F483698
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 857 | 288 | 1714 | 145 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0188518|Ga0466967_0188518_463_936 |
| Length | 157 |
| Sequence | MDIALRAIFLYAFVVFLMRVMGRRELSSLSAIDLVLLIVLGDAIQQGLTQDDYSVTGAVIAVSTIAAVQVGSSYLSYRSRRMRRVLEGEPIVIVQAGKLIERNMKRERLTEDEVAEEMRTQQIASVGDVEWGILESDGTMSFIPKNPRPTAAGRSWA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 89 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 107 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 110 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 165 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 168 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 169 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 175 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 176 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 177 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 178 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 179 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 183 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 184 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 187 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 188 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 189 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 190 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 193 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 194 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 197 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 232 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 233 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 234 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 235 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 236 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 254 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 288 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.72 |
| Metatranscriptomes | 1.28 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 11.32 |
| Rhizosphere | 87.98 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0188518 | 3300045976 | Unclassified | 1948 |
| 2 | JGI24746J21847_1024597 | 3300001977 | Unclassified | 834 |
| 3 | JGI24751J29686_10084866 | 3300002459 | Unclassified | 657 |
| 4 | Ga0065712_10120415 | 3300005290 | Bacteria | 1679 |
| 5 | Ga0065715_10335807 | 3300005293 | Unclassified | 975 |
| 6 | Ga0070658_10056846 | 3300005327 | Bacteria | 3181 |
| 7 | Ga0070658_10078745 | 3300005327 | Bacteria | 2706 |
| 8 | Ga0070658_10156069 | 3300005327 | Bacteria | 1913 |
| 9 | Ga0070658_10221886 | 3300005327 | Unclassified | 1599 |
| 10 | Ga0070683_100038026 | 3300005329 | Bacteria | 4409 |
| 11 | Ga0070683_100066613 | 3300005329 | Bacteria | 3355 |
| 12 | Ga0070683_100095696 | 3300005329 | Bacteria | 2792 |
| 13 | Ga0070683_100112761 | 3300005329 | Bacteria | 2566 |
| 14 | Ga0070683_100173035 | 3300005329 | Bacteria | 2050 |
| 15 | Ga0070683_100743225 | 3300005329 | Unclassified | 940 |
| 16 | Ga0070690_101099849 | 3300005330 | Unclassified | 630 |
| 17 | Ga0070670_100094769 | 3300005331 | Unclassified | 2567 |
| 18 | Ga0070677_10181137 | 3300005333 | Unclassified | 1003 |
| 19 | Ga0068869_100538551 | 3300005334 | Unclassified | 979 |
| 20 | Ga0070680_100014676 | 3300005336 | Bacteria | 6126 |
| 21 | Ga0070680_100052938 | 3300005336 | Bacteria | 3313 |
| 22 | Ga0070680_100061167 | 3300005336 | Bacteria | 3082 |
| 23 | Ga0070680_100078728 | 3300005336 | Unclassified | 2716 |
| 24 | Ga0070682_100017035 | 3300005337 | Bacteria | 4232 |
| 25 | Ga0070682_100029295 | 3300005337 | Bacteria | 3313 |
| 26 | Ga0070682_100081456 | 3300005337 | Unclassified | 2096 |
| 27 | Ga0070682_100292287 | 3300005337 | Unclassified | 1192 |
| 28 | Ga0070682_101146206 | 3300005337 | Unclassified | 653 |
| 29 | Ga0070682_101257976 | 3300005337 | Unclassified | 627 |
| 30 | Ga0068868_100043392 | 3300005338 | Bacteria | 3513 |
| 31 | Ga0068868_100880038 | 3300005338 | Unclassified | 813 |
| 32 | Ga0070660_100007754 | 3300005339 | Bacteria | 7487 |
| 33 | Ga0070660_100123379 | 3300005339 | Bacteria | 2068 |
| 34 | Ga0070691_10057135 | 3300005341 | Unclassified | 1871 |
| 35 | Ga0070691_10233364 | 3300005341 | Bacteria | 980 |
| 36 | Ga0070691_10827082 | 3300005341 | Unclassified | 566 |
| 37 | Ga0070687_100417177 | 3300005343 | Unclassified | 884 |
| 38 | Ga0070661_100129574 | 3300005344 | Bacteria | 1894 |
| 39 | Ga0070661_100232235 | 3300005344 | Bacteria | 1418 |
| 40 | Ga0070661_100838304 | 3300005344 | Unclassified | 756 |
| 41 | Ga0070661_100994194 | 3300005344 | Bacteria | 696 |
| 42 | Ga0070692_10424487 | 3300005345 | Unclassified | 845 |
| 43 | Ga0070668_100855552 | 3300005347 | Unclassified | 811 |
| 44 | Ga0070668_100952540 | 3300005347 | Unclassified | 769 |
| 45 | Ga0070669_100507769 | 3300005353 | Unclassified | 1001 |
| 46 | Ga0070671_100142316 | 3300005355 | Bacteria | 2024 |
| 47 | Ga0070671_100378232 | 3300005355 | Unclassified | 1210 |
| 48 | Ga0070674_100078318 | 3300005356 | Unclassified | 2355 |
| 49 | Ga0070674_100213567 | 3300005356 | Bacteria | 1497 |
| 50 | Ga0070674_100266839 | 3300005356 | Bacteria | 1351 |
| 51 | Ga0070674_100337825 | 3300005356 | Unclassified | 1212 |
| 52 | Ga0070673_100443304 | 3300005364 | Unclassified | 1167 |
| 53 | Ga0070673_101188583 | 3300005364 | Bacteria | 714 |
| 54 | Ga0070688_100799427 | 3300005365 | Unclassified | 737 |
| 55 | Ga0070659_100056043 | 3300005366 | Bacteria | 3107 |
| 56 | Ga0070659_100554868 | 3300005366 | Unclassified | 984 |
| 57 | Ga0070709_10437401 | 3300005434 | Unclassified | 983 |
| 58 | Ga0070714_100009235 | 3300005435 | Bacteria | 7746 |
| 59 | Ga0070714_100045826 | 3300005435 | Bacteria | 3708 |
| 60 | Ga0070714_100123253 | 3300005435 | Bacteria | 2308 |
| 61 | Ga0070713_100643534 | 3300005436 | Unclassified | 1009 |
| 62 | Ga0070713_101186748 | 3300005436 | Bacteria | 739 |
| 63 | Ga0070701_10140042 | 3300005438 | Unclassified | 1382 |
| 64 | Ga0070711_100048624 | 3300005439 | Bacteria | 2902 |
| 65 | Ga0070705_100521343 | 3300005440 | Unclassified | 906 |
| 66 | Ga0070705_100563056 | 3300005440 | Bacteria | 876 |
| 67 | Ga0070700_100766897 | 3300005441 | Unclassified | 773 |
| 68 | Ga0070700_101240142 | 3300005441 | Unclassified | 624 |
| 69 | Ga0070694_100397165 | 3300005444 | Bacteria | 1079 |
| 70 | Ga0070694_100744267 | 3300005444 | Unclassified | 800 |
| 71 | Ga0070663_100001354 | 3300005455 | Bacteria | 13389 |
| 72 | Ga0070663_100433268 | 3300005455 | Bacteria | 1081 |
| 73 | Ga0070663_101104875 | 3300005455 | Bacteria | 693 |
| 74 | Ga0070663_101152557 | 3300005455 | Unclassified | 680 |
| 75 | Ga0070678_100026290 | 3300005456 | Bacteria | 3932 |
| 76 | Ga0070678_100047140 | 3300005456 | Bacteria | 3095 |
| 77 | Ga0070678_100380900 | 3300005456 | Unclassified | 1220 |
| 78 | Ga0070662_100027753 | 3300005457 | Bacteria | 3934 |
| 79 | Ga0070662_100505282 | 3300005457 | Unclassified | 1009 |
| 80 | Ga0070681_10004088 | 3300005458 | Bacteria | 13788 |
| 81 | Ga0070681_10005202 | 3300005458 | Bacteria | 12561 |
| 82 | Ga0070681_10013493 | 3300005458 | Bacteria | 8120 |
| 83 | Ga0070681_10022680 | 3300005458 | Bacteria | 6307 |
| 84 | Ga0070681_10101498 | 3300005458 | Unclassified | 2823 |
| 85 | Ga0070681_10256807 | 3300005458 | Bacteria | 1659 |
| 86 | Ga0070681_10307627 | 3300005458 | Bacteria | 1494 |
| 87 | Ga0070681_10356307 | 3300005458 | Bacteria | 1373 |
| 88 | Ga0070685_10013576 | 3300005466 | Unclassified | 4299 |
| 89 | Ga0070685_10346423 | 3300005466 | Unclassified | 1014 |
| 90 | Ga0070679_100001302 | 3300005530 | Bacteria | 22036 |
| 91 | Ga0070679_100012229 | 3300005530 | Bacteria | 8198 |
| 92 | Ga0070679_100112115 | 3300005530 | Bacteria | 2713 |
| 93 | Ga0070679_100125296 | 3300005530 | Bacteria | 2551 |
| 94 | Ga0070679_100260684 | 3300005530 | Unclassified | 1689 |
| 95 | Ga0070679_100341246 | 3300005530 | Bacteria | 1446 |
| 96 | Ga0070679_100782114 | 3300005530 | Unclassified | 897 |
| 97 | Ga0070679_101292471 | 3300005530 | Bacteria | 675 |
| 98 | Ga0070684_100003652 | 3300005535 | Bacteria | 11603 |
| 99 | Ga0070684_100039454 | 3300005535 | Bacteria | 4061 |
| 100 | Ga0070684_100113814 | 3300005535 | Bacteria | 2428 |
| 101 | Ga0070684_100523130 | 3300005535 | Bacteria | 1099 |
| 102 | Ga0070684_100537319 | 3300005535 | Bacteria | 1084 |
| 103 | Ga0070684_100987293 | 3300005535 | Unclassified | 790 |
| 104 | Ga0070697_100039698 | 3300005536 | Unclassified | 3807 |
| 105 | Ga0070697_100735848 | 3300005536 | Unclassified | 871 |
| 106 | Ga0068853_100948589 | 3300005539 | Unclassified | 827 |
| 107 | Ga0070672_100122696 | 3300005543 | Unclassified | 2128 |
| 108 | Ga0070686_100402154 | 3300005544 | Bacteria | 1042 |
| 109 | Ga0070686_100583530 | 3300005544 | Unclassified | 879 |
| 110 | Ga0070695_100002173 | 3300005545 | Bacteria | 11236 |
| 111 | Ga0070695_100092348 | 3300005545 | Unclassified | 2023 |
| 112 | Ga0070695_100221164 | 3300005545 | Unclassified | 1364 |
| 113 | Ga0070695_100722385 | 3300005545 | Bacteria | 792 |
| 114 | Ga0070696_100012188 | 3300005546 | Bacteria | 5761 |
| 115 | Ga0070696_100184129 | 3300005546 | Bacteria | 1551 |
| 116 | Ga0070696_100962415 | 3300005546 | Unclassified | 711 |
| 117 | Ga0070696_101461554 | 3300005546 | Bacteria | 584 |
| 118 | Ga0070693_100003297 | 3300005547 | Bacteria | 7498 |
| 119 | Ga0070693_100061708 | 3300005547 | Bacteria | 2180 |
| 120 | Ga0070665_100208549 | 3300005548 | Unclassified | 1954 |
| 121 | Ga0070704_100345547 | 3300005549 | Unclassified | 1254 |
| 122 | Ga0070704_101659601 | 3300005549 | Unclassified | 590 |
| 123 | Ga0068855_100108954 | 3300005563 | Bacteria | 3181 |
| 124 | Ga0068855_100354051 | 3300005563 | Unclassified | 1617 |
| 125 | Ga0068855_101433182 | 3300005563 | Unclassified | 711 |
| 126 | Ga0070664_100188195 | 3300005564 | Bacteria | 1838 |
| 127 | Ga0070664_100414408 | 3300005564 | Unclassified | 1233 |
| 128 | Ga0070664_100530627 | 3300005564 | Unclassified | 1087 |
| 129 | Ga0070664_101287880 | 3300005564 | Unclassified | 690 |
| 130 | Ga0068857_100002399 | 3300005577 | Bacteria | 15278 |
| 131 | Ga0068857_102270773 | 3300005577 | Unclassified | 533 |
| 132 | Ga0068857_102505781 | 3300005577 | Unclassified | 506 |
| 133 | Ga0068854_100519197 | 3300005578 | Bacteria | 1006 |
| 134 | Ga0068854_100871254 | 3300005578 | Bacteria | 790 |
| 135 | Ga0068854_100941431 | 3300005578 | Unclassified | 761 |
| 136 | Ga0068856_100032154 | 3300005614 | Bacteria | 5136 |
| 137 | Ga0068856_100072526 | 3300005614 | Bacteria | 3409 |
| 138 | Ga0068856_100078848 | 3300005614 | Bacteria | 3265 |
| 139 | Ga0068856_100110734 | 3300005614 | Bacteria | 2743 |
| 140 | Ga0068856_100127835 | 3300005614 | Bacteria | 2545 |
| 141 | Ga0068856_100221143 | 3300005614 | Bacteria | 1909 |
| 142 | Ga0068856_100234044 | 3300005614 | Bacteria | 1852 |
| 143 | Ga0068856_100569976 | 3300005614 | Bacteria | 1153 |
| 144 | Ga0068856_101332600 | 3300005614 | Bacteria | 733 |
| 145 | Ga0068852_100117174 | 3300005616 | Bacteria | 2432 |
| 146 | Ga0068852_100941657 | 3300005616 | Bacteria | 881 |
| 147 | Ga0068864_100122839 | 3300005618 | Unclassified | 2324 |
| 148 | Ga0068866_10154714 | 3300005718 | Unclassified | 1331 |
| 149 | Ga0068866_10299247 | 3300005718 | Bacteria | 1004 |
| 150 | Ga0068863_100171806 | 3300005841 | Unclassified | 2079 |
| 151 | Ga0068863_100813460 | 3300005841 | Bacteria | 932 |
| 152 | Ga0068860_100562793 | 3300005843 | Bacteria | 1143 |
| 153 | Ga0081539_10018807 | 3300005985 | Unclassified | 4765 |
| 154 | Ga0081539_10043615 | 3300005985 | Bacteria | 2597 |
| 155 | Ga0070717_10007314 | 3300006028 | Bacteria | 8193 |
| 156 | Ga0070717_10020944 | 3300006028 | Bacteria | 5148 |
| 157 | Ga0070716_100651057 | 3300006173 | Bacteria | 799 |
| 158 | Ga0070712_100081037 | 3300006175 | Bacteria | 2351 |
| 159 | Ga0070712_100246004 | 3300006175 | Bacteria | 1427 |
| 160 | Ga0097621_100754588 | 3300006237 | Bacteria | 899 |
| 161 | Ga0075428_100297052 | 3300006844 | Unclassified | 1737 |
| 162 | Ga0075430_100317136 | 3300006846 | Bacteria | 1289 |
| 163 | Ga0075431_100779524 | 3300006847 | Unclassified | 930 |
| 164 | Ga0075433_10013206 | 3300006852 | Bacteria | 6705 |
| 165 | Ga0075433_10303479 | 3300006852 | Bacteria | 1414 |
| 166 | Ga0075433_10912236 | 3300006852 | Bacteria | 766 |
| 167 | Ga0075434_100002825 | 3300006871 | Bacteria | 15378 |
| 168 | Ga0075434_100007883 | 3300006871 | Bacteria | 9863 |
| 169 | Ga0075434_100182047 | 3300006871 | Bacteria | 2122 |
| 170 | Ga0075434_100370031 | 3300006871 | Bacteria | 1454 |
| 171 | Ga0068865_100114685 | 3300006881 | Unclassified | 1993 |
| 172 | Ga0068865_100706932 | 3300006881 | Bacteria | 862 |
| 173 | Ga0075436_100050747 | 3300006914 | Bacteria | 2863 |
| 174 | Ga0075436_100072955 | 3300006914 | Unclassified | 2375 |
| 175 | Ga0075436_100591600 | 3300006914 | Bacteria | 817 |
| 176 | Ga0075435_100083098 | 3300007076 | Unclassified | 2632 |
| 177 | Ga0075435_100100650 | 3300007076 | Unclassified | 2394 |
| 178 | Ga0075435_100212090 | 3300007076 | Bacteria | 1643 |
| 179 | Ga0075435_100217215 | 3300007076 | Bacteria | 1623 |
| 180 | Ga0075435_100306275 | 3300007076 | Bacteria | 1359 |
| 181 | Ga0099795_10508781 | 3300007788 | Unclassified | 562 |
| 182 | Ga0105240_10013540 | 3300009093 | Bacteria | 11196 |
| 183 | Ga0105240_10124766 | 3300009093 | Bacteria | 3096 |
| 184 | Ga0105240_10587452 | 3300009093 | Bacteria | 1228 |
| 185 | Ga0111539_10002777 | 3300009094 | Bacteria | 23238 |
| 186 | Ga0111539_10041358 | 3300009094 | Bacteria | 5542 |
| 187 | Ga0111539_10092843 | 3300009094 | Bacteria | 3546 |
| 188 | Ga0111539_10527759 | 3300009094 | Bacteria | 1375 |
| 189 | Ga0111539_10853207 | 3300009094 | Unclassified | 1060 |
| 190 | Ga0105245_10034907 | 3300009098 | Bacteria | 4462 |
| 191 | Ga0105245_10050771 | 3300009098 | Bacteria | 3718 |
| 192 | Ga0105245_10123449 | 3300009098 | Bacteria | 2421 |
| 193 | Ga0105245_10131498 | 3300009098 | Unclassified | 2348 |
| 194 | Ga0105245_10178243 | 3300009098 | Unclassified | 2028 |
| 195 | Ga0105245_10264020 | 3300009098 | Unclassified | 1676 |
| 196 | Ga0114129_10282382 | 3300009147 | Bacteria | 2218 |
| 197 | Ga0114129_10400255 | 3300009147 | Bacteria | 1809 |
| 198 | Ga0105243_10029991 | 3300009148 | Bacteria | 4186 |
| 199 | Ga0105243_10285175 | 3300009148 | Unclassified | 1489 |
| 200 | Ga0105243_10777349 | 3300009148 | Bacteria | 941 |
| 201 | Ga0105243_11963785 | 3300009148 | Bacteria | 619 |
| 202 | Ga0105241_10034607 | 3300009174 | Bacteria | 3796 |
| 203 | Ga0105241_10614045 | 3300009174 | Bacteria | 984 |
| 204 | Ga0105242_10011248 | 3300009176 | Bacteria | 6877 |
| 205 | Ga0105242_10236200 | 3300009176 | Unclassified | 1641 |
| 206 | Ga0105242_10760862 | 3300009176 | Bacteria | 955 |
| 207 | Ga0105242_10886736 | 3300009176 | Unclassified | 891 |
| 208 | Ga0105242_11478576 | 3300009176 | Bacteria | 709 |
| 209 | Ga0105248_10127892 | 3300009177 | Bacteria | 2866 |
| 210 | Ga0105248_10151731 | 3300009177 | Unclassified | 2614 |
| 211 | Ga0105248_10536607 | 3300009177 | Bacteria | 1319 |
| 212 | Ga0105248_10756973 | 3300009177 | Unclassified | 1096 |
| 213 | Ga0105248_10781677 | 3300009177 | Bacteria | 1077 |
| 214 | Ga0105237_10061228 | 3300009545 | Bacteria | 3764 |
| 215 | Ga0105237_10326261 | 3300009545 | Bacteria | 1539 |
| 216 | Ga0105237_10947321 | 3300009545 | Bacteria | 868 |
| 217 | Ga0105238_10083356 | 3300009551 | Bacteria | 3186 |
| 218 | Ga0105238_10109300 | 3300009551 | Bacteria | 2746 |
| 219 | Ga0105238_10233605 | 3300009551 | Bacteria | 1815 |
| 220 | Ga0105238_10381129 | 3300009551 | Bacteria | 1402 |
| 221 | Ga0105238_10508735 | 3300009551 | Bacteria | 1206 |
| 222 | Ga0105249_10135924 | 3300009553 | Unclassified | 2352 |
| 223 | Ga0105249_10424569 | 3300009553 | Bacteria | 1364 |
| 224 | Ga0105239_10011216 | 3300010375 | Bacteria | 10001 |
| 225 | Ga0105239_10039700 | 3300010375 | Bacteria | 5157 |
| 226 | Ga0105239_10042402 | 3300010375 | Bacteria | 4987 |
| 227 | Ga0105239_10082056 | 3300010375 | Bacteria | 3549 |
| 228 | Ga0105239_10285610 | 3300010375 | Bacteria | 1858 |
| 229 | Ga0105239_10338218 | 3300010375 | Unclassified | 1698 |
| 230 | Ga0105239_10460456 | 3300010375 | Unclassified | 1443 |
| 231 | Ga0105239_11344634 | 3300010375 | Bacteria | 824 |
| 232 | Ga0105239_11355104 | 3300010375 | Unclassified | 821 |
| 233 | Ga0105246_10030372 | 3300011119 | Bacteria | 3568 |
| 234 | Ga0105246_10033922 | 3300011119 | Unclassified | 3395 |
| 235 | Ga0105246_12108905 | 3300011119 | Bacteria | 546 |
| 236 | Ga0157320_1011300 | 3300012481 | Bacteria | 701 |
| 237 | Ga0157371_10221846 | 3300013102 | Bacteria | 1358 |
| 238 | Ga0157371_10234463 | 3300013102 | Bacteria | 1319 |
| 239 | Ga0157371_11390168 | 3300013102 | Bacteria | 545 |
| 240 | Ga0157370_10187652 | 3300013104 | Bacteria | 1919 |
| 241 | Ga0157370_10359089 | 3300013104 | Bacteria | 1343 |
| 242 | Ga0157369_10023673 | 3300013105 | Bacteria | 6840 |
| 243 | Ga0157369_10082298 | 3300013105 | Bacteria | 3444 |
| 244 | Ga0157369_10812863 | 3300013105 | Bacteria | 960 |
| 245 | Ga0157369_10909693 | 3300013105 | Bacteria | 902 |
| 246 | Ga0157369_10919951 | 3300013105 | Bacteria | 897 |
| 247 | Ga0157369_12005403 | 3300013105 | Bacteria | 587 |
| 248 | Ga0157374_10017674 | 3300013296 | Bacteria | 6284 |
| 249 | Ga0157374_10075205 | 3300013296 | Bacteria | 3192 |
| 250 | Ga0157374_11189713 | 3300013296 | Unclassified | 783 |
| 251 | Ga0157378_10150072 | 3300013297 | Unclassified | 2171 |
| 252 | Ga0163162_10182775 | 3300013306 | Bacteria | 2223 |
| 253 | Ga0163162_10386424 | 3300013306 | Bacteria | 1533 |
| 254 | Ga0163162_11711503 | 3300013306 | Unclassified | 718 |
| 255 | Ga0163162_12295425 | 3300013306 | Unclassified | 620 |
| 256 | Ga0157372_10048315 | 3300013307 | Bacteria | 4730 |
| 257 | Ga0157372_10112115 | 3300013307 | Bacteria | 3125 |
| 258 | Ga0157372_10115264 | 3300013307 | Bacteria | 3081 |
| 259 | Ga0157372_10191177 | 3300013307 | Bacteria | 2371 |
| 260 | Ga0157372_10224887 | 3300013307 | Bacteria | 2176 |
| 261 | Ga0157372_10359948 | 3300013307 | Bacteria | 1695 |
| 262 | Ga0157372_10381454 | 3300013307 | Unclassified | 1642 |
| 263 | Ga0157372_10720582 | 3300013307 | Bacteria | 1160 |
| 264 | Ga0157372_11343878 | 3300013307 | Bacteria | 824 |
| 265 | Ga0157372_11894199 | 3300013307 | Bacteria | 685 |
| 266 | Ga0157375_10014286 | 3300013308 | Bacteria | 7080 |
| 267 | Ga0157375_10123813 | 3300013308 | Bacteria | 2698 |
| 268 | Ga0157375_10242929 | 3300013308 | Bacteria | 1960 |
| 269 | Ga0157375_10374382 | 3300013308 | Bacteria | 1590 |
| 270 | Ga0157375_10551564 | 3300013308 | Bacteria | 1314 |
| 271 | Ga0163163_10052869 | 3300014325 | Bacteria | 4008 |
| 272 | Ga0163163_10186191 | 3300014325 | Unclassified | 2124 |
| 273 | Ga0163163_10194136 | 3300014325 | Bacteria | 2078 |
| 274 | Ga0163163_12588381 | 3300014325 | Bacteria | 565 |
| 275 | Ga0157380_10113205 | 3300014326 | Unclassified | 2284 |
| 276 | Ga0157380_11993028 | 3300014326 | Bacteria | 642 |
| 277 | Ga0182008_10261199 | 3300014497 | Bacteria | 896 |
| 278 | Ga0157377_10046768 | 3300014745 | Unclassified | 2422 |
| 279 | Ga0157377_10137012 | 3300014745 | Bacteria | 1501 |
| 280 | Ga0157377_10548486 | 3300014745 | Bacteria | 816 |
| 281 | Ga0157379_10540545 | 3300014968 | Bacteria | 1083 |
| 282 | Ga0157379_11190969 | 3300014968 | Bacteria | 732 |
| 283 | Ga0157376_10075638 | 3300014969 | Bacteria | 2874 |
| 284 | Ga0157376_10177102 | 3300014969 | Unclassified | 1946 |
| 285 | Ga0163161_11401243 | 3300017792 | Bacteria | 610 |
| 286 | Ga0197907_10809293 | 3300020069 | Unclassified | 816 |
| 287 | Ga0206356_11892448 | 3300020070 | Bacteria | 3059 |
| 288 | Ga0206355_1270139 | 3300020076 | Bacteria | 967 |
| 289 | Ga0206354_10299673 | 3300020081 | Bacteria | 2684 |
| 290 | Ga0206353_10059895 | 3300020082 | Unclassified | 617 |
| 291 | Ga0206353_10877554 | 3300020082 | Unclassified | 856 |
| 292 | Ga0213876_10002035 | 3300021384 | Bacteria | 12024 |
| 293 | Ga0224712_10007156 | 3300022467 | Bacteria | 3230 |
| 294 | Ga0224712_10175156 | 3300022467 | Unclassified | 964 |
| 295 | Ga0224712_10188025 | 3300022467 | Bacteria | 934 |
| 296 | Ga0224712_10244316 | 3300022467 | Unclassified | 828 |
| 297 | Ga0207642_10112109 | 3300025899 | Bacteria | 1391 |
| 298 | Ga0207642_10240720 | 3300025899 | Unclassified | 1021 |
| 299 | Ga0207688_10028876 | 3300025901 | Unclassified | 3051 |
| 300 | Ga0207688_10399678 | 3300025901 | Bacteria | 852 |
| 301 | Ga0207699_10134773 | 3300025906 | Unclassified | 1616 |
| 302 | Ga0207699_11152367 | 3300025906 | Bacteria | 574 |
| 303 | Ga0207643_10003437 | 3300025908 | Bacteria | 8518 |
| 304 | Ga0207705_10095069 | 3300025909 | Bacteria | 2186 |
| 305 | Ga0207705_10096644 | 3300025909 | Bacteria | 2169 |
| 306 | Ga0207705_10162124 | 3300025909 | Bacteria | 1680 |
| 307 | Ga0207684_10219608 | 3300025910 | Unclassified | 1640 |
| 308 | Ga0207654_10089438 | 3300025911 | Unclassified | 1873 |
| 309 | Ga0207654_10546675 | 3300025911 | Bacteria | 822 |
| 310 | Ga0207654_11300431 | 3300025911 | Unclassified | 530 |
| 311 | Ga0207707_10004701 | 3300025912 | Bacteria | 11981 |
| 312 | Ga0207707_10020322 | 3300025912 | Bacteria | 5799 |
| 313 | Ga0207707_10023248 | 3300025912 | Bacteria | 5424 |
| 314 | Ga0207707_10073838 | 3300025912 | Bacteria | 2974 |
| 315 | Ga0207707_10100098 | 3300025912 | Bacteria | 2533 |
| 316 | Ga0207707_10609786 | 3300025912 | Bacteria | 923 |
| 317 | Ga0207695_10009334 | 3300025913 | Bacteria | 12136 |
| 318 | Ga0207695_10013582 | 3300025913 | Bacteria | 9700 |
| 319 | Ga0207695_11650563 | 3300025913 | Unclassified | 522 |
| 320 | Ga0207671_10059594 | 3300025914 | Bacteria | 2831 |
| 321 | Ga0207671_10549646 | 3300025914 | Unclassified | 921 |
| 322 | Ga0207693_10093940 | 3300025915 | Bacteria | 2351 |
| 323 | Ga0207693_10155180 | 3300025915 | Bacteria | 1800 |
| 324 | Ga0207660_10023976 | 3300025917 | Bacteria | 4126 |
| 325 | Ga0207660_10106618 | 3300025917 | Unclassified | 2101 |
| 326 | Ga0207660_10278290 | 3300025917 | Bacteria | 1327 |
| 327 | Ga0207660_10331930 | 3300025917 | Unclassified | 1216 |
| 328 | Ga0207662_10670925 | 3300025918 | Unclassified | 725 |
| 329 | Ga0207657_10138275 | 3300025919 | Unclassified | 1992 |
| 330 | Ga0207657_10237473 | 3300025919 | Unclassified | 1456 |
| 331 | Ga0207649_10200783 | 3300025920 | Bacteria | 1408 |
| 332 | Ga0207652_10000283 | 3300025921 | Bacteria | 52945 |
| 333 | Ga0207652_10033729 | 3300025921 | Bacteria | 4311 |
| 334 | Ga0207652_10044714 | 3300025921 | Unclassified | 3773 |
| 335 | Ga0207652_10333599 | 3300025921 | Bacteria | 1369 |
| 336 | Ga0207652_10468371 | 3300025921 | Bacteria | 1135 |
| 337 | Ga0207652_10538930 | 3300025921 | Bacteria | 1049 |
| 338 | Ga0207681_10988577 | 3300025923 | Bacteria | 706 |
| 339 | Ga0207681_11023697 | 3300025923 | Unclassified | 693 |
| 340 | Ga0207694_10069985 | 3300025924 | Bacteria | 2741 |
| 341 | Ga0207694_10382363 | 3300025924 | Bacteria | 1169 |
| 342 | Ga0207694_10443394 | 3300025924 | Bacteria | 1083 |
| 343 | Ga0207694_10456862 | 3300025924 | Bacteria | 1067 |
| 344 | Ga0207650_10078957 | 3300025925 | Unclassified | 2491 |
| 345 | Ga0207650_10692381 | 3300025925 | Bacteria | 861 |
| 346 | Ga0207659_10098446 | 3300025926 | Unclassified | 2199 |
| 347 | Ga0207659_10728915 | 3300025926 | Bacteria | 850 |
| 348 | Ga0207687_10021930 | 3300025927 | Bacteria | 4246 |
| 349 | Ga0207687_10125498 | 3300025927 | Unclassified | 1926 |
| 350 | Ga0207687_10165138 | 3300025927 | Bacteria | 1703 |
| 351 | Ga0207687_10396579 | 3300025927 | Bacteria | 1134 |
| 352 | Ga0207687_10521945 | 3300025927 | Unclassified | 993 |
| 353 | Ga0207687_10545959 | 3300025927 | Bacteria | 972 |
| 354 | Ga0207687_11031617 | 3300025927 | Bacteria | 705 |
| 355 | Ga0207687_11160296 | 3300025927 | Bacteria | 664 |
| 356 | Ga0207700_10041273 | 3300025928 | Bacteria | 3374 |
| 357 | Ga0207700_10226887 | 3300025928 | Unclassified | 1586 |
| 358 | Ga0207700_10525382 | 3300025928 | Unclassified | 1049 |
| 359 | Ga0207700_10655736 | 3300025928 | Bacteria | 936 |
| 360 | Ga0207700_10805772 | 3300025928 | Bacteria | 840 |
| 361 | Ga0207700_10979618 | 3300025928 | Bacteria | 757 |
| 362 | Ga0207664_10001938 | 3300025929 | Bacteria | 13599 |
| 363 | Ga0207644_10276223 | 3300025931 | Bacteria | 1348 |
| 364 | Ga0207644_10581815 | 3300025931 | Bacteria | 929 |
| 365 | Ga0207644_10777748 | 3300025931 | Unclassified | 800 |
| 366 | Ga0207644_10969937 | 3300025931 | Unclassified | 713 |
| 367 | Ga0207690_10164060 | 3300025932 | Bacteria | 1659 |
| 368 | Ga0207690_10671196 | 3300025932 | Unclassified | 850 |
| 369 | Ga0207706_10492641 | 3300025933 | Unclassified | 1058 |
| 370 | Ga0207706_10697905 | 3300025933 | Unclassified | 867 |
| 371 | Ga0207686_10130146 | 3300025934 | Unclassified | 1725 |
| 372 | Ga0207686_10569034 | 3300025934 | Unclassified | 888 |
| 373 | Ga0207686_10948309 | 3300025934 | Unclassified | 696 |
| 374 | Ga0207709_10049473 | 3300025935 | Unclassified | 2566 |
| 375 | Ga0207709_10567370 | 3300025935 | Bacteria | 895 |
| 376 | Ga0207669_10070436 | 3300025937 | Unclassified | 2192 |
| 377 | Ga0207669_10139204 | 3300025937 | Bacteria | 1682 |
| 378 | Ga0207669_10328551 | 3300025937 | Bacteria | 1173 |
| 379 | Ga0207704_10028781 | 3300025938 | Unclassified | 3088 |
| 380 | Ga0207665_10510887 | 3300025939 | Unclassified | 929 |
| 381 | Ga0207691_10076084 | 3300025940 | Unclassified | 3025 |
| 382 | Ga0207711_10245870 | 3300025941 | Bacteria | 1641 |
| 383 | Ga0207711_10417228 | 3300025941 | Bacteria | 1248 |
| 384 | Ga0207711_10564715 | 3300025941 | Unclassified | 1061 |
| 385 | Ga0207711_10843003 | 3300025941 | Unclassified | 853 |
| 386 | Ga0207689_11142484 | 3300025942 | Bacteria | 656 |
| 387 | Ga0207661_10004372 | 3300025944 | Bacteria | 9903 |
| 388 | Ga0207661_10027070 | 3300025944 | Bacteria | 4377 |
| 389 | Ga0207661_10050294 | 3300025944 | Bacteria | 3320 |
| 390 | Ga0207661_10069025 | 3300025944 | Bacteria | 2880 |
| 391 | Ga0207661_10359967 | 3300025944 | Bacteria | 1314 |
| 392 | Ga0207661_11050249 | 3300025944 | Bacteria | 750 |
| 393 | Ga0207661_11261593 | 3300025944 | Bacteria | 679 |
| 394 | Ga0207679_10037399 | 3300025945 | Bacteria | 3450 |
| 395 | Ga0207679_10090402 | 3300025945 | Bacteria | 2367 |
| 396 | Ga0207679_10478832 | 3300025945 | Unclassified | 1108 |
| 397 | Ga0207679_10925767 | 3300025945 | Unclassified | 798 |
| 398 | Ga0207667_10271348 | 3300025949 | Bacteria | 1734 |
| 399 | Ga0207667_10382714 | 3300025949 | Bacteria | 1433 |
| 400 | Ga0207667_10442617 | 3300025949 | Bacteria | 1321 |
| 401 | Ga0207667_11240439 | 3300025949 | Unclassified | 724 |
| 402 | Ga0207651_10298943 | 3300025960 | Unclassified | 1338 |
| 403 | Ga0207651_10608598 | 3300025960 | Bacteria | 956 |
| 404 | Ga0207712_10129338 | 3300025961 | Unclassified | 1922 |
| 405 | Ga0207640_10299915 | 3300025981 | Bacteria | 1271 |
| 406 | Ga0207640_10947620 | 3300025981 | Bacteria | 754 |
| 407 | Ga0207677_10230219 | 3300026023 | Unclassified | 1492 |
| 408 | Ga0207677_10662147 | 3300026023 | Bacteria | 923 |
| 409 | Ga0207677_11385649 | 3300026023 | Unclassified | 647 |
| 410 | Ga0207639_10817826 | 3300026041 | Bacteria | 869 |
| 411 | Ga0207678_10013062 | 3300026067 | Bacteria | 7285 |
| 412 | Ga0207708_10755092 | 3300026075 | Unclassified | 835 |
| 413 | Ga0207708_11190730 | 3300026075 | Bacteria | 666 |
| 414 | Ga0207702_10039544 | 3300026078 | Bacteria | 3953 |
| 415 | Ga0207702_10068719 | 3300026078 | Bacteria | 3044 |
| 416 | Ga0207702_10088160 | 3300026078 | Bacteria | 2710 |
| 417 | Ga0207702_10148985 | 3300026078 | Bacteria | 2127 |
| 418 | Ga0207702_10167498 | 3300026078 | Unclassified | 2011 |
| 419 | Ga0207702_10270940 | 3300026078 | Bacteria | 1601 |
| 420 | Ga0207702_10324224 | 3300026078 | Unclassified | 1468 |
| 421 | Ga0207702_10464061 | 3300026078 | Bacteria | 1230 |
| 422 | Ga0207702_11082209 | 3300026078 | Bacteria | 796 |
| 423 | Ga0207641_10287345 | 3300026088 | Unclassified | 1549 |
| 424 | Ga0207676_10132016 | 3300026095 | Unclassified | 2125 |
| 425 | Ga0207674_10001651 | 3300026116 | Bacteria | 28696 |
| 426 | Ga0207674_10167990 | 3300026116 | Bacteria | 2147 |
| 427 | Ga0207675_102313393 | 3300026118 | Unclassified | 551 |
| 428 | Ga0207683_10025974 | 3300026121 | Bacteria | 5056 |
| 429 | Ga0207683_10032734 | 3300026121 | Bacteria | 4516 |
| 430 | Ga0207683_10070937 | 3300026121 | Bacteria | 3078 |
| 431 | Ga0207698_10118962 | 3300026142 | Bacteria | 2232 |
| 432 | Ga0207428_10010153 | 3300027907 | Bacteria | 8421 |
| 433 | Ga0207428_10264845 | 3300027907 | Bacteria | 1279 |
| 434 | Ga0268264_10361536 | 3300028381 | Bacteria | 1385 |
| 435 | Ga0307408_101032380 | 3300031548 | Bacteria | 759 |
| 436 | Ga0307413_10778497 | 3300031824 | Bacteria | 802 |
| 437 | Ga0307406_10103704 | 3300031901 | Bacteria | 1943 |
| 438 | Ga0307409_100481401 | 3300031995 | Bacteria | 1204 |
| 439 | Ga0307416_100282394 | 3300032002 | Bacteria | 1638 |
| 440 | Ga0307415_100032554 | 3300032126 | Bacteria | 3373 |
| 441 | Ga0373943_0285475 | 3300035170 | Bacteria | 934 |
| 442 | Ga0373935_0105670 | 3300035692 | Bacteria | 1862 |
| 443 | Ga0373947_0823712 | 3300035725 | Bacteria | 634 |
| 444 | Ga0373925_0223348 | 3300037068 | Bacteria | 1504 |
| 445 | Ga0373925_0269930 | 3300037068 | Bacteria | 1368 |
| 446 | Ga0395899_0001741 | 3300037312 | Bacteria | 18107 |
| 447 | Ga0395899_0030651 | 3300037312 | Bacteria | 4044 |
| 448 | Ga0395899_0102604 | 3300037312 | Bacteria | 2064 |
| 449 | Ga0395899_0238490 | 3300037312 | Bacteria | 1252 |
| 450 | Ga0395899_0324208 | 3300037312 | Bacteria | 1037 |
| 451 | Ga0395899_0340715 | 3300037312 | Bacteria | 1005 |
| 452 | Ga0395899_0627842 | 3300037312 | Unclassified | 681 |
| 453 | Ga0395900_0002164 | 3300037418 | Bacteria | 21947 |
| 454 | Ga0395900_0004516 | 3300037418 | Bacteria | 14725 |
| 455 | Ga0395900_0006695 | 3300037418 | Bacteria | 11971 |
| 456 | Ga0395900_0007275 | 3300037418 | Bacteria | 11460 |
| 457 | Ga0395900_0018846 | 3300037418 | Bacteria | 7038 |
| 458 | Ga0395900_0030866 | 3300037418 | Bacteria | 5503 |
| 459 | Ga0395900_0082545 | 3300037418 | Bacteria | 3302 |
| 460 | Ga0395900_0104329 | 3300037418 | Bacteria | 2912 |
| 461 | Ga0395900_0106169 | 3300037418 | Bacteria | 2884 |
| 462 | Ga0395900_0288820 | 3300037418 | Bacteria | 1629 |
| 463 | Ga0395900_0354020 | 3300037418 | Bacteria | 1441 |
| 464 | Ga0395900_0405535 | 3300037418 | Unclassified | 1326 |
| 465 | Ga0395900_0618903 | 3300037418 | Bacteria | 1022 |
| 466 | Ga0395900_0999896 | 3300037418 | Bacteria | 756 |
| 467 | Ga0395900_1016280 | 3300037418 | Bacteria | 749 |
| 468 | Ga0395900_1104513 | 3300037418 | Bacteria | 710 |
| 469 | Ga0395898_0001577 | 3300037466 | Bacteria | 31168 |
| 470 | Ga0395898_0005425 | 3300037466 | Bacteria | 13771 |
| 471 | Ga0395898_0007535 | 3300037466 | Bacteria | 11558 |
| 472 | Ga0395898_0030126 | 3300037466 | Bacteria | 5432 |
| 473 | Ga0395898_0030454 | 3300037466 | Bacteria | 5399 |
| 474 | Ga0395898_0035203 | 3300037466 | Bacteria | 4982 |
| 475 | Ga0395898_0058699 | 3300037466 | Plasmid | 3745 |
| 476 | Ga0395898_0094671 | 3300037466 | Bacteria | 2870 |
| 477 | Ga0395898_0097015 | 3300037466 | Unclassified | 2831 |
| 478 | Ga0395898_0126666 | 3300037466 | Bacteria | 2446 |
| 479 | Ga0395898_0342596 | 3300037466 | Bacteria | 1425 |
| 480 | Ga0395898_0504578 | 3300037466 | Bacteria | 1150 |
| 481 | Ga0395898_0682361 | 3300037466 | Bacteria | 969 |
| 482 | Ga0395898_0954243 | 3300037466 | Bacteria | 794 |
| 483 | Ga0395898_1197200 | 3300037466 | Bacteria | 691 |
| 484 | Ga0395898_1398501 | 3300037466 | Unclassified | 627 |
| 485 | Ga0395898_1575390 | 3300037466 | Bacteria | 582 |
| 486 | Ga0395905_0006618 | 3300037471 | Bacteria | 11622 |
| 487 | Ga0395905_0009307 | 3300037471 | Bacteria | 9610 |
| 488 | Ga0395905_0012963 | 3300037471 | Bacteria | 8011 |
| 489 | Ga0395905_0020243 | 3300037471 | Bacteria | 6303 |
| 490 | Ga0395905_0024781 | 3300037471 | Bacteria | 5661 |
| 491 | Ga0395905_0041203 | 3300037471 | Bacteria | 4334 |
| 492 | Ga0395905_0047735 | 3300037471 | Unclassified | 4011 |
| 493 | Ga0395905_0059517 | 3300037471 | Bacteria | 3571 |
| 494 | Ga0395905_0067701 | 3300037471 | Unclassified | 3344 |
| 495 | Ga0395905_0212780 | 3300037471 | Bacteria | 1811 |
| 496 | Ga0395905_0263688 | 3300037471 | Unclassified | 1608 |
| 497 | Ga0395905_0326111 | 3300037471 | Bacteria | 1425 |
| 498 | Ga0395905_0399492 | 3300037471 | Bacteria | 1269 |
| 499 | Ga0395901_0001505 | 3300038443 | Bacteria | 24214 |
| 500 | Ga0395901_0009295 | 3300038443 | Bacteria | 9964 |
| 501 | Ga0395901_0015931 | 3300038443 | Bacteria | 7658 |
| 502 | Ga0395901_0021606 | 3300038443 | Bacteria | 6593 |
| 503 | Ga0395901_0039136 | 3300038443 | Bacteria | 4906 |
| 504 | Ga0395901_0075359 | 3300038443 | Bacteria | 3519 |
| 505 | Ga0395901_0100335 | 3300038443 | Bacteria | 3036 |
| 506 | Ga0395901_0108322 | 3300038443 | Bacteria | 2917 |
| 507 | Ga0395901_0124416 | 3300038443 | Unclassified | 2709 |
| 508 | Ga0395901_0172774 | 3300038443 | Bacteria | 2267 |
| 509 | Ga0395901_0387745 | 3300038443 | Bacteria | 1437 |
| 510 | Ga0395901_0390206 | 3300038443 | Bacteria | 1431 |
| 511 | Ga0395901_0399229 | 3300038443 | Unclassified | 1413 |
| 512 | Ga0395901_0408408 | 3300038443 | Bacteria | 1394 |
| 513 | Ga0395901_0414952 | 3300038443 | Bacteria | 1381 |
| 514 | Ga0395901_0523368 | 3300038443 | Bacteria | 1204 |
| 515 | Ga0395901_1043595 | 3300038443 | Bacteria | 791 |
| 516 | Ga0436365_1022478 | 3300039437 | Bacteria | 15716 |
| 517 | Ga0436362_0264146 | 3300039453 | Unclassified | 683 |
| 518 | Ga0451798_0738793 | 3300041458 | Unclassified | 544 |
| 519 | Ga0451835_0218292 | 3300041492 | Bacteria | 713 |
| 520 | Ga0451841_1282089 | 3300041498 | Bacteria | 752 |
| 521 | Ga0451849_1111261 | 3300041505 | Bacteria | 1094 |
| 522 | Ga0451853_0559045 | 3300041512 | Bacteria | 922 |
| 523 | Ga0439448_0142075 | 3300042005 | Unclassified | 831 |
| 524 | Ga0466972_0142636 | 3300044658 | Bacteria | 1127 |
| 525 | Ga0466972_0169842 | 3300044658 | Bacteria | 1024 |
| 526 | Ga0466965_0152676 | 3300044683 | Bacteria | 1207 |
| 527 | Ga0466965_0158566 | 3300044683 | Unclassified | 1186 |
| 528 | Ga0466966_0442805 | 3300044684 | Bacteria | 781 |
| 529 | Ga0466966_0492316 | 3300044684 | Unclassified | 737 |
| 530 | Ga0466961_0090187 | 3300044693 | Unclassified | 1936 |
| 531 | Ga0466961_0106071 | 3300044693 | Bacteria | 1769 |
| 532 | Ga0466961_0123189 | 3300044693 | Bacteria | 1627 |
| 533 | Ga0466961_0133362 | 3300044693 | Bacteria | 1556 |
| 534 | Ga0466961_0166251 | 3300044693 | Bacteria | 1373 |
| 535 | Ga0466963_0005318 | 3300044694 | Bacteria | 7527 |
| 536 | Ga0466963_0005817 | 3300044694 | Bacteria | 7255 |
| 537 | Ga0466963_0006073 | 3300044694 | Bacteria | 7120 |
| 538 | Ga0466963_0010084 | 3300044694 | Bacteria | 5712 |
| 539 | Ga0466963_0015500 | 3300044694 | Bacteria | 4722 |
| 540 | Ga0466963_0016239 | 3300044694 | Bacteria | 4627 |
| 541 | Ga0466963_0031404 | 3300044694 | Bacteria | 3433 |
| 542 | Ga0466963_0057844 | 3300044694 | Bacteria | 2583 |
| 543 | Ga0466963_0087244 | 3300044694 | Bacteria | 2121 |
| 544 | Ga0466963_0091595 | 3300044694 | Bacteria | 2071 |
| 545 | Ga0466963_0252037 | 3300044694 | Unclassified | 1239 |
| 546 | Ga0466963_0448784 | 3300044694 | Bacteria | 910 |
| 547 | Ga0466963_0543165 | 3300044694 | Bacteria | 821 |
| 548 | Ga0466964_0000896 | 3300044706 | Bacteria | 9763 |
| 549 | Ga0466964_0003925 | 3300044706 | Bacteria | 5465 |
| 550 | Ga0466964_0005649 | 3300044706 | Bacteria | 4650 |
| 551 | Ga0466964_0010856 | 3300044706 | Bacteria | 3440 |
| 552 | Ga0466964_0024825 | 3300044706 | Bacteria | 2337 |
| 553 | Ga0466964_0086743 | 3300044706 | Bacteria | 1354 |
| 554 | Ga0466964_0098427 | 3300044706 | Bacteria | 1285 |
| 555 | Ga0466964_0258516 | 3300044706 | Bacteria | 862 |
| 556 | Ga0466964_0402877 | 3300044706 | Bacteria | 715 |
| 557 | Ga0466964_0407327 | 3300044706 | Unclassified | 712 |
| 558 | Ga0466964_0433485 | 3300044706 | Bacteria | 694 |
| 559 | Ga0466971_0002294 | 3300044719 | Bacteria | 8102 |
| 560 | Ga0466971_0006146 | 3300044719 | Bacteria | 5221 |
| 561 | Ga0466971_0030631 | 3300044719 | Bacteria | 2408 |
| 562 | Ga0466971_0128744 | 3300044719 | Bacteria | 1174 |
| 563 | Ga0466968_0068749 | 3300044735 | Bacteria | 1538 |
| 564 | Ga0466968_0092903 | 3300044735 | Bacteria | 1339 |
| 565 | Ga0466968_0109208 | 3300044735 | Bacteria | 1242 |
| 566 | Ga0466968_0113957 | 3300044735 | Bacteria | 1218 |
| 567 | Ga0466957_0013495 | 3300044842 | Bacteria | 4739 |
| 568 | Ga0466957_0015637 | 3300044842 | Bacteria | 4433 |
| 569 | Ga0466957_0016847 | 3300044842 | Bacteria | 4275 |
| 570 | Ga0466957_0033339 | 3300044842 | Bacteria | 3090 |
| 571 | Ga0466957_0051471 | 3300044842 | Bacteria | 2507 |
| 572 | Ga0466957_0056404 | 3300044842 | Archaea | 2402 |
| 573 | Ga0466957_0095909 | 3300044842 | Bacteria | 1863 |
| 574 | Ga0466957_0311893 | 3300044842 | Bacteria | 1059 |
| 575 | Ga0466957_0917885 | 3300044842 | Bacteria | 626 |
| 576 | Ga0466960_0012527 | 3300044901 | Bacteria | 3581 |
| 577 | Ga0466960_0043606 | 3300044901 | Bacteria | 2135 |
| 578 | Ga0466960_0109559 | 3300044901 | Bacteria | 1433 |
| 579 | Ga0466960_0137569 | 3300044901 | Unclassified | 1294 |
| 580 | Ga0466960_0165753 | 3300044901 | Unclassified | 1189 |
| 581 | Ga0466960_0505878 | 3300044901 | Unclassified | 708 |
| 582 | Ga0466959_0017423 | 3300045049 | Bacteria | 5265 |
| 583 | Ga0466959_0069429 | 3300045049 | Bacteria | 2553 |
| 584 | Ga0466959_0654162 | 3300045049 | Unclassified | 705 |
| 585 | Ga0466958_0006158 | 3300045836 | Bacteria | 6505 |
| 586 | Ga0466958_0016589 | 3300045836 | Bacteria | 4243 |
| 587 | Ga0466958_0026537 | 3300045836 | Bacteria | 3424 |
| 588 | Ga0466958_0028867 | 3300045836 | Bacteria | 3291 |
| 589 | Ga0466958_0039330 | 3300045836 | Unclassified | 2841 |
| 590 | Ga0466958_0068420 | 3300045836 | Bacteria | 2170 |
| 591 | Ga0466958_0068779 | 3300045836 | Bacteria | 2165 |
| 592 | Ga0466958_0692276 | 3300045836 | Bacteria | 664 |
| 593 | Ga0466967_0004561 | 3300045976 | Bacteria | 9379 |
| 594 | Ga0466967_0005287 | 3300045976 | Bacteria | 8910 |
| 595 | Ga0466967_0008406 | 3300045976 | Bacteria | 7558 |
| 596 | Ga0466967_0019629 | 3300045976 | Bacteria | 5441 |
| 597 | Ga0466967_0025977 | 3300045976 | Bacteria | 4840 |
| 598 | Ga0466967_0026147 | 3300045976 | Bacteria | 4828 |
| 599 | Ga0466967_0056701 | 3300045976 | Bacteria | 3456 |
| 600 | Ga0466967_0069617 | 3300045976 | Unclassified | 3145 |
| 601 | Ga0466967_0144471 | 3300045976 | Bacteria | 2218 |
| 602 | Ga0466967_0202132 | 3300045976 | Archaea | 1882 |
| 603 | Ga0466967_0219360 | 3300045976 | Bacteria | 1806 |
| 604 | Ga0466967_0225392 | 3300045976 | Bacteria | 1783 |
| 605 | Ga0466967_0269239 | 3300045976 | Bacteria | 1632 |
| 606 | Ga0466967_0436916 | 3300045976 | Unclassified | 1277 |
| 607 | Ga0466967_1065507 | 3300045976 | Unclassified | 805 |
| 608 | Ga0466967_2112622 | 3300045976 | Bacteria | 559 |
| 609 | Ga0495603_0132206 | 3300046455 | Unclassified | 1453 |
| 610 | Ga0495603_0713942 | 3300046455 | Bacteria | 573 |
| 611 | Ga0495629_0277374 | 3300046459 | Bacteria | 1151 |
| 612 | Ga0495641_0181306 | 3300046461 | Unclassified | 943 |
| 613 | Ga0495641_0322335 | 3300046461 | Unclassified | 697 |
| 614 | Ga0495651_0099564 | 3300046462 | Bacteria | 2168 |
| 615 | Ga0495653_0031482 | 3300046463 | Bacteria | 4216 |
| 616 | Ga0495605_0065314 | 3300046474 | Unclassified | 1731 |
| 617 | Ga0495584_0104642 | 3300046491 | Bacteria | 1431 |
| 618 | Ga0495584_0106856 | 3300046491 | Unclassified | 1415 |
| 619 | Ga0495584_0174694 | 3300046491 | Bacteria | 1092 |
| 620 | Ga0495616_0289692 | 3300046513 | Bacteria | 694 |
| 621 | Ga0495618_0175520 | 3300046514 | Bacteria | 1363 |
| 622 | Ga0495630_0273075 | 3300046517 | Unclassified | 1292 |
| 623 | Ga0495630_1184355 | 3300046517 | Bacteria | 578 |
| 624 | Ga0495667_0015176 | 3300046559 | Bacteria | 5200 |
| 625 | Ga0495656_0383629 | 3300046615 | Unclassified | 733 |
| 626 | Ga0495635_0149387 | 3300046663 | Bacteria | 1590 |
| 627 | Ga0495661_0130639 | 3300046665 | Bacteria | 1377 |
| 628 | Ga0495588_0542048 | 3300046674 | Unclassified | 610 |
| 629 | Ga0495657_0060907 | 3300046675 | Bacteria | 2498 |
| 630 | Ga0495657_0305090 | 3300046675 | Bacteria | 949 |
| 631 | Ga0495658_0240992 | 3300046683 | Bacteria | 1136 |
| 632 | Ga0495658_0287722 | 3300046683 | Bacteria | 1038 |
| 633 | Ga0495613_0128588 | 3300046689 | Bacteria | 1815 |
| 634 | Ga0495624_0017254 | 3300046690 | Bacteria | 4851 |
| 635 | Ga0495649_0161183 | 3300046694 | Bacteria | 1176 |
| 636 | Ga0495589_0076666 | 3300046794 | Bacteria | 1630 |
| 637 | Ga0495600_0181341 | 3300046809 | Bacteria | 1357 |
| 638 | Ga0495636_0081043 | 3300047318 | Unclassified | 1398 |
| 639 | Ga0495674_1163237 | 3300047319 | Unclassified | 585 |
| 640 | Ga0495676_0179777 | 3300047321 | Bacteria | 1483 |
| 641 | Ga0495676_0224447 | 3300047321 | Bacteria | 1293 |
| 642 | Ga0495676_0635515 | 3300047321 | Bacteria | 693 |
| 643 | Ga0495680_0022776 | 3300047322 | Bacteria | 5216 |
| 644 | Ga0495683_0252367 | 3300047323 | Bacteria | 774 |
| 645 | Ga0495684_0053664 | 3300047471 | Bacteria | 3075 |
| 646 | Ga0495614_0048491 | 3300048089 | Bacteria | 1821 |
| 647 | Ga0495626_0201911 | 3300048091 | Bacteria | 815 |
| 648 | Ga0496100_0008236 | 3300048903 | Bacteria | 5808 |
| 649 | Ga0496100_0101775 | 3300048903 | Bacteria | 1981 |
| 650 | Ga0496100_0612675 | 3300048903 | Bacteria | 846 |
| 651 | Ga0496100_0657791 | 3300048903 | Unclassified | 816 |
| 652 | Ga0496101_0000735 | 3300048904 | Bacteria | 19496 |
| 653 | Ga0496101_0035693 | 3300048904 | Bacteria | 3518 |
| 654 | Ga0496101_0051756 | 3300048904 | Bacteria | 2960 |
| 655 | Ga0496101_0110979 | 3300048904 | Unclassified | 2064 |
| 656 | Ga0496101_0204888 | 3300048904 | Bacteria | 1526 |
| 657 | Ga0496101_0804999 | 3300048904 | Bacteria | 741 |
| 658 | Ga0496101_1516657 | 3300048904 | Unclassified | 522 |
| 659 | Ga0496102_0001216 | 3300048905 | Bacteria | 23348 |
| 660 | Ga0496102_0002713 | 3300048905 | Bacteria | 15060 |
| 661 | Ga0496102_0004949 | 3300048905 | Bacteria | 11288 |
| 662 | Ga0496102_0021825 | 3300048905 | Bacteria | 5667 |
| 663 | Ga0496102_0057297 | 3300048905 | Unclassified | 3557 |
| 664 | Ga0496102_0150169 | 3300048905 | Bacteria | 2189 |
| 665 | Ga0496102_0202002 | 3300048905 | Bacteria | 1874 |
| 666 | Ga0496102_0379833 | 3300048905 | Bacteria | 1330 |
| 667 | Ga0496102_1648303 | 3300048905 | Bacteria | 559 |
| 668 | Ga0496103_0002705 | 3300048906 | Bacteria | 11061 |
| 669 | Ga0496103_0035655 | 3300048906 | Bacteria | 3046 |
| 670 | Ga0496103_0077376 | 3300048906 | Bacteria | 2088 |
| 671 | Ga0496103_0148019 | 3300048906 | Bacteria | 1504 |
| 672 | Ga0496104_0000134 | 3300048907 | Bacteria | 68737 |
| 673 | Ga0496104_0028410 | 3300048907 | Bacteria | 5185 |
| 674 | Ga0496104_0054508 | 3300048907 | Bacteria | 3779 |
| 675 | Ga0496104_0067820 | 3300048907 | Unclassified | 3389 |
| 676 | Ga0496104_0623787 | 3300048907 | Bacteria | 988 |
| 677 | Ga0496104_1271154 | 3300048907 | Bacteria | 639 |
| 678 | Ga0496104_1417344 | 3300048907 | Unclassified | 598 |
| 679 | Ga0496105_0000484 | 3300048908 | Bacteria | 26155 |
| 680 | Ga0496105_0036663 | 3300048908 | Bacteria | 4040 |
| 681 | Ga0496105_0174680 | 3300048908 | Bacteria | 1760 |
| 682 | Ga0496105_0184856 | 3300048908 | Unclassified | 1705 |
| 683 | Ga0496106_0018184 | 3300048909 | Bacteria | 5199 |
| 684 | Ga0496106_0090449 | 3300048909 | Bacteria | 2362 |
| 685 | Ga0496106_0811044 | 3300048909 | Bacteria | 742 |
| 686 | Ga0496106_0990536 | 3300048909 | Bacteria | 661 |
| 687 | Ga0496107_0020634 | 3300048910 | Bacteria | 4656 |
| 688 | Ga0496107_0047392 | 3300048910 | Bacteria | 3095 |
| 689 | Ga0496107_0049850 | 3300048910 | Bacteria | 3018 |
| 690 | Ga0496107_0050199 | 3300048910 | Bacteria | 3007 |
| 691 | Ga0496107_0534218 | 3300048910 | Bacteria | 869 |
| 692 | Ga0496107_0604577 | 3300048910 | Bacteria | 810 |
| 693 | Ga0496107_1174405 | 3300048910 | Unclassified | 552 |
| 694 | Ga0496108_0001238 | 3300048911 | Bacteria | 20020 |
| 695 | Ga0496108_0004984 | 3300048911 | Bacteria | 10732 |
| 696 | Ga0496108_0044538 | 3300048911 | Bacteria | 3703 |
| 697 | Ga0496108_0063188 | 3300048911 | Bacteria | 3118 |
| 698 | Ga0496108_0304533 | 3300048911 | Unclassified | 1388 |
| 699 | Ga0496108_0370652 | 3300048911 | Unclassified | 1250 |
| 700 | Ga0496108_1792805 | 3300048911 | Bacteria | 503 |
| 701 | Ga0496109_0000898 | 3300048912 | Bacteria | 24813 |
| 702 | Ga0496109_0014986 | 3300048912 | Bacteria | 6747 |
| 703 | Ga0496109_0016825 | 3300048912 | Bacteria | 6399 |
| 704 | Ga0496109_0052892 | 3300048912 | Bacteria | 3702 |
| 705 | Ga0496109_0054658 | 3300048912 | Unclassified | 3642 |
| 706 | Ga0496109_0100070 | 3300048912 | Unclassified | 2689 |
| 707 | Ga0496109_0172836 | 3300048912 | Unclassified | 2027 |
| 708 | Ga0496109_0178938 | 3300048912 | Bacteria | 1991 |
| 709 | Ga0496109_0462505 | 3300048912 | Bacteria | 1198 |
| 710 | Ga0496109_0791725 | 3300048912 | Unclassified | 886 |
| 711 | Ga0496110_0000851 | 3300048913 | Bacteria | 21507 |
| 712 | Ga0496110_0000905 | 3300048913 | Bacteria | 20843 |
| 713 | Ga0496110_0005135 | 3300048913 | Bacteria | 10229 |
| 714 | Ga0496110_0134709 | 3300048913 | Bacteria | 2232 |
| 715 | Ga0496110_0358315 | 3300048913 | Unclassified | 1329 |
| 716 | Ga0496110_0714335 | 3300048913 | Unclassified | 904 |
| 717 | Ga0496110_0793199 | 3300048913 | Unclassified | 851 |
| 718 | Ga0496110_0934957 | 3300048913 | Unclassified | 773 |
| 719 | Ga0496111_0013044 | 3300048914 | Bacteria | 5642 |
| 720 | Ga0496111_0042155 | 3300048914 | Bacteria | 3276 |
| 721 | Ga0496111_0171953 | 3300048914 | Bacteria | 1610 |
| 722 | Ga0496111_0255115 | 3300048914 | Bacteria | 1301 |
| 723 | Ga0496111_0388966 | 3300048914 | Unclassified | 1031 |
| 724 | Ga0496111_0455804 | 3300048914 | Unclassified | 943 |
| 725 | Ga0496112_0078305 | 3300048915 | Bacteria | 3269 |
| 726 | Ga0496112_0244434 | 3300048915 | Bacteria | 1747 |
| 727 | Ga0496112_0544835 | 3300048915 | Bacteria | 1094 |
| 728 | Ga0496112_0613310 | 3300048915 | Unclassified | 1019 |
| 729 | Ga0496112_0715941 | 3300048915 | Bacteria | 928 |
| 730 | Ga0496112_0832144 | 3300048915 | Bacteria | 847 |
| 731 | Ga0496113_0017399 | 3300048916 | Bacteria | 4989 |
| 732 | Ga0496113_0070861 | 3300048916 | Bacteria | 2651 |
| 733 | Ga0496113_0165213 | 3300048916 | Bacteria | 1751 |
| 734 | Ga0496113_0374931 | 3300048916 | Unclassified | 1142 |
| 735 | Ga0496113_0482516 | 3300048916 | Unclassified | 996 |
| 736 | Ga0496114_0000597 | 3300048917 | Bacteria | 26684 |
| 737 | Ga0496114_0002596 | 3300048917 | Bacteria | 13791 |
| 738 | Ga0496114_0069746 | 3300048917 | Bacteria | 2952 |
| 739 | Ga0496114_0104528 | 3300048917 | Bacteria | 2422 |
| 740 | Ga0496115_0054617 | 3300048918 | Unclassified | 3208 |
| 741 | Ga0496115_0063108 | 3300048918 | Bacteria | 2989 |
| 742 | Ga0496115_0135744 | 3300048918 | Bacteria | 2029 |
| 743 | Ga0496115_0265491 | 3300048918 | Bacteria | 1411 |
| 744 | Ga0501031_0000784 | 3300049568 | Bacteria | 19083 |
| 745 | Ga0501032_0017056 | 3300049569 | Bacteria | 5102 |
| 746 | Ga0501033_0001741 | 3300049570 | Bacteria | 19030 |
| 747 | Ga0501034_0004685 | 3300049571 | Bacteria | 15145 |
| 748 | Ga0501034_0034868 | 3300049571 | Bacteria | 5103 |
| 749 | Ga0501034_0595828 | 3300049571 | Bacteria | 1011 |
| 750 | Ga0501036_0025762 | 3300049572 | Bacteria | 4964 |
| 751 | Ga0501037_0020117 | 3300049573 | Bacteria | 4929 |
| 752 | Ga0501037_0093043 | 3300049573 | Unclassified | 2180 |
| 753 | Ga0501038_0028184 | 3300049574 | Bacteria | 4990 |
| 754 | Ga0501039_0547254 | 3300049575 | Bacteria | 908 |
| 755 | Ga0501040_0049265 | 3300049576 | Bacteria | 2880 |
| 756 | Ga0501040_0141502 | 3300049576 | Bacteria | 1695 |
| 757 | Ga0501042_0028132 | 3300049578 | Bacteria | 3957 |
| 758 | Ga0501042_0109600 | 3300049578 | Bacteria | 1988 |
| 759 | Ga0501043_0022114 | 3300049579 | Bacteria | 4990 |
| 760 | Ga0501046_0000162 | 3300049580 | Bacteria | 69629 |
| 761 | Ga0501046_0587256 | 3300049580 | Bacteria | 791 |
| 762 | Ga0501047_0001471 | 3300049581 | Bacteria | 22975 |
| 763 | Ga0501047_0037313 | 3300049581 | Bacteria | 4699 |
| 764 | Ga0501047_0311170 | 3300049581 | Bacteria | 1416 |
| 765 | Ga0501048_0001285 | 3300049582 | Bacteria | 19040 |
| 766 | Ga0501067_0007016 | 3300049583 | Bacteria | 6255 |
| 767 | Ga0501067_0008934 | 3300049583 | Bacteria | 5552 |
| 768 | Ga0501067_0010223 | 3300049583 | Bacteria | 5190 |
| 769 | Ga0501067_0037515 | 3300049583 | Bacteria | 2692 |
| 770 | Ga0501067_0092538 | 3300049583 | Bacteria | 1679 |
| 771 | Ga0501067_0516410 | 3300049583 | Bacteria | 668 |
| 772 | Ga0501068_0011568 | 3300049584 | Bacteria | 4984 |
| 773 | Ga0501068_0018378 | 3300049584 | Bacteria | 4049 |
| 774 | Ga0501068_0028736 | 3300049584 | Bacteria | 3290 |
| 775 | Ga0501069_0000428 | 3300049585 | Bacteria | 19110 |
| 776 | Ga0501069_0000856 | 3300049585 | Bacteria | 14425 |
| 777 | Ga0501069_0007926 | 3300049585 | Bacteria | 5578 |
| 778 | Ga0501069_0009520 | 3300049585 | Bacteria | 5127 |
| 779 | Ga0501069_0060440 | 3300049585 | Bacteria | 2115 |
| 780 | Ga0501069_0091416 | 3300049585 | Unclassified | 1721 |
| 781 | Ga0501070_0000032 | 3300049586 | Bacteria | 131255 |
| 782 | Ga0501070_0004474 | 3300049586 | Bacteria | 12002 |
| 783 | Ga0501070_0006018 | 3300049586 | Bacteria | 10332 |
| 784 | Ga0501070_0013992 | 3300049586 | Bacteria | 6755 |
| 785 | Ga0501070_0207431 | 3300049586 | Bacteria | 1609 |
| 786 | Ga0501070_0215280 | 3300049586 | Bacteria | 1576 |
| 787 | Ga0501070_0249793 | 3300049586 | Bacteria | 1451 |
| 788 | Ga0501070_0297653 | 3300049586 | Bacteria | 1315 |
| 789 | Ga0501070_0298971 | 3300049586 | Bacteria | 1311 |
| 790 | Ga0501071_0019931 | 3300049587 | Bacteria | 4658 |
| 791 | Ga0501071_0061168 | 3300049587 | Bacteria | 2727 |
| 792 | Ga0501071_0286356 | 3300049587 | Bacteria | 1247 |
| 793 | Ga0501072_0618279 | 3300049588 | Unclassified | 854 |
| 794 | Ga0501073_0018899 | 3300049589 | Bacteria | 4979 |
| 795 | Ga0501073_0103628 | 3300049589 | Bacteria | 1975 |
| 796 | Ga0501073_0257241 | 3300049589 | Bacteria | 1205 |
| 797 | Ga0501074_0002052 | 3300049590 | Bacteria | 13918 |
| 798 | Ga0501074_0018970 | 3300049590 | Bacteria | 4996 |
| 799 | Ga0501074_0027224 | 3300049590 | Bacteria | 4145 |
| 800 | Ga0501074_0050263 | 3300049590 | Bacteria | 3010 |
| 801 | Ga0501074_0445912 | 3300049590 | Bacteria | 918 |
| 802 | Ga0501075_0747072 | 3300049591 | Bacteria | 745 |
| 803 | Ga0501077_0227761 | 3300049593 | Bacteria | 1185 |
| 804 | Ga0501079_0000154 | 3300049741 | Bacteria | 37557 |
| 805 | Ga0501079_0073348 | 3300049741 | Bacteria | 2645 |
| 806 | Ga0501080_0000096 | 3300049742 | Bacteria | 59454 |
| 807 | Ga0501080_0009066 | 3300049742 | Bacteria | 9056 |
| 808 | Ga0501080_0015468 | 3300049742 | Bacteria | 7034 |
| 809 | Ga0501080_0018304 | 3300049742 | Bacteria | 6483 |
| 810 | Ga0501080_0031976 | 3300049742 | Bacteria | 4905 |
| 811 | Ga0501080_0069360 | 3300049742 | Bacteria | 3278 |
| 812 | Ga0501080_1085927 | 3300049742 | Bacteria | 691 |
| 813 | Ga0501083_0017869 | 3300049744 | Bacteria | 4946 |
| 814 | Ga0501083_0463269 | 3300049744 | Bacteria | 825 |
| 815 | Ga0501035_0001581 | 3300049822 | Bacteria | 23115 |
| 816 | Ga0501035_0194829 | 3300049822 | Bacteria | 1741 |
| 817 | Ga0501044_0000056 | 3300049823 | Bacteria | 139804 |
| 818 | Ga0501044_0002508 | 3300049823 | Bacteria | 20936 |
| 819 | Ga0501044_0078601 | 3300049823 | Bacteria | 3343 |
| 820 | Ga0501044_0970669 | 3300049823 | Bacteria | 722 |
| 821 | Ga0501045_0068121 | 3300049824 | Bacteria | 2614 |
| 822 | nmdc:mga05p37_203949_c1 | 3300050507 | Unclassified | 2393 |
| 823 | nmdc:mga05p37_276541_c1 | 3300050507 | Unclassified | 2004 |
| 824 | nmdc:mga05p37_328065_c1 | 3300050507 | Bacteria | 1809 |
| 825 | nmdc:mga0qj67_165844_c1 | 3300050509 | Unclassified | 1793 |
| 826 | nmdc:mga08y16_121319_c1 | 3300050511 | Bacteria | 2720 |
| 827 | nmdc:mga08y16_13904_c1 | 3300050511 | Bacteria | 8470 |
| 828 | nmdc:mga08y16_371457_c1 | 3300050511 | Bacteria | 1467 |
| 829 | nmdc:mga08y16_419358_c1 | 3300050511 | Bacteria | 1368 |
| 830 | nmdc:mga08y16_645936_c1 | 3300050511 | Unclassified | 1063 |
| 831 | nmdc:mga08y16_887716_c1 | 3300050511 | Unclassified | 878 |
| 832 | nmdc:mga0n895_131085_c1 | 3300050512 | Unclassified | 2532 |
| 833 | nmdc:mga0n895_3007_c1 | 3300050512 | Bacteria | 13392 |
| 834 | nmdc:mga0n895_41130_c1 | 3300050512 | Bacteria | 4493 |
| 835 | nmdc:mga0n895_432754_c1 | 3300050512 | Bacteria | 1329 |
| 836 | nmdc:mga0n895_65495_c1 | 3300050512 | Bacteria | 3596 |
| 837 | nmdc:mga0n895_710568_c1 | 3300050512 | Unclassified | 1000 |
| 838 | nmdc:mga0rr50_13483_c1 | 3300050513 | Bacteria | 5323 |
| 839 | nmdc:mga0rr50_449927_c1 | 3300050513 | Bacteria | 1092 |
| 840 | nmdc:mga0rr50_829541_c1 | 3300050513 | Bacteria | 789 |
| 841 | nmdc:mga08x19_344872_c1 | 3300050514 | Bacteria | 1039 |
| 842 | nmdc:mga08x19_37852_c1 | 3300050514 | Unclassified | 3063 |
| 843 | nmdc:mga08x19_79926_c1 | 3300050514 | Bacteria | 2145 |
| 844 | nmdc:mga0a205_4356_c1 | 3300050515 | Bacteria | 12693 |
| 845 | nmdc:mga0a205_899455_c1 | 3300050515 | Bacteria | 732 |
| 846 | Ga0495655_0032761 | 3300053083 | Bacteria | 1274 |
| 847 | Ga0495595_0022594 | 3300053084 | Bacteria | 2762 |
| 848 | Ga0501084_0361149 | 3300054114 | Bacteria | 1227 |
| 849 | Ga0587073_0192793 | 3300059492 | Unclassified | 606 |
| 850 | Ga0501082_0026821 | 3300060353 | Bacteria | 4965 |
| 851 | Ga0466962_0006257 | 3300061719 | Bacteria | 5719 |
| 852 | Ga0466962_0009425 | 3300061719 | Bacteria | 4680 |
| 853 | Ga0466962_0126676 | 3300061719 | Unclassified | 1233 |
| 854 | Ga0466962_0395624 | 3300061719 | Bacteria | 691 |
| 855 | Ga0530510_0044741 | 3300061734 | Bacteria | 3199 |
| 856 | Ga0530510_0045135 | 3300061734 | Bacteria | 3184 |
| 857 | Ga0530510_0178214 | 3300061734 | Bacteria | 1575 |
| 858 | Ga0466967_0188518 | |||
| 859 | JGI24746J21847_1024597 | |||
| 860 | JGI24751J29686_10084866 | |||
| 861 | Ga0065712_10120415 | |||
| 862 | Ga0065715_10335807 | |||
| 863 | Ga0070658_10056846 | |||
| 864 | Ga0070658_10078745 | |||
| 865 | Ga0070658_10156069 | |||
| 866 | Ga0070658_10221886 | |||
| 867 | Ga0070683_100038026 | |||
| 868 | Ga0070683_100066613 | |||
| 869 | Ga0070683_100095696 | |||
| 870 | Ga0070683_100112761 | |||
| 871 | Ga0070683_100173035 | |||
| 872 | Ga0070683_100743225 | |||
| 873 | Ga0070690_101099849 | |||
| 874 | Ga0070670_100094769 | |||
| 875 | Ga0070677_10181137 | |||
| 876 | Ga0068869_100538551 | |||
| 877 | Ga0070680_100014676 | |||
| 878 | Ga0070680_100052938 | |||
| 879 | Ga0070680_100061167 | |||
| 880 | Ga0070680_100078728 | |||
| 881 | Ga0070682_100017035 | |||
| 882 | Ga0070682_100029295 | |||
| 883 | Ga0070682_100081456 | |||
| 884 | Ga0070682_100292287 | |||
| 885 | Ga0070682_101146206 | |||
| 886 | Ga0070682_101257976 | |||
| 887 | Ga0068868_100043392 | |||
| 888 | Ga0068868_100880038 | |||
| 889 | Ga0070660_100007754 | |||
| 890 | Ga0070660_100123379 | |||
| 891 | Ga0070691_10057135 | |||
| 892 | Ga0070691_10233364 | |||
| 893 | Ga0070691_10827082 | |||
| 894 | Ga0070687_100417177 | |||
| 895 | Ga0070661_100129574 | |||
| 896 | Ga0070661_100232235 | |||
| 897 | Ga0070661_100838304 | |||
| 898 | Ga0070661_100994194 | |||
| 899 | Ga0070692_10424487 | |||
| 900 | Ga0070668_100855552 | |||
| 901 | Ga0070668_100952540 | |||
| 902 | Ga0070669_100507769 | |||
| 903 | Ga0070671_100142316 | |||
| 904 | Ga0070671_100378232 | |||
| 905 | Ga0070674_100078318 | |||
| 906 | Ga0070674_100213567 | |||
| 907 | Ga0070674_100266839 | |||
| 908 | Ga0070674_100337825 | |||
| 909 | Ga0070673_100443304 | |||
| 910 | Ga0070673_101188583 | |||
| 911 | Ga0070688_100799427 | |||
| 912 | Ga0070659_100056043 | |||
| 913 | Ga0070659_100554868 | |||
| 914 | Ga0070709_10437401 | |||
| 915 | Ga0070714_100009235 | |||
| 916 | Ga0070714_100045826 | |||
| 917 | Ga0070714_100123253 | |||
| 918 | Ga0070713_100643534 | |||
| 919 | Ga0070713_101186748 | |||
| 920 | Ga0070701_10140042 | |||
| 921 | Ga0070711_100048624 | |||
| 922 | Ga0070705_100521343 | |||
| 923 | Ga0070705_100563056 | |||
| 924 | Ga0070700_100766897 | |||
| 925 | Ga0070700_101240142 | |||
| 926 | Ga0070694_100397165 | |||
| 927 | Ga0070694_100744267 | |||
| 928 | Ga0070663_100001354 | |||
| 929 | Ga0070663_100433268 | |||
| 930 | Ga0070663_101104875 | |||
| 931 | Ga0070663_101152557 | |||
| 932 | Ga0070678_100026290 | |||
| 933 | Ga0070678_100047140 | |||
| 934 | Ga0070678_100380900 | |||
| 935 | Ga0070662_100027753 | |||
| 936 | Ga0070662_100505282 | |||
| 937 | Ga0070681_10004088 | |||
| 938 | Ga0070681_10005202 | |||
| 939 | Ga0070681_10013493 | |||
| 940 | Ga0070681_10022680 | |||
| 941 | Ga0070681_10101498 | |||
| 942 | Ga0070681_10256807 | |||
| 943 | Ga0070681_10307627 | |||
| 944 | Ga0070681_10356307 | |||
| 945 | Ga0070685_10013576 | |||
| 946 | Ga0070685_10346423 | |||
| 947 | Ga0070679_100001302 | |||
| 948 | Ga0070679_100012229 | |||
| 949 | Ga0070679_100112115 | |||
| 950 | Ga0070679_100125296 | |||
| 951 | Ga0070679_100260684 | |||
| 952 | Ga0070679_100341246 | |||
| 953 | Ga0070679_100782114 | |||
| 954 | Ga0070679_101292471 | |||
| 955 | Ga0070684_100003652 | |||
| 956 | Ga0070684_100039454 | |||
| 957 | Ga0070684_100113814 | |||
| 958 | Ga0070684_100523130 | |||
| 959 | Ga0070684_100537319 | |||
| 960 | Ga0070684_100987293 | |||
| 961 | Ga0070697_100039698 | |||
| 962 | Ga0070697_100735848 | |||
| 963 | Ga0068853_100948589 | |||
| 964 | Ga0070672_100122696 | |||
| 965 | Ga0070686_100402154 | |||
| 966 | Ga0070686_100583530 | |||
| 967 | Ga0070695_100002173 | |||
| 968 | Ga0070695_100092348 | |||
| 969 | Ga0070695_100221164 | |||
| 970 | Ga0070695_100722385 | |||
| 971 | Ga0070696_100012188 | |||
| 972 | Ga0070696_100184129 | |||
| 973 | Ga0070696_100962415 | |||
| 974 | Ga0070696_101461554 | |||
| 975 | Ga0070693_100003297 | |||
| 976 | Ga0070693_100061708 | |||
| 977 | Ga0070665_100208549 | |||
| 978 | Ga0070704_100345547 | |||
| 979 | Ga0070704_101659601 | |||
| 980 | Ga0068855_100108954 | |||
| 981 | Ga0068855_100354051 | |||
| 982 | Ga0068855_101433182 | |||
| 983 | Ga0070664_100188195 | |||
| 984 | Ga0070664_100414408 | |||
| 985 | Ga0070664_100530627 | |||
| 986 | Ga0070664_101287880 | |||
| 987 | Ga0068857_100002399 | |||
| 988 | Ga0068857_102270773 | |||
| 989 | Ga0068857_102505781 | |||
| 990 | Ga0068854_100519197 | |||
| 991 | Ga0068854_100871254 | |||
| 992 | Ga0068854_100941431 | |||
| 993 | Ga0068856_100032154 | |||
| 994 | Ga0068856_100072526 | |||
| 995 | Ga0068856_100078848 | |||
| 996 | Ga0068856_100110734 | |||
| 997 | Ga0068856_100127835 | |||
| 998 | Ga0068856_100221143 | |||
| 999 | Ga0068856_100234044 | |||
| 1000 | Ga0068856_100569976 | |||
| 1001 | Ga0068856_101332600 | |||
| 1002 | Ga0068852_100117174 | |||
| 1003 | Ga0068852_100941657 | |||
| 1004 | Ga0068864_100122839 | |||
| 1005 | Ga0068866_10154714 | |||
| 1006 | Ga0068866_10299247 | |||
| 1007 | Ga0068863_100171806 | |||
| 1008 | Ga0068863_100813460 | |||
| 1009 | Ga0068860_100562793 | |||
| 1010 | Ga0081539_10018807 | |||
| 1011 | Ga0081539_10043615 | |||
| 1012 | Ga0070717_10007314 | |||
| 1013 | Ga0070717_10020944 | |||
| 1014 | Ga0070716_100651057 | |||
| 1015 | Ga0070712_100081037 | |||
| 1016 | Ga0070712_100246004 | |||
| 1017 | Ga0097621_100754588 | |||
| 1018 | Ga0075428_100297052 | |||
| 1019 | Ga0075430_100317136 | |||
| 1020 | Ga0075431_100779524 | |||
| 1021 | Ga0075433_10013206 | |||
| 1022 | Ga0075433_10303479 | |||
| 1023 | Ga0075433_10912236 | |||
| 1024 | Ga0075434_100002825 | |||
| 1025 | Ga0075434_100007883 | |||
| 1026 | Ga0075434_100182047 | |||
| 1027 | Ga0075434_100370031 | |||
| 1028 | Ga0068865_100114685 | |||
| 1029 | Ga0068865_100706932 | |||
| 1030 | Ga0075436_100050747 | |||
| 1031 | Ga0075436_100072955 | |||
| 1032 | Ga0075436_100591600 | |||
| 1033 | Ga0075435_100083098 | |||
| 1034 | Ga0075435_100100650 | |||
| 1035 | Ga0075435_100212090 | |||
| 1036 | Ga0075435_100217215 | |||
| 1037 | Ga0075435_100306275 | |||
| 1038 | Ga0099795_10508781 | |||
| 1039 | Ga0105240_10013540 | |||
| 1040 | Ga0105240_10124766 | |||
| 1041 | Ga0105240_10587452 | |||
| 1042 | Ga0111539_10002777 | |||
| 1043 | Ga0111539_10041358 | |||
| 1044 | Ga0111539_10092843 | |||
| 1045 | Ga0111539_10527759 | |||
| 1046 | Ga0111539_10853207 | |||
| 1047 | Ga0105245_10034907 | |||
| 1048 | Ga0105245_10050771 | |||
| 1049 | Ga0105245_10123449 | |||
| 1050 | Ga0105245_10131498 | |||
| 1051 | Ga0105245_10178243 | |||
| 1052 | Ga0105245_10264020 | |||
| 1053 | Ga0114129_10282382 | |||
| 1054 | Ga0114129_10400255 | |||
| 1055 | Ga0105243_10029991 | |||
| 1056 | Ga0105243_10285175 | |||
| 1057 | Ga0105243_10777349 | |||
| 1058 | Ga0105243_11963785 | |||
| 1059 | Ga0105241_10034607 | |||
| 1060 | Ga0105241_10614045 | |||
| 1061 | Ga0105242_10011248 | |||
| 1062 | Ga0105242_10236200 | |||
| 1063 | Ga0105242_10760862 | |||
| 1064 | Ga0105242_10886736 | |||
| 1065 | Ga0105242_11478576 | |||
| 1066 | Ga0105248_10127892 | |||
| 1067 | Ga0105248_10151731 | |||
| 1068 | Ga0105248_10536607 | |||
| 1069 | Ga0105248_10756973 | |||
| 1070 | Ga0105248_10781677 | |||
| 1071 | Ga0105237_10061228 | |||
| 1072 | Ga0105237_10326261 | |||
| 1073 | Ga0105237_10947321 | |||
| 1074 | Ga0105238_10083356 | |||
| 1075 | Ga0105238_10109300 | |||
| 1076 | Ga0105238_10233605 | |||
| 1077 | Ga0105238_10381129 | |||
| 1078 | Ga0105238_10508735 | |||
| 1079 | Ga0105249_10135924 | |||
| 1080 | Ga0105249_10424569 | |||
| 1081 | Ga0105239_10011216 | |||
| 1082 | Ga0105239_10039700 | |||
| 1083 | Ga0105239_10042402 | |||
| 1084 | Ga0105239_10082056 | |||
| 1085 | Ga0105239_10285610 | |||
| 1086 | Ga0105239_10338218 | |||
| 1087 | Ga0105239_10460456 | |||
| 1088 | Ga0105239_11344634 | |||
| 1089 | Ga0105239_11355104 | |||
| 1090 | Ga0105246_10030372 | |||
| 1091 | Ga0105246_10033922 | |||
| 1092 | Ga0105246_12108905 | |||
| 1093 | Ga0157320_1011300 | |||
| 1094 | Ga0157371_10221846 | |||
| 1095 | Ga0157371_10234463 | |||
| 1096 | Ga0157371_11390168 | |||
| 1097 | Ga0157370_10187652 | |||
| 1098 | Ga0157370_10359089 | |||
| 1099 | Ga0157369_10023673 | |||
| 1100 | Ga0157369_10082298 | |||
| 1101 | Ga0157369_10812863 | |||
| 1102 | Ga0157369_10909693 | |||
| 1103 | Ga0157369_10919951 | |||
| 1104 | Ga0157369_12005403 | |||
| 1105 | Ga0157374_10017674 | |||
| 1106 | Ga0157374_10075205 | |||
| 1107 | Ga0157374_11189713 | |||
| 1108 | Ga0157378_10150072 | |||
| 1109 | Ga0163162_10182775 | |||
| 1110 | Ga0163162_10386424 | |||
| 1111 | Ga0163162_11711503 | |||
| 1112 | Ga0163162_12295425 | |||
| 1113 | Ga0157372_10048315 | |||
| 1114 | Ga0157372_10112115 | |||
| 1115 | Ga0157372_10115264 | |||
| 1116 | Ga0157372_10191177 | |||
| 1117 | Ga0157372_10224887 | |||
| 1118 | Ga0157372_10359948 | |||
| 1119 | Ga0157372_10381454 | |||
| 1120 | Ga0157372_10720582 | |||
| 1121 | Ga0157372_11343878 | |||
| 1122 | Ga0157372_11894199 | |||
| 1123 | Ga0157375_10014286 | |||
| 1124 | Ga0157375_10123813 | |||
| 1125 | Ga0157375_10242929 | |||
| 1126 | Ga0157375_10374382 | |||
| 1127 | Ga0157375_10551564 | |||
| 1128 | Ga0163163_10052869 | |||
| 1129 | Ga0163163_10186191 | |||
| 1130 | Ga0163163_10194136 | |||
| 1131 | Ga0163163_12588381 | |||
| 1132 | Ga0157380_10113205 | |||
| 1133 | Ga0157380_11993028 | |||
| 1134 | Ga0182008_10261199 | |||
| 1135 | Ga0157377_10046768 | |||
| 1136 | Ga0157377_10137012 | |||
| 1137 | Ga0157377_10548486 | |||
| 1138 | Ga0157379_10540545 | |||
| 1139 | Ga0157379_11190969 | |||
| 1140 | Ga0157376_10075638 | |||
| 1141 | Ga0157376_10177102 | |||
| 1142 | Ga0163161_11401243 | |||
| 1143 | Ga0197907_10809293 | |||
| 1144 | Ga0206356_11892448 | |||
| 1145 | Ga0206355_1270139 | |||
| 1146 | Ga0206354_10299673 | |||
| 1147 | Ga0206353_10059895 | |||
| 1148 | Ga0206353_10877554 | |||
| 1149 | Ga0213876_10002035 | |||
| 1150 | Ga0224712_10007156 | |||
| 1151 | Ga0224712_10175156 | |||
| 1152 | Ga0224712_10188025 | |||
| 1153 | Ga0224712_10244316 | |||
| 1154 | Ga0207642_10112109 | |||
| 1155 | Ga0207642_10240720 | |||
| 1156 | Ga0207688_10028876 | |||
| 1157 | Ga0207688_10399678 | |||
| 1158 | Ga0207699_10134773 | |||
| 1159 | Ga0207699_11152367 | |||
| 1160 | Ga0207643_10003437 | |||
| 1161 | Ga0207705_10095069 | |||
| 1162 | Ga0207705_10096644 | |||
| 1163 | Ga0207705_10162124 | |||
| 1164 | Ga0207684_10219608 | |||
| 1165 | Ga0207654_10089438 | |||
| 1166 | Ga0207654_10546675 | |||
| 1167 | Ga0207654_11300431 | |||
| 1168 | Ga0207707_10004701 | |||
| 1169 | Ga0207707_10020322 | |||
| 1170 | Ga0207707_10023248 | |||
| 1171 | Ga0207707_10073838 | |||
| 1172 | Ga0207707_10100098 | |||
| 1173 | Ga0207707_10609786 | |||
| 1174 | Ga0207695_10009334 | |||
| 1175 | Ga0207695_10013582 | |||
| 1176 | Ga0207695_11650563 | |||
| 1177 | Ga0207671_10059594 | |||
| 1178 | Ga0207671_10549646 | |||
| 1179 | Ga0207693_10093940 | |||
| 1180 | Ga0207693_10155180 | |||
| 1181 | Ga0207660_10023976 | |||
| 1182 | Ga0207660_10106618 | |||
| 1183 | Ga0207660_10278290 | |||
| 1184 | Ga0207660_10331930 | |||
| 1185 | Ga0207662_10670925 | |||
| 1186 | Ga0207657_10138275 | |||
| 1187 | Ga0207657_10237473 | |||
| 1188 | Ga0207649_10200783 | |||
| 1189 | Ga0207652_10000283 | |||
| 1190 | Ga0207652_10033729 | |||
| 1191 | Ga0207652_10044714 | |||
| 1192 | Ga0207652_10333599 | |||
| 1193 | Ga0207652_10468371 | |||
| 1194 | Ga0207652_10538930 | |||
| 1195 | Ga0207681_10988577 | |||
| 1196 | Ga0207681_11023697 | |||
| 1197 | Ga0207694_10069985 | |||
| 1198 | Ga0207694_10382363 | |||
| 1199 | Ga0207694_10443394 | |||
| 1200 | Ga0207694_10456862 | |||
| 1201 | Ga0207650_10078957 | |||
| 1202 | Ga0207650_10692381 | |||
| 1203 | Ga0207659_10098446 | |||
| 1204 | Ga0207659_10728915 | |||
| 1205 | Ga0207687_10021930 | |||
| 1206 | Ga0207687_10125498 | |||
| 1207 | Ga0207687_10165138 | |||
| 1208 | Ga0207687_10396579 | |||
| 1209 | Ga0207687_10521945 | |||
| 1210 | Ga0207687_10545959 | |||
| 1211 | Ga0207687_11031617 | |||
| 1212 | Ga0207687_11160296 | |||
| 1213 | Ga0207700_10041273 | |||
| 1214 | Ga0207700_10226887 | |||
| 1215 | Ga0207700_10525382 | |||
| 1216 | Ga0207700_10655736 | |||
| 1217 | Ga0207700_10805772 | |||
| 1218 | Ga0207700_10979618 | |||
| 1219 | Ga0207664_10001938 | |||
| 1220 | Ga0207644_10276223 | |||
| 1221 | Ga0207644_10581815 | |||
| 1222 | Ga0207644_10777748 | |||
| 1223 | Ga0207644_10969937 | |||
| 1224 | Ga0207690_10164060 | |||
| 1225 | Ga0207690_10671196 | |||
| 1226 | Ga0207706_10492641 | |||
| 1227 | Ga0207706_10697905 | |||
| 1228 | Ga0207686_10130146 | |||
| 1229 | Ga0207686_10569034 | |||
| 1230 | Ga0207686_10948309 | |||
| 1231 | Ga0207709_10049473 | |||
| 1232 | Ga0207709_10567370 | |||
| 1233 | Ga0207669_10070436 | |||
| 1234 | Ga0207669_10139204 | |||
| 1235 | Ga0207669_10328551 | |||
| 1236 | Ga0207704_10028781 | |||
| 1237 | Ga0207665_10510887 | |||
| 1238 | Ga0207691_10076084 | |||
| 1239 | Ga0207711_10245870 | |||
| 1240 | Ga0207711_10417228 | |||
| 1241 | Ga0207711_10564715 | |||
| 1242 | Ga0207711_10843003 | |||
| 1243 | Ga0207689_11142484 | |||
| 1244 | Ga0207661_10004372 | |||
| 1245 | Ga0207661_10027070 | |||
| 1246 | Ga0207661_10050294 | |||
| 1247 | Ga0207661_10069025 | |||
| 1248 | Ga0207661_10359967 | |||
| 1249 | Ga0207661_11050249 | |||
| 1250 | Ga0207661_11261593 | |||
| 1251 | Ga0207679_10037399 | |||
| 1252 | Ga0207679_10090402 | |||
| 1253 | Ga0207679_10478832 | |||
| 1254 | Ga0207679_10925767 | |||
| 1255 | Ga0207667_10271348 | |||
| 1256 | Ga0207667_10382714 | |||
| 1257 | Ga0207667_10442617 | |||
| 1258 | Ga0207667_11240439 | |||
| 1259 | Ga0207651_10298943 | |||
| 1260 | Ga0207651_10608598 | |||
| 1261 | Ga0207712_10129338 | |||
| 1262 | Ga0207640_10299915 | |||
| 1263 | Ga0207640_10947620 | |||
| 1264 | Ga0207677_10230219 | |||
| 1265 | Ga0207677_10662147 | |||
| 1266 | Ga0207677_11385649 | |||
| 1267 | Ga0207639_10817826 | |||
| 1268 | Ga0207678_10013062 | |||
| 1269 | Ga0207708_10755092 | |||
| 1270 | Ga0207708_11190730 | |||
| 1271 | Ga0207702_10039544 | |||
| 1272 | Ga0207702_10068719 | |||
| 1273 | Ga0207702_10088160 | |||
| 1274 | Ga0207702_10148985 | |||
| 1275 | Ga0207702_10167498 | |||
| 1276 | Ga0207702_10270940 | |||
| 1277 | Ga0207702_10324224 | |||
| 1278 | Ga0207702_10464061 | |||
| 1279 | Ga0207702_11082209 | |||
| 1280 | Ga0207641_10287345 | |||
| 1281 | Ga0207676_10132016 | |||
| 1282 | Ga0207674_10001651 | |||
| 1283 | Ga0207674_10167990 | |||
| 1284 | Ga0207675_102313393 | |||
| 1285 | Ga0207683_10025974 | |||
| 1286 | Ga0207683_10032734 | |||
| 1287 | Ga0207683_10070937 | |||
| 1288 | Ga0207698_10118962 | |||
| 1289 | Ga0207428_10010153 | |||
| 1290 | Ga0207428_10264845 | |||
| 1291 | Ga0268264_10361536 | |||
| 1292 | Ga0307408_101032380 | |||
| 1293 | Ga0307413_10778497 | |||
| 1294 | Ga0307406_10103704 | |||
| 1295 | Ga0307409_100481401 | |||
| 1296 | Ga0307416_100282394 | |||
| 1297 | Ga0307415_100032554 | |||
| 1298 | Ga0373943_0285475 | |||
| 1299 | Ga0373935_0105670 | |||
| 1300 | Ga0373947_0823712 | |||
| 1301 | Ga0373925_0223348 | |||
| 1302 | Ga0373925_0269930 | |||
| 1303 | Ga0395899_0001741 | |||
| 1304 | Ga0395899_0030651 | |||
| 1305 | Ga0395899_0102604 | |||
| 1306 | Ga0395899_0238490 | |||
| 1307 | Ga0395899_0324208 | |||
| 1308 | Ga0395899_0340715 | |||
| 1309 | Ga0395899_0627842 | |||
| 1310 | Ga0395900_0002164 | |||
| 1311 | Ga0395900_0004516 | |||
| 1312 | Ga0395900_0006695 | |||
| 1313 | Ga0395900_0007275 | |||
| 1314 | Ga0395900_0018846 | |||
| 1315 | Ga0395900_0030866 | |||
| 1316 | Ga0395900_0082545 | |||
| 1317 | Ga0395900_0104329 | |||
| 1318 | Ga0395900_0106169 | |||
| 1319 | Ga0395900_0288820 | |||
| 1320 | Ga0395900_0354020 | |||
| 1321 | Ga0395900_0405535 | |||
| 1322 | Ga0395900_0618903 | |||
| 1323 | Ga0395900_0999896 | |||
| 1324 | Ga0395900_1016280 | |||
| 1325 | Ga0395900_1104513 | |||
| 1326 | Ga0395898_0001577 | |||
| 1327 | Ga0395898_0005425 | |||
| 1328 | Ga0395898_0007535 | |||
| 1329 | Ga0395898_0030126 | |||
| 1330 | Ga0395898_0030454 | |||
| 1331 | Ga0395898_0035203 | |||
| 1332 | Ga0395898_0058699 | |||
| 1333 | Ga0395898_0094671 | |||
| 1334 | Ga0395898_0097015 | |||
| 1335 | Ga0395898_0126666 | |||
| 1336 | Ga0395898_0342596 | |||
| 1337 | Ga0395898_0504578 | |||
| 1338 | Ga0395898_0682361 | |||
| 1339 | Ga0395898_0954243 | |||
| 1340 | Ga0395898_1197200 | |||
| 1341 | Ga0395898_1398501 | |||
| 1342 | Ga0395898_1575390 | |||
| 1343 | Ga0395905_0006618 | |||
| 1344 | Ga0395905_0009307 | |||
| 1345 | Ga0395905_0012963 | |||
| 1346 | Ga0395905_0020243 | |||
| 1347 | Ga0395905_0024781 | |||
| 1348 | Ga0395905_0041203 | |||
| 1349 | Ga0395905_0047735 | |||
| 1350 | Ga0395905_0059517 | |||
| 1351 | Ga0395905_0067701 | |||
| 1352 | Ga0395905_0212780 | |||
| 1353 | Ga0395905_0263688 | |||
| 1354 | Ga0395905_0326111 | |||
| 1355 | Ga0395905_0399492 | |||
| 1356 | Ga0395901_0001505 | |||
| 1357 | Ga0395901_0009295 | |||
| 1358 | Ga0395901_0015931 | |||
| 1359 | Ga0395901_0021606 | |||
| 1360 | Ga0395901_0039136 | |||
| 1361 | Ga0395901_0075359 | |||
| 1362 | Ga0395901_0100335 | |||
| 1363 | Ga0395901_0108322 | |||
| 1364 | Ga0395901_0124416 | |||
| 1365 | Ga0395901_0172774 | |||
| 1366 | Ga0395901_0387745 | |||
| 1367 | Ga0395901_0390206 | |||
| 1368 | Ga0395901_0399229 | |||
| 1369 | Ga0395901_0408408 | |||
| 1370 | Ga0395901_0414952 | |||
| 1371 | Ga0395901_0523368 | |||
| 1372 | Ga0395901_1043595 | |||
| 1373 | Ga0436365_1022478 | |||
| 1374 | Ga0436362_0264146 | |||
| 1375 | Ga0451798_0738793 | |||
| 1376 | Ga0451835_0218292 | |||
| 1377 | Ga0451841_1282089 | |||
| 1378 | Ga0451849_1111261 | |||
| 1379 | Ga0451853_0559045 | |||
| 1380 | Ga0439448_0142075 | |||
| 1381 | Ga0466972_0142636 | |||
| 1382 | Ga0466972_0169842 | |||
| 1383 | Ga0466965_0152676 | |||
| 1384 | Ga0466965_0158566 | |||
| 1385 | Ga0466966_0442805 | |||
| 1386 | Ga0466966_0492316 | |||
| 1387 | Ga0466961_0090187 | |||
| 1388 | Ga0466961_0106071 | |||
| 1389 | Ga0466961_0123189 | |||
| 1390 | Ga0466961_0133362 | |||
| 1391 | Ga0466961_0166251 | |||
| 1392 | Ga0466963_0005318 | |||
| 1393 | Ga0466963_0005817 | |||
| 1394 | Ga0466963_0006073 | |||
| 1395 | Ga0466963_0010084 | |||
| 1396 | Ga0466963_0015500 | |||
| 1397 | Ga0466963_0016239 | |||
| 1398 | Ga0466963_0031404 | |||
| 1399 | Ga0466963_0057844 | |||
| 1400 | Ga0466963_0087244 | |||
| 1401 | Ga0466963_0091595 | |||
| 1402 | Ga0466963_0252037 | |||
| 1403 | Ga0466963_0448784 | |||
| 1404 | Ga0466963_0543165 | |||
| 1405 | Ga0466964_0000896 | |||
| 1406 | Ga0466964_0003925 | |||
| 1407 | Ga0466964_0005649 | |||
| 1408 | Ga0466964_0010856 | |||
| 1409 | Ga0466964_0024825 | |||
| 1410 | Ga0466964_0086743 | |||
| 1411 | Ga0466964_0098427 | |||
| 1412 | Ga0466964_0258516 | |||
| 1413 | Ga0466964_0402877 | |||
| 1414 | Ga0466964_0407327 | |||
| 1415 | Ga0466964_0433485 | |||
| 1416 | Ga0466971_0002294 | |||
| 1417 | Ga0466971_0006146 | |||
| 1418 | Ga0466971_0030631 | |||
| 1419 | Ga0466971_0128744 | |||
| 1420 | Ga0466968_0068749 | |||
| 1421 | Ga0466968_0092903 | |||
| 1422 | Ga0466968_0109208 | |||
| 1423 | Ga0466968_0113957 | |||
| 1424 | Ga0466957_0013495 | |||
| 1425 | Ga0466957_0015637 | |||
| 1426 | Ga0466957_0016847 | |||
| 1427 | Ga0466957_0033339 | |||
| 1428 | Ga0466957_0051471 | |||
| 1429 | Ga0466957_0056404 | |||
| 1430 | Ga0466957_0095909 | |||
| 1431 | Ga0466957_0311893 | |||
| 1432 | Ga0466957_0917885 | |||
| 1433 | Ga0466960_0012527 | |||
| 1434 | Ga0466960_0043606 | |||
| 1435 | Ga0466960_0109559 | |||
| 1436 | Ga0466960_0137569 | |||
| 1437 | Ga0466960_0165753 | |||
| 1438 | Ga0466960_0505878 | |||
| 1439 | Ga0466959_0017423 | |||
| 1440 | Ga0466959_0069429 | |||
| 1441 | Ga0466959_0654162 | |||
| 1442 | Ga0466958_0006158 | |||
| 1443 | Ga0466958_0016589 | |||
| 1444 | Ga0466958_0026537 | |||
| 1445 | Ga0466958_0028867 | |||
| 1446 | Ga0466958_0039330 | |||
| 1447 | Ga0466958_0068420 | |||
| 1448 | Ga0466958_0068779 | |||
| 1449 | Ga0466958_0692276 | |||
| 1450 | Ga0466967_0004561 | |||
| 1451 | Ga0466967_0005287 | |||
| 1452 | Ga0466967_0008406 | |||
| 1453 | Ga0466967_0019629 | |||
| 1454 | Ga0466967_0025977 | |||
| 1455 | Ga0466967_0026147 | |||
| 1456 | Ga0466967_0056701 | |||
| 1457 | Ga0466967_0069617 | |||
| 1458 | Ga0466967_0144471 | |||
| 1459 | Ga0466967_0202132 | |||
| 1460 | Ga0466967_0219360 | |||
| 1461 | Ga0466967_0225392 | |||
| 1462 | Ga0466967_0269239 | |||
| 1463 | Ga0466967_0436916 | |||
| 1464 | Ga0466967_1065507 | |||
| 1465 | Ga0466967_2112622 | |||
| 1466 | Ga0495603_0132206 | |||
| 1467 | Ga0495603_0713942 | |||
| 1468 | Ga0495629_0277374 | |||
| 1469 | Ga0495641_0181306 | |||
| 1470 | Ga0495641_0322335 | |||
| 1471 | Ga0495651_0099564 | |||
| 1472 | Ga0495653_0031482 | |||
| 1473 | Ga0495605_0065314 | |||
| 1474 | Ga0495584_0104642 | |||
| 1475 | Ga0495584_0106856 | |||
| 1476 | Ga0495584_0174694 | |||
| 1477 | Ga0495616_0289692 | |||
| 1478 | Ga0495618_0175520 | |||
| 1479 | Ga0495630_0273075 | |||
| 1480 | Ga0495630_1184355 | |||
| 1481 | Ga0495667_0015176 | |||
| 1482 | Ga0495656_0383629 | |||
| 1483 | Ga0495635_0149387 | |||
| 1484 | Ga0495661_0130639 | |||
| 1485 | Ga0495588_0542048 | |||
| 1486 | Ga0495657_0060907 | |||
| 1487 | Ga0495657_0305090 | |||
| 1488 | Ga0495658_0240992 | |||
| 1489 | Ga0495658_0287722 | |||
| 1490 | Ga0495613_0128588 | |||
| 1491 | Ga0495624_0017254 | |||
| 1492 | Ga0495649_0161183 | |||
| 1493 | Ga0495589_0076666 | |||
| 1494 | Ga0495600_0181341 | |||
| 1495 | Ga0495636_0081043 | |||
| 1496 | Ga0495674_1163237 | |||
| 1497 | Ga0495676_0179777 | |||
| 1498 | Ga0495676_0224447 | |||
| 1499 | Ga0495676_0635515 | |||
| 1500 | Ga0495680_0022776 | |||
| 1501 | Ga0495683_0252367 | |||
| 1502 | Ga0495684_0053664 | |||
| 1503 | Ga0495614_0048491 | |||
| 1504 | Ga0495626_0201911 | |||
| 1505 | Ga0496100_0008236 | |||
| 1506 | Ga0496100_0101775 | |||
| 1507 | Ga0496100_0612675 | |||
| 1508 | Ga0496100_0657791 | |||
| 1509 | Ga0496101_0000735 | |||
| 1510 | Ga0496101_0035693 | |||
| 1511 | Ga0496101_0051756 | |||
| 1512 | Ga0496101_0110979 | |||
| 1513 | Ga0496101_0204888 | |||
| 1514 | Ga0496101_0804999 | |||
| 1515 | Ga0496101_1516657 | |||
| 1516 | Ga0496102_0001216 | |||
| 1517 | Ga0496102_0002713 | |||
| 1518 | Ga0496102_0004949 | |||
| 1519 | Ga0496102_0021825 | |||
| 1520 | Ga0496102_0057297 | |||
| 1521 | Ga0496102_0150169 | |||
| 1522 | Ga0496102_0202002 | |||
| 1523 | Ga0496102_0379833 | |||
| 1524 | Ga0496102_1648303 | |||
| 1525 | Ga0496103_0002705 | |||
| 1526 | Ga0496103_0035655 | |||
| 1527 | Ga0496103_0077376 | |||
| 1528 | Ga0496103_0148019 | |||
| 1529 | Ga0496104_0000134 | |||
| 1530 | Ga0496104_0028410 | |||
| 1531 | Ga0496104_0054508 | |||
| 1532 | Ga0496104_0067820 | |||
| 1533 | Ga0496104_0623787 | |||
| 1534 | Ga0496104_1271154 | |||
| 1535 | Ga0496104_1417344 | |||
| 1536 | Ga0496105_0000484 | |||
| 1537 | Ga0496105_0036663 | |||
| 1538 | Ga0496105_0174680 | |||
| 1539 | Ga0496105_0184856 | |||
| 1540 | Ga0496106_0018184 | |||
| 1541 | Ga0496106_0090449 | |||
| 1542 | Ga0496106_0811044 | |||
| 1543 | Ga0496106_0990536 | |||
| 1544 | Ga0496107_0020634 | |||
| 1545 | Ga0496107_0047392 | |||
| 1546 | Ga0496107_0049850 | |||
| 1547 | Ga0496107_0050199 | |||
| 1548 | Ga0496107_0534218 | |||
| 1549 | Ga0496107_0604577 | |||
| 1550 | Ga0496107_1174405 | |||
| 1551 | Ga0496108_0001238 | |||
| 1552 | Ga0496108_0004984 | |||
| 1553 | Ga0496108_0044538 | |||
| 1554 | Ga0496108_0063188 | |||
| 1555 | Ga0496108_0304533 | |||
| 1556 | Ga0496108_0370652 | |||
| 1557 | Ga0496108_1792805 | |||
| 1558 | Ga0496109_0000898 | |||
| 1559 | Ga0496109_0014986 | |||
| 1560 | Ga0496109_0016825 | |||
| 1561 | Ga0496109_0052892 | |||
| 1562 | Ga0496109_0054658 | |||
| 1563 | Ga0496109_0100070 | |||
| 1564 | Ga0496109_0172836 | |||
| 1565 | Ga0496109_0178938 | |||
| 1566 | Ga0496109_0462505 | |||
| 1567 | Ga0496109_0791725 | |||
| 1568 | Ga0496110_0000851 | |||
| 1569 | Ga0496110_0000905 | |||
| 1570 | Ga0496110_0005135 | |||
| 1571 | Ga0496110_0134709 | |||
| 1572 | Ga0496110_0358315 | |||
| 1573 | Ga0496110_0714335 | |||
| 1574 | Ga0496110_0793199 | |||
| 1575 | Ga0496110_0934957 | |||
| 1576 | Ga0496111_0013044 | |||
| 1577 | Ga0496111_0042155 | |||
| 1578 | Ga0496111_0171953 | |||
| 1579 | Ga0496111_0255115 | |||
| 1580 | Ga0496111_0388966 | |||
| 1581 | Ga0496111_0455804 | |||
| 1582 | Ga0496112_0078305 | |||
| 1583 | Ga0496112_0244434 | |||
| 1584 | Ga0496112_0544835 | |||
| 1585 | Ga0496112_0613310 | |||
| 1586 | Ga0496112_0715941 | |||
| 1587 | Ga0496112_0832144 | |||
| 1588 | Ga0496113_0017399 | |||
| 1589 | Ga0496113_0070861 | |||
| 1590 | Ga0496113_0165213 | |||
| 1591 | Ga0496113_0374931 | |||
| 1592 | Ga0496113_0482516 | |||
| 1593 | Ga0496114_0000597 | |||
| 1594 | Ga0496114_0002596 | |||
| 1595 | Ga0496114_0069746 | |||
| 1596 | Ga0496114_0104528 | |||
| 1597 | Ga0496115_0054617 | |||
| 1598 | Ga0496115_0063108 | |||
| 1599 | Ga0496115_0135744 | |||
| 1600 | Ga0496115_0265491 | |||
| 1601 | Ga0501031_0000784 | |||
| 1602 | Ga0501032_0017056 | |||
| 1603 | Ga0501033_0001741 | |||
| 1604 | Ga0501034_0004685 | |||
| 1605 | Ga0501034_0034868 | |||
| 1606 | Ga0501034_0595828 | |||
| 1607 | Ga0501036_0025762 | |||
| 1608 | Ga0501037_0020117 | |||
| 1609 | Ga0501037_0093043 | |||
| 1610 | Ga0501038_0028184 | |||
| 1611 | Ga0501039_0547254 | |||
| 1612 | Ga0501040_0049265 | |||
| 1613 | Ga0501040_0141502 | |||
| 1614 | Ga0501042_0028132 | |||
| 1615 | Ga0501042_0109600 | |||
| 1616 | Ga0501043_0022114 | |||
| 1617 | Ga0501046_0000162 | |||
| 1618 | Ga0501046_0587256 | |||
| 1619 | Ga0501047_0001471 | |||
| 1620 | Ga0501047_0037313 | |||
| 1621 | Ga0501047_0311170 | |||
| 1622 | Ga0501048_0001285 | |||
| 1623 | Ga0501067_0007016 | |||
| 1624 | Ga0501067_0008934 | |||
| 1625 | Ga0501067_0010223 | |||
| 1626 | Ga0501067_0037515 | |||
| 1627 | Ga0501067_0092538 | |||
| 1628 | Ga0501067_0516410 | |||
| 1629 | Ga0501068_0011568 | |||
| 1630 | Ga0501068_0018378 | |||
| 1631 | Ga0501068_0028736 | |||
| 1632 | Ga0501069_0000428 | |||
| 1633 | Ga0501069_0000856 | |||
| 1634 | Ga0501069_0007926 | |||
| 1635 | Ga0501069_0009520 | |||
| 1636 | Ga0501069_0060440 | |||
| 1637 | Ga0501069_0091416 | |||
| 1638 | Ga0501070_0000032 | |||
| 1639 | Ga0501070_0004474 | |||
| 1640 | Ga0501070_0006018 | |||
| 1641 | Ga0501070_0013992 | |||
| 1642 | Ga0501070_0207431 | |||
| 1643 | Ga0501070_0215280 | |||
| 1644 | Ga0501070_0249793 | |||
| 1645 | Ga0501070_0297653 | |||
| 1646 | Ga0501070_0298971 | |||
| 1647 | Ga0501071_0019931 | |||
| 1648 | Ga0501071_0061168 | |||
| 1649 | Ga0501071_0286356 | |||
| 1650 | Ga0501072_0618279 | |||
| 1651 | Ga0501073_0018899 | |||
| 1652 | Ga0501073_0103628 | |||
| 1653 | Ga0501073_0257241 | |||
| 1654 | Ga0501074_0002052 | |||
| 1655 | Ga0501074_0018970 | |||
| 1656 | Ga0501074_0027224 | |||
| 1657 | Ga0501074_0050263 | |||
| 1658 | Ga0501074_0445912 | |||
| 1659 | Ga0501075_0747072 | |||
| 1660 | Ga0501077_0227761 | |||
| 1661 | Ga0501079_0000154 | |||
| 1662 | Ga0501079_0073348 | |||
| 1663 | Ga0501080_0000096 | |||
| 1664 | Ga0501080_0009066 | |||
| 1665 | Ga0501080_0015468 | |||
| 1666 | Ga0501080_0018304 | |||
| 1667 | Ga0501080_0031976 | |||
| 1668 | Ga0501080_0069360 | |||
| 1669 | Ga0501080_1085927 | |||
| 1670 | Ga0501083_0017869 | |||
| 1671 | Ga0501083_0463269 | |||
| 1672 | Ga0501035_0001581 | |||
| 1673 | Ga0501035_0194829 | |||
| 1674 | Ga0501044_0000056 | |||
| 1675 | Ga0501044_0002508 | |||
| 1676 | Ga0501044_0078601 | |||
| 1677 | Ga0501044_0970669 | |||
| 1678 | Ga0501045_0068121 | |||
| 1679 | nmdc:mga05p37_203949_c1 | |||
| 1680 | nmdc:mga05p37_276541_c1 | |||
| 1681 | nmdc:mga05p37_328065_c1 | |||
| 1682 | nmdc:mga0qj67_165844_c1 | |||
| 1683 | nmdc:mga08y16_121319_c1 | |||
| 1684 | nmdc:mga08y16_13904_c1 | |||
| 1685 | nmdc:mga08y16_371457_c1 | |||
| 1686 | nmdc:mga08y16_419358_c1 | |||
| 1687 | nmdc:mga08y16_645936_c1 | |||
| 1688 | nmdc:mga08y16_887716_c1 | |||
| 1689 | nmdc:mga0n895_131085_c1 | |||
| 1690 | nmdc:mga0n895_3007_c1 | |||
| 1691 | nmdc:mga0n895_41130_c1 | |||
| 1692 | nmdc:mga0n895_432754_c1 | |||
| 1693 | nmdc:mga0n895_65495_c1 | |||
| 1694 | nmdc:mga0n895_710568_c1 | |||
| 1695 | nmdc:mga0rr50_13483_c1 | |||
| 1696 | nmdc:mga0rr50_449927_c1 | |||
| 1697 | nmdc:mga0rr50_829541_c1 | |||
| 1698 | nmdc:mga08x19_344872_c1 | |||
| 1699 | nmdc:mga08x19_37852_c1 | |||
| 1700 | nmdc:mga08x19_79926_c1 | |||
| 1701 | nmdc:mga0a205_4356_c1 | |||
| 1702 | nmdc:mga0a205_899455_c1 | |||
| 1703 | Ga0495655_0032761 | |||
| 1704 | Ga0495595_0022594 | |||
| 1705 | Ga0501084_0361149 | |||
| 1706 | Ga0587073_0192793 | |||
| 1707 | Ga0501082_0026821 | |||
| 1708 | Ga0466962_0006257 | |||
| 1709 | Ga0466962_0009425 | |||
| 1710 | Ga0466962_0126676 | |||
| 1711 | Ga0466962_0395624 | |||
| 1712 | Ga0530510_0044741 | |||
| 1713 | Ga0530510_0045135 | |||
| 1714 | Ga0530510_0178214 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3c6f-assembly1.cif.gz_C | crystal structure of protein bsu07140 from bacillus subtilis | 0.9307 | 91 | 146 |
| 6rdk-assembly1.cif.gz_G | cryo-em structure of polytomella f-atp synthase, rotary substate 1b, composite map | 0.4742 | 1 | 86 |
| 4qnc-assembly1.cif.gz_A | crystal structure of a semisweet in an occluded state | 0.4657 | 3 | 66 |
| 6rd8-assembly1.cif.gz_J | cryoem structure of polytomella f-atp synthase, c-ring position 2, focussed refinement of fo and peripheral stalk | 0.4651 | 1 | 86 |
| 6rdk-assembly1.cif.gz_G | cryo-em structure of polytomella f-atp synthase, rotary substate 1b, composite map | 0.4604 | 1 | 86 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c6fC02 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.93 | 89 | 144 | 3.30.240.20 |
| 3c6fD01 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.9278 | 91 | 146 | 3.30.240.20 |
| af_P75839_95_166_3.30.240.20 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8517 | 77 | 147 | 3.30.240.20 |
| 3c6fD01 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8317 | 91 | 146 | 3.30.240.20 |
| af_P75839_95_166_3.30.240.20 | Alpha Beta;2-Layer Sandwich;CRO Repressor;bsu07140 like domains | 0.8314 | 77 | 147 | 3.30.240.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4LXT0-F1-model_v4 | DUF421 domain-containing protein | 0.8654 | 1 | 147 |
GO:0005886
|
| AF-A0A7S8IZR0-F1-model_v4 | YetF C-terminal domain-containing protein | 0.8633 | 3 | 147 |
GO:0005886
|
| AF-A0A2R6EFH0-F1-model_v4 | DUF421 domain-containing protein | 0.8608 | 24 | 145 |
GO:0005886
|
| AF-A0A2W4LXT0-F1-model_v4 | DUF421 domain-containing protein | 0.8601 | 1 | 147 |
GO:0005886
|
| AF-A0A7W0JQC3-F1-model_v4 | DUF421 domain-containing protein | 0.8531 | 2 | 144 |
GO:0005886
|