F483591

General Info

Members Datasets Scaffolds Average Seq Length
854 394 693 295

Family's Representative Sequence

Representative Sequence 3300046452|Ga0495617_031435|Ga0495617_031435_723_1745
Length 340
Sequence MRPAKSIQYLAPAYRPKSETFVTADLACRAKLLIMARPSVCKELLMRRLLTGCFVTLLLLLNTLILIGPLLVFALLKLVAPGRWRDYASGAVMWIAETWAEIDKLIFRLCIPTQWDIRGGEDLRGDTSYLVVSNHQSWVDIPALIQTLNRRTPFFKFFLKKELIWVPFLGLAWWALDYPFMKRYTKAFLAKHPELAGKDLEITKQACELFKRQPVTVVNYLEGTRYTAAKSAQQQSPFKHLLKPKAGGVAFVLAAMGEQLDAILDVTVVYPQAKIPGFWDLISGNVPRVIIDIKTRELDPALWQGDYENDPAFRQKVQSWVNQLWNEKDQRIAELRSERG

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
3 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
4 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231017 Pseudomonas sp. GM55 Isolate Nodule
13 2511231020 Pseudomonas sp. GM74 Isolate Nodule
14 2511231021 Pseudomonas sp. GM78 Isolate Nodule
15 2511231023 Pseudomonas sp. GM80 Isolate Nodule
16 2511231024 Pseudomonas sp. GM84 Isolate Nodule
17 2511231031 Pseudomonas sp. GM16 Isolate Nodule
18 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
19 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
20 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
21 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
22 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
23 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
24 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
25 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
26 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
27 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
28 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
29 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
30 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
31 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
32 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
33 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
34 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
35 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
36 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
37 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
38 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
39 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
40 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
41 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
42 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
43 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
44 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
45 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
46 2643221672 Variovorax sp. Root434 Isolate Unclassified
47 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
48 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
49 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
50 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
51 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
52 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
53 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
54 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
55 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
56 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
57 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
58 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
59 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
60 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
61 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
62 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
63 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
64 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
65 2765235841 Pseudomonas putida AA7 Isolate Unclassified
66 2773857670 Pseudomonas sp. 478 Isolate Unclassified
67 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
68 2773857673 Pseudomonas sp. 443 Isolate Unclassified
69 2784132063 Pseudomonas sp. 424 Isolate Unclassified
70 2784132072 Pseudomonas sp. 460 Isolate Unclassified
71 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
72 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
73 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
74 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
75 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
76 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
77 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
78 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
79 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
80 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
81 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
82 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
83 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
84 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
85 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
86 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
87 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
88 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
89 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
90 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
91 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
92 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
93 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
94 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
95 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
96 2904456579 Variovorax sp. 2002 Isolate Unclassified
97 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
98 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
99 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
100 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
101 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
102 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
103 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
104 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
105 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
106 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
107 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
108 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
109 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
110 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
111 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
112 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
113 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
114 2929520902 Variovorax beijingensis 502 Isolate Unclassified
115 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
116 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
117 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
118 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
119 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
120 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
121 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
122 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
123 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
124 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
125 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
126 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
127 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
128 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
129 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
130 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
131 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
132 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
133 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
134 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
135 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
136 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
137 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
138 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
139 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
140 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
141 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
142 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
143 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
144 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
145 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
146 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
147 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
148 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
149 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
150 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
151 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
152 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
153 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
154 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
155 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
156 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
157 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
158 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
159 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
160 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
161 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
162 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
163 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
164 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
165 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
166 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
167 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
168 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
169 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
170 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
171 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
172 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
173 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
174 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
175 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
176 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
177 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
178 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
179 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
180 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
181 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
182 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
183 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
184 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
185 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
186 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
187 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
188 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
189 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
190 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
191 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
192 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
193 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
194 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
195 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
196 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
197 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
198 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
201 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
202 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
203 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
204 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
205 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
206 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
208 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
209 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
210 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
213 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
228 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
231 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
233 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
234 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
235 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
236 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
237 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
242 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
243 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
244 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
245 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
250 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
251 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
252 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
253 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
254 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
255 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
256 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
257 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
258 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
259 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
260 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
261 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
262 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
263 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
264 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
271 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
272 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
273 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
274 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
275 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
276 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
277 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
278 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
295 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
300 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
301 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
302 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
303 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
304 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
305 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
306 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
307 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
311 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
312 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
313 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
314 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
315 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
316 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
317 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
318 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
319 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
320 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
321 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
322 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
327 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
330 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
331 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
332 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
333 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
334 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
335 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
336 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
337 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
338 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
339 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
340 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
341 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
342 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
343 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
344 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
345 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
346 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
347 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
348 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
349 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
350 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
351 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
352 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
353 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
354 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
355 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
356 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
357 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
358 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
359 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
360 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
366 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
367 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
368 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
369 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
370 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
371 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
372 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
373 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
374 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
375 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
376 8052494512 Pseudomonas putida LD6 Isolate Unclassified
377 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
378 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
379 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
380 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
381 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
382 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
383 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
384 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
385 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
386 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
387 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
388 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
389 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
390 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
391 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
392 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
393 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
394 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.91
Metatranscriptomes 0.23
Isolates 18.85

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 7.03
Nodule 2.22
Rhizoplane 1.99
Rhizosphere 74.94
Stem 0
Stem Tuber 0
Unclassified 13.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_1749 2124908027 Bacteria 2302
2 JGI24741J21665_1002957 3300001915 Bacteria 4235
3 JGI25162J39368_1000076 3300002737 Bacteria 120246
4 JGI25162J39368_1000104 3300002737 Bacteria 93706
5 JGI25154J39366_1005394 3300002738 Bacteria 2050
6 JGI25163J39215_1000198 3300002771 Bacteria 23415
7 JGI25164J39214_1000083 3300002772 Bacteria 93706
8 JGI25164J39214_1000084 3300002772 Bacteria 93684
9 JGI25165J46597_1000140 3300003214 Bacteria 120246
10 JGI25165J46597_1000186 3300003214 Bacteria 93706
11 Ga0006562J51391_1056221 3300003578 Bacteria 5370
12 Ga0006562J51391_1056222 3300003578 Bacteria 8660
13 Ga0055538_1000074 3300003751 Bacteria 90292
14 Ga0055539_1000112 3300003752 Bacteria 90292
15 Ga0055533_1000118 3300003756 Bacteria 90292
16 Ga0055532_1000106 3300003758 Bacteria 90264
17 Ga0055525_1000157 3300003759 Bacteria 90292
18 Ga0055535_1002953 3300003761 Bacteria 5254
19 Ga0055536_1000289 3300003781 Bacteria 38013
20 Ga0055536_1000620 3300003781 Bacteria 24134
21 Ga0055536_1000625 3300003781 Bacteria 24031
22 Ga0055530_10000389 3300003791 Bacteria 39450
23 Ga0055530_10000757 3300003791 Bacteria 26909
24 Ga0055530_10001107 3300003791 Bacteria 21076
25 Ga0055540_1000259 3300003792 Bacteria 47811
26 Ga0055540_1000366 3300003792 Bacteria 38001
27 Ga0055540_1001425 3300003792 Bacteria 14249
28 Ga0055531_10000109 3300003794 Bacteria 89901
29 Ga0055541_1000075 3300003841 Bacteria 90292
30 Ga0058692_1010636 3300003856 Bacteria 2265
31 Ga0065714_10000526 3300005288 Bacteria 4018
32 Ga0065714_10006723 3300005288 Bacteria 3164
33 Ga0065714_10079851 3300005288 Bacteria 2480
34 Ga0065714_10095472 3300005288 Bacteria 1785
35 Ga0065704_10001207 3300005289 Bacteria 8932
36 Ga0065704_10079943 3300005289 Bacteria 4045
37 Ga0065712_10017828 3300005290 Bacteria 1608
38 Ga0070670_100000368 3300005331 Bacteria 37602
39 Ga0070670_100056184 3300005331 Bacteria 3378
40 Ga0070661_100000038 3300005344 Bacteria 104775
41 Ga0070669_100000626 3300005353 Bacteria 26162
42 Ga0070669_100003116 3300005353 Bacteria 11939
43 Ga0070662_100000787 3300005457 Bacteria 19461
44 Ga0070662_100032555 3300005457 Bacteria 3664
45 Ga0068853_100000155 3300005539 Bacteria 46420
46 Ga0070665_100011929 3300005548 Bacteria 8775
47 Ga0070665_100080326 3300005548 Bacteria 3266
48 Ga0070664_100001315 3300005564 Bacteria 19831
49 Ga0070664_100038811 3300005564 Bacteria 4010
50 Ga0068854_100003965 3300005578 Bacteria 9277
51 Ga0068851_10000012 3300005834 Bacteria 175130
52 Ga0075364_10093140 3300006051 Bacteria 2000
53 Ga0075364_10286262 3300006051 Bacteria 1121
54 Ga0075432_10002115 3300006058 Bacteria 6612
55 Ga0075432_10009609 3300006058 Bacteria 3293
56 Ga0075362_10001209 3300006177 Bacteria 8116
57 Ga0075362_10023071 3300006177 Bacteria 2628
58 Ga0099823_1001650 3300006944 Bacteria 18964
59 Ga0079104_1000752 3300006946 Bacteria 28044
60 Ga0105251_10000019 3300009011 Bacteria 141884
61 Ga0105251_10001508 3300009011 Bacteria 20005
62 Ga0105251_10001556 3300009011 Bacteria 19676
63 Ga0105251_10001642 3300009011 Bacteria 18947
64 Ga0105251_10002891 3300009011 Bacteria 12914
65 Ga0105251_10014004 3300009011 Bacteria 4455
66 Ga0105244_10000150 3300009036 Bacteria 73078
67 Ga0105244_10000711 3300009036 Bacteria 28745
68 Ga0105244_10001478 3300009036 Bacteria 18951
69 Ga0105244_10006568 3300009036 Bacteria 7502
70 Ga0105244_10007253 3300009036 Bacteria 7062
71 Ga0105244_10037387 3300009036 Bacteria 2538
72 Ga0105244_10061700 3300009036 Bacteria 1886
73 Ga0105244_10065901 3300009036 Bacteria 1814
74 Ga0105244_10069185 3300009036 Bacteria 1763
75 Ga0105244_10082667 3300009036 Bacteria 1588
76 Ga0105250_10000519 3300009092 Bacteria 26981
77 Ga0105250_10000752 3300009092 Bacteria 19712
78 Ga0105250_10023832 3300009092 Bacteria 2468
79 Ga0105250_10053748 3300009092 Bacteria 1615
80 Ga0105243_10119166 3300009148 Bacteria 2222
81 Ga0105242_10000169 3300009176 Bacteria 49398
82 Ga0105242_10030577 3300009176 Bacteria 4300
83 Ga0105248_10232939 3300009177 Bacteria 2073
84 Ga0105237_10005893 3300009545 Bacteria 13742
85 Ga0105246_10000617 3300011119 Bacteria 19838
86 Ga0105246_10001973 3300011119 Bacteria 12368
87 Ga0157345_1000021 3300012498 Bacteria 41056
88 Ga0157373_10001281 3300013100 Bacteria 19218
89 Ga0157373_10004690 3300013100 Bacteria 10275
90 Ga0157373_10023736 3300013100 Bacteria 4444
91 Ga0157373_10043580 3300013100 Bacteria 3205
92 Ga0157373_10106007 3300013100 Bacteria 1976
93 Ga0157373_10138254 3300013100 Bacteria 1713
94 Ga0157373_10204153 3300013100 Bacteria 1393
95 Ga0157371_10001747 3300013102 Bacteria 22022
96 Ga0157371_10002492 3300013102 Bacteria 17498
97 Ga0157371_10006333 3300013102 Bacteria 9792
98 Ga0157370_10016538 3300013104 Bacteria 7463
99 Ga0157370_10067825 3300013104 Bacteria 3372
100 Ga0157370_10133835 3300013104 Bacteria 2312
101 Ga0157369_10006372 3300013105 Bacteria 13686
102 Ga0157369_10007915 3300013105 Bacteria 12219
103 Ga0157369_10028628 3300013105 Bacteria 6164
104 Ga0157369_10057638 3300013105 Bacteria 4190
105 Ga0157369_10073051 3300013105 Bacteria 3680
106 Ga0163162_10001061 3300013306 Bacteria 25562
107 Ga0163162_10240437 3300013306 Bacteria 1941
108 Ga0157372_10012514 3300013307 Bacteria 9040
109 Ga0157372_10022580 3300013307 Bacteria 6809
110 Ga0157372_10059867 3300013307 Bacteria 4261
111 Ga0157375_10005580 3300013308 Bacteria 10945
112 Ga0157375_10069687 3300013308 Bacteria 3524
113 Ga0182008_10006385 3300014497 Bacteria 6597
114 Ga0182008_10014722 3300014497 Bacteria 4090
115 Ga0182008_10018747 3300014497 Bacteria 3581
116 Ga0182008_10021787 3300014497 Bacteria 3290
117 Ga0182008_10023826 3300014497 Bacteria 3120
118 Ga0182008_10030419 3300014497 Bacteria 2722
119 Ga0182008_10034988 3300014497 Bacteria 2518
120 Ga0182006_1001027 3300015261 Bacteria 18242
121 Ga0182006_1001586 3300015261 Bacteria 13498
122 Ga0182006_1001598 3300015261 Bacteria 13404
123 Ga0182006_1023686 3300015261 Bacteria 2540
124 Ga0182006_1033011 3300015261 Bacteria 2077
125 Ga0182006_1035592 3300015261 Bacteria 1983
126 Ga0182007_10000408 3300015262 Bacteria 26444
127 Ga0182007_10001004 3300015262 Bacteria 15472
128 Ga0182005_1002494 3300015265 Bacteria 6546
129 Ga0182005_1003495 3300015265 Bacteria 5316
130 Ga0182005_1003776 3300015265 Bacteria 5038
131 Ga0182005_1017337 3300015265 Bacteria 1994
132 Ga0182005_1023792 3300015265 Bacteria 1673
133 Ga0163161_10001087 3300017792 Bacteria 20607
134 Ga0163161_10044753 3300017792 Bacteria 3189
135 Ga0163161_10107479 3300017792 Bacteria 2082
136 Ga0163161_10339589 3300017792 Bacteria 1191
137 Ga0163161_10425647 3300017792 Bacteria 1069
138 Ga0209760_100098 3300025207 Bacteria 66801
139 Ga0209760_100274 3300025207 Bacteria 18776
140 Ga0209784_100007 3300025224 Bacteria 747715
141 Ga0209566_100062 3300025225 Bacteria 193033
142 Ga0209674_100132 3300025226 Bacteria 117820
143 Ga0209147_100009 3300025229 Bacteria 747409
144 Ga0209563_100018 3300025230 Bacteria 747850
145 Ga0207427_100005 3300025231 Bacteria 797999
146 Ga0207427_100006 3300025231 Bacteria 785415
147 Ga0209437_100013 3300025233 Bacteria 785457
148 Ga0209437_100018 3300025233 Bacteria 694400
149 Ga0209258_100330 3300025242 Bacteria 71644
150 Ga0209646_1000185 3300025246 Bacteria 77981
151 Ga0209677_100056 3300025253 Bacteria 165557
152 Ga0209759_1014981 3300025256 Bacteria 2022
153 Ga0209233_1000021 3300025261 Bacteria 798078
154 Ga0209233_1000022 3300025261 Bacteria 785415
155 Ga0209676_1000015 3300025292 Bacteria 784458
156 Ga0209676_1000030 3300025292 Bacteria 506421
157 Ga0209676_1000041 3300025292 Bacteria 424583
158 Ga0209676_1000917 3300025292 Bacteria 36740
159 Ga0209050_1000075 3300025298 Bacteria 286562
160 Ga0209050_1000128 3300025298 Bacteria 187432
161 Ga0209050_1001373 3300025298 Bacteria 26568
162 Ga0209051_1000012 3300025303 Bacteria 595474
163 Ga0209051_1000041 3300025303 Bacteria 311155
164 Ga0209051_1000144 3300025303 Bacteria 134811
165 Ga0209051_1009490 3300025303 Bacteria 5010
166 Ga0209257_1000069 3300025304 Bacteria 339826
167 Ga0207656_10000006 3300025321 Bacteria 395044
168 Ga0207696_1000031 3300025711 Bacteria 384169
169 Ga0207696_1000064 3300025711 Bacteria 238379
170 Ga0207696_1000094 3300025711 Bacteria 184065
171 Ga0207696_1000095 3300025711 Bacteria 179123
172 Ga0207696_1000149 3300025711 Bacteria 120461
173 Ga0207696_1002997 3300025711 Bacteria 7885
174 Ga0207696_1008634 3300025711 Bacteria 3873
175 Ga0207696_1017447 3300025711 Bacteria 2378
176 Ga0207696_1037243 3300025711 Bacteria 1441
177 Ga0207655_1000107 3300025728 Bacteria 178758
178 Ga0207655_1000455 3300025728 Bacteria 53605
179 Ga0207655_1000847 3300025728 Bacteria 32804
180 Ga0207655_1000992 3300025728 Bacteria 28937
181 Ga0207655_1001195 3300025728 Bacteria 25084
182 Ga0207655_1001311 3300025728 Bacteria 23515
183 Ga0207655_1002303 3300025728 Bacteria 15693
184 Ga0207655_1012388 3300025728 Bacteria 4988
185 Ga0207655_1012657 3300025728 Bacteria 4908
186 Ga0207655_1013711 3300025728 Bacteria 4631
187 Ga0207655_1017834 3300025728 Bacteria 3809
188 Ga0207655_1031824 3300025728 Bacteria 2422
189 Ga0207655_1032389 3300025728 Bacteria 2389
190 Ga0207713_1000010 3300025735 Bacteria 528374
191 Ga0207713_1001139 3300025735 Bacteria 22567
192 Ga0207713_1001437 3300025735 Bacteria 19017
193 Ga0207713_1001904 3300025735 Bacteria 15814
194 Ga0207713_1002108 3300025735 Bacteria 14839
195 Ga0207713_1002895 3300025735 Bacteria 12021
196 Ga0207713_1008495 3300025735 Bacteria 5907
197 Ga0207713_1011728 3300025735 Bacteria 4737
198 Ga0207713_1013045 3300025735 Bacteria 4406
199 Ga0207713_1015928 3300025735 Bacteria 3838
200 Ga0207713_1024358 3300025735 Bacteria 2824
201 Ga0207671_10000299 3300025914 Bacteria 73023
202 Ga0207649_10000022 3300025920 Bacteria 188959
203 Ga0207681_10000422 3300025923 Bacteria 29446
204 Ga0207681_10002906 3300025923 Bacteria 10833
205 Ga0207650_10000138 3300025925 Bacteria 88802
206 Ga0207650_10000159 3300025925 Bacteria 81496
207 Ga0207706_10000290 3300025933 Bacteria 54761
208 Ga0207706_10004400 3300025933 Bacteria 13233
209 Ga0207686_10000305 3300025934 Bacteria 35554
210 Ga0207686_10171489 3300025934 Bacteria 1530
211 Ga0207709_10000086 3300025935 Bacteria 156177
212 Ga0207709_10008628 3300025935 Bacteria 5629
213 Ga0207711_10158830 3300025941 Bacteria 2045
214 Ga0207679_10000027 3300025945 Bacteria 196811
215 Ga0207639_10001167 3300026041 Bacteria 17836
216 Ga0209281_1000016 3300027111 Bacteria 588107
217 Ga0209281_1001719 3300027111 Bacteria 11302
218 Ga0209389_1000095 3300027296 Bacteria 80518
219 Ga0209371_1000066 3300027312 Bacteria 212660
220 Ga0209371_1004519 3300027312 Bacteria 5991
221 Ga0207428_10011576 3300027907 Bacteria 7789
222 Ga0207428_10042461 3300027907 Bacteria 3678
223 Ga0207428_10049641 3300027907 Bacteria 3361
224 Ga0207428_10049870 3300027907 Bacteria 3352
225 Ga0207428_10082591 3300027907 Bacteria 2507
226 Ga0207428_10158677 3300027907 Bacteria 1719
227 Ga0207428_10177269 3300027907 Bacteria 1612
228 Ga0268266_10006578 3300028379 Bacteria 10616
229 Ga0265334_10000011 3300028573 Bacteria 178287
230 Ga0268256_1000063 3300030500 Bacteria 212660
231 Ga0268256_1003588 3300030500 Bacteria 6917
232 Ga0307511_10040857 3300030521 Bacteria 3929
233 Ga0316179_1031537 3300030734 Bacteria 1169
234 Ga0316178_1083275 3300030735 Bacteria 51744
235 Ga0307408_100000019 3300031548 Bacteria 344502
236 Ga0307408_100001812 3300031548 Bacteria 15561
237 Ga0307408_100127531 3300031548 Bacteria 1981
238 Ga0307405_10019766 3300031731 Bacteria 3749
239 Ga0307405_10431161 3300031731 Bacteria 1040
240 Ga0307413_10132296 3300031824 Bacteria 1710
241 Ga0307406_10000970 3300031901 Bacteria 16033
242 Ga0307412_10024028 3300031911 Bacteria 3758
243 Ga0307412_10151144 3300031911 Bacteria 1713
244 Ga0307409_100020735 3300031995 Bacteria 4488
245 Ga0307416_100162343 3300032002 Bacteria 2067
246 Ga0307414_10077621 3300032004 Bacteria 2418
247 Ga0307411_10003310 3300032005 Bacteria 7452
248 Ga0307411_10204196 3300032005 Bacteria 1520
249 Ga0307510_10002877 3300033180 Bacteria 19810
250 Ga0373925_0199427 3300037068 Bacteria 1591
251 Ga0395905_0010256 3300037471 Bacteria 9125
252 Ga0237819_00209 3300038705 Bacteria 21356
253 Ga0400487_09819 3300039110 Bacteria 1504
254 Ga0439436_0003377 3300041404 Bacteria 4841
255 Ga0439438_000779 3300041405 Bacteria 14188
256 Ga0439438_000931 3300041405 Bacteria 13060
257 Ga0439438_012440 3300041405 Bacteria 2609
258 Ga0439447_023349 3300041407 Bacteria 1612
259 Ga0439466_0001641 3300041411 Bacteria 8763
260 Ga0439466_0003559 3300041411 Bacteria 6018
261 Ga0439466_0011358 3300041411 Bacteria 3295
262 Ga0439432_000859 3300042006 Bacteria 11357
263 Ga0439432_003308 3300042006 Bacteria 5990
264 Ga0439432_009057 3300042006 Bacteria 3479
265 Ga0439432_014193 3300042006 Bacteria 2697
266 Ga0439432_035953 3300042006 Bacteria 1586
267 Ga0439451_005341 3300042009 Bacteria 2617
268 Ga0439452_000507 3300042010 Bacteria 21118
269 Ga0439452_000648 3300042010 Bacteria 17388
270 Ga0439452_003067 3300042010 Bacteria 5934
271 Ga0439456_000068 3300042013 Bacteria 36709
272 Ga0439456_002218 3300042013 Bacteria 3908
273 Ga0439456_004119 3300042013 Bacteria 2949
274 Ga0439463_000149 3300042016 Bacteria 17859
275 Ga0439463_000438 3300042016 Bacteria 11631
276 Ga0450911_000003 3300042115 Bacteria 237055
277 Ga0450911_000581 3300042115 Bacteria 11332
278 Ga0450917_001206 3300042120 Bacteria 1874
279 Ga0450922_000034 3300042124 Bacteria 12012
280 Ga0450923_000592 3300042125 Bacteria 4140
281 Ga0450904_000051 3300042139 Bacteria 26256
282 Ga0450904_000479 3300042139 Bacteria 7830
283 Ga0450906_007442 3300042145 Bacteria 2162
284 Ga0450907_000760 3300042146 Bacteria 8157
285 Ga0439446_0002675 3300042156 Bacteria 4308
286 Ga0450908_003667 3300042184 Bacteria 2984
287 Ga0439464_0000142 3300042439 Bacteria 11665
288 Ga0439460_0003661 3300042461 Bacteria 3726
289 Ga0450916_000325 3300042530 Bacteria 3870
290 Ga0439440_0001743 3300042993 Bacteria 4005
291 Ga0453684_0052308 3300044712 Bacteria 5343
292 Ga0495617_000582 3300046452 Bacteria 18600
293 Ga0495617_002152 3300046452 Bacteria 8090
294 Ga0495617_010002 3300046452 Bacteria 3251
295 Ga0495617_027341 3300046452 Bacteria 1919
296 Ga0495617_031435 3300046452 Bacteria 1782
297 Ga0495627_000023 3300046453 Bacteria 251113
298 Ga0495627_000134 3300046453 Bacteria 88155
299 Ga0495627_001005 3300046453 Bacteria 18979
300 Ga0495627_002276 3300046453 Bacteria 9478
301 Ga0495627_004374 3300046453 Bacteria 5933
302 Ga0495627_014907 3300046453 Bacteria 2696
303 Ga0495603_0063755 3300046455 Bacteria 2173
304 Ga0495590_0000356 3300046457 Bacteria 23621
305 Ga0495590_0001252 3300046457 Bacteria 11076
306 Ga0495590_0056514 3300046457 Bacteria 1371
307 Ga0495591_000025 3300046458 Bacteria 189897
308 Ga0495591_000728 3300046458 Bacteria 23844
309 Ga0495591_000970 3300046458 Bacteria 19586
310 Ga0495591_001914 3300046458 Bacteria 12218
311 Ga0495591_001960 3300046458 Bacteria 12021
312 Ga0495591_003795 3300046458 Bacteria 7639
313 Ga0495591_006789 3300046458 Bacteria 4982
314 Ga0495591_012572 3300046458 Bacteria 3144
315 Ga0495591_017961 3300046458 Bacteria 2412
316 Ga0495591_025601 3300046458 Bacteria 1847
317 Ga0495638_0002423 3300046460 Bacteria 15246
318 Ga0495638_0009363 3300046460 Bacteria 6885
319 Ga0495638_0016132 3300046460 Bacteria 5006
320 Ga0495638_0022024 3300046460 Bacteria 4188
321 Ga0495638_0023288 3300046460 Bacteria 4052
322 Ga0495638_0026660 3300046460 Bacteria 3744
323 Ga0495638_0077315 3300046460 Bacteria 2026
324 Ga0495653_0002339 3300046463 Bacteria 15047
325 Ga0495653_0003298 3300046463 Bacteria 12949
326 Ga0495653_0017970 3300046463 Bacteria 5748
327 Ga0495650_0002155 3300046471 Bacteria 16715
328 Ga0495650_0003462 3300046471 Bacteria 11501
329 Ga0495650_0009445 3300046471 Bacteria 5543
330 Ga0495650_0016777 3300046471 Bacteria 3693
331 Ga0495605_0001169 3300046474 Bacteria 17426
332 Ga0495605_0003351 3300046474 Bacteria 9576
333 Ga0495605_0015636 3300046474 Bacteria 4123
334 Ga0495605_0040265 3300046474 Bacteria 2335
335 Ga0495639_0000577 3300046475 Bacteria 17080
336 Ga0495639_0015405 3300046475 Bacteria 3316
337 Ga0495584_0001354 3300046491 Bacteria 14821
338 Ga0495584_0007191 3300046491 Bacteria 5812
339 Ga0495584_0010611 3300046491 Bacteria 4731
340 Ga0495584_0020423 3300046491 Bacteria 3365
341 Ga0495584_0031642 3300046491 Bacteria 2677
342 Ga0495584_0039065 3300046491 Bacteria 2398
343 Ga0495584_0055637 3300046491 Bacteria 1990
344 Ga0495585_0000705 3300046492 Bacteria 30104
345 Ga0495585_0001233 3300046492 Bacteria 20629
346 Ga0495585_0003913 3300046492 Bacteria 9868
347 Ga0495585_0012245 3300046492 Bacteria 5053
348 Ga0495585_0014493 3300046492 Bacteria 4592
349 Ga0495585_0018776 3300046492 Bacteria 3987
350 Ga0495585_0021613 3300046492 Bacteria 3694
351 Ga0495594_0066064 3300046499 Bacteria 2006
352 Ga0495596_0000478 3300046500 Bacteria 25350
353 Ga0495607_0000069 3300046501 Bacteria 101754
354 Ga0495607_0001688 3300046501 Bacteria 19008
355 Ga0495607_0003172 3300046501 Bacteria 12738
356 Ga0495607_0003303 3300046501 Bacteria 12386
357 Ga0495607_0004123 3300046501 Bacteria 10840
358 Ga0495607_0009558 3300046501 Bacteria 6552
359 Ga0495607_0011736 3300046501 Bacteria 5811
360 Ga0495607_0012648 3300046501 Bacteria 5560
361 Ga0495607_0055511 3300046501 Bacteria 2278
362 Ga0495607_0090195 3300046501 Bacteria 1662
363 Ga0495607_0119073 3300046501 Bacteria 1389
364 Ga0495583_0002951 3300046506 Bacteria 13670
365 Ga0495583_0003018 3300046506 Bacteria 13422
366 Ga0495583_0043336 3300046506 Bacteria 2095
367 Ga0495583_0053729 3300046506 Bacteria 1827
368 Ga0495606_0004110 3300046507 Bacteria 14781
369 Ga0495606_0006032 3300046507 Bacteria 11343
370 Ga0495606_0006404 3300046507 Bacteria 10867
371 Ga0495606_0010755 3300046507 Bacteria 7544
372 Ga0495606_0018269 3300046507 Bacteria 5265
373 Ga0495606_0022823 3300046507 Bacteria 4547
374 Ga0495606_0070275 3300046507 Bacteria 2208
375 Ga0495606_0089323 3300046507 Bacteria 1898
376 Ga0495610_0002777 3300046512 Bacteria 14352
377 Ga0495610_0005863 3300046512 Bacteria 8621
378 Ga0495610_0013003 3300046512 Bacteria 4972
379 Ga0495610_0023436 3300046512 Bacteria 3355
380 Ga0495616_0002193 3300046513 Bacteria 13053
381 Ga0495616_0002782 3300046513 Bacteria 11424
382 Ga0495616_0017155 3300046513 Bacteria 3994
383 Ga0495616_0057430 3300046513 Bacteria 1918
384 Ga0495616_0072336 3300046513 Bacteria 1665
385 Ga0495620_0000879 3300046515 Bacteria 18536
386 Ga0495620_0001236 3300046515 Bacteria 15611
387 Ga0495620_0001871 3300046515 Bacteria 12386
388 Ga0495620_0005263 3300046515 Bacteria 7238
389 Ga0495620_0005831 3300046515 Bacteria 6839
390 Ga0495620_0082316 3300046515 Bacteria 1300
391 Ga0495630_0128933 3300046517 Bacteria 1920
392 Ga0495631_0000557 3300046518 Bacteria 24982
393 Ga0495631_0001273 3300046518 Bacteria 15530
394 Ga0495631_0001898 3300046518 Bacteria 12311
395 Ga0495631_0009216 3300046518 Bacteria 4942
396 Ga0495631_0022766 3300046518 Bacteria 2912
397 Ga0495631_0100615 3300046518 Bacteria 1244
398 Ga0495632_0002203 3300046519 Bacteria 15039
399 Ga0495632_0002244 3300046519 Bacteria 14886
400 Ga0495632_0002355 3300046519 Bacteria 14484
401 Ga0495632_0006993 3300046519 Bacteria 7160
402 Ga0495632_0028208 3300046519 Bacteria 2930
403 Ga0495632_0044728 3300046519 Bacteria 2208
404 Ga0495632_0064361 3300046519 Bacteria 1773
405 Ga0495632_0070666 3300046519 Bacteria 1678
406 Ga0495632_0071073 3300046519 Bacteria 1672
407 Ga0495637_0000982 3300046520 Bacteria 18091
408 Ga0495637_0001013 3300046520 Bacteria 17686
409 Ga0495637_0002185 3300046520 Bacteria 10935
410 Ga0495637_0004272 3300046520 Bacteria 7419
411 Ga0495637_0005147 3300046520 Bacteria 6704
412 Ga0495637_0007429 3300046520 Bacteria 5425
413 Ga0495637_0016381 3300046520 Bacteria 3465
414 Ga0495637_0018073 3300046520 Bacteria 3274
415 Ga0495637_0018784 3300046520 Bacteria 3202
416 Ga0495637_0020252 3300046520 Bacteria 3062
417 Ga0495637_0024037 3300046520 Bacteria 2758
418 Ga0495637_0034885 3300046520 Bacteria 2200
419 Ga0495637_0053008 3300046520 Bacteria 1690
420 Ga0495637_0057048 3300046520 Bacteria 1614
421 Ga0495643_0001214 3300046522 Bacteria 24940
422 Ga0495643_0006720 3300046522 Bacteria 7527
423 Ga0495643_0013302 3300046522 Bacteria 4929
424 Ga0495643_0030237 3300046522 Bacteria 3026
425 Ga0495643_0056107 3300046522 Bacteria 2103
426 Ga0495643_0087371 3300046522 Bacteria 1613
427 Ga0495644_0000474 3300046523 Bacteria 17385
428 Ga0495644_0033998 3300046523 Bacteria 1924
429 Ga0495644_0045073 3300046523 Bacteria 1658
430 Ga0495648_0001169 3300046524 Bacteria 26511
431 Ga0495648_0001874 3300046524 Bacteria 20108
432 Ga0495648_0002169 3300046524 Bacteria 18476
433 Ga0495648_0004794 3300046524 Bacteria 11432
434 Ga0495648_0005415 3300046524 Bacteria 10611
435 Ga0495648_0023508 3300046524 Bacteria 4219
436 Ga0495648_0028304 3300046524 Bacteria 3735
437 Ga0495648_0038394 3300046524 Bacteria 3063
438 Ga0495648_0093759 3300046524 Bacteria 1673
439 Ga0495648_0094826 3300046524 Bacteria 1661
440 Ga0495648_0139352 3300046524 Bacteria 1278
441 Ga0495642_0000253 3300046528 Bacteria 29942
442 Ga0495642_0000574 3300046528 Bacteria 18445
443 Ga0495642_0001251 3300046528 Bacteria 11606
444 Ga0495654_0000947 3300046530 Bacteria 21495
445 Ga0495654_0001612 3300046530 Bacteria 15295
446 Ga0495654_0002089 3300046530 Bacteria 13074
447 Ga0495654_0002168 3300046530 Bacteria 12784
448 Ga0495654_0002476 3300046530 Bacteria 11870
449 Ga0495654_0010516 3300046530 Bacteria 5033
450 Ga0495654_0015217 3300046530 Bacteria 4088
451 Ga0495654_0018982 3300046530 Bacteria 3598
452 Ga0495654_0023761 3300046530 Bacteria 3172
453 Ga0495654_0028857 3300046530 Bacteria 2833
454 Ga0495654_0031052 3300046530 Bacteria 2713
455 Ga0495654_0047218 3300046530 Bacteria 2117
456 Ga0495587_0009814 3300046536 Bacteria 6117
457 Ga0495609_0000057 3300046538 Bacteria 143793
458 Ga0495609_0010555 3300046538 Bacteria 4427
459 Ga0495609_0012057 3300046538 Bacteria 4103
460 Ga0495609_0016335 3300046538 Bacteria 3458
461 Ga0495609_0126374 3300046538 Bacteria 1097
462 Ga0495597_0000229 3300046542 Bacteria 50600
463 Ga0495597_0001472 3300046542 Bacteria 16864
464 Ga0495597_0002031 3300046542 Bacteria 13545
465 Ga0495597_0004119 3300046542 Bacteria 8093
466 Ga0495597_0010651 3300046542 Bacteria 4483
467 Ga0495597_0031005 3300046542 Bacteria 2434
468 Ga0495622_0000871 3300046557 Bacteria 16536
469 Ga0495622_0001113 3300046557 Bacteria 14064
470 Ga0495622_0003393 3300046557 Bacteria 7514
471 Ga0495622_0051148 3300046557 Bacteria 1916
472 Ga0495633_0002371 3300046558 Bacteria 13349
473 Ga0495656_0032589 3300046615 Bacteria 2121
474 Ga0495668_0001637 3300046616 Bacteria 20908
475 Ga0495668_0010876 3300046616 Bacteria 5480
476 Ga0495668_0011902 3300046616 Bacteria 5182
477 Ga0495668_0013844 3300046616 Bacteria 4743
478 Ga0495611_0000398 3300046648 Bacteria 27372
479 Ga0495625_0001611 3300046660 Bacteria 26632
480 Ga0495625_0005979 3300046660 Bacteria 10939
481 Ga0495625_0008586 3300046660 Bacteria 8695
482 Ga0495625_0010435 3300046660 Bacteria 7686
483 Ga0495625_0015095 3300046660 Bacteria 6131
484 Ga0495625_0024032 3300046660 Bacteria 4645
485 Ga0495625_0028783 3300046660 Bacteria 4161
486 Ga0495625_0055556 3300046660 Bacteria 2823
487 Ga0495625_0061846 3300046660 Bacteria 2648
488 Ga0495635_0002400 3300046663 Bacteria 12762
489 Ga0495635_0014787 3300046663 Bacteria 5459
490 Ga0495659_0024028 3300046664 Bacteria 2074
491 Ga0495661_0000027 3300046665 Bacteria 184297
492 Ga0495661_0000571 3300046665 Bacteria 38251
493 Ga0495661_0003441 3300046665 Bacteria 11683
494 Ga0495661_0012541 3300046665 Bacteria 5723
495 Ga0495661_0027461 3300046665 Bacteria 3652
496 Ga0495661_0129785 3300046665 Bacteria 1382
497 Ga0495661_0132934 3300046665 Bacteria 1361
498 Ga0495588_0003618 3300046674 Bacteria 6757
499 Ga0495588_0015925 3300046674 Bacteria 3626
500 Ga0495623_0004003 3300046679 Bacteria 9702
501 Ga0495646_0003143 3300046680 Bacteria 10249
502 Ga0495646_0014400 3300046680 Bacteria 5030
503 Ga0495613_0023434 3300046689 Bacteria 4598
504 Ga0495624_0001016 3300046690 Bacteria 22226
505 Ga0495670_0000898 3300046691 Bacteria 14390
506 Ga0495670_0001148 3300046691 Bacteria 12867
507 Ga0495670_0001629 3300046691 Bacteria 10988
508 Ga0495671_0000860 3300046692 Bacteria 21697
509 Ga0495671_0001062 3300046692 Bacteria 19031
510 Ga0495671_0002728 3300046692 Bacteria 11058
511 Ga0495671_0003121 3300046692 Bacteria 10298
512 Ga0495671_0006460 3300046692 Bacteria 6772
513 Ga0495671_0016960 3300046692 Bacteria 3880
514 Ga0495671_0025098 3300046692 Bacteria 3099
515 Ga0495671_0031230 3300046692 Bacteria 2723
516 Ga0495671_0073639 3300046692 Bacteria 1676
517 Ga0495671_0082388 3300046692 Bacteria 1576
518 Ga0495671_0087314 3300046692 Bacteria 1527
519 Ga0495671_0096697 3300046692 Bacteria 1444
520 Ga0495649_0000950 3300046694 Bacteria 22854
521 Ga0495649_0003030 3300046694 Bacteria 11526
522 Ga0495649_0009177 3300046694 Bacteria 5896
523 Ga0495649_0009407 3300046694 Bacteria 5813
524 Ga0495649_0012447 3300046694 Bacteria 4946
525 Ga0495649_0024115 3300046694 Bacteria 3395
526 Ga0495649_0094265 3300046694 Bacteria 1593
527 Ga0495649_0096994 3300046694 Bacteria 1568
528 Ga0495649_0180428 3300046694 Bacteria 1101
529 Ga0495589_0001444 3300046794 Bacteria 13702
530 Ga0495589_0006684 3300046794 Bacteria 6074
531 Ga0495589_0011088 3300046794 Bacteria 4676
532 Ga0495589_0013075 3300046794 Bacteria 4286
533 Ga0495600_0015051 3300046809 Bacteria 4885
534 Ga0495660_0001871 3300046810 Bacteria 13814
535 Ga0495660_0001949 3300046810 Bacteria 13431
536 Ga0495660_0004554 3300046810 Bacteria 8372
537 Ga0495660_0009310 3300046810 Bacteria 5727
538 Ga0495660_0009972 3300046810 Bacteria 5526
539 Ga0495660_0010711 3300046810 Bacteria 5328
540 Ga0495660_0013744 3300046810 Bacteria 4692
541 Ga0495660_0020234 3300046810 Bacteria 3814
542 Ga0495660_0037445 3300046810 Bacteria 2701
543 Ga0495660_0066718 3300046810 Bacteria 1918
544 Ga0495660_0071553 3300046810 Bacteria 1838
545 Ga0495660_0100319 3300046810 Bacteria 1491
546 Ga0495660_0101481 3300046810 Bacteria 1480
547 Ga0495604_0004835 3300047317 Bacteria 10676
548 Ga0495604_0042857 3300047317 Bacteria 3544
549 Ga0495636_0008286 3300047318 Bacteria 4103
550 Ga0495674_0010280 3300047319 Bacteria 8862
551 Ga0495672_0001187 3300047320 Bacteria 26409
552 Ga0495672_0001861 3300047320 Bacteria 20089
553 Ga0495672_0002241 3300047320 Bacteria 17992
554 Ga0495672_0002630 3300047320 Bacteria 16221
555 Ga0495672_0004619 3300047320 Bacteria 11174
556 Ga0495672_0008985 3300047320 Bacteria 7292
557 Ga0495672_0009137 3300047320 Bacteria 7224
558 Ga0495672_0009191 3300047320 Bacteria 7197
559 Ga0495672_0033904 3300047320 Bacteria 3160
560 Ga0495672_0034522 3300047320 Bacteria 3124
561 Ga0495672_0051836 3300047320 Bacteria 2414
562 Ga0495672_0061802 3300047320 Bacteria 2157
563 Ga0495672_0102697 3300047320 Bacteria 1547
564 Ga0495672_0171934 3300047320 Bacteria 1104
565 Ga0495676_0024333 3300047321 Bacteria 5244
566 Ga0495676_0037406 3300047321 Bacteria 4039
567 Ga0495680_0008892 3300047322 Bacteria 9079
568 Ga0495680_0040858 3300047322 Bacteria 3691
569 Ga0495680_0158885 3300047322 Bacteria 1642
570 Ga0495680_0305255 3300047322 Bacteria 1116
571 Ga0495683_0000032 3300047323 Bacteria 149612
572 Ga0495683_0000584 3300047323 Bacteria 27512
573 Ga0495683_0000905 3300047323 Bacteria 20921
574 Ga0495683_0011935 3300047323 Bacteria 4567
575 Ga0495683_0017678 3300047323 Bacteria 3693
576 Ga0495683_0022727 3300047323 Bacteria 3224
577 Ga0495687_001410 3300047443 Bacteria 22145
578 Ga0495687_001593 3300047443 Bacteria 20495
579 Ga0495687_001720 3300047443 Bacteria 19389
580 Ga0495675_0007362 3300047444 Bacteria 6780
581 Ga0495675_0195133 3300047444 Bacteria 1234
582 Ga0495677_0001304 3300047445 Bacteria 9965
583 Ga0495679_000721 3300047446 Bacteria 21281
584 Ga0495679_005501 3300047446 Bacteria 5604
585 Ga0495679_006071 3300047446 Bacteria 5271
586 Ga0495679_019394 3300047446 Bacteria 2390
587 Ga0495679_024712 3300047446 Bacteria 2021
588 Ga0495685_038423 3300047447 Bacteria 1640
589 Ga0495673_0001703 3300047469 Bacteria 16856
590 Ga0495673_0001708 3300047469 Bacteria 16794
591 Ga0495673_0001879 3300047469 Bacteria 15762
592 Ga0495673_0002166 3300047469 Bacteria 14269
593 Ga0495673_0003787 3300047469 Bacteria 9785
594 Ga0495673_0004038 3300047469 Bacteria 9351
595 Ga0495673_0004292 3300047469 Bacteria 8987
596 Ga0495673_0005096 3300047469 Bacteria 8029
597 Ga0495673_0005300 3300047469 Bacteria 7825
598 Ga0495673_0011643 3300047469 Bacteria 4718
599 Ga0495673_0050441 3300047469 Bacteria 1826
600 Ga0495673_0061429 3300047469 Bacteria 1608
601 Ga0495681_0001535 3300047470 Bacteria 17232
602 Ga0495681_0002339 3300047470 Bacteria 13621
603 Ga0495681_0002940 3300047470 Bacteria 12036
604 Ga0495681_0004215 3300047470 Bacteria 9862
605 Ga0495681_0005581 3300047470 Bacteria 8396
606 Ga0495681_0014801 3300047470 Bacteria 4451
607 Ga0495681_0015012 3300047470 Bacteria 4403
608 Ga0495681_0022720 3300047470 Bacteria 3350
609 Ga0495681_0041300 3300047470 Bacteria 2239
610 Ga0495681_0048687 3300047470 Bacteria 2007
611 Ga0495684_0025758 3300047471 Bacteria 4519
612 Ga0495686_0005103 3300047472 Bacteria 10496
613 Ga0495686_0006282 3300047472 Bacteria 9139
614 Ga0495686_0015694 3300047472 Bacteria 5161
615 Ga0495593_0067458 3300047673 Bacteria 1862
616 Ga0495602_0030875 3300048088 Bacteria 5074
617 Ga0495626_0000831 3300048091 Bacteria 27665
618 Ga0495626_0001108 3300048091 Bacteria 22736
619 Ga0495626_0002541 3300048091 Bacteria 12532
620 Ga0495626_0005222 3300048091 Bacteria 7688
621 Ga0495626_0006203 3300048091 Bacteria 6831
622 Ga0495626_0016707 3300048091 Bacteria 3721
623 Ga0495626_0053489 3300048091 Bacteria 1857
624 Ga0496102_0002311 3300048905 Bacteria 16292
625 Ga0496103_0002862 3300048906 Bacteria 10730
626 Ga0496116_0002775 3300048919 Bacteria 18000
627 Ga0496116_0004594 3300048919 Bacteria 13090
628 Ga0496116_0006605 3300048919 Bacteria 10494
629 Ga0496116_0007417 3300048919 Bacteria 9732
630 Ga0496116_0014607 3300048919 Bacteria 6260
631 Ga0496117_0005359 3300048920 Bacteria 13510
632 Ga0496117_0031812 3300048920 Bacteria 4023
633 Ga0496117_0211872 3300048920 Bacteria 1085
634 Ga0496117_0211885 3300048920 Bacteria 1085
635 Ga0496118_0007335 3300048921 Bacteria 11728
636 Ga0496118_0007906 3300048921 Bacteria 11136
637 Ga0496118_0009100 3300048921 Bacteria 10111
638 Ga0496118_0036847 3300048921 Bacteria 3947
639 Ga0496118_0079709 3300048921 Bacteria 2309
640 Ga0496118_0156456 3300048921 Bacteria 1417
641 Ga0496119_0000071 3300048922 Bacteria 153652
642 Ga0496120_0002726 3300048923 Bacteria 17252
643 Ga0496121_0007900 3300048924 Bacteria 12731
644 Ga0496121_0037516 3300048924 Bacteria 4303
645 Ga0496122_0002157 3300048925 Bacteria 28836
646 Ga0496122_0006460 3300048925 Bacteria 13445
647 Ga0496122_0010517 3300048925 Bacteria 9515
648 Ga0496122_0037573 3300048925 Bacteria 3894
649 Ga0496122_0094946 3300048925 Bacteria 2017
650 Ga0496123_0001464 3300048926 Bacteria 32764
651 Ga0496123_0011812 3300048926 Bacteria 7519
652 Ga0496123_0016348 3300048926 Bacteria 6033
653 Ga0496123_0049495 3300048926 Bacteria 2817
654 Ga0496123_0143414 3300048926 Bacteria 1301
655 Ga0496124_0000407 3300048927 Bacteria 78013
656 Ga0496124_0005384 3300048927 Bacteria 14446
657 Ga0496124_0006059 3300048927 Bacteria 13308
658 Ga0496124_0015951 3300048927 Bacteria 7171
659 Ga0496124_0022335 3300048927 Bacteria 5801
660 Ga0496124_0039119 3300048927 Bacteria 4113
661 Ga0496124_0039847 3300048927 Bacteria 4068
662 Ga0496124_0188712 3300048927 Bacteria 1579
663 Ga0496124_0352512 3300048927 Bacteria 1040
664 Ga0496125_0002636 3300048928 Bacteria 22968
665 Ga0496125_0002716 3300048928 Bacteria 22480
666 Ga0496125_0017906 3300048928 Bacteria 6736
667 Ga0496126_0062641 3300048929 Bacteria 3336
668 Ga0495678_000541 3300049459 Bacteria 36468
669 Ga0495678_001270 3300049459 Bacteria 20477
670 Ga0495678_001393 3300049459 Bacteria 19214
671 Ga0495678_002041 3300049459 Bacteria 14449
672 Ga0495678_003217 3300049459 Bacteria 10254
673 Ga0495678_008652 3300049459 Bacteria 5116
674 Ga0495678_028588 3300049459 Bacteria 2350
675 Ga0495678_036912 3300049459 Bacteria 1990
676 Ga0495678_052112 3300049459 Bacteria 1577
677 Ga0495682_0001635 3300049460 Bacteria 11536
678 Ga0495682_0003896 3300049460 Bacteria 6520
679 Ga0495682_0022278 3300049460 Bacteria 2369
680 Ga0495682_0055634 3300049460 Bacteria 1434
681 Ga0501032_0041522 3300049569 Bacteria 3123
682 Ga0501033_0093077 3300049570 Bacteria 2204
683 Ga0501034_0041130 3300049571 Bacteria 4676
684 Ga0501034_0150183 3300049571 Bacteria 2306
685 Ga0501034_0179197 3300049571 Bacteria 2084
686 Ga0501037_0101041 3300049573 Bacteria 2082
687 Ga0501035_0204272 3300049822 Bacteria 1693
688 Ga0501226_000065 3300049853 Bacteria 34452
689 nmdc:mga03683_579_c1 3300050489 Bacteria 10505
690 Ga0500572_003770 3300053111 Bacteria 3439
691 Ga0500659_0005178 3300053135 Bacteria 7339
692 Ga0500573_0036557 3300053140 Bacteria 2836
693 Ga0500634_0013813 3300053161 Bacteria 4244

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842815866 2842819367 253
2 iso_pu_bacteria 2842849001 2842852345 253
3 3300046506 Ga0495583_0003018 Ga0495583_0003018_12445_13338 270
4 3300013102 Ga0157371_10002492 Ga0157371_1000249210 271
5 3300013100 Ga0157373_10204153 Ga0157373_102041532 275
6 3300049570 Ga0501033_0093077 Ga0501033_0093077_832_1719 278
7 3300049571 Ga0501034_0179197 Ga0501034_0179197_442_1329 278
8 3300049822 Ga0501035_0204272 Ga0501035_0204272_665_1552 278
9 3300049853 Ga0501226_000065 Ga0501226_000065_10919_11806 278
10 3300042013 Ga0439456_004119 Ga0439456_004119_1505_2392 279
11 3300042115 Ga0450911_000003 Ga0450911_000003_167265_168152 279
12 3300042120 Ga0450917_001206 Ga0450917_001206_716_1603 279
13 3300042530 Ga0450916_000325 Ga0450916_000325_800_1687 279
14 3300048921 Ga0496118_0156456 Ga0496118_0156456_183_1076 279
15 3300048927 Ga0496124_0039847 Ga0496124_0039847_648_1541 279
16 3300025935 Ga0207709_10008628 Ga0207709_100086287 280
17 3300042139 Ga0450904_000051 Ga0450904_000051_2931_3818 280
18 3300042439 Ga0439464_0000142 Ga0439464_0000142_7942_8835 280
19 3300042006 Ga0439432_035953 Ga0439432_035953_304_1197 281
20 3300047323 Ga0495683_0022727 Ga0495683_0022727_511_1356 281
21 iso_pu_bacteria 2643221672 2644398185 281
22 iso_pu_bacteria 2904456579 2904459093 281
23 iso_pu_bacteria 2929520902 2929522408 281
24 3300046458 Ga0495591_001960 Ga0495591_001960_3049_3936 282
25 3300006944 Ga0099823_1001650 Ga0099823_100165010 283
26 3300009036 Ga0105244_10001478 Ga0105244_100014789 283
27 3300009036 Ga0105244_10065901 Ga0105244_100659012 283
28 3300013104 Ga0157370_10133835 Ga0157370_101338352 283
29 3300025711 Ga0207696_1002997 Ga0207696_10029978 283
30 3300025711 Ga0207696_1037243 Ga0207696_10372432 283
31 3300025728 Ga0207655_1000455 Ga0207655_100045510 283
32 3300025728 Ga0207655_1000847 Ga0207655_100084710 283
33 3300027296 Ga0209389_1000095 Ga0209389_10000955 283
34 3300042006 Ga0439432_000859 Ga0439432_000859_4067_4954 283
35 3300046522 Ga0495643_0006720 Ga0495643_0006720_6586_7473 283
36 3300048920 Ga0496117_0031812 Ga0496117_0031812_3059_3946 283
37 3300048921 Ga0496118_0009100 Ga0496118_0009100_3099_3986 283
38 3300048925 Ga0496122_0002157 Ga0496122_0002157_26554_27441 283
39 3300048925 Ga0496122_0094946 Ga0496122_0094946_792_1679 283
40 3300048926 Ga0496123_0001464 Ga0496123_0001464_30482_31369 283
41 3300048927 Ga0496124_0006059 Ga0496124_0006059_8946_9833 283
42 3300049571 Ga0501034_0041130 Ga0501034_0041130_831_1718 283
43 3300053135 Ga0500659_0005178 Ga0500659_0005178_663_1550 283
44 3300032002 Ga0307416_100162343 Ga0307416_1001623432 284
45 3300046522 Ga0495643_0001214 Ga0495643_0001214_14616_15506 284
46 iso_pu_bacteria 2904449895 2904453576 284
47 3300003792 Ga0055540_1001425 Ga0055540_100142510 285
48 3300005289 Ga0065704_10001207 Ga0065704_100012079 285
49 3300006177 Ga0075362_10001209 Ga0075362_100012095 285
50 3300014497 Ga0182008_10014722 Ga0182008_100147223 285
51 3300015261 Ga0182006_1033011 Ga0182006_10330114 285
52 3300025303 Ga0209051_1000144 Ga0209051_1000144110 285
53 3300025711 Ga0207696_1000064 Ga0207696_100006490 285
54 3300025728 Ga0207655_1032389 Ga0207655_10323892 285
55 3300025735 Ga0207713_1015928 Ga0207713_10159283 285
56 3300031548 Ga0307408_100001812 Ga0307408_1000018128 285
57 3300031731 Ga0307405_10431161 Ga0307405_104311612 285
58 3300031901 Ga0307406_10000970 Ga0307406_100009706 285
59 3300046515 Ga0495620_0001871 Ga0495620_0001871_11430_12320 285
60 3300046519 Ga0495632_0070666 Ga0495632_0070666_38_928 285
61 3300046524 Ga0495648_0094826 Ga0495648_0094826_39_929 285
62 3300048920 Ga0496117_0005359 Ga0496117_0005359_9583_10470 285
63 3300048921 Ga0496118_0036847 Ga0496118_0036847_93_980 285
64 3300048926 Ga0496123_0049495 Ga0496123_0049495_232_1119 285
65 3300048927 Ga0496124_0015951 Ga0496124_0015951_6197_7084 285
66 3300048928 Ga0496125_0002636 Ga0496125_0002636_12650_13537 285
67 3300048929 Ga0496126_0062641 Ga0496126_0062641_1706_2593 285
68 3300050489 nmdc:mga03683_579_c1 nmdc:mga03683_579_c1_7756_8628 285
69 3300003578 Ga0006562J51391_1056221 Ga0006562J51391_10562212 286
70 3300003578 Ga0006562J51391_1056222 Ga0006562J51391_10562228 286
71 3300025292 Ga0209676_1000917 Ga0209676_100091726 286
72 3300041405 Ga0439438_000779 Ga0439438_000779_8766_9662 286
73 3300044712 Ga0453684_0052308 Ga0453684_0052308_190_1098 286
74 3300048927 Ga0496124_0039119 Ga0496124_0039119_415_1302 286
75 3300037471 Ga0395905_0010256 Ga0395905_0010256_2385_3281 287
76 3300047320 Ga0495672_0001187 Ga0495672_0001187_1552_2418 287
77 iso_pu_bacteria 2917832318 2917834574 287
78 iso_pu_bacteria 2919125081 2919127218 287
79 iso_pu_bacteria 2984504281 2984506952 287
80 iso_pu_bacteria 2599185167 2599400758 288
81 iso_pu_bacteria 2599185179 2599450085 288
82 iso_pu_bacteria 2599185190 2599512157 288
83 iso_pu_bacteria 2599185191 2599517138 288
84 iso_pu_bacteria 2599185288 2599878821 288
85 iso_pu_bacteria 2599185290 2599892481 288
86 iso_pu_bacteria 2738541294 2738807038 288
87 iso_pu_bacteria 2738541309 2738894398 288
88 iso_pu_bacteria 2947233263 2947234205 288
89 iso_pu_bacteria 8056148874 8056151716 288
90 iso_pu_bacteria 2510065053 2510285356 289
91 iso_pu_bacteria 2510065055 2510294772 289
92 iso_pu_bacteria 2510065058 2510311368 289
93 iso_pu_bacteria 2773857672 2774129606 289
94 iso_pu_bacteria 2919155634 2919155733 289
95 iso_pu_bacteria 2974298342 2974301993 289
96 iso_pu_bacteria 2984499530 2984500439 289
97 iso_pu_bacteria 8011350971 8011352503 289
98 iso_pu_bacteria 2511231007 2511270896 290
99 iso_pu_bacteria 2597489888 2597866412 290
100 iso_pu_bacteria 2597489889 2597872255 290
101 iso_pu_bacteria 2599185189 2599505542 290
102 iso_pu_bacteria 2600255296 2601693654 290
103 iso_pu_bacteria 2623620446 2624494720 290
104 iso_pu_bacteria 2721755607 2723251151 290
105 iso_pu_bacteria 2808606373 2808906349 290
106 iso_pu_bacteria 2842826826 2842829224 290
107 iso_pu_bacteria 2842837860 2842842073 290
108 iso_pu_bacteria 2919501602 2919505669 290
109 iso_pu_bacteria 2919697872 2919700784 290
110 iso_pu_bacteria 2926063275 2926068053 290
111 iso_pu_bacteria 2929189879 2929194933 290
112 iso_pu_bacteria 8019775933 8019777892 290
113 iso_pu_bacteria 8054347763 8054349792 290
114 iso_pu_bacteria 8056155041 8056160631 290
115 iso_pu_bacteria 2511231006 2511265662 291
116 iso_pu_bacteria 2511231008 2511279504 291
117 iso_pu_bacteria 2511231011 2511294543 291
118 iso_pu_bacteria 2511231012 2511304699 291
119 iso_pu_bacteria 2511231014 2511311273 291
120 iso_pu_bacteria 2511231015 2511318009 291
121 iso_pu_bacteria 2511231017 2511333215 291
122 iso_pu_bacteria 2511231020 2511349274 291
123 iso_pu_bacteria 2511231021 2511355360 291
124 iso_pu_bacteria 2511231023 2511367081 291
125 iso_pu_bacteria 2511231024 2511376013 291
126 iso_pu_bacteria 2511231031 2511411566 291
127 iso_pu_bacteria 2512047018 2512327592 291
128 iso_pu_bacteria 2554235231 2555247811 291
129 iso_pu_bacteria 2582580891 2583795157 291
130 iso_pu_bacteria 2597489887 2597860674 291
131 iso_pu_bacteria 2599185155 2599330728 291
132 iso_pu_bacteria 2599185185 2599486093 291
133 iso_pu_bacteria 2599185257 2599804874 291
134 iso_pu_bacteria 2599185303 2599951033 291
135 iso_pu_bacteria 2599185307 2599975156 291
136 iso_pu_bacteria 2619619299 2621297052 291
137 iso_pu_bacteria 2623620443 2624483195 291
138 iso_pu_bacteria 2643221565 2643842759 291
139 iso_pu_bacteria 2643221571 2643872049 291
140 iso_pu_bacteria 2643221589 2643955845 291
141 iso_pu_bacteria 2643221602 2644020639 291
142 iso_pu_bacteria 2643221633 2644186155 291
143 iso_pu_bacteria 2671180172 2671771881 291
144 iso_pu_bacteria 2675903420 2677896914 291
145 iso_pu_bacteria 2713897148 2715750036 291
146 iso_pu_bacteria 2718217725 2718636398 291
147 iso_pu_bacteria 2738541265 2738671873 291
148 iso_pu_bacteria 2738541271 2738690246 291
149 iso_pu_bacteria 2738541282 2738750267 291
150 iso_pu_bacteria 2738541303 2738859307 291
151 iso_pu_bacteria 2738543004 2739198846 291
152 iso_pu_bacteria 2738543015 2739261575 291
153 iso_pu_bacteria 2738543016 2739266020 291
154 iso_pu_bacteria 2738543020 2739289708 291
155 iso_pu_bacteria 2738543021 2739295020 291
156 iso_pu_bacteria 2738543025 2739312727 291
157 iso_pu_bacteria 2740892503 2743740221 291
158 iso_pu_bacteria 2765235841 2765586420 291
159 iso_pu_bacteria 2773857670 2774118597 291
160 iso_pu_bacteria 2773857673 2774135784 291
161 iso_pu_bacteria 2784132063 2784262037 291
162 iso_pu_bacteria 2784132072 2784313270 291
163 iso_pu_bacteria 2806310737 2807410665 291
164 iso_pu_bacteria 2806310745 2807459006 291
165 iso_pu_bacteria 2808606377 2808928664 291
166 iso_pu_bacteria 2808606381 2808950153 291
167 iso_pu_bacteria 2808606385 2808975928 291
168 iso_pu_bacteria 2808606388 2808993037 291
169 iso_pu_bacteria 2811994881 2812369281 291
170 iso_pu_bacteria 2816332298 2817493834 291
171 iso_pu_bacteria 2818991456 2819654917 291
172 iso_pu_bacteria 2823421272 2823421792 291
173 iso_pu_bacteria 2826581358 2826582010 291
174 iso_pu_bacteria 2834028612 2834030741 291
175 iso_pu_bacteria 2842832357 2842833256 291
176 iso_pu_bacteria 2842843487 2842845484 291
177 iso_pu_bacteria 2852612431 2852616139 291
178 iso_pu_bacteria 2852657418 2852662464 291
179 iso_pu_bacteria 2852667396 2852671107 291
180 iso_pu_bacteria 2860339153 2860341501 291
181 iso_pu_bacteria 2880230671 2880235780 291
182 iso_pu_bacteria 2904518522 2904519169 291
183 iso_pu_bacteria 2904550169 2904552198 291
184 iso_pu_bacteria 2908446538 2908452355 291
185 iso_pu_bacteria 2912963787 2912968699 291
186 iso_pu_bacteria 2919063839 2919065740 291
187 iso_pu_bacteria 2919385768 2919389405 291
188 iso_pu_bacteria 2919456309 2919457336 291
189 iso_pu_bacteria 2919487758 2919488370 291
190 iso_pu_bacteria 2923153595 2923159313 291
191 iso_pu_bacteria 2923519811 2923523366 291
192 iso_pu_bacteria 2931390751 2931396204 291
193 iso_pu_bacteria 2931396565 2931397854 291
194 iso_pu_bacteria 2939636861 2939642082 291
195 iso_pu_bacteria 2939651529 2939654039 291
196 iso_pu_bacteria 2945928738 2945931128 291
197 iso_pu_bacteria 2945961074 2945966625 291
198 iso_pu_bacteria 2946006987 2946007153 291
199 iso_pu_bacteria 2946027586 2946027692 291
200 iso_pu_bacteria 2969304461 2969309960 291
201 iso_pu_bacteria 2974289157 2974294291 291
202 iso_pu_bacteria 2990196909 2990199557 291
203 iso_pu_bacteria 2998139840 2998145186 291
204 iso_pu_bacteria 3007252601 3007254680 291
205 iso_pu_bacteria 3007315729 3007316542 291
206 iso_pu_bacteria 3007614139 3007616544 291
207 iso_pu_bacteria 3007718800 3007719297 291
208 iso_pu_bacteria 3007803356 3007805369 291
209 iso_pu_bacteria 3007855910 3007858103 291
210 iso_pu_bacteria 3007872151 3007872404 291
211 iso_pu_bacteria 8015687852 8015693402 291
212 iso_pu_bacteria 8029995093 8029995710 291
213 iso_pu_bacteria 8034962539 8034966408 291
214 iso_pu_bacteria 8052494512 8052499634 291
215 iso_pu_bacteria 8054285046 8054291592 291
216 iso_pu_bacteria 8054503363 8054508705 291
217 iso_pu_bacteria 8054929484 8054934191 291
218 iso_pu_bacteria 8055770955 8055776653 291
219 iso_pu_bacteria 8055817908 8055823679 291
220 iso_pu_bacteria 8056115690 8056115957 291
221 iso_pu_bacteria 8056120720 8056121089 291
222 iso_pu_bacteria 8056125926 8056131396 291
223 iso_pu_bacteria 8056131705 8056137106 291
224 iso_pu_bacteria 8056137416 8056137806 291
225 iso_pu_bacteria 8056161164 8056163405 291
226 iso_pu_bacteria 8056166840 8056171382 291
227 iso_pu_bacteria 8056172158 8056177626 291
228 iso_pu_bacteria 8056177738 8056181792 291
229 iso_pu_bacteria 8056569372 8056570253 291
230 3300005578 Ga0068854_100003965 Ga0068854_1000039655 292
231 3300013105 Ga0157369_10057638 Ga0157369_100576385 292
232 3300015261 Ga0182006_1001598 Ga0182006_10015989 292
233 3300025735 Ga0207713_1001139 Ga0207713_100113920 292
234 3300031731 Ga0307405_10019766 Ga0307405_100197664 292
235 3300031911 Ga0307412_10024028 Ga0307412_100240284 292
236 3300046463 Ga0495653_0002339 Ga0495653_0002339_12682_13560 292
237 3300046492 Ga0495585_0000705 Ga0495585_0000705_26183_27061 292
238 3300046507 Ga0495606_0018269 Ga0495606_0018269_2726_3604 292
239 3300046507 Ga0495606_0022823 Ga0495606_0022823_2625_3503 292
240 3300046518 Ga0495631_0100615 Ga0495631_0100615_273_1151 292
241 3300046665 Ga0495661_0000027 Ga0495661_0000027_27746_28624 292
242 3300047470 Ga0495681_0015012 Ga0495681_0015012_497_1375 292
243 3300049459 Ga0495678_008652 Ga0495678_008652_819_1697 292
244 3300005288 Ga0065714_10079851 Ga0065714_100798513 293
245 3300009011 Ga0105251_10001642 Ga0105251_100016429 293
246 3300009036 Ga0105244_10082667 Ga0105244_100826672 293
247 3300013105 Ga0157369_10007915 Ga0157369_1000791510 293
248 3300013307 Ga0157372_10012514 Ga0157372_100125143 293
249 3300013307 Ga0157372_10059867 Ga0157372_100598672 293
250 3300025728 Ga0207655_1017834 Ga0207655_10178342 293
251 3300025735 Ga0207713_1008495 Ga0207713_10084952 293
252 3300027312 Ga0209371_1004519 Ga0209371_10045196 293
253 3300030500 Ga0268256_1003588 Ga0268256_10035882 293
254 3300039110 Ga0400487_09819 Ga0400487_09819_107_1006 293
255 3300046491 Ga0495584_0007191 Ga0495584_0007191_562_1443 293
256 3300048922 Ga0496119_0000071 Ga0496119_0000071_115936_116817 293
257 3300048923 Ga0496120_0002726 Ga0496120_0002726_3296_4177 293
258 3300002738 JGI25154J39366_1005394 JGI25154J39366_10053941 294
259 3300003751 Ga0055538_1000074 Ga0055538_100007468 294
260 3300003752 Ga0055539_1000112 Ga0055539_100011268 294
261 3300003756 Ga0055533_1000118 Ga0055533_100011868 294
262 3300003758 Ga0055532_1000106 Ga0055532_100010615 294
263 3300003759 Ga0055525_1000157 Ga0055525_100015715 294
264 3300003761 Ga0055535_1002953 Ga0055535_10029535 294
265 3300003841 Ga0055541_1000075 Ga0055541_100007568 294
266 3300005288 Ga0065714_10006723 Ga0065714_100067232 294
267 3300006058 Ga0075432_10009609 Ga0075432_100096093 294
268 3300009036 Ga0105244_10037387 Ga0105244_100373872 294
269 3300014497 Ga0182008_10018747 Ga0182008_100187474 294
270 3300014497 Ga0182008_10021787 Ga0182008_100217872 294
271 3300015261 Ga0182006_1001586 Ga0182006_10015864 294
272 3300015262 Ga0182007_10001004 Ga0182007_1000100411 294
273 3300015265 Ga0182005_1003776 Ga0182005_10037762 294
274 3300025224 Ga0209784_100007 Ga0209784_100007596 294
275 3300025225 Ga0209566_100062 Ga0209566_10006281 294
276 3300025226 Ga0209674_100132 Ga0209674_10013215 294
277 3300025229 Ga0209147_100009 Ga0209147_100009596 294
278 3300025230 Ga0209563_100018 Ga0209563_100018596 294
279 3300025242 Ga0209258_100330 Ga0209258_10033039 294
280 3300025246 Ga0209646_1000185 Ga0209646_100018510 294
281 3300025253 Ga0209677_100056 Ga0209677_10005681 294
282 3300025256 Ga0209759_1014981 Ga0209759_10149811 294
283 3300025728 Ga0207655_1002303 Ga0207655_10023032 294
284 3300028573 Ga0265334_10000011 Ga0265334_10000011104 294
285 3300037068 Ga0373925_0199427 Ga0373925_0199427_117_1019 294
286 3300042006 Ga0439432_009057 Ga0439432_009057_2386_3270 294
287 3300042009 Ga0439451_005341 Ga0439451_005341_449_1336 294
288 3300046452 Ga0495617_000582 Ga0495617_000582_5397_6281 294
289 3300046457 Ga0495590_0001252 Ga0495590_0001252_5303_6187 294
290 3300046475 Ga0495639_0000577 Ga0495639_0000577_6666_7550 294
291 3300046491 Ga0495584_0001354 Ga0495584_0001354_7463_8347 294
292 3300046491 Ga0495584_0031642 Ga0495584_0031642_937_1821 294
293 3300046501 Ga0495607_0001688 Ga0495607_0001688_7561_8445 294
294 3300046501 Ga0495607_0004123 Ga0495607_0004123_8158_9042 294
295 3300046506 Ga0495583_0053729 Ga0495583_0053729_555_1439 294
296 3300046513 Ga0495616_0002193 Ga0495616_0002193_2758_3642 294
297 3300046519 Ga0495632_0002244 Ga0495632_0002244_8381_9265 294
298 3300046520 Ga0495637_0020252 Ga0495637_0020252_2115_2999 294
299 3300046528 Ga0495642_0000574 Ga0495642_0000574_15106_15990 294
300 3300046530 Ga0495654_0002168 Ga0495654_0002168_2554_3438 294
301 3300046530 Ga0495654_0023761 Ga0495654_0023761_1557_2441 294
302 3300046538 Ga0495609_0012057 Ga0495609_0012057_2932_3816 294
303 3300046538 Ga0495609_0016335 Ga0495609_0016335_732_1616 294
304 3300046557 Ga0495622_0000871 Ga0495622_0000871_9490_10374 294
305 3300046660 Ga0495625_0015095 Ga0495625_0015095_1259_2143 294
306 3300046660 Ga0495625_0055556 Ga0495625_0055556_1100_1984 294
307 3300046691 Ga0495670_0000898 Ga0495670_0000898_6184_7068 294
308 3300046692 Ga0495671_0003121 Ga0495671_0003121_912_1796 294
309 3300046694 Ga0495649_0000950 Ga0495649_0000950_5078_5962 294
310 3300046794 Ga0495589_0013075 Ga0495589_0013075_1019_1903 294
311 3300046810 Ga0495660_0037445 Ga0495660_0037445_737_1621 294
312 3300047318 Ga0495636_0008286 Ga0495636_0008286_2932_3816 294
313 3300047320 Ga0495672_0061802 Ga0495672_0061802_288_1172 294
314 3300047320 Ga0495672_0102697 Ga0495672_0102697_576_1460 294
315 3300047323 Ga0495683_0017678 Ga0495683_0017678_1743_2627 294
316 3300047443 Ga0495687_001720 Ga0495687_001720_1696_2580 294
317 3300047469 Ga0495673_0003787 Ga0495673_0003787_5970_6854 294
318 3300048091 Ga0495626_0002541 Ga0495626_0002541_9517_10401 294
319 3300048091 Ga0495626_0006203 Ga0495626_0006203_2425_3309 294
320 3300048919 Ga0496116_0006605 Ga0496116_0006605_2124_3008 294
321 3300048924 Ga0496121_0037516 Ga0496121_0037516_637_1521 294
322 3300048925 Ga0496122_0006460 Ga0496122_0006460_3619_4503 294
323 3300049459 Ga0495678_001270 Ga0495678_001270_2572_3456 294
324 3300049459 Ga0495678_002041 Ga0495678_002041_6354_7238 294
325 2124908027 MRS2a_Contig_1749 MRS2a_00606860 295
326 3300001915 JGI24741J21665_1002957 JGI24741J21665_10029573 295
327 3300002737 JGI25162J39368_1000076 JGI25162J39368_100007660 295
328 3300002737 JGI25162J39368_1000104 JGI25162J39368_100010468 295
329 3300002771 JGI25163J39215_1000198 JGI25163J39215_10001989 295
330 3300002772 JGI25164J39214_1000083 JGI25164J39214_100008319 295
331 3300002772 JGI25164J39214_1000084 JGI25164J39214_100008460 295
332 3300003214 JGI25165J46597_1000140 JGI25165J46597_100014045 295
333 3300003214 JGI25165J46597_1000186 JGI25165J46597_100018668 295
334 3300003781 Ga0055536_1000289 Ga0055536_100028919 295
335 3300003781 Ga0055536_1000620 Ga0055536_100062015 295
336 3300003781 Ga0055536_1000625 Ga0055536_10006259 295
337 3300003791 Ga0055530_10000389 Ga0055530_100003899 295
338 3300003791 Ga0055530_10000757 Ga0055530_1000075710 295
339 3300003791 Ga0055530_10001107 Ga0055530_1000110715 295
340 3300003792 Ga0055540_1000259 Ga0055540_100025925 295
341 3300003792 Ga0055540_1000366 Ga0055540_100036619 295
342 3300003794 Ga0055531_10000109 Ga0055531_1000010910 295
343 3300003856 Ga0058692_1010636 Ga0058692_10106363 295
344 3300005288 Ga0065714_10000526 Ga0065714_100005264 295
345 3300005288 Ga0065714_10095472 Ga0065714_100954722 295
346 3300005289 Ga0065704_10079943 Ga0065704_100799434 295
347 3300005290 Ga0065712_10017828 Ga0065712_100178282 295
348 3300005331 Ga0070670_100000368 Ga0070670_10000036835 295
349 3300005331 Ga0070670_100056184 Ga0070670_1000561843 295
350 3300005344 Ga0070661_100000038 Ga0070661_10000003855 295
351 3300005353 Ga0070669_100000626 Ga0070669_10000062610 295
352 3300005353 Ga0070669_100003116 Ga0070669_1000031165 295
353 3300005457 Ga0070662_100000787 Ga0070662_10000078710 295
354 3300005457 Ga0070662_100032555 Ga0070662_1000325553 295
355 3300005539 Ga0068853_100000155 Ga0068853_10000015531 295
356 3300005548 Ga0070665_100011929 Ga0070665_1000119298 295
357 3300005548 Ga0070665_100080326 Ga0070665_1000803264 295
358 3300005564 Ga0070664_100001315 Ga0070664_10000131515 295
359 3300005564 Ga0070664_100038811 Ga0070664_1000388115 295
360 3300005834 Ga0068851_10000012 Ga0068851_1000001241 295
361 3300006051 Ga0075364_10093140 Ga0075364_100931402 295
362 3300006051 Ga0075364_10286262 Ga0075364_102862622 295
363 3300006058 Ga0075432_10002115 Ga0075432_100021155 295
364 3300006177 Ga0075362_10023071 Ga0075362_100230713 295
365 3300006946 Ga0079104_1000752 Ga0079104_100075218 295
366 3300009011 Ga0105251_10000019 Ga0105251_1000001966 295
367 3300009011 Ga0105251_10001508 Ga0105251_100015085 295
368 3300009011 Ga0105251_10001556 Ga0105251_1000155615 295
369 3300009011 Ga0105251_10002891 Ga0105251_100028918 295
370 3300009011 Ga0105251_10014004 Ga0105251_100140042 295
371 3300009036 Ga0105244_10000150 Ga0105244_1000015061 295
372 3300009036 Ga0105244_10000711 Ga0105244_100007116 295
373 3300009036 Ga0105244_10006568 Ga0105244_100065684 295
374 3300009036 Ga0105244_10007253 Ga0105244_100072536 295
375 3300009036 Ga0105244_10061700 Ga0105244_100617002 295
376 3300009036 Ga0105244_10069185 Ga0105244_100691853 295
377 3300009092 Ga0105250_10000519 Ga0105250_1000051924 295
378 3300009092 Ga0105250_10000752 Ga0105250_1000075213 295
379 3300009092 Ga0105250_10023832 Ga0105250_100238322 295
380 3300009092 Ga0105250_10053748 Ga0105250_100537481 295
381 3300009148 Ga0105243_10119166 Ga0105243_101191663 295
382 3300009176 Ga0105242_10000169 Ga0105242_1000016916 295
383 3300009176 Ga0105242_10030577 Ga0105242_100305776 295
384 3300009177 Ga0105248_10232939 Ga0105248_102329393 295
385 3300009545 Ga0105237_10005893 Ga0105237_100058938 295
386 3300011119 Ga0105246_10000617 Ga0105246_1000061715 295
387 3300011119 Ga0105246_10001973 Ga0105246_100019739 295
388 3300012498 Ga0157345_1000021 Ga0157345_100002130 295
389 3300013100 Ga0157373_10001281 Ga0157373_100012817 295
390 3300013100 Ga0157373_10004690 Ga0157373_100046904 295
391 3300013100 Ga0157373_10023736 Ga0157373_100237362 295
392 3300013100 Ga0157373_10043580 Ga0157373_100435802 295
393 3300013100 Ga0157373_10106007 Ga0157373_101060072 295
394 3300013100 Ga0157373_10138254 Ga0157373_101382542 295
395 3300013102 Ga0157371_10001747 Ga0157371_100017479 295
396 3300013102 Ga0157371_10006333 Ga0157371_100063337 295
397 3300013104 Ga0157370_10016538 Ga0157370_100165384 295
398 3300013104 Ga0157370_10067825 Ga0157370_100678252 295
399 3300013105 Ga0157369_10006372 Ga0157369_1000637212 295
400 3300013105 Ga0157369_10028628 Ga0157369_100286284 295
401 3300013105 Ga0157369_10073051 Ga0157369_100730513 295
402 3300013306 Ga0163162_10001061 Ga0163162_1000106115 295
403 3300013306 Ga0163162_10240437 Ga0163162_102404372 295
404 3300013307 Ga0157372_10022580 Ga0157372_100225805 295
405 3300013308 Ga0157375_10005580 Ga0157375_100055806 295
406 3300013308 Ga0157375_10069687 Ga0157375_100696874 295
407 3300014497 Ga0182008_10006385 Ga0182008_100063855 295
408 3300014497 Ga0182008_10023826 Ga0182008_100238262 295
409 3300014497 Ga0182008_10030419 Ga0182008_100304193 295
410 3300014497 Ga0182008_10034988 Ga0182008_100349885 295
411 3300015261 Ga0182006_1001027 Ga0182006_10010278 295
412 3300015261 Ga0182006_1023686 Ga0182006_10236863 295
413 3300015261 Ga0182006_1035592 Ga0182006_10355922 295
414 3300015262 Ga0182007_10000408 Ga0182007_1000040823 295
415 3300015265 Ga0182005_1002494 Ga0182005_10024947 295
416 3300015265 Ga0182005_1003495 Ga0182005_10034956 295
417 3300015265 Ga0182005_1017337 Ga0182005_10173371 295
418 3300015265 Ga0182005_1023792 Ga0182005_10237922 295
419 3300017792 Ga0163161_10001087 Ga0163161_1000108715 295
420 3300017792 Ga0163161_10044753 Ga0163161_100447534 295
421 3300017792 Ga0163161_10107479 Ga0163161_101074793 295
422 3300017792 Ga0163161_10339589 Ga0163161_103395891 295
423 3300017792 Ga0163161_10425647 Ga0163161_104256471 295
424 3300025207 Ga0209760_100098 Ga0209760_10009813 295
425 3300025207 Ga0209760_100274 Ga0209760_10027410 295
426 3300025231 Ga0207427_100005 Ga0207427_100005109 295
427 3300025231 Ga0207427_100006 Ga0207427_100006647 295
428 3300025233 Ga0209437_100013 Ga0209437_100013647 295
429 3300025233 Ga0209437_100018 Ga0209437_10001819 295
430 3300025261 Ga0209233_1000021 Ga0209233_1000021109 295
431 3300025261 Ga0209233_1000022 Ga0209233_1000022647 295
432 3300025292 Ga0209676_1000015 Ga0209676_1000015627 295
433 3300025292 Ga0209676_1000030 Ga0209676_100003056 295
434 3300025292 Ga0209676_1000041 Ga0209676_1000041380 295
435 3300025298 Ga0209050_1000075 Ga0209050_100007566 295
436 3300025298 Ga0209050_1000128 Ga0209050_1000128101 295
437 3300025298 Ga0209050_1001373 Ga0209050_100137314 295
438 3300025303 Ga0209051_1000012 Ga0209051_100001256 295
439 3300025303 Ga0209051_1000041 Ga0209051_100004199 295
440 3300025303 Ga0209051_1009490 Ga0209051_10094907 295
441 3300025304 Ga0209257_1000069 Ga0209257_1000069210 295
442 3300025321 Ga0207656_10000006 Ga0207656_10000006275 295
443 3300025711 Ga0207696_1000031 Ga0207696_100003119 295
444 3300025711 Ga0207696_1000094 Ga0207696_1000094108 295
445 3300025711 Ga0207696_1000095 Ga0207696_100009595 295
446 3300025711 Ga0207696_1000149 Ga0207696_100014954 295
447 3300025711 Ga0207696_1008634 Ga0207696_10086344 295
448 3300025711 Ga0207696_1017447 Ga0207696_10174471 295
449 3300025728 Ga0207655_1000107 Ga0207655_100010753 295
450 3300025728 Ga0207655_1000992 Ga0207655_10009929 295
451 3300025728 Ga0207655_1001195 Ga0207655_10011959 295
452 3300025728 Ga0207655_1001311 Ga0207655_100131114 295
453 3300025728 Ga0207655_1012388 Ga0207655_10123885 295
454 3300025728 Ga0207655_1012657 Ga0207655_10126574 295
455 3300025728 Ga0207655_1013711 Ga0207655_10137112 295
456 3300025728 Ga0207655_1031824 Ga0207655_10318243 295
457 3300025735 Ga0207713_1000010 Ga0207713_1000010114 295
458 3300025735 Ga0207713_1001437 Ga0207713_100143710 295
459 3300025735 Ga0207713_1001904 Ga0207713_10019045 295
460 3300025735 Ga0207713_1002108 Ga0207713_100210811 295
461 3300025735 Ga0207713_1002895 Ga0207713_10028955 295
462 3300025735 Ga0207713_1011728 Ga0207713_10117284 295
463 3300025735 Ga0207713_1013045 Ga0207713_10130452 295
464 3300025735 Ga0207713_1024358 Ga0207713_10243582 295
465 3300025914 Ga0207671_10000299 Ga0207671_1000029959 295
466 3300025920 Ga0207649_10000022 Ga0207649_10000022125 295
467 3300025923 Ga0207681_10000422 Ga0207681_1000042215 295
468 3300025923 Ga0207681_10002906 Ga0207681_100029065 295
469 3300025925 Ga0207650_10000138 Ga0207650_1000013832 295
470 3300025925 Ga0207650_10000159 Ga0207650_1000015970 295
471 3300025933 Ga0207706_10000290 Ga0207706_1000029035 295
472 3300025933 Ga0207706_10004400 Ga0207706_100044007 295
473 3300025934 Ga0207686_10000305 Ga0207686_100003059 295
474 3300025934 Ga0207686_10171489 Ga0207686_101714892 295
475 3300025935 Ga0207709_10000086 Ga0207709_1000008661 295
476 3300025941 Ga0207711_10158830 Ga0207711_101588302 295
477 3300025945 Ga0207679_10000027 Ga0207679_1000002777 295
478 3300026041 Ga0207639_10001167 Ga0207639_1000116713 295
479 3300027111 Ga0209281_1000016 Ga0209281_1000016106 295
480 3300027111 Ga0209281_1001719 Ga0209281_10017196 295
481 3300027312 Ga0209371_1000066 Ga0209371_1000066172 295
482 3300027907 Ga0207428_10011576 Ga0207428_100115764 295
483 3300027907 Ga0207428_10042461 Ga0207428_100424611 295
484 3300027907 Ga0207428_10049641 Ga0207428_100496415 295
485 3300027907 Ga0207428_10049870 Ga0207428_100498703 295
486 3300027907 Ga0207428_10082591 Ga0207428_100825913 295
487 3300027907 Ga0207428_10158677 Ga0207428_101586771 295
488 3300027907 Ga0207428_10177269 Ga0207428_101772692 295
489 3300028379 Ga0268266_10006578 Ga0268266_100065783 295
490 3300030500 Ga0268256_1000063 Ga0268256_1000063172 295
491 3300030521 Ga0307511_10040857 Ga0307511_100408575 295
492 3300030734 Ga0316179_1031537 Ga0316179_10315371 295
493 3300030735 Ga0316178_1083275 Ga0316178_108327544 295
494 3300031548 Ga0307408_100000019 Ga0307408_10000001918 295
495 3300031548 Ga0307408_100127531 Ga0307408_1001275311 295
496 3300031824 Ga0307413_10132296 Ga0307413_101322962 295
497 3300031911 Ga0307412_10151144 Ga0307412_101511442 295
498 3300031995 Ga0307409_100020735 Ga0307409_1000207355 295
499 3300032004 Ga0307414_10077621 Ga0307414_100776213 295
500 3300032005 Ga0307411_10003310 Ga0307411_100033105 295
501 3300032005 Ga0307411_10204196 Ga0307411_102041962 295
502 3300033180 Ga0307510_10002877 Ga0307510_1000287711 295
503 3300038705 Ga0237819_00209 Ga0237819_00209_19364_20251 295
504 3300041404 Ga0439436_0003377 Ga0439436_0003377_2430_3323 295
505 3300041405 Ga0439438_000931 Ga0439438_000931_7300_8187 295
506 3300041405 Ga0439438_012440 Ga0439438_012440_1197_2090 295
507 3300041407 Ga0439447_023349 Ga0439447_023349_566_1459 295
508 3300041411 Ga0439466_0001641 Ga0439466_0001641_4143_5030 295
509 3300041411 Ga0439466_0003559 Ga0439466_0003559_3787_4680 295
510 3300041411 Ga0439466_0011358 Ga0439466_0011358_335_1234 295
511 3300042006 Ga0439432_003308 Ga0439432_003308_4128_5021 295
512 3300042006 Ga0439432_014193 Ga0439432_014193_719_1606 295
513 3300042010 Ga0439452_000507 Ga0439452_000507_12844_13731 295
514 3300042010 Ga0439452_000648 Ga0439452_000648_7884_8771 295
515 3300042010 Ga0439452_003067 Ga0439452_003067_2612_3505 295
516 3300042013 Ga0439456_000068 Ga0439456_000068_26624_27511 295
517 3300042013 Ga0439456_002218 Ga0439456_002218_1720_2607 295
518 3300042016 Ga0439463_000149 Ga0439463_000149_2986_3879 295
519 3300042016 Ga0439463_000438 Ga0439463_000438_1849_2736 295
520 3300042115 Ga0450911_000581 Ga0450911_000581_1995_2882 295
521 3300042124 Ga0450922_000034 Ga0450922_000034_9325_10212 295
522 3300042125 Ga0450923_000592 Ga0450923_000592_1002_1895 295
523 3300042139 Ga0450904_000479 Ga0450904_000479_1222_2109 295
524 3300042145 Ga0450906_007442 Ga0450906_007442_134_1021 295
525 3300042146 Ga0450907_000760 Ga0450907_000760_5670_6557 295
526 3300042156 Ga0439446_0002675 Ga0439446_0002675_2504_3397 295
527 3300042184 Ga0450908_003667 Ga0450908_003667_1704_2591 295
528 3300042461 Ga0439460_0003661 Ga0439460_0003661_2390_3277 295
529 3300042993 Ga0439440_0001743 Ga0439440_0001743_914_1801 295
530 3300046452 Ga0495617_002152 Ga0495617_002152_1242_2129 295
531 3300046452 Ga0495617_010002 Ga0495617_010002_342_1229 295
532 3300046452 Ga0495617_027341 Ga0495617_027341_869_1756 295
533 3300046452 Ga0495617_031435 Ga0495617_031435_723_1745 295
534 3300046453 Ga0495627_000023 Ga0495627_000023_209046_209939 295
535 3300046453 Ga0495627_000134 Ga0495627_000134_15061_15951 295
536 3300046453 Ga0495627_001005 Ga0495627_001005_8567_9454 295
537 3300046453 Ga0495627_002276 Ga0495627_002276_6507_7394 295
538 3300046453 Ga0495627_004374 Ga0495627_004374_2641_3528 295
539 3300046453 Ga0495627_014907 Ga0495627_014907_20_907 295
540 3300046455 Ga0495603_0063755 Ga0495603_0063755_1086_1973 295
541 3300046457 Ga0495590_0000356 Ga0495590_0000356_15756_16643 295
542 3300046457 Ga0495590_0056514 Ga0495590_0056514_447_1334 295
543 3300046458 Ga0495591_000025 Ga0495591_000025_149875_150828 295
544 3300046458 Ga0495591_000728 Ga0495591_000728_15701_16588 295
545 3300046458 Ga0495591_000970 Ga0495591_000970_2650_3537 295
546 3300046458 Ga0495591_001914 Ga0495591_001914_3547_4434 295
547 3300046458 Ga0495591_003795 Ga0495591_003795_6189_7076 295
548 3300046458 Ga0495591_006789 Ga0495591_006789_4000_4887 295
549 3300046458 Ga0495591_012572 Ga0495591_012572_2025_2912 295
550 3300046458 Ga0495591_017961 Ga0495591_017961_628_1515 295
551 3300046458 Ga0495591_025601 Ga0495591_025601_549_1436 295
552 3300046460 Ga0495638_0002423 Ga0495638_0002423_9299_10186 295
553 3300046460 Ga0495638_0009363 Ga0495638_0009363_3023_3910 295
554 3300046460 Ga0495638_0016132 Ga0495638_0016132_435_1322 295
555 3300046460 Ga0495638_0022024 Ga0495638_0022024_65_952 295
556 3300046460 Ga0495638_0023288 Ga0495638_0023288_2841_3758 295
557 3300046460 Ga0495638_0026660 Ga0495638_0026660_356_1243 295
558 3300046460 Ga0495638_0077315 Ga0495638_0077315_534_1421 295
559 3300046463 Ga0495653_0003298 Ga0495653_0003298_5185_6105 295
560 3300046463 Ga0495653_0017970 Ga0495653_0017970_147_1034 295
561 3300046471 Ga0495650_0002155 Ga0495650_0002155_2085_2972 295
562 3300046471 Ga0495650_0003462 Ga0495650_0003462_2626_3546 295
563 3300046471 Ga0495650_0009445 Ga0495650_0009445_3132_4019 295
564 3300046471 Ga0495650_0016777 Ga0495650_0016777_665_1552 295
565 3300046474 Ga0495605_0001169 Ga0495605_0001169_15690_16577 295
566 3300046474 Ga0495605_0003351 Ga0495605_0003351_874_1821 295
567 3300046474 Ga0495605_0015636 Ga0495605_0015636_282_1169 295
568 3300046474 Ga0495605_0040265 Ga0495605_0040265_843_1730 295
569 3300046475 Ga0495639_0015405 Ga0495639_0015405_1116_2003 295
570 3300046491 Ga0495584_0010611 Ga0495584_0010611_3793_4680 295
571 3300046491 Ga0495584_0020423 Ga0495584_0020423_1274_2161 295
572 3300046491 Ga0495584_0039065 Ga0495584_0039065_857_1744 295
573 3300046491 Ga0495584_0055637 Ga0495584_0055637_498_1385 295
574 3300046492 Ga0495585_0001233 Ga0495585_0001233_7739_8626 295
575 3300046492 Ga0495585_0003913 Ga0495585_0003913_760_1647 295
576 3300046492 Ga0495585_0012245 Ga0495585_0012245_2238_3125 295
577 3300046492 Ga0495585_0014493 Ga0495585_0014493_598_1485 295
578 3300046492 Ga0495585_0018776 Ga0495585_0018776_1119_2006 295
579 3300046492 Ga0495585_0021613 Ga0495585_0021613_657_1544 295
580 3300046499 Ga0495594_0066064 Ga0495594_0066064_522_1409 295
581 3300046500 Ga0495596_0000478 Ga0495596_0000478_16237_17124 295
582 3300046501 Ga0495607_0000069 Ga0495607_0000069_26473_27366 295
583 3300046501 Ga0495607_0003172 Ga0495607_0003172_11378_12268 295
584 3300046501 Ga0495607_0003303 Ga0495607_0003303_8618_9505 295
585 3300046501 Ga0495607_0009558 Ga0495607_0009558_4879_5766 295
586 3300046501 Ga0495607_0011736 Ga0495607_0011736_1334_2221 295
587 3300046501 Ga0495607_0012648 Ga0495607_0012648_94_981 295
588 3300046501 Ga0495607_0055511 Ga0495607_0055511_193_1080 295
589 3300046501 Ga0495607_0090195 Ga0495607_0090195_728_1615 295
590 3300046501 Ga0495607_0119073 Ga0495607_0119073_398_1291 295
591 3300046506 Ga0495583_0002951 Ga0495583_0002951_8651_9538 295
592 3300046506 Ga0495583_0043336 Ga0495583_0043336_586_1473 295
593 3300046507 Ga0495606_0004110 Ga0495606_0004110_9670_10557 295
594 3300046507 Ga0495606_0006032 Ga0495606_0006032_6702_7589 295
595 3300046507 Ga0495606_0006404 Ga0495606_0006404_1299_2294 295
596 3300046507 Ga0495606_0010755 Ga0495606_0010755_3765_4652 295
597 3300046507 Ga0495606_0070275 Ga0495606_0070275_973_1860 295
598 3300046507 Ga0495606_0089323 Ga0495606_0089323_481_1368 295
599 3300046512 Ga0495610_0002777 Ga0495610_0002777_3697_4584 295
600 3300046512 Ga0495610_0005863 Ga0495610_0005863_4577_5464 295
601 3300046512 Ga0495610_0013003 Ga0495610_0013003_2687_3574 295
602 3300046512 Ga0495610_0023436 Ga0495610_0023436_19_906 295
603 3300046513 Ga0495616_0002782 Ga0495616_0002782_2625_3545 295
604 3300046513 Ga0495616_0017155 Ga0495616_0017155_28_915 295
605 3300046513 Ga0495616_0057430 Ga0495616_0057430_534_1421 295
606 3300046513 Ga0495616_0072336 Ga0495616_0072336_632_1519 295
607 3300046515 Ga0495620_0000879 Ga0495620_0000879_6219_7106 295
608 3300046515 Ga0495620_0001236 Ga0495620_0001236_3789_4682 295
609 3300046515 Ga0495620_0005263 Ga0495620_0005263_2147_3142 295
610 3300046515 Ga0495620_0005831 Ga0495620_0005831_613_1500 295
611 3300046515 Ga0495620_0082316 Ga0495620_0082316_367_1254 295
612 3300046517 Ga0495630_0128933 Ga0495630_0128933_987_1874 295
613 3300046518 Ga0495631_0000557 Ga0495631_0000557_15234_16121 295
614 3300046518 Ga0495631_0001273 Ga0495631_0001273_3612_4505 295
615 3300046518 Ga0495631_0001898 Ga0495631_0001898_8003_8998 295
616 3300046518 Ga0495631_0009216 Ga0495631_0009216_529_1416 295
617 3300046518 Ga0495631_0022766 Ga0495631_0022766_662_1552 295
618 3300046519 Ga0495632_0002203 Ga0495632_0002203_8597_9484 295
619 3300046519 Ga0495632_0002355 Ga0495632_0002355_8399_9286 295
620 3300046519 Ga0495632_0006993 Ga0495632_0006993_2203_3090 295
621 3300046519 Ga0495632_0028208 Ga0495632_0028208_642_1529 295
622 3300046519 Ga0495632_0044728 Ga0495632_0044728_716_1603 295
623 3300046519 Ga0495632_0064361 Ga0495632_0064361_512_1402 295
624 3300046519 Ga0495632_0071073 Ga0495632_0071073_244_1134 295
625 3300046520 Ga0495637_0000982 Ga0495637_0000982_8719_9606 295
626 3300046520 Ga0495637_0001013 Ga0495637_0001013_3581_4474 295
627 3300046520 Ga0495637_0002185 Ga0495637_0002185_8533_9420 295
628 3300046520 Ga0495637_0004272 Ga0495637_0004272_630_1523 295
629 3300046520 Ga0495637_0005147 Ga0495637_0005147_1841_2734 295
630 3300046520 Ga0495637_0007429 Ga0495637_0007429_3753_4640 295
631 3300046520 Ga0495637_0016381 Ga0495637_0016381_2388_3275 295
632 3300046520 Ga0495637_0018073 Ga0495637_0018073_1925_2818 295
633 3300046520 Ga0495637_0018784 Ga0495637_0018784_1882_2769 295
634 3300046520 Ga0495637_0024037 Ga0495637_0024037_853_1740 295
635 3300046520 Ga0495637_0034885 Ga0495637_0034885_715_1602 295
636 3300046520 Ga0495637_0053008 Ga0495637_0053008_546_1433 295
637 3300046520 Ga0495637_0057048 Ga0495637_0057048_120_1007 295
638 3300046522 Ga0495643_0013302 Ga0495643_0013302_426_1448 295
639 3300046522 Ga0495643_0030237 Ga0495643_0030237_193_1080 295
640 3300046522 Ga0495643_0056107 Ga0495643_0056107_203_1090 295
641 3300046522 Ga0495643_0087371 Ga0495643_0087371_534_1421 295
642 3300046523 Ga0495644_0000474 Ga0495644_0000474_2042_2929 295
643 3300046523 Ga0495644_0033998 Ga0495644_0033998_215_1102 295
644 3300046523 Ga0495644_0045073 Ga0495644_0045073_274_1161 295
645 3300046524 Ga0495648_0001169 Ga0495648_0001169_6177_7064 295
646 3300046524 Ga0495648_0001874 Ga0495648_0001874_14813_15700 295
647 3300046524 Ga0495648_0002169 Ga0495648_0002169_7883_8770 295
648 3300046524 Ga0495648_0004794 Ga0495648_0004794_3512_4399 295
649 3300046524 Ga0495648_0005415 Ga0495648_0005415_2689_3684 295
650 3300046524 Ga0495648_0023508 Ga0495648_0023508_1876_2763 295
651 3300046524 Ga0495648_0028304 Ga0495648_0028304_2456_3343 295
652 3300046524 Ga0495648_0038394 Ga0495648_0038394_1694_2581 295
653 3300046524 Ga0495648_0093759 Ga0495648_0093759_149_1036 295
654 3300046524 Ga0495648_0139352 Ga0495648_0139352_264_1259 295
655 3300046528 Ga0495642_0000253 Ga0495642_0000253_28440_29327 295
656 3300046528 Ga0495642_0001251 Ga0495642_0001251_8616_9503 295
657 3300046530 Ga0495654_0000947 Ga0495654_0000947_18443_19330 295
658 3300046530 Ga0495654_0001612 Ga0495654_0001612_10754_11647 295
659 3300046530 Ga0495654_0002089 Ga0495654_0002089_8879_9766 295
660 3300046530 Ga0495654_0002476 Ga0495654_0002476_2308_3195 295
661 3300046530 Ga0495654_0010516 Ga0495654_0010516_3515_4537 295
662 3300046530 Ga0495654_0015217 Ga0495654_0015217_675_1562 295
663 3300046530 Ga0495654_0018982 Ga0495654_0018982_141_1031 295
664 3300046530 Ga0495654_0028857 Ga0495654_0028857_1790_2785 295
665 3300046530 Ga0495654_0031052 Ga0495654_0031052_1722_2609 295
666 3300046530 Ga0495654_0047218 Ga0495654_0047218_764_1711 295
667 3300046536 Ga0495587_0009814 Ga0495587_0009814_4580_5467 295
668 3300046538 Ga0495609_0000057 Ga0495609_0000057_50645_51538 295
669 3300046538 Ga0495609_0010555 Ga0495609_0010555_65_952 295
670 3300046538 Ga0495609_0126374 Ga0495609_0126374_97_984 295
671 3300046542 Ga0495597_0000229 Ga0495597_0000229_41348_42301 295
672 3300046542 Ga0495597_0001472 Ga0495597_0001472_12584_13477 295
673 3300046542 Ga0495597_0002031 Ga0495597_0002031_8131_9126 295
674 3300046542 Ga0495597_0004119 Ga0495597_0004119_2063_2950 295
675 3300046542 Ga0495597_0010651 Ga0495597_0010651_349_1236 295
676 3300046542 Ga0495597_0031005 Ga0495597_0031005_638_1525 295
677 3300046557 Ga0495622_0001113 Ga0495622_0001113_10139_11026 295
678 3300046557 Ga0495622_0003393 Ga0495622_0003393_3310_4305 295
679 3300046557 Ga0495622_0051148 Ga0495622_0051148_839_1726 295
680 3300046558 Ga0495633_0002371 Ga0495633_0002371_8354_9241 295
681 3300046615 Ga0495656_0032589 Ga0495656_0032589_1099_2031 295
682 3300046616 Ga0495668_0001637 Ga0495668_0001637_14668_15555 295
683 3300046616 Ga0495668_0010876 Ga0495668_0010876_1493_2386 295
684 3300046616 Ga0495668_0011902 Ga0495668_0011902_494_1381 295
685 3300046616 Ga0495668_0013844 Ga0495668_0013844_2246_3133 295
686 3300046648 Ga0495611_0000398 Ga0495611_0000398_9449_10471 295
687 3300046660 Ga0495625_0001611 Ga0495625_0001611_18841_19728 295
688 3300046660 Ga0495625_0005979 Ga0495625_0005979_5462_6349 295
689 3300046660 Ga0495625_0008586 Ga0495625_0008586_3427_4314 295
690 3300046660 Ga0495625_0010435 Ga0495625_0010435_4635_5522 295
691 3300046660 Ga0495625_0024032 Ga0495625_0024032_481_1368 295
692 3300046660 Ga0495625_0028783 Ga0495625_0028783_64_951 295
693 3300046660 Ga0495625_0061846 Ga0495625_0061846_1060_1947 295
694 3300046663 Ga0495635_0002400 Ga0495635_0002400_6178_7065 295
695 3300046663 Ga0495635_0014787 Ga0495635_0014787_879_1817 295
696 3300046664 Ga0495659_0024028 Ga0495659_0024028_335_1222 295
697 3300046665 Ga0495661_0000571 Ga0495661_0000571_9006_9893 295
698 3300046665 Ga0495661_0003441 Ga0495661_0003441_8780_9667 295
699 3300046665 Ga0495661_0012541 Ga0495661_0012541_556_1443 295
700 3300046665 Ga0495661_0027461 Ga0495661_0027461_1975_2862 295
701 3300046665 Ga0495661_0129785 Ga0495661_0129785_59_1054 295
702 3300046665 Ga0495661_0132934 Ga0495661_0132934_383_1270 295
703 3300046674 Ga0495588_0003618 Ga0495588_0003618_3208_4095 295
704 3300046674 Ga0495588_0015925 Ga0495588_0015925_1168_2055 295
705 3300046679 Ga0495623_0004003 Ga0495623_0004003_6143_7030 295
706 3300046680 Ga0495646_0003143 Ga0495646_0003143_3646_4533 295
707 3300046680 Ga0495646_0014400 Ga0495646_0014400_595_1515 295
708 3300046689 Ga0495613_0023434 Ga0495613_0023434_3032_3952 295
709 3300046690 Ga0495624_0001016 Ga0495624_0001016_14969_15889 295
710 3300046691 Ga0495670_0001148 Ga0495670_0001148_8277_9299 295
711 3300046691 Ga0495670_0001629 Ga0495670_0001629_5144_6031 295
712 3300046692 Ga0495671_0000860 Ga0495671_0000860_3049_3936 295
713 3300046692 Ga0495671_0001062 Ga0495671_0001062_11540_12427 295
714 3300046692 Ga0495671_0002728 Ga0495671_0002728_5895_6782 295
715 3300046692 Ga0495671_0006460 Ga0495671_0006460_4622_5512 295
716 3300046692 Ga0495671_0016960 Ga0495671_0016960_465_1352 295
717 3300046692 Ga0495671_0025098 Ga0495671_0025098_2093_2980 295
718 3300046692 Ga0495671_0031230 Ga0495671_0031230_534_1421 295
719 3300046692 Ga0495671_0073639 Ga0495671_0073639_517_1449 295
720 3300046692 Ga0495671_0082388 Ga0495671_0082388_638_1525 295
721 3300046692 Ga0495671_0087314 Ga0495671_0087314_63_950 295
722 3300046692 Ga0495671_0096697 Ga0495671_0096697_241_1128 295
723 3300046694 Ga0495649_0003030 Ga0495649_0003030_3788_4675 295
724 3300046694 Ga0495649_0009177 Ga0495649_0009177_1539_2426 295
725 3300046694 Ga0495649_0009407 Ga0495649_0009407_119_1006 295
726 3300046694 Ga0495649_0012447 Ga0495649_0012447_1707_2594 295
727 3300046694 Ga0495649_0024115 Ga0495649_0024115_1572_2576 295
728 3300046694 Ga0495649_0094265 Ga0495649_0094265_216_1103 295
729 3300046694 Ga0495649_0096994 Ga0495649_0096994_661_1548 295
730 3300046694 Ga0495649_0180428 Ga0495649_0180428_62_949 295
731 3300046794 Ga0495589_0001444 Ga0495589_0001444_8706_9593 295
732 3300046794 Ga0495589_0006684 Ga0495589_0006684_704_1591 295
733 3300046794 Ga0495589_0011088 Ga0495589_0011088_907_1794 295
734 3300046809 Ga0495600_0015051 Ga0495600_0015051_2431_3318 295
735 3300046810 Ga0495660_0001871 Ga0495660_0001871_1693_2586 295
736 3300046810 Ga0495660_0001949 Ga0495660_0001949_6357_7250 295
737 3300046810 Ga0495660_0004554 Ga0495660_0004554_1293_2180 295
738 3300046810 Ga0495660_0009310 Ga0495660_0009310_753_1640 295
739 3300046810 Ga0495660_0009972 Ga0495660_0009972_1512_2399 295
740 3300046810 Ga0495660_0010711 Ga0495660_0010711_4394_5281 295
741 3300046810 Ga0495660_0013744 Ga0495660_0013744_269_1162 295
742 3300046810 Ga0495660_0020234 Ga0495660_0020234_48_935 295
743 3300046810 Ga0495660_0066718 Ga0495660_0066718_727_1614 295
744 3300046810 Ga0495660_0071553 Ga0495660_0071553_900_1787 295
745 3300046810 Ga0495660_0100319 Ga0495660_0100319_505_1392 295
746 3300046810 Ga0495660_0101481 Ga0495660_0101481_146_1033 295
747 3300047317 Ga0495604_0004835 Ga0495604_0004835_4750_5637 295
748 3300047317 Ga0495604_0042857 Ga0495604_0042857_2548_3468 295
749 3300047319 Ga0495674_0010280 Ga0495674_0010280_3165_4052 295
750 3300047320 Ga0495672_0001861 Ga0495672_0001861_16443_17330 295
751 3300047320 Ga0495672_0002241 Ga0495672_0002241_1821_2708 295
752 3300047320 Ga0495672_0002630 Ga0495672_0002630_5591_6478 295
753 3300047320 Ga0495672_0004619 Ga0495672_0004619_3284_4171 295
754 3300047320 Ga0495672_0008985 Ga0495672_0008985_5260_6192 295
755 3300047320 Ga0495672_0009137 Ga0495672_0009137_1211_2098 295
756 3300047320 Ga0495672_0009191 Ga0495672_0009191_5409_6296 295
757 3300047320 Ga0495672_0033904 Ga0495672_0033904_924_1811 295
758 3300047320 Ga0495672_0034522 Ga0495672_0034522_1213_2106 295
759 3300047320 Ga0495672_0051836 Ga0495672_0051836_1096_2049 295
760 3300047320 Ga0495672_0171934 Ga0495672_0171934_35_922 295
761 3300047321 Ga0495676_0024333 Ga0495676_0024333_781_1668 295
762 3300047321 Ga0495676_0037406 Ga0495676_0037406_2975_3895 295
763 3300047322 Ga0495680_0008892 Ga0495680_0008892_3547_4467 295
764 3300047322 Ga0495680_0040858 Ga0495680_0040858_1025_1912 295
765 3300047322 Ga0495680_0158885 Ga0495680_0158885_143_1030 295
766 3300047322 Ga0495680_0305255 Ga0495680_0305255_92_1030 295
767 3300047323 Ga0495683_0000032 Ga0495683_0000032_98079_98972 295
768 3300047323 Ga0495683_0000584 Ga0495683_0000584_19615_20502 295
769 3300047323 Ga0495683_0000905 Ga0495683_0000905_8898_9785 295
770 3300047323 Ga0495683_0011935 Ga0495683_0011935_2595_3482 295
771 3300047443 Ga0495687_001410 Ga0495687_001410_13163_14050 295
772 3300047443 Ga0495687_001593 Ga0495687_001593_2321_3208 295
773 3300047444 Ga0495675_0007362 Ga0495675_0007362_2678_3616 295
774 3300047444 Ga0495675_0195133 Ga0495675_0195133_64_951 295
775 3300047445 Ga0495677_0001304 Ga0495677_0001304_2818_3705 295
776 3300047446 Ga0495679_000721 Ga0495679_000721_16118_17005 295
777 3300047446 Ga0495679_005501 Ga0495679_005501_4295_5182 295
778 3300047446 Ga0495679_006071 Ga0495679_006071_2769_3716 295
779 3300047446 Ga0495679_019394 Ga0495679_019394_1357_2244 295
780 3300047446 Ga0495679_024712 Ga0495679_024712_928_1815 295
781 3300047447 Ga0495685_038423 Ga0495685_038423_145_1032 295
782 3300047469 Ga0495673_0001703 Ga0495673_0001703_3871_4764 295
783 3300047469 Ga0495673_0001708 Ga0495673_0001708_424_1311 295
784 3300047469 Ga0495673_0001879 Ga0495673_0001879_4759_5646 295
785 3300047469 Ga0495673_0002166 Ga0495673_0002166_3262_4155 295
786 3300047469 Ga0495673_0004038 Ga0495673_0004038_5810_6697 295
787 3300047469 Ga0495673_0004292 Ga0495673_0004292_4769_5656 295
788 3300047469 Ga0495673_0005096 Ga0495673_0005096_959_1846 295
789 3300047469 Ga0495673_0005300 Ga0495673_0005300_3964_4857 295
790 3300047469 Ga0495673_0011643 Ga0495673_0011643_2063_2950 295
791 3300047469 Ga0495673_0050441 Ga0495673_0050441_534_1421 295
792 3300047469 Ga0495673_0061429 Ga0495673_0061429_628_1515 295
793 3300047470 Ga0495681_0001535 Ga0495681_0001535_3679_4566 295
794 3300047470 Ga0495681_0002339 Ga0495681_0002339_4343_5230 295
795 3300047470 Ga0495681_0002940 Ga0495681_0002940_8494_9414 295
796 3300047470 Ga0495681_0004215 Ga0495681_0004215_6610_7497 295
797 3300047470 Ga0495681_0005581 Ga0495681_0005581_2615_3502 295
798 3300047470 Ga0495681_0014801 Ga0495681_0014801_385_1272 295
799 3300047470 Ga0495681_0022720 Ga0495681_0022720_749_1636 295
800 3300047470 Ga0495681_0041300 Ga0495681_0041300_638_1525 295
801 3300047470 Ga0495681_0048687 Ga0495681_0048687_259_1146 295
802 3300047471 Ga0495684_0025758 Ga0495684_0025758_2984_3904 295
803 3300047472 Ga0495686_0005103 Ga0495686_0005103_4059_4946 295
804 3300047472 Ga0495686_0006282 Ga0495686_0006282_2065_2952 295
805 3300047472 Ga0495686_0015694 Ga0495686_0015694_3495_4382 295
806 3300047673 Ga0495593_0067458 Ga0495593_0067458_396_1316 295
807 3300048088 Ga0495602_0030875 Ga0495602_0030875_3560_4480 295
808 3300048091 Ga0495626_0000831 Ga0495626_0000831_19449_20336 295
809 3300048091 Ga0495626_0001108 Ga0495626_0001108_9129_10016 295
810 3300048091 Ga0495626_0005222 Ga0495626_0005222_2344_3231 295
811 3300048091 Ga0495626_0016707 Ga0495626_0016707_638_1525 295
812 3300048091 Ga0495626_0053489 Ga0495626_0053489_919_1806 295
813 3300048905 Ga0496102_0002311 Ga0496102_0002311_6066_6953 295
814 3300048906 Ga0496103_0002862 Ga0496103_0002862_4235_5122 295
815 3300048919 Ga0496116_0002775 Ga0496116_0002775_9929_10816 295
816 3300048919 Ga0496116_0004594 Ga0496116_0004594_3222_4142 295
817 3300048919 Ga0496116_0007417 Ga0496116_0007417_5931_6818 295
818 3300048919 Ga0496116_0014607 Ga0496116_0014607_2361_3248 295
819 3300048920 Ga0496117_0211872 Ga0496117_0211872_33_920 295
820 3300048920 Ga0496117_0211885 Ga0496117_0211885_33_920 295
821 3300048921 Ga0496118_0007335 Ga0496118_0007335_1692_2612 295
822 3300048921 Ga0496118_0007906 Ga0496118_0007906_5274_6161 295
823 3300048921 Ga0496118_0079709 Ga0496118_0079709_761_1648 295
824 3300048924 Ga0496121_0007900 Ga0496121_0007900_3215_4135 295
825 3300048925 Ga0496122_0010517 Ga0496122_0010517_5797_6684 295
826 3300048925 Ga0496122_0037573 Ga0496122_0037573_819_1706 295
827 3300048926 Ga0496123_0011812 Ga0496123_0011812_1430_2317 295
828 3300048926 Ga0496123_0016348 Ga0496123_0016348_3922_4809 295
829 3300048926 Ga0496123_0143414 Ga0496123_0143414_145_1032 295
830 3300048927 Ga0496124_0000407 Ga0496124_0000407_8160_9137 295
831 3300048927 Ga0496124_0005384 Ga0496124_0005384_10084_10971 295
832 3300048927 Ga0496124_0022335 Ga0496124_0022335_1875_2762 295
833 3300048927 Ga0496124_0188712 Ga0496124_0188712_20_940 295
834 3300048927 Ga0496124_0352512 Ga0496124_0352512_101_1021 295
835 3300048928 Ga0496125_0002716 Ga0496125_0002716_5904_6791 295
836 3300048928 Ga0496125_0017906 Ga0496125_0017906_1052_1939 295
837 3300049459 Ga0495678_000541 Ga0495678_000541_22363_23256 295
838 3300049459 Ga0495678_001393 Ga0495678_001393_2243_3130 295
839 3300049459 Ga0495678_003217 Ga0495678_003217_8707_9594 295
840 3300049459 Ga0495678_028588 Ga0495678_028588_816_1703 295
841 3300049459 Ga0495678_036912 Ga0495678_036912_606_1493 295
842 3300049459 Ga0495678_052112 Ga0495678_052112_496_1383 295
843 3300049460 Ga0495682_0001635 Ga0495682_0001635_3301_4296 295
844 3300049460 Ga0495682_0003896 Ga0495682_0003896_4686_5573 295
845 3300049460 Ga0495682_0022278 Ga0495682_0022278_473_1405 295
846 3300049460 Ga0495682_0055634 Ga0495682_0055634_91_1023 295
847 3300049569 Ga0501032_0041522 Ga0501032_0041522_1628_2527 295
848 3300049571 Ga0501034_0150183 Ga0501034_0150183_504_1397 295
849 3300049573 Ga0501037_0101041 Ga0501037_0101041_312_1211 295
850 3300053111 Ga0500572_003770 Ga0500572_003770_2283_3170 295
851 3300053140 Ga0500573_0036557 Ga0500573_0036557_877_1770 295
852 3300053161 Ga0500634_0013813 Ga0500634_0013813_563_1450 295
853 iso_pu_bacteria 2554235341 2555672609 295
854 iso_pu_bacteria 3007861166 3007865315 295

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01553

Acyltransferase

Acyltransferase

114

271

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bqt-assembly1.cif.gz_B complex of 14-3-3 theta with an irsp53 peptide doubly-phosphorylated at t340 and t360 0.7467 21 69
6qk8-assembly2.cif.gz_B crystal structure of yeast 14-3-3 protein (bmh1) from saccharomyces cerevisiae with the nha1p (yeast na+/h+ antiporter) 14-3-3 binding motif ser481 0.7205 28 67
6r7z-assembly1.cif.gz_B cryoem structure of calcium-free human tmem16k / anoctamin 10 in detergent (closed form) 0.6135 2 64
5kym-assembly1.cif.gz_A crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6058 1 279
5kym-assembly2.cif.gz_B crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima 0.6003 2 279
ID Description Score Start End Superfamily
2pu8A02 Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe 0.8584 28 65 3.90.1200.10
af_P32129_82_238_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8484 69 222 3.40.50.620
af_P32129_82_238_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8289 69 222 3.40.50.620
af_Q9NRZ5_70_233_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7348 82 222 3.40.50.620
af_Q22267_77_205_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.7295 74 210 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A0P9SIR0-F1-model_v4 Acyltransferase 0.9786 181 293 GO:0016746
AF-A0A0P9CUI6-F1-model_v4 Acyltransferase 0.9763 168 293 GO:0016746
AF-A0A656H741-F1-model_v4 deleted 0.9731 52 284
AF-A0A136Q9J9-F1-model_v4 deleted 0.9698 97 295
AF-A0A433FBK4-F1-model_v4 deleted 0.9652 168 294

Feature Viewer

pLDDT pTM Quality
91.47 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map