714
1006 Ga0068866_10299247
1007 Ga0068863_100171806
1008 Ga0068863_100813460
1009 Ga0068860_100562793
1010 Ga0081539_10018807
1011 Ga0081539_10043615
1012 Ga0070717_10007314
1013 Ga0070717_10020944
1014 Ga0070716_100651057
1015 Ga0070712_100081037
1016 Ga0070712_100246004
1017 Ga0097621_100754588
1018 Ga0075428_100297052
1019 Ga0075430_100317136
1020 Ga0075431_100779524
1021 Ga0075433_10013206
1022 Ga0075433_10303479
1023 Ga0075433_10912236
1024 Ga0075434_100002825
1025 Ga0075434_100007883
1026 Ga0075434_100182047
1027 Ga0075434_100370031
1028 Ga0068865_100114685
1029 Ga0068865_100706932
1030 Ga0075436_100050747
1031 Ga0075436_100072955
1032 Ga0075436_100591600
1033 Ga0075435_100083098
1034 Ga0075435_100100650
1035 Ga0075435_100212090
1036 Ga0075435_100217215
1037 Ga0075435_100306275
1038 Ga0099795_10508781
1039 Ga0105240_10013540
1040 Ga0105240_10124766
1041 Ga0105240_10587452
1042 Ga0111539_10002777
1043 Ga0111539_10041358
1044 Ga0111539_10092843
1045 Ga0111539_10527759
1046 Ga0111539_10853207
1047 Ga0105245_10034907
1048 Ga0105245_10050771
1049 Ga0105245_10123449
1050 Ga0105245_10131498
1051 Ga0105245_10178243
1052 Ga0105245_10264020
1053 Ga0114129_10282382
1054 Ga0114129_10400255
1055 Ga0105243_10029991
1056 Ga0105243_10285175
1057 Ga0105243_10777349
1058 Ga0105243_11963785
1059 Ga0105241_10034607
1060 Ga0105241_10614045
1061 Ga0105242_10011248
1062 Ga0105242_10236200
1063 Ga0105242_10760862
1064 Ga0105242_10886736
1065 Ga0105242_11478576
1066 Ga0105248_10127892
1067 Ga0105248_10151731
1068 Ga0105248_10536607
1069 Ga0105248_10756973
1070 Ga0105248_10781677
1071 Ga0105237_10061228
1072 Ga0105237_10326261
1073 Ga0105237_10947321
1074 Ga0105238_10083356
1075 Ga0105238_10109300
1076 Ga0105238_10233605
1077 Ga0105238_10381129
1078 Ga0105238_10508735
1079 Ga0105249_10135924
1080 Ga0105249_10424569
1081 Ga0105239_10011216
1082 Ga0105239_10039700
1083 Ga0105239_10042402
1084 Ga0105239_10082056
1085 Ga0105239_10285610
1086 Ga0105239_10338218
1087 Ga0105239_10460456
1088 Ga0105239_11344634
1089 Ga0105239_11355104
1090 Ga0105246_10030372
1091 Ga0105246_10033922
1092 Ga0105246_12108905
1093 Ga0157320_1011300
1094 Ga0157371_10221846
1095 Ga0157371_10234463
1096 Ga0157371_11390168
1097 Ga0157370_10187652
1098 Ga0157370_10359089
1099 Ga0157369_10023673
1100 Ga0157369_10082298
1101 Ga0157369_10812863
1102 Ga0157369_10909693
1103 Ga0157369_10919951
1104 Ga0157369_12005403
1105 Ga0157374_10017674
1106 Ga0157374_10075205
1107 Ga0157374_11189713
1108 Ga0157378_10150072
1109 Ga0163162_10182775
1110 Ga0163162_10386424
1111 Ga0163162_11711503
1112 Ga0163162_12295425
1113 Ga0157372_10048315
1114 Ga0157372_10112115
1115 Ga0157372_10115264
1116 Ga0157372_10191177
1117 Ga0157372_10224887
1118 Ga0157372_10359948
1119 Ga0157372_10381454
1120 Ga0157372_10720582
1121 Ga0157372_11343878
1122 Ga0157372_11894199
1123 Ga0157375_10014286
1124 Ga0157375_10123813
1125 Ga0157375_10242929
1126 Ga0157375_10374382
1127 Ga0157375_10551564
1128 Ga0163163_10052869
1129 Ga0163163_10186191
1130 Ga0163163_10194136
1131 Ga0163163_12588381
1132 Ga0157380_10113205
1133 Ga0157380_11993028
1134 Ga0182008_10261199
1135 Ga0157377_10046768
1136 Ga0157377_10137012
1137 Ga0157377_10548486
1138 Ga0157379_10540545
1139 Ga0157379_11190969
1140 Ga0157376_10075638
1141 Ga0157376_10177102
1142 Ga0163161_11401243
1143 Ga0197907_10809293
1144 Ga0206356_11892448
1145 Ga0206355_1270139
1146 Ga0206354_10299673
1147 Ga0206353_10059895
1148 Ga0206353_10877554
1149 Ga0213876_10002035
1150 Ga0224712_10007156
1151 Ga0224712_10175156
1152 Ga0224712_10188025
1153 Ga0224712_10244316
1154 Ga0207642_10112109
1155 Ga0207642_10240720
1156 Ga0207688_10028876
1157 Ga0207688_10399678
1158 Ga0207699_10134773
1159 Ga0207699_11152367
1160 Ga0207643_10003437
1161 Ga0207705_10095069
1162 Ga0207705_10096644
1163 Ga0207705_10162124
1164 Ga0207684_10219608
1165 Ga0207654_10089438
1166 Ga0207654_10546675
1167 Ga0207654_11300431
1168 Ga0207707_10004701
1169 Ga0207707_10020322
1170 Ga0207707_10023248
1171 Ga0207707_10073838
1172 Ga0207707_10100098
1173 Ga0207707_10609786
1174 Ga0207695_10009334
1175 Ga0207695_10013582
1176 Ga0207695_11650563
1177 Ga0207671_10059594
1178 Ga0207671_10549646
1179 Ga0207693_10093940
1180 Ga0207693_10155180
1181 Ga0207660_10023976
1182 Ga0207660_10106618
1183 Ga0207660_10278290
1184 Ga0207660_10331930
1185 Ga0207662_10670925
1186 Ga0207657_10138275
1187 Ga0207657_10237473
1188 Ga0207649_10200783
1189 Ga0207652_10000283
1190 Ga0207652_10033729
1191 Ga0207652_10044714
1192 Ga0207652_10333599
1193 Ga0207652_10468371
1194 Ga0207652_10538930
1195 Ga0207681_10988577
1196 Ga0207681_11023697
1197 Ga0207694_10069985
1198 Ga0207694_10382363
1199 Ga0207694_10443394
1200 Ga0207694_10456862
1201 Ga0207650_10078957
1202 Ga0207650_10692381
1203 Ga0207659_10098446
1204 Ga0207659_10728915
1205 Ga0207687_10021930
1206 Ga0207687_10125498
1207 Ga0207687_10165138
1208 Ga0207687_10396579
1209 Ga0207687_10521945
1210 Ga0207687_10545959
1211 Ga0207687_11031617
1212 Ga0207687_11160296
1213 Ga0207700_10041273
1214 Ga0207700_10226887
1215 Ga0207700_10525382
1216 Ga0207700_10655736
1217 Ga0207700_10805772
1218 Ga0207700_10979618
1219 Ga0207664_10001938
1220 Ga0207644_10276223
1221 Ga0207644_10581815
1222 Ga0207644_10777748
1223 Ga0207644_10969937
1224 Ga0207690_10164060
1225 Ga0207690_10671196
1226 Ga0207706_10492641
1227 Ga0207706_10697905
1228 Ga0207686_10130146
1229 Ga0207686_10569034
1230 Ga0207686_10948309
1231 Ga0207709_10049473
1232 Ga0207709_10567370
1233 Ga0207669_10070436
1234 Ga0207669_10139204
1235 Ga0207669_10328551
1236 Ga0207704_10028781
1237 Ga0207665_10510887
1238 Ga0207691_10076084
1239 Ga0207711_10245870
1240 Ga0207711_10417228
1241 Ga0207711_10564715
1242 Ga0207711_10843003
1243 Ga0207689_11142484
1244 Ga0207661_10004372
1245 Ga0207661_10027070
1246 Ga0207661_10050294
1247 Ga0207661_10069025
1248 Ga0207661_10359967
1249 Ga0207661_11050249
1250 Ga0207661_11261593
1251 Ga0207679_10037399
1252 Ga0207679_10090402
1253 Ga0207679_10478832
1254 Ga0207679_10925767
1255 Ga0207667_10271348
1256 Ga0207667_10382714
1257 Ga0207667_10442617
1258 Ga0207667_11240439
1259 Ga0207651_10298943
1260 Ga0207651_10608598
1261 Ga0207712_10129338
1262 Ga0207640_10299915
1263 Ga0207640_10947620
1264 Ga0207677_10230219
1265 Ga0207677_10662147
1266 Ga0207677_11385649
1267 Ga0207639_10817826
1268 Ga0207678_10013062
1269 Ga0207708_10755092
1270 Ga0207708_11190730
1271 Ga0207702_10039544
1272 Ga0207702_10068719
1273 Ga0207702_10088160
1274 Ga0207702_10148985
1275 Ga0207702_10167498
1276 Ga0207702_10270940
1277 Ga0207702_10324224
1278 Ga0207702_10464061
1279 Ga0207702_11082209
1280 Ga0207641_10287345
1281 Ga0207676_10132016
1282 Ga0207674_10001651
1283 Ga0207674_10167990
1284 Ga0207675_102313393
1285 Ga0207683_10025974
1286 Ga0207683_10032734
1287 Ga0207683_10070937
1288 Ga0207698_10118962
1289 Ga0207428_10010153
1290 Ga0207428_10264845
1291 Ga0268264_10361536
1292 Ga0307408_101032380
1293 Ga0307413_10778497
1294 Ga0307406_10103704
1295 Ga0307409_100481401
1296 Ga0307416_100282394
1297 Ga0307415_100032554
1298 Ga0373943_0285475
1299 Ga0373935_0105670
1300 Ga0373947_0823712
1301 Ga0373925_0223348
1302 Ga0373925_0269930
1303 Ga0395899_0001741
1304 Ga0395899_0030651
1305 Ga0395899_0102604
1306 Ga0395899_0238490
1307 Ga0395899_0324208
1308 Ga0395899_0340715
1309 Ga0395899_0627842
1310 Ga0395900_0002164
1311 Ga0395900_0004516
1312 Ga0395900_0006695
1313 Ga0395900_0007275
1314 Ga0395900_0018846
1315 Ga0395900_0030866
1316 Ga0395900_0082545
1317 Ga0395900_0104329
1318 Ga0395900_0106169
1319 Ga0395900_0288820
1320 Ga0395900_0354020
1321 Ga0395900_0405535
1322 Ga0395900_0618903
1323 Ga0395900_0999896
1324 Ga0395900_1016280
1325 Ga0395900_1104513
1326 Ga0395898_0001577
1327 Ga0395898_0005425
1328 Ga0395898_0007535
1329 Ga0395898_0030126
1330 Ga0395898_0030454
1331 Ga0395898_0035203
1332 Ga0395898_0058699
1333 Ga0395898_0094671
1334 Ga0395898_0097015
1335 Ga0395898_0126666
1336 Ga0395898_0342596
1337 Ga0395898_0504578
1338 Ga0395898_0682361
1339 Ga0395898_0954243
1340 Ga0395898_1197200
1341 Ga0395898_1398501
1342 Ga0395898_1575390
1343 Ga0395905_0006618
1344 Ga0395905_0009307
1345 Ga0395905_0012963
1346 Ga0395905_0020243
1347 Ga0395905_0024781
1348 Ga0395905_0041203
1349 Ga0395905_0047735
1350 Ga0395905_0059517
1351 Ga0395905_0067701
1352 Ga0395905_0212780
1353 Ga0395905_0263688
1354 Ga0395905_0326111
1355 Ga0395905_0399492
1356 Ga0395901_0001505
1357 Ga0395901_0009295
1358 Ga0395901_0015931
1359 Ga0395901_0021606
1360 Ga0395901_0039136
1361 Ga0395901_0075359
1362 Ga0395901_0100335
1363 Ga0395901_0108322
1364 Ga0395901_0124416
1365 Ga0395901_0172774
1366 Ga0395901_0387745
1367 Ga0395901_0390206
1368 Ga0395901_0399229
1369 Ga0395901_0408408
1370 Ga0395901_0414952
1371 Ga0395901_0523368
1372 Ga0395901_1043595
1373 Ga0436365_1022478
1374 Ga0436362_0264146
1375 Ga0451798_0738793
1376 Ga0451835_0218292
1377 Ga0451841_1282089
1378 Ga0451849_1111261
1379 Ga0451853_0559045
1380 Ga0439448_0142075
1381 Ga0466972_0142636
1382 Ga0466972_0169842
1383 Ga0466965_0152676
1384 Ga0466965_0158566
1385 Ga0466966_0442805
1386 Ga0466966_0492316
1387 Ga0466961_0090187
1388 Ga0466961_0106071
1389 Ga0466961_0123189
1390 Ga0466961_0133362
1391 Ga0466961_0166251
1392 Ga0466963_0005318
1393 Ga0466963_0005817
1394 Ga0466963_0006073
1395 Ga0466963_0010084
1396 Ga0466963_0015500
1397 Ga0466963_0016239
1398 Ga0466963_0031404
1399 Ga0466963_0057844
1400 Ga0466963_0087244
1401 Ga0466963_0091595
1402 Ga0466963_0252037
1403 Ga0466963_0448784
1404 Ga0466963_0543165
1405 Ga0466964_0000896
1406 Ga0466964_0003925
1407 Ga0466964_0005649
1408 Ga0466964_0010856
1409 Ga0466964_0024825
1410 Ga0466964_0086743
1411 Ga0466964_0098427
1412 Ga0466964_0258516
1413 Ga0466964_0402877
1414 Ga0466964_0407327
1415 Ga0466964_0433485
1416 Ga0466971_0002294
1417 Ga0466971_0006146
1418 Ga0466971_0030631
1419 Ga0466971_0128744
1420 Ga0466968_0068749
1421 Ga0466968_0092903
1422 Ga0466968_0109208
1423 Ga0466968_0113957
1424 Ga0466957_0013495
1425 Ga0466957_0015637
1426 Ga0466957_0016847
1427 Ga0466957_0033339
1428 Ga0466957_0051471
1429 Ga0466957_0056404
1430 Ga0466957_0095909
1431 Ga0466957_0311893
1432 Ga0466957_0917885
1433 Ga0466960_0012527
1434 Ga0466960_0043606
1435 Ga0466960_0109559
1436 Ga0466960_0137569
1437 Ga0466960_0165753
1438 Ga0466960_0505878
1439 Ga0466959_0017423
1440 Ga0466959_0069429
1441 Ga0466959_0654162
1442 Ga0466958_0006158
1443 Ga0466958_0016589
1444 Ga0466958_0026537
1445 Ga0466958_0028867
1446 Ga0466958_0039330
1447 Ga0466958_0068420
1448 Ga0466958_0068779
1449 Ga0466958_0692276
1450 Ga0466967_0004561
1451 Ga0466967_0005287
1452 Ga0466967_0008406
1453 Ga0466967_0019629
1454 Ga0466967_0025977
1455 Ga0466967_0026147
1456 Ga0466967_0056701
1457 Ga0466967_0069617
1458 Ga0466967_0144471
1459 Ga0466967_0202132
1460 Ga0466967_0219360
1461 Ga0466967_0225392
1462 Ga0466967_0269239
1463 Ga0466967_0436916
1464 Ga0466967_1065507
1465 Ga0466967_2112622
1466 Ga0495603_0132206
1467 Ga0495603_0713942
1468 Ga0495629_0277374
1469 Ga0495641_0181306
1470 Ga0495641_0322335
1471 Ga0495651_0099564
1472 Ga0495653_0031482
1473 Ga0495605_0065314
1474 Ga0495584_0104642
1475 Ga0495584_0106856
1476 Ga0495584_0174694
1477 Ga0495616_0289692
1478 Ga0495618_0175520
1479 Ga0495630_0273075
1480 Ga0495630_1184355
1481 Ga0495667_0015176
1482 Ga0495656_0383629
1483 Ga0495635_0149387
1484 Ga0495661_0130639
1485 Ga0495588_0542048
1486 Ga0495657_0060907
1487 Ga0495657_0305090
1488 Ga0495658_0240992
1489 Ga0495658_0287722
1490 Ga0495613_0128588
1491 Ga0495624_0017254
1492 Ga0495649_0161183
1493 Ga0495589_0076666
1494 Ga0495600_0181341
1495 Ga0495636_0081043
1496 Ga0495674_1163237
1497 Ga0495676_0179777
1498 Ga0495676_0224447
1499 Ga0495676_0635515
1500 Ga0495680_0022776
1501 Ga0495683_0252367
1502 Ga0495684_0053664
1503 Ga0495614_0048491
1504 Ga0495626_0201911
1505 Ga0496100_0008236
1506 Ga0496100_0101775
1507 Ga0496100_0612675
1508 Ga0496100_0657791
1509 Ga0496101_0000735
1510 Ga0496101_0035693
1511 Ga0496101_0051756
1512 Ga0496101_0110979
1513 Ga0496101_0204888
1514 Ga0496101_0804999
1515 Ga0496101_1516657
1516 Ga0496102_0001216
1517 Ga0496102_0002713
1518 Ga0496102_0004949
1519 Ga0496102_0021825
1520 Ga0496102_0057297
1521 Ga0496102_0150169
1522 Ga0496102_0202002
1523 Ga0496102_0379833
1524 Ga0496102_1648303
1525 Ga0496103_0002705
1526 Ga0496103_0035655
1527 Ga0496103_0077376
1528 Ga0496103_0148019
1529 Ga0496104_0000134
1530 Ga0496104_0028410
1531 Ga0496104_0054508
1532 Ga0496104_0067820
1533 Ga0496104_0623787
1534 Ga0496104_1271154
1535 Ga0496104_1417344
1536 Ga0496105_0000484
1537 Ga0496105_0036663
1538 Ga0496105_0174680
1539 Ga0496105_0184856
1540 Ga0496106_0018184
1541 Ga0496106_0090449
1542 Ga0496106_0811044
1543 Ga0496106_0990536
1544 Ga0496107_0020634
1545 Ga0496107_0047392
1546 Ga0496107_0049850
1547 Ga0496107_0050199
1548 Ga0496107_0534218
1549 Ga0496107_0604577
1550 Ga0496107_1174405
1551 Ga0496108_0001238
1552 Ga0496108_0004984
1553 Ga0496108_0044538
1554 Ga0496108_0063188
1555 Ga0496108_0304533
1556 Ga0496108_0370652
1557 Ga0496108_1792805
1558 Ga0496109_0000898
1559 Ga0496109_0014986
1560 Ga0496109_0016825
1561 Ga0496109_0052892
1562 Ga0496109_0054658
1563 Ga0496109_0100070
1564 Ga0496109_0172836
1565 Ga0496109_0178938
1566 Ga0496109_0462505
1567 Ga0496109_0791725
1568 Ga0496110_0000851
1569 Ga0496110_0000905
1570 Ga0496110_0005135
1571 Ga0496110_0134709
1572 Ga0496110_0358315
1573 Ga0496110_0714335
1574 Ga0496110_0793199
1575 Ga0496110_0934957
1576 Ga0496111_0013044
1577 Ga0496111_0042155
1578 Ga0496111_0171953
1579 Ga0496111_0255115
1580 Ga0496111_0388966
1581 Ga0496111_0455804
1582 Ga0496112_0078305
1583 Ga0496112_0244434
1584 Ga0496112_0544835
1585 Ga0496112_0613310
1586 Ga0496112_0715941
1587 Ga0496112_0832144
1588 Ga0496113_0017399
1589 Ga0496113_0070861
1590 Ga0496113_0165213
1591 Ga0496113_0374931
1592 Ga0496113_0482516
1593 Ga0496114_0000597
1594 Ga0496114_0002596
1595 Ga0496114_0069746
1596 Ga0496114_0104528
1597 Ga0496115_0054617
1598 Ga0496115_0063108
1599 Ga0496115_0135744
1600 Ga0496115_0265491
1601 Ga0501031_0000784
1602 Ga0501032_0017056
1603 Ga0501033_0001741
1604 Ga0501034_0004685
1605 Ga0501034_0034868
1606 Ga0501034_0595828
1607 Ga0501036_0025762
1608 Ga0501037_0020117
1609 Ga0501037_0093043
1610 Ga0501038_0028184
1611 Ga0501039_0547254
1612 Ga0501040_0049265
1613 Ga0501040_0141502
1614 Ga0501042_0028132
1615 Ga0501042_0109600
1616 Ga0501043_0022114
1617 Ga0501046_0000162
1618 Ga0501046_0587256
1619 Ga0501047_0001471
1620 Ga0501047_0037313
1621 Ga0501047_0311170
1622 Ga0501048_0001285
1623 Ga0501067_0007016
1624 Ga0501067_0008934
1625 Ga0501067_0010223
1626 Ga0501067_0037515
1627 Ga0501067_0092538
1628 Ga0501067_0516410
1629 Ga0501068_0011568
1630 Ga0501068_0018378
1631 Ga0501068_0028736
1632 Ga0501069_0000428
1633 Ga0501069_0000856
1634 Ga0501069_0007926
1635 Ga0501069_0009520
1636 Ga0501069_0060440
1637 Ga0501069_0091416
1638 Ga0501070_0000032
1639 Ga0501070_0004474
1640 Ga0501070_0006018
1641 Ga0501070_0013992
1642 Ga0501070_0207431
1643 Ga0501070_0215280
1644 Ga0501070_0249793
1645 Ga0501070_0297653
1646 Ga0501070_0298971
1647 Ga0501071_0019931
1648 Ga0501071_0061168
1649 Ga0501071_0286356
1650 Ga0501072_0618279
1651 Ga0501073_0018899
1652 Ga0501073_0103628
1653 Ga0501073_0257241
1654 Ga0501074_0002052
1655 Ga0501074_0018970
1656 Ga0501074_0027224
1657 Ga0501074_0050263
1658 Ga0501074_0445912
1659 Ga0501075_0747072
1660 Ga0501077_0227761
1661 Ga0501079_0000154
1662 Ga0501079_0073348
1663 Ga0501080_0000096
1664 Ga0501080_0009066
1665 Ga0501080_0015468
1666 Ga0501080_0018304
1667 Ga0501080_0031976
1668 Ga0501080_0069360
1669 Ga0501080_1085927
1670 Ga0501083_0017869
1671 Ga0501083_0463269
1672 Ga0501035_0001581
1673 Ga0501035_0194829
1674 Ga0501044_0000056
1675 Ga0501044_0002508
1676 Ga0501044_0078601
1677 Ga0501044_0970669
1678 Ga0501045_0068121
1679 nmdc:mga05p37_203949_c1
1680 nmdc:mga05p37_276541_c1
1681 nmdc:mga05p37_328065_c1
1682 nmdc:mga0qj67_165844_c1
1683 nmdc:mga08y16_121319_c1
1684 nmdc:mga08y16_13904_c1
1685 nmdc:mga08y16_371457_c1
1686 nmdc:mga08y16_419358_c1
1687 nmdc:mga08y16_645936_c1
1688 nmdc:mga08y16_887716_c1
1689 nmdc:mga0n895_131085_c1
1690 nmdc:mga0n895_3007_c1
1691 nmdc:mga0n895_41130_c1
1692 nmdc:mga0n895_432754_c1
1693 nmdc:mga0n895_65495_c1
1694 nmdc:mga0n895_710568_c1
1695 nmdc:mga0rr50_13483_c1
1696 nmdc:mga0rr50_449927_c1
1697 nmdc:mga0rr50_829541_c1
1698 nmdc:mga08x19_344872_c1
1699 nmdc:mga08x19_37852_c1
1700 nmdc:mga08x19_79926_c1
1701 nmdc:mga0a205_4356_c1
1702 nmdc:mga0a205_899455_c1
1703 Ga0495655_0032761
1704 Ga0495595_0022594
1705 Ga0501084_0361149
1706 Ga0587073_0192793
1707 Ga0501082_0026821
1708 Ga0466962_0006257
1709 Ga0466962_0009425
1710 Ga0466962_0126676
1711 Ga0466962_0395624
1712 Ga0530510_0044741
1713 Ga0530510_0045135
1714 Ga0530510_0178214

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

77

155

0.95

PF20730

YetF_N

YetF N-terminal transmembrane domain

1

75

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3c6f-assembly1.cif.gz_C crystal structure of protein bsu07140 from bacillus subtilis 0.9307 91 146
6rdk-assembly1.cif.gz_G cryo-em structure of polytomella f-atp synthase, rotary substate 1b, composite map 0.4742 1 86
4qnc-assembly1.cif.gz_A crystal structure of a semisweet in an occluded state 0.4657 3 66
6rd8-assembly1.cif.gz_J cryoem structure of polytomella f-atp synthase, c-ring position 2, focussed refinement of fo and peripheral stalk 0.4651 1 86
6rdk-assembly1.cif.gz_G cryo-em structure of polytomella f-atp synthase, rotary substate 1b, composite map 0.4604 1 86
ID Description Score Start End Superfamily
3c6fC02 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.93 89 144 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.9278 91 146 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8517 77 147 3.30.240.20
3c6fD01 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8317 91 146 3.30.240.20
af_P75839_95_166_3.30.240.20 Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains 0.8314 77 147 3.30.240.20
ID Description Score Start End GO Terms
AF-A0A2W4LXT0-F1-model_v4 DUF421 domain-containing protein 0.8654 1 147 GO:0005886
AF-A0A7S8IZR0-F1-model_v4 YetF C-terminal domain-containing protein 0.8633 3 147 GO:0005886
AF-A0A2R6EFH0-F1-model_v4 DUF421 domain-containing protein 0.8608 24 145 GO:0005886
AF-A0A2W4LXT0-F1-model_v4 DUF421 domain-containing protein 0.8601 1 147 GO:0005886
AF-A0A7W0JQC3-F1-model_v4 DUF421 domain-containing protein 0.8531 2 144 GO:0005886

Map