F483591
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 394 | 693 | 295 |
Family's Representative Sequence
| Representative Sequence | 3300046452|Ga0495617_031435|Ga0495617_031435_723_1745 |
| Length | 340 |
| Sequence | MRPAKSIQYLAPAYRPKSETFVTADLACRAKLLIMARPSVCKELLMRRLLTGCFVTLLLLLNTLILIGPLLVFALLKLVAPGRWRDYASGAVMWIAETWAEIDKLIFRLCIPTQWDIRGGEDLRGDTSYLVVSNHQSWVDIPALIQTLNRRTPFFKFFLKKELIWVPFLGLAWWALDYPFMKRYTKAFLAKHPELAGKDLEITKQACELFKRQPVTVVNYLEGTRYTAAKSAQQQSPFKHLLKPKAGGVAFVLAAMGEQLDAILDVTVVYPQAKIPGFWDLISGNVPRVIIDIKTRELDPALWQGDYENDPAFRQKVQSWVNQLWNEKDQRIAELRSERG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 3 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 4 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 5 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 6 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 7 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 8 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 9 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 10 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 11 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 12 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 13 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 14 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 15 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 16 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 17 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 18 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 19 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 20 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 21 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 22 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 23 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 24 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 25 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 26 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 27 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 28 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 29 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 30 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 31 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 32 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 33 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 34 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 35 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 36 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 37 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 38 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 39 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 40 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 41 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 42 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 43 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 44 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 45 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 46 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 47 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 48 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 49 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 50 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 51 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 52 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 53 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 54 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 55 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 56 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 57 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 58 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 59 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 60 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 61 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 62 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 63 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 64 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 65 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 66 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 67 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 68 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 69 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 70 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 71 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 72 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 73 | 2808606373 | Pseudomonas sp. SLBN-2 | Isolate | Unclassified |
| 74 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 75 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 76 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 77 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 78 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 79 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 80 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 81 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 82 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 83 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 84 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 85 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 86 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 87 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 88 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 89 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 90 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 91 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 92 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 93 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 94 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 95 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 96 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 97 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 98 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 99 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 100 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 101 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 102 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 103 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 104 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 105 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 106 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 107 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 108 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 109 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 110 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 111 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 112 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 113 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 114 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 115 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 116 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 117 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 118 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 119 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 120 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 121 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 122 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 123 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 124 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 125 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 126 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 127 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 128 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 129 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 130 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 131 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 132 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 133 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 134 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 135 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 136 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 137 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 138 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 139 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 140 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 141 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 142 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 143 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 144 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 145 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 146 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 147 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 148 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 149 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 150 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 151 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 152 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 153 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 154 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 155 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 156 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 157 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 158 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 160 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 161 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 162 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 163 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 164 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 165 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 166 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 167 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 168 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 169 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 170 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 171 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 172 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 173 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 174 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 175 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 180 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 181 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 182 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 183 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 184 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 192 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 193 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 194 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 195 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 196 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 197 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 199 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 202 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 203 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 204 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 205 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 206 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 207 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 208 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 211 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 212 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 228 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 229 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 231 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 234 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 235 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 236 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 237 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 242 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 243 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 244 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 245 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 248 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 249 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 250 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 251 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 252 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 253 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 254 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 255 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 256 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 257 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 258 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 259 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 260 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 261 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 262 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 263 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 264 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 265 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 269 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 270 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 271 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 272 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 273 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 274 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 346 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 347 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 348 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 349 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 350 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 351 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 352 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 353 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 354 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 355 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 356 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 357 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 358 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 367 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 368 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 369 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 370 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 371 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 372 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 373 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 374 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 375 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 376 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 377 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 378 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 379 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 380 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 381 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 382 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 383 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 384 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 385 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 386 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 387 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 388 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 389 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 390 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 391 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 392 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 393 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 394 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.91 |
| Metatranscriptomes | 0.23 |
| Isolates | 18.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.23 |
| Bulb | 0 |
| Endosphere | 7.03 |
| Nodule | 2.22 |
| Rhizoplane | 1.99 |
| Rhizosphere | 74.94 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.58 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_1749 | 2124908027 | Bacteria | 2302 |
| 2 | JGI24741J21665_1002957 | 3300001915 | Bacteria | 4235 |
| 3 | JGI25162J39368_1000076 | 3300002737 | Bacteria | 120246 |
| 4 | JGI25162J39368_1000104 | 3300002737 | Bacteria | 93706 |
| 5 | JGI25154J39366_1005394 | 3300002738 | Bacteria | 2050 |
| 6 | JGI25163J39215_1000198 | 3300002771 | Bacteria | 23415 |
| 7 | JGI25164J39214_1000083 | 3300002772 | Bacteria | 93706 |
| 8 | JGI25164J39214_1000084 | 3300002772 | Bacteria | 93684 |
| 9 | JGI25165J46597_1000140 | 3300003214 | Bacteria | 120246 |
| 10 | JGI25165J46597_1000186 | 3300003214 | Bacteria | 93706 |
| 11 | Ga0006562J51391_1056221 | 3300003578 | Bacteria | 5370 |
| 12 | Ga0006562J51391_1056222 | 3300003578 | Bacteria | 8660 |
| 13 | Ga0055538_1000074 | 3300003751 | Bacteria | 90292 |
| 14 | Ga0055539_1000112 | 3300003752 | Bacteria | 90292 |
| 15 | Ga0055533_1000118 | 3300003756 | Bacteria | 90292 |
| 16 | Ga0055532_1000106 | 3300003758 | Bacteria | 90264 |
| 17 | Ga0055525_1000157 | 3300003759 | Bacteria | 90292 |
| 18 | Ga0055535_1002953 | 3300003761 | Bacteria | 5254 |
| 19 | Ga0055536_1000289 | 3300003781 | Bacteria | 38013 |
| 20 | Ga0055536_1000620 | 3300003781 | Bacteria | 24134 |
| 21 | Ga0055536_1000625 | 3300003781 | Bacteria | 24031 |
| 22 | Ga0055530_10000389 | 3300003791 | Bacteria | 39450 |
| 23 | Ga0055530_10000757 | 3300003791 | Bacteria | 26909 |
| 24 | Ga0055530_10001107 | 3300003791 | Bacteria | 21076 |
| 25 | Ga0055540_1000259 | 3300003792 | Bacteria | 47811 |
| 26 | Ga0055540_1000366 | 3300003792 | Bacteria | 38001 |
| 27 | Ga0055540_1001425 | 3300003792 | Bacteria | 14249 |
| 28 | Ga0055531_10000109 | 3300003794 | Bacteria | 89901 |
| 29 | Ga0055541_1000075 | 3300003841 | Bacteria | 90292 |
| 30 | Ga0058692_1010636 | 3300003856 | Bacteria | 2265 |
| 31 | Ga0065714_10000526 | 3300005288 | Bacteria | 4018 |
| 32 | Ga0065714_10006723 | 3300005288 | Bacteria | 3164 |
| 33 | Ga0065714_10079851 | 3300005288 | Bacteria | 2480 |
| 34 | Ga0065714_10095472 | 3300005288 | Bacteria | 1785 |
| 35 | Ga0065704_10001207 | 3300005289 | Bacteria | 8932 |
| 36 | Ga0065704_10079943 | 3300005289 | Bacteria | 4045 |
| 37 | Ga0065712_10017828 | 3300005290 | Bacteria | 1608 |
| 38 | Ga0070670_100000368 | 3300005331 | Bacteria | 37602 |
| 39 | Ga0070670_100056184 | 3300005331 | Bacteria | 3378 |
| 40 | Ga0070661_100000038 | 3300005344 | Bacteria | 104775 |
| 41 | Ga0070669_100000626 | 3300005353 | Bacteria | 26162 |
| 42 | Ga0070669_100003116 | 3300005353 | Bacteria | 11939 |
| 43 | Ga0070662_100000787 | 3300005457 | Bacteria | 19461 |
| 44 | Ga0070662_100032555 | 3300005457 | Bacteria | 3664 |
| 45 | Ga0068853_100000155 | 3300005539 | Bacteria | 46420 |
| 46 | Ga0070665_100011929 | 3300005548 | Bacteria | 8775 |
| 47 | Ga0070665_100080326 | 3300005548 | Bacteria | 3266 |
| 48 | Ga0070664_100001315 | 3300005564 | Bacteria | 19831 |
| 49 | Ga0070664_100038811 | 3300005564 | Bacteria | 4010 |
| 50 | Ga0068854_100003965 | 3300005578 | Bacteria | 9277 |
| 51 | Ga0068851_10000012 | 3300005834 | Bacteria | 175130 |
| 52 | Ga0075364_10093140 | 3300006051 | Bacteria | 2000 |
| 53 | Ga0075364_10286262 | 3300006051 | Bacteria | 1121 |
| 54 | Ga0075432_10002115 | 3300006058 | Bacteria | 6612 |
| 55 | Ga0075432_10009609 | 3300006058 | Bacteria | 3293 |
| 56 | Ga0075362_10001209 | 3300006177 | Bacteria | 8116 |
| 57 | Ga0075362_10023071 | 3300006177 | Bacteria | 2628 |
| 58 | Ga0099823_1001650 | 3300006944 | Bacteria | 18964 |
| 59 | Ga0079104_1000752 | 3300006946 | Bacteria | 28044 |
| 60 | Ga0105251_10000019 | 3300009011 | Bacteria | 141884 |
| 61 | Ga0105251_10001508 | 3300009011 | Bacteria | 20005 |
| 62 | Ga0105251_10001556 | 3300009011 | Bacteria | 19676 |
| 63 | Ga0105251_10001642 | 3300009011 | Bacteria | 18947 |
| 64 | Ga0105251_10002891 | 3300009011 | Bacteria | 12914 |
| 65 | Ga0105251_10014004 | 3300009011 | Bacteria | 4455 |
| 66 | Ga0105244_10000150 | 3300009036 | Bacteria | 73078 |
| 67 | Ga0105244_10000711 | 3300009036 | Bacteria | 28745 |
| 68 | Ga0105244_10001478 | 3300009036 | Bacteria | 18951 |
| 69 | Ga0105244_10006568 | 3300009036 | Bacteria | 7502 |
| 70 | Ga0105244_10007253 | 3300009036 | Bacteria | 7062 |
| 71 | Ga0105244_10037387 | 3300009036 | Bacteria | 2538 |
| 72 | Ga0105244_10061700 | 3300009036 | Bacteria | 1886 |
| 73 | Ga0105244_10065901 | 3300009036 | Bacteria | 1814 |
| 74 | Ga0105244_10069185 | 3300009036 | Bacteria | 1763 |
| 75 | Ga0105244_10082667 | 3300009036 | Bacteria | 1588 |
| 76 | Ga0105250_10000519 | 3300009092 | Bacteria | 26981 |
| 77 | Ga0105250_10000752 | 3300009092 | Bacteria | 19712 |
| 78 | Ga0105250_10023832 | 3300009092 | Bacteria | 2468 |
| 79 | Ga0105250_10053748 | 3300009092 | Bacteria | 1615 |
| 80 | Ga0105243_10119166 | 3300009148 | Bacteria | 2222 |
| 81 | Ga0105242_10000169 | 3300009176 | Bacteria | 49398 |
| 82 | Ga0105242_10030577 | 3300009176 | Bacteria | 4300 |
| 83 | Ga0105248_10232939 | 3300009177 | Bacteria | 2073 |
| 84 | Ga0105237_10005893 | 3300009545 | Bacteria | 13742 |
| 85 | Ga0105246_10000617 | 3300011119 | Bacteria | 19838 |
| 86 | Ga0105246_10001973 | 3300011119 | Bacteria | 12368 |
| 87 | Ga0157345_1000021 | 3300012498 | Bacteria | 41056 |
| 88 | Ga0157373_10001281 | 3300013100 | Bacteria | 19218 |
| 89 | Ga0157373_10004690 | 3300013100 | Bacteria | 10275 |
| 90 | Ga0157373_10023736 | 3300013100 | Bacteria | 4444 |
| 91 | Ga0157373_10043580 | 3300013100 | Bacteria | 3205 |
| 92 | Ga0157373_10106007 | 3300013100 | Bacteria | 1976 |
| 93 | Ga0157373_10138254 | 3300013100 | Bacteria | 1713 |
| 94 | Ga0157373_10204153 | 3300013100 | Bacteria | 1393 |
| 95 | Ga0157371_10001747 | 3300013102 | Bacteria | 22022 |
| 96 | Ga0157371_10002492 | 3300013102 | Bacteria | 17498 |
| 97 | Ga0157371_10006333 | 3300013102 | Bacteria | 9792 |
| 98 | Ga0157370_10016538 | 3300013104 | Bacteria | 7463 |
| 99 | Ga0157370_10067825 | 3300013104 | Bacteria | 3372 |
| 100 | Ga0157370_10133835 | 3300013104 | Bacteria | 2312 |
| 101 | Ga0157369_10006372 | 3300013105 | Bacteria | 13686 |
| 102 | Ga0157369_10007915 | 3300013105 | Bacteria | 12219 |
| 103 | Ga0157369_10028628 | 3300013105 | Bacteria | 6164 |
| 104 | Ga0157369_10057638 | 3300013105 | Bacteria | 4190 |
| 105 | Ga0157369_10073051 | 3300013105 | Bacteria | 3680 |
| 106 | Ga0163162_10001061 | 3300013306 | Bacteria | 25562 |
| 107 | Ga0163162_10240437 | 3300013306 | Bacteria | 1941 |
| 108 | Ga0157372_10012514 | 3300013307 | Bacteria | 9040 |
| 109 | Ga0157372_10022580 | 3300013307 | Bacteria | 6809 |
| 110 | Ga0157372_10059867 | 3300013307 | Bacteria | 4261 |
| 111 | Ga0157375_10005580 | 3300013308 | Bacteria | 10945 |
| 112 | Ga0157375_10069687 | 3300013308 | Bacteria | 3524 |
| 113 | Ga0182008_10006385 | 3300014497 | Bacteria | 6597 |
| 114 | Ga0182008_10014722 | 3300014497 | Bacteria | 4090 |
| 115 | Ga0182008_10018747 | 3300014497 | Bacteria | 3581 |
| 116 | Ga0182008_10021787 | 3300014497 | Bacteria | 3290 |
| 117 | Ga0182008_10023826 | 3300014497 | Bacteria | 3120 |
| 118 | Ga0182008_10030419 | 3300014497 | Bacteria | 2722 |
| 119 | Ga0182008_10034988 | 3300014497 | Bacteria | 2518 |
| 120 | Ga0182006_1001027 | 3300015261 | Bacteria | 18242 |
| 121 | Ga0182006_1001586 | 3300015261 | Bacteria | 13498 |
| 122 | Ga0182006_1001598 | 3300015261 | Bacteria | 13404 |
| 123 | Ga0182006_1023686 | 3300015261 | Bacteria | 2540 |
| 124 | Ga0182006_1033011 | 3300015261 | Bacteria | 2077 |
| 125 | Ga0182006_1035592 | 3300015261 | Bacteria | 1983 |
| 126 | Ga0182007_10000408 | 3300015262 | Bacteria | 26444 |
| 127 | Ga0182007_10001004 | 3300015262 | Bacteria | 15472 |
| 128 | Ga0182005_1002494 | 3300015265 | Bacteria | 6546 |
| 129 | Ga0182005_1003495 | 3300015265 | Bacteria | 5316 |
| 130 | Ga0182005_1003776 | 3300015265 | Bacteria | 5038 |
| 131 | Ga0182005_1017337 | 3300015265 | Bacteria | 1994 |
| 132 | Ga0182005_1023792 | 3300015265 | Bacteria | 1673 |
| 133 | Ga0163161_10001087 | 3300017792 | Bacteria | 20607 |
| 134 | Ga0163161_10044753 | 3300017792 | Bacteria | 3189 |
| 135 | Ga0163161_10107479 | 3300017792 | Bacteria | 2082 |
| 136 | Ga0163161_10339589 | 3300017792 | Bacteria | 1191 |
| 137 | Ga0163161_10425647 | 3300017792 | Bacteria | 1069 |
| 138 | Ga0209760_100098 | 3300025207 | Bacteria | 66801 |
| 139 | Ga0209760_100274 | 3300025207 | Bacteria | 18776 |
| 140 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 141 | Ga0209566_100062 | 3300025225 | Bacteria | 193033 |
| 142 | Ga0209674_100132 | 3300025226 | Bacteria | 117820 |
| 143 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 144 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 145 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 146 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 147 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 148 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 149 | Ga0209258_100330 | 3300025242 | Bacteria | 71644 |
| 150 | Ga0209646_1000185 | 3300025246 | Bacteria | 77981 |
| 151 | Ga0209677_100056 | 3300025253 | Bacteria | 165557 |
| 152 | Ga0209759_1014981 | 3300025256 | Bacteria | 2022 |
| 153 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 154 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 155 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 156 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 157 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 158 | Ga0209676_1000917 | 3300025292 | Bacteria | 36740 |
| 159 | Ga0209050_1000075 | 3300025298 | Bacteria | 286562 |
| 160 | Ga0209050_1000128 | 3300025298 | Bacteria | 187432 |
| 161 | Ga0209050_1001373 | 3300025298 | Bacteria | 26568 |
| 162 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 163 | Ga0209051_1000041 | 3300025303 | Bacteria | 311155 |
| 164 | Ga0209051_1000144 | 3300025303 | Bacteria | 134811 |
| 165 | Ga0209051_1009490 | 3300025303 | Bacteria | 5010 |
| 166 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 167 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 168 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 169 | Ga0207696_1000064 | 3300025711 | Bacteria | 238379 |
| 170 | Ga0207696_1000094 | 3300025711 | Bacteria | 184065 |
| 171 | Ga0207696_1000095 | 3300025711 | Bacteria | 179123 |
| 172 | Ga0207696_1000149 | 3300025711 | Bacteria | 120461 |
| 173 | Ga0207696_1002997 | 3300025711 | Bacteria | 7885 |
| 174 | Ga0207696_1008634 | 3300025711 | Bacteria | 3873 |
| 175 | Ga0207696_1017447 | 3300025711 | Bacteria | 2378 |
| 176 | Ga0207696_1037243 | 3300025711 | Bacteria | 1441 |
| 177 | Ga0207655_1000107 | 3300025728 | Bacteria | 178758 |
| 178 | Ga0207655_1000455 | 3300025728 | Bacteria | 53605 |
| 179 | Ga0207655_1000847 | 3300025728 | Bacteria | 32804 |
| 180 | Ga0207655_1000992 | 3300025728 | Bacteria | 28937 |
| 181 | Ga0207655_1001195 | 3300025728 | Bacteria | 25084 |
| 182 | Ga0207655_1001311 | 3300025728 | Bacteria | 23515 |
| 183 | Ga0207655_1002303 | 3300025728 | Bacteria | 15693 |
| 184 | Ga0207655_1012388 | 3300025728 | Bacteria | 4988 |
| 185 | Ga0207655_1012657 | 3300025728 | Bacteria | 4908 |
| 186 | Ga0207655_1013711 | 3300025728 | Bacteria | 4631 |
| 187 | Ga0207655_1017834 | 3300025728 | Bacteria | 3809 |
| 188 | Ga0207655_1031824 | 3300025728 | Bacteria | 2422 |
| 189 | Ga0207655_1032389 | 3300025728 | Bacteria | 2389 |
| 190 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 191 | Ga0207713_1001139 | 3300025735 | Bacteria | 22567 |
| 192 | Ga0207713_1001437 | 3300025735 | Bacteria | 19017 |
| 193 | Ga0207713_1001904 | 3300025735 | Bacteria | 15814 |
| 194 | Ga0207713_1002108 | 3300025735 | Bacteria | 14839 |
| 195 | Ga0207713_1002895 | 3300025735 | Bacteria | 12021 |
| 196 | Ga0207713_1008495 | 3300025735 | Bacteria | 5907 |
| 197 | Ga0207713_1011728 | 3300025735 | Bacteria | 4737 |
| 198 | Ga0207713_1013045 | 3300025735 | Bacteria | 4406 |
| 199 | Ga0207713_1015928 | 3300025735 | Bacteria | 3838 |
| 200 | Ga0207713_1024358 | 3300025735 | Bacteria | 2824 |
| 201 | Ga0207671_10000299 | 3300025914 | Bacteria | 73023 |
| 202 | Ga0207649_10000022 | 3300025920 | Bacteria | 188959 |
| 203 | Ga0207681_10000422 | 3300025923 | Bacteria | 29446 |
| 204 | Ga0207681_10002906 | 3300025923 | Bacteria | 10833 |
| 205 | Ga0207650_10000138 | 3300025925 | Bacteria | 88802 |
| 206 | Ga0207650_10000159 | 3300025925 | Bacteria | 81496 |
| 207 | Ga0207706_10000290 | 3300025933 | Bacteria | 54761 |
| 208 | Ga0207706_10004400 | 3300025933 | Bacteria | 13233 |
| 209 | Ga0207686_10000305 | 3300025934 | Bacteria | 35554 |
| 210 | Ga0207686_10171489 | 3300025934 | Bacteria | 1530 |
| 211 | Ga0207709_10000086 | 3300025935 | Bacteria | 156177 |
| 212 | Ga0207709_10008628 | 3300025935 | Bacteria | 5629 |
| 213 | Ga0207711_10158830 | 3300025941 | Bacteria | 2045 |
| 214 | Ga0207679_10000027 | 3300025945 | Bacteria | 196811 |
| 215 | Ga0207639_10001167 | 3300026041 | Bacteria | 17836 |
| 216 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 217 | Ga0209281_1001719 | 3300027111 | Bacteria | 11302 |
| 218 | Ga0209389_1000095 | 3300027296 | Bacteria | 80518 |
| 219 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 220 | Ga0209371_1004519 | 3300027312 | Bacteria | 5991 |
| 221 | Ga0207428_10011576 | 3300027907 | Bacteria | 7789 |
| 222 | Ga0207428_10042461 | 3300027907 | Bacteria | 3678 |
| 223 | Ga0207428_10049641 | 3300027907 | Bacteria | 3361 |
| 224 | Ga0207428_10049870 | 3300027907 | Bacteria | 3352 |
| 225 | Ga0207428_10082591 | 3300027907 | Bacteria | 2507 |
| 226 | Ga0207428_10158677 | 3300027907 | Bacteria | 1719 |
| 227 | Ga0207428_10177269 | 3300027907 | Bacteria | 1612 |
| 228 | Ga0268266_10006578 | 3300028379 | Bacteria | 10616 |
| 229 | Ga0265334_10000011 | 3300028573 | Bacteria | 178287 |
| 230 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 231 | Ga0268256_1003588 | 3300030500 | Bacteria | 6917 |
| 232 | Ga0307511_10040857 | 3300030521 | Bacteria | 3929 |
| 233 | Ga0316179_1031537 | 3300030734 | Bacteria | 1169 |
| 234 | Ga0316178_1083275 | 3300030735 | Bacteria | 51744 |
| 235 | Ga0307408_100000019 | 3300031548 | Bacteria | 344502 |
| 236 | Ga0307408_100001812 | 3300031548 | Bacteria | 15561 |
| 237 | Ga0307408_100127531 | 3300031548 | Bacteria | 1981 |
| 238 | Ga0307405_10019766 | 3300031731 | Bacteria | 3749 |
| 239 | Ga0307405_10431161 | 3300031731 | Bacteria | 1040 |
| 240 | Ga0307413_10132296 | 3300031824 | Bacteria | 1710 |
| 241 | Ga0307406_10000970 | 3300031901 | Bacteria | 16033 |
| 242 | Ga0307412_10024028 | 3300031911 | Bacteria | 3758 |
| 243 | Ga0307412_10151144 | 3300031911 | Bacteria | 1713 |
| 244 | Ga0307409_100020735 | 3300031995 | Bacteria | 4488 |
| 245 | Ga0307416_100162343 | 3300032002 | Bacteria | 2067 |
| 246 | Ga0307414_10077621 | 3300032004 | Bacteria | 2418 |
| 247 | Ga0307411_10003310 | 3300032005 | Bacteria | 7452 |
| 248 | Ga0307411_10204196 | 3300032005 | Bacteria | 1520 |
| 249 | Ga0307510_10002877 | 3300033180 | Bacteria | 19810 |
| 250 | Ga0373925_0199427 | 3300037068 | Bacteria | 1591 |
| 251 | Ga0395905_0010256 | 3300037471 | Bacteria | 9125 |
| 252 | Ga0237819_00209 | 3300038705 | Bacteria | 21356 |
| 253 | Ga0400487_09819 | 3300039110 | Bacteria | 1504 |
| 254 | Ga0439436_0003377 | 3300041404 | Bacteria | 4841 |
| 255 | Ga0439438_000779 | 3300041405 | Bacteria | 14188 |
| 256 | Ga0439438_000931 | 3300041405 | Bacteria | 13060 |
| 257 | Ga0439438_012440 | 3300041405 | Bacteria | 2609 |
| 258 | Ga0439447_023349 | 3300041407 | Bacteria | 1612 |
| 259 | Ga0439466_0001641 | 3300041411 | Bacteria | 8763 |
| 260 | Ga0439466_0003559 | 3300041411 | Bacteria | 6018 |
| 261 | Ga0439466_0011358 | 3300041411 | Bacteria | 3295 |
| 262 | Ga0439432_000859 | 3300042006 | Bacteria | 11357 |
| 263 | Ga0439432_003308 | 3300042006 | Bacteria | 5990 |
| 264 | Ga0439432_009057 | 3300042006 | Bacteria | 3479 |
| 265 | Ga0439432_014193 | 3300042006 | Bacteria | 2697 |
| 266 | Ga0439432_035953 | 3300042006 | Bacteria | 1586 |
| 267 | Ga0439451_005341 | 3300042009 | Bacteria | 2617 |
| 268 | Ga0439452_000507 | 3300042010 | Bacteria | 21118 |
| 269 | Ga0439452_000648 | 3300042010 | Bacteria | 17388 |
| 270 | Ga0439452_003067 | 3300042010 | Bacteria | 5934 |
| 271 | Ga0439456_000068 | 3300042013 | Bacteria | 36709 |
| 272 | Ga0439456_002218 | 3300042013 | Bacteria | 3908 |
| 273 | Ga0439456_004119 | 3300042013 | Bacteria | 2949 |
| 274 | Ga0439463_000149 | 3300042016 | Bacteria | 17859 |
| 275 | Ga0439463_000438 | 3300042016 | Bacteria | 11631 |
| 276 | Ga0450911_000003 | 3300042115 | Bacteria | 237055 |
| 277 | Ga0450911_000581 | 3300042115 | Bacteria | 11332 |
| 278 | Ga0450917_001206 | 3300042120 | Bacteria | 1874 |
| 279 | Ga0450922_000034 | 3300042124 | Bacteria | 12012 |
| 280 | Ga0450923_000592 | 3300042125 | Bacteria | 4140 |
| 281 | Ga0450904_000051 | 3300042139 | Bacteria | 26256 |
| 282 | Ga0450904_000479 | 3300042139 | Bacteria | 7830 |
| 283 | Ga0450906_007442 | 3300042145 | Bacteria | 2162 |
| 284 | Ga0450907_000760 | 3300042146 | Bacteria | 8157 |
| 285 | Ga0439446_0002675 | 3300042156 | Bacteria | 4308 |
| 286 | Ga0450908_003667 | 3300042184 | Bacteria | 2984 |
| 287 | Ga0439464_0000142 | 3300042439 | Bacteria | 11665 |
| 288 | Ga0439460_0003661 | 3300042461 | Bacteria | 3726 |
| 289 | Ga0450916_000325 | 3300042530 | Bacteria | 3870 |
| 290 | Ga0439440_0001743 | 3300042993 | Bacteria | 4005 |
| 291 | Ga0453684_0052308 | 3300044712 | Bacteria | 5343 |
| 292 | Ga0495617_000582 | 3300046452 | Bacteria | 18600 |
| 293 | Ga0495617_002152 | 3300046452 | Bacteria | 8090 |
| 294 | Ga0495617_010002 | 3300046452 | Bacteria | 3251 |
| 295 | Ga0495617_027341 | 3300046452 | Bacteria | 1919 |
| 296 | Ga0495617_031435 | 3300046452 | Bacteria | 1782 |
| 297 | Ga0495627_000023 | 3300046453 | Bacteria | 251113 |
| 298 | Ga0495627_000134 | 3300046453 | Bacteria | 88155 |
| 299 | Ga0495627_001005 | 3300046453 | Bacteria | 18979 |
| 300 | Ga0495627_002276 | 3300046453 | Bacteria | 9478 |
| 301 | Ga0495627_004374 | 3300046453 | Bacteria | 5933 |
| 302 | Ga0495627_014907 | 3300046453 | Bacteria | 2696 |
| 303 | Ga0495603_0063755 | 3300046455 | Bacteria | 2173 |
| 304 | Ga0495590_0000356 | 3300046457 | Bacteria | 23621 |
| 305 | Ga0495590_0001252 | 3300046457 | Bacteria | 11076 |
| 306 | Ga0495590_0056514 | 3300046457 | Bacteria | 1371 |
| 307 | Ga0495591_000025 | 3300046458 | Bacteria | 189897 |
| 308 | Ga0495591_000728 | 3300046458 | Bacteria | 23844 |
| 309 | Ga0495591_000970 | 3300046458 | Bacteria | 19586 |
| 310 | Ga0495591_001914 | 3300046458 | Bacteria | 12218 |
| 311 | Ga0495591_001960 | 3300046458 | Bacteria | 12021 |
| 312 | Ga0495591_003795 | 3300046458 | Bacteria | 7639 |
| 313 | Ga0495591_006789 | 3300046458 | Bacteria | 4982 |
| 314 | Ga0495591_012572 | 3300046458 | Bacteria | 3144 |
| 315 | Ga0495591_017961 | 3300046458 | Bacteria | 2412 |
| 316 | Ga0495591_025601 | 3300046458 | Bacteria | 1847 |
| 317 | Ga0495638_0002423 | 3300046460 | Bacteria | 15246 |
| 318 | Ga0495638_0009363 | 3300046460 | Bacteria | 6885 |
| 319 | Ga0495638_0016132 | 3300046460 | Bacteria | 5006 |
| 320 | Ga0495638_0022024 | 3300046460 | Bacteria | 4188 |
| 321 | Ga0495638_0023288 | 3300046460 | Bacteria | 4052 |
| 322 | Ga0495638_0026660 | 3300046460 | Bacteria | 3744 |
| 323 | Ga0495638_0077315 | 3300046460 | Bacteria | 2026 |
| 324 | Ga0495653_0002339 | 3300046463 | Bacteria | 15047 |
| 325 | Ga0495653_0003298 | 3300046463 | Bacteria | 12949 |
| 326 | Ga0495653_0017970 | 3300046463 | Bacteria | 5748 |
| 327 | Ga0495650_0002155 | 3300046471 | Bacteria | 16715 |
| 328 | Ga0495650_0003462 | 3300046471 | Bacteria | 11501 |
| 329 | Ga0495650_0009445 | 3300046471 | Bacteria | 5543 |
| 330 | Ga0495650_0016777 | 3300046471 | Bacteria | 3693 |
| 331 | Ga0495605_0001169 | 3300046474 | Bacteria | 17426 |
| 332 | Ga0495605_0003351 | 3300046474 | Bacteria | 9576 |
| 333 | Ga0495605_0015636 | 3300046474 | Bacteria | 4123 |
| 334 | Ga0495605_0040265 | 3300046474 | Bacteria | 2335 |
| 335 | Ga0495639_0000577 | 3300046475 | Bacteria | 17080 |
| 336 | Ga0495639_0015405 | 3300046475 | Bacteria | 3316 |
| 337 | Ga0495584_0001354 | 3300046491 | Bacteria | 14821 |
| 338 | Ga0495584_0007191 | 3300046491 | Bacteria | 5812 |
| 339 | Ga0495584_0010611 | 3300046491 | Bacteria | 4731 |
| 340 | Ga0495584_0020423 | 3300046491 | Bacteria | 3365 |
| 341 | Ga0495584_0031642 | 3300046491 | Bacteria | 2677 |
| 342 | Ga0495584_0039065 | 3300046491 | Bacteria | 2398 |
| 343 | Ga0495584_0055637 | 3300046491 | Bacteria | 1990 |
| 344 | Ga0495585_0000705 | 3300046492 | Bacteria | 30104 |
| 345 | Ga0495585_0001233 | 3300046492 | Bacteria | 20629 |
| 346 | Ga0495585_0003913 | 3300046492 | Bacteria | 9868 |
| 347 | Ga0495585_0012245 | 3300046492 | Bacteria | 5053 |
| 348 | Ga0495585_0014493 | 3300046492 | Bacteria | 4592 |
| 349 | Ga0495585_0018776 | 3300046492 | Bacteria | 3987 |
| 350 | Ga0495585_0021613 | 3300046492 | Bacteria | 3694 |
| 351 | Ga0495594_0066064 | 3300046499 | Bacteria | 2006 |
| 352 | Ga0495596_0000478 | 3300046500 | Bacteria | 25350 |
| 353 | Ga0495607_0000069 | 3300046501 | Bacteria | 101754 |
| 354 | Ga0495607_0001688 | 3300046501 | Bacteria | 19008 |
| 355 | Ga0495607_0003172 | 3300046501 | Bacteria | 12738 |
| 356 | Ga0495607_0003303 | 3300046501 | Bacteria | 12386 |
| 357 | Ga0495607_0004123 | 3300046501 | Bacteria | 10840 |
| 358 | Ga0495607_0009558 | 3300046501 | Bacteria | 6552 |
| 359 | Ga0495607_0011736 | 3300046501 | Bacteria | 5811 |
| 360 | Ga0495607_0012648 | 3300046501 | Bacteria | 5560 |
| 361 | Ga0495607_0055511 | 3300046501 | Bacteria | 2278 |
| 362 | Ga0495607_0090195 | 3300046501 | Bacteria | 1662 |
| 363 | Ga0495607_0119073 | 3300046501 | Bacteria | 1389 |
| 364 | Ga0495583_0002951 | 3300046506 | Bacteria | 13670 |
| 365 | Ga0495583_0003018 | 3300046506 | Bacteria | 13422 |
| 366 | Ga0495583_0043336 | 3300046506 | Bacteria | 2095 |
| 367 | Ga0495583_0053729 | 3300046506 | Bacteria | 1827 |
| 368 | Ga0495606_0004110 | 3300046507 | Bacteria | 14781 |
| 369 | Ga0495606_0006032 | 3300046507 | Bacteria | 11343 |
| 370 | Ga0495606_0006404 | 3300046507 | Bacteria | 10867 |
| 371 | Ga0495606_0010755 | 3300046507 | Bacteria | 7544 |
| 372 | Ga0495606_0018269 | 3300046507 | Bacteria | 5265 |
| 373 | Ga0495606_0022823 | 3300046507 | Bacteria | 4547 |
| 374 | Ga0495606_0070275 | 3300046507 | Bacteria | 2208 |
| 375 | Ga0495606_0089323 | 3300046507 | Bacteria | 1898 |
| 376 | Ga0495610_0002777 | 3300046512 | Bacteria | 14352 |
| 377 | Ga0495610_0005863 | 3300046512 | Bacteria | 8621 |
| 378 | Ga0495610_0013003 | 3300046512 | Bacteria | 4972 |
| 379 | Ga0495610_0023436 | 3300046512 | Bacteria | 3355 |
| 380 | Ga0495616_0002193 | 3300046513 | Bacteria | 13053 |
| 381 | Ga0495616_0002782 | 3300046513 | Bacteria | 11424 |
| 382 | Ga0495616_0017155 | 3300046513 | Bacteria | 3994 |
| 383 | Ga0495616_0057430 | 3300046513 | Bacteria | 1918 |
| 384 | Ga0495616_0072336 | 3300046513 | Bacteria | 1665 |
| 385 | Ga0495620_0000879 | 3300046515 | Bacteria | 18536 |
| 386 | Ga0495620_0001236 | 3300046515 | Bacteria | 15611 |
| 387 | Ga0495620_0001871 | 3300046515 | Bacteria | 12386 |
| 388 | Ga0495620_0005263 | 3300046515 | Bacteria | 7238 |
| 389 | Ga0495620_0005831 | 3300046515 | Bacteria | 6839 |
| 390 | Ga0495620_0082316 | 3300046515 | Bacteria | 1300 |
| 391 | Ga0495630_0128933 | 3300046517 | Bacteria | 1920 |
| 392 | Ga0495631_0000557 | 3300046518 | Bacteria | 24982 |
| 393 | Ga0495631_0001273 | 3300046518 | Bacteria | 15530 |
| 394 | Ga0495631_0001898 | 3300046518 | Bacteria | 12311 |
| 395 | Ga0495631_0009216 | 3300046518 | Bacteria | 4942 |
| 396 | Ga0495631_0022766 | 3300046518 | Bacteria | 2912 |
| 397 | Ga0495631_0100615 | 3300046518 | Bacteria | 1244 |
| 398 | Ga0495632_0002203 | 3300046519 | Bacteria | 15039 |
| 399 | Ga0495632_0002244 | 3300046519 | Bacteria | 14886 |
| 400 | Ga0495632_0002355 | 3300046519 | Bacteria | 14484 |
| 401 | Ga0495632_0006993 | 3300046519 | Bacteria | 7160 |
| 402 | Ga0495632_0028208 | 3300046519 | Bacteria | 2930 |
| 403 | Ga0495632_0044728 | 3300046519 | Bacteria | 2208 |
| 404 | Ga0495632_0064361 | 3300046519 | Bacteria | 1773 |
| 405 | Ga0495632_0070666 | 3300046519 | Bacteria | 1678 |
| 406 | Ga0495632_0071073 | 3300046519 | Bacteria | 1672 |
| 407 | Ga0495637_0000982 | 3300046520 | Bacteria | 18091 |
| 408 | Ga0495637_0001013 | 3300046520 | Bacteria | 17686 |
| 409 | Ga0495637_0002185 | 3300046520 | Bacteria | 10935 |
| 410 | Ga0495637_0004272 | 3300046520 | Bacteria | 7419 |
| 411 | Ga0495637_0005147 | 3300046520 | Bacteria | 6704 |
| 412 | Ga0495637_0007429 | 3300046520 | Bacteria | 5425 |
| 413 | Ga0495637_0016381 | 3300046520 | Bacteria | 3465 |
| 414 | Ga0495637_0018073 | 3300046520 | Bacteria | 3274 |
| 415 | Ga0495637_0018784 | 3300046520 | Bacteria | 3202 |
| 416 | Ga0495637_0020252 | 3300046520 | Bacteria | 3062 |
| 417 | Ga0495637_0024037 | 3300046520 | Bacteria | 2758 |
| 418 | Ga0495637_0034885 | 3300046520 | Bacteria | 2200 |
| 419 | Ga0495637_0053008 | 3300046520 | Bacteria | 1690 |
| 420 | Ga0495637_0057048 | 3300046520 | Bacteria | 1614 |
| 421 | Ga0495643_0001214 | 3300046522 | Bacteria | 24940 |
| 422 | Ga0495643_0006720 | 3300046522 | Bacteria | 7527 |
| 423 | Ga0495643_0013302 | 3300046522 | Bacteria | 4929 |
| 424 | Ga0495643_0030237 | 3300046522 | Bacteria | 3026 |
| 425 | Ga0495643_0056107 | 3300046522 | Bacteria | 2103 |
| 426 | Ga0495643_0087371 | 3300046522 | Bacteria | 1613 |
| 427 | Ga0495644_0000474 | 3300046523 | Bacteria | 17385 |
| 428 | Ga0495644_0033998 | 3300046523 | Bacteria | 1924 |
| 429 | Ga0495644_0045073 | 3300046523 | Bacteria | 1658 |
| 430 | Ga0495648_0001169 | 3300046524 | Bacteria | 26511 |
| 431 | Ga0495648_0001874 | 3300046524 | Bacteria | 20108 |
| 432 | Ga0495648_0002169 | 3300046524 | Bacteria | 18476 |
| 433 | Ga0495648_0004794 | 3300046524 | Bacteria | 11432 |
| 434 | Ga0495648_0005415 | 3300046524 | Bacteria | 10611 |
| 435 | Ga0495648_0023508 | 3300046524 | Bacteria | 4219 |
| 436 | Ga0495648_0028304 | 3300046524 | Bacteria | 3735 |
| 437 | Ga0495648_0038394 | 3300046524 | Bacteria | 3063 |
| 438 | Ga0495648_0093759 | 3300046524 | Bacteria | 1673 |
| 439 | Ga0495648_0094826 | 3300046524 | Bacteria | 1661 |
| 440 | Ga0495648_0139352 | 3300046524 | Bacteria | 1278 |
| 441 | Ga0495642_0000253 | 3300046528 | Bacteria | 29942 |
| 442 | Ga0495642_0000574 | 3300046528 | Bacteria | 18445 |
| 443 | Ga0495642_0001251 | 3300046528 | Bacteria | 11606 |
| 444 | Ga0495654_0000947 | 3300046530 | Bacteria | 21495 |
| 445 | Ga0495654_0001612 | 3300046530 | Bacteria | 15295 |
| 446 | Ga0495654_0002089 | 3300046530 | Bacteria | 13074 |
| 447 | Ga0495654_0002168 | 3300046530 | Bacteria | 12784 |
| 448 | Ga0495654_0002476 | 3300046530 | Bacteria | 11870 |
| 449 | Ga0495654_0010516 | 3300046530 | Bacteria | 5033 |
| 450 | Ga0495654_0015217 | 3300046530 | Bacteria | 4088 |
| 451 | Ga0495654_0018982 | 3300046530 | Bacteria | 3598 |
| 452 | Ga0495654_0023761 | 3300046530 | Bacteria | 3172 |
| 453 | Ga0495654_0028857 | 3300046530 | Bacteria | 2833 |
| 454 | Ga0495654_0031052 | 3300046530 | Bacteria | 2713 |
| 455 | Ga0495654_0047218 | 3300046530 | Bacteria | 2117 |
| 456 | Ga0495587_0009814 | 3300046536 | Bacteria | 6117 |
| 457 | Ga0495609_0000057 | 3300046538 | Bacteria | 143793 |
| 458 | Ga0495609_0010555 | 3300046538 | Bacteria | 4427 |
| 459 | Ga0495609_0012057 | 3300046538 | Bacteria | 4103 |
| 460 | Ga0495609_0016335 | 3300046538 | Bacteria | 3458 |
| 461 | Ga0495609_0126374 | 3300046538 | Bacteria | 1097 |
| 462 | Ga0495597_0000229 | 3300046542 | Bacteria | 50600 |
| 463 | Ga0495597_0001472 | 3300046542 | Bacteria | 16864 |
| 464 | Ga0495597_0002031 | 3300046542 | Bacteria | 13545 |
| 465 | Ga0495597_0004119 | 3300046542 | Bacteria | 8093 |
| 466 | Ga0495597_0010651 | 3300046542 | Bacteria | 4483 |
| 467 | Ga0495597_0031005 | 3300046542 | Bacteria | 2434 |
| 468 | Ga0495622_0000871 | 3300046557 | Bacteria | 16536 |
| 469 | Ga0495622_0001113 | 3300046557 | Bacteria | 14064 |
| 470 | Ga0495622_0003393 | 3300046557 | Bacteria | 7514 |
| 471 | Ga0495622_0051148 | 3300046557 | Bacteria | 1916 |
| 472 | Ga0495633_0002371 | 3300046558 | Bacteria | 13349 |
| 473 | Ga0495656_0032589 | 3300046615 | Bacteria | 2121 |
| 474 | Ga0495668_0001637 | 3300046616 | Bacteria | 20908 |
| 475 | Ga0495668_0010876 | 3300046616 | Bacteria | 5480 |
| 476 | Ga0495668_0011902 | 3300046616 | Bacteria | 5182 |
| 477 | Ga0495668_0013844 | 3300046616 | Bacteria | 4743 |
| 478 | Ga0495611_0000398 | 3300046648 | Bacteria | 27372 |
| 479 | Ga0495625_0001611 | 3300046660 | Bacteria | 26632 |
| 480 | Ga0495625_0005979 | 3300046660 | Bacteria | 10939 |
| 481 | Ga0495625_0008586 | 3300046660 | Bacteria | 8695 |
| 482 | Ga0495625_0010435 | 3300046660 | Bacteria | 7686 |
| 483 | Ga0495625_0015095 | 3300046660 | Bacteria | 6131 |
| 484 | Ga0495625_0024032 | 3300046660 | Bacteria | 4645 |
| 485 | Ga0495625_0028783 | 3300046660 | Bacteria | 4161 |
| 486 | Ga0495625_0055556 | 3300046660 | Bacteria | 2823 |
| 487 | Ga0495625_0061846 | 3300046660 | Bacteria | 2648 |
| 488 | Ga0495635_0002400 | 3300046663 | Bacteria | 12762 |
| 489 | Ga0495635_0014787 | 3300046663 | Bacteria | 5459 |
| 490 | Ga0495659_0024028 | 3300046664 | Bacteria | 2074 |
| 491 | Ga0495661_0000027 | 3300046665 | Bacteria | 184297 |
| 492 | Ga0495661_0000571 | 3300046665 | Bacteria | 38251 |
| 493 | Ga0495661_0003441 | 3300046665 | Bacteria | 11683 |
| 494 | Ga0495661_0012541 | 3300046665 | Bacteria | 5723 |
| 495 | Ga0495661_0027461 | 3300046665 | Bacteria | 3652 |
| 496 | Ga0495661_0129785 | 3300046665 | Bacteria | 1382 |
| 497 | Ga0495661_0132934 | 3300046665 | Bacteria | 1361 |
| 498 | Ga0495588_0003618 | 3300046674 | Bacteria | 6757 |
| 499 | Ga0495588_0015925 | 3300046674 | Bacteria | 3626 |
| 500 | Ga0495623_0004003 | 3300046679 | Bacteria | 9702 |
| 501 | Ga0495646_0003143 | 3300046680 | Bacteria | 10249 |
| 502 | Ga0495646_0014400 | 3300046680 | Bacteria | 5030 |
| 503 | Ga0495613_0023434 | 3300046689 | Bacteria | 4598 |
| 504 | Ga0495624_0001016 | 3300046690 | Bacteria | 22226 |
| 505 | Ga0495670_0000898 | 3300046691 | Bacteria | 14390 |
| 506 | Ga0495670_0001148 | 3300046691 | Bacteria | 12867 |
| 507 | Ga0495670_0001629 | 3300046691 | Bacteria | 10988 |
| 508 | Ga0495671_0000860 | 3300046692 | Bacteria | 21697 |
| 509 | Ga0495671_0001062 | 3300046692 | Bacteria | 19031 |
| 510 | Ga0495671_0002728 | 3300046692 | Bacteria | 11058 |
| 511 | Ga0495671_0003121 | 3300046692 | Bacteria | 10298 |
| 512 | Ga0495671_0006460 | 3300046692 | Bacteria | 6772 |
| 513 | Ga0495671_0016960 | 3300046692 | Bacteria | 3880 |
| 514 | Ga0495671_0025098 | 3300046692 | Bacteria | 3099 |
| 515 | Ga0495671_0031230 | 3300046692 | Bacteria | 2723 |
| 516 | Ga0495671_0073639 | 3300046692 | Bacteria | 1676 |
| 517 | Ga0495671_0082388 | 3300046692 | Bacteria | 1576 |
| 518 | Ga0495671_0087314 | 3300046692 | Bacteria | 1527 |
| 519 | Ga0495671_0096697 | 3300046692 | Bacteria | 1444 |
| 520 | Ga0495649_0000950 | 3300046694 | Bacteria | 22854 |
| 521 | Ga0495649_0003030 | 3300046694 | Bacteria | 11526 |
| 522 | Ga0495649_0009177 | 3300046694 | Bacteria | 5896 |
| 523 | Ga0495649_0009407 | 3300046694 | Bacteria | 5813 |
| 524 | Ga0495649_0012447 | 3300046694 | Bacteria | 4946 |
| 525 | Ga0495649_0024115 | 3300046694 | Bacteria | 3395 |
| 526 | Ga0495649_0094265 | 3300046694 | Bacteria | 1593 |
| 527 | Ga0495649_0096994 | 3300046694 | Bacteria | 1568 |
| 528 | Ga0495649_0180428 | 3300046694 | Bacteria | 1101 |
| 529 | Ga0495589_0001444 | 3300046794 | Bacteria | 13702 |
| 530 | Ga0495589_0006684 | 3300046794 | Bacteria | 6074 |
| 531 | Ga0495589_0011088 | 3300046794 | Bacteria | 4676 |
| 532 | Ga0495589_0013075 | 3300046794 | Bacteria | 4286 |
| 533 | Ga0495600_0015051 | 3300046809 | Bacteria | 4885 |
| 534 | Ga0495660_0001871 | 3300046810 | Bacteria | 13814 |
| 535 | Ga0495660_0001949 | 3300046810 | Bacteria | 13431 |
| 536 | Ga0495660_0004554 | 3300046810 | Bacteria | 8372 |
| 537 | Ga0495660_0009310 | 3300046810 | Bacteria | 5727 |
| 538 | Ga0495660_0009972 | 3300046810 | Bacteria | 5526 |
| 539 | Ga0495660_0010711 | 3300046810 | Bacteria | 5328 |
| 540 | Ga0495660_0013744 | 3300046810 | Bacteria | 4692 |
| 541 | Ga0495660_0020234 | 3300046810 | Bacteria | 3814 |
| 542 | Ga0495660_0037445 | 3300046810 | Bacteria | 2701 |
| 543 | Ga0495660_0066718 | 3300046810 | Bacteria | 1918 |
| 544 | Ga0495660_0071553 | 3300046810 | Bacteria | 1838 |
| 545 | Ga0495660_0100319 | 3300046810 | Bacteria | 1491 |
| 546 | Ga0495660_0101481 | 3300046810 | Bacteria | 1480 |
| 547 | Ga0495604_0004835 | 3300047317 | Bacteria | 10676 |
| 548 | Ga0495604_0042857 | 3300047317 | Bacteria | 3544 |
| 549 | Ga0495636_0008286 | 3300047318 | Bacteria | 4103 |
| 550 | Ga0495674_0010280 | 3300047319 | Bacteria | 8862 |
| 551 | Ga0495672_0001187 | 3300047320 | Bacteria | 26409 |
| 552 | Ga0495672_0001861 | 3300047320 | Bacteria | 20089 |
| 553 | Ga0495672_0002241 | 3300047320 | Bacteria | 17992 |
| 554 | Ga0495672_0002630 | 3300047320 | Bacteria | 16221 |
| 555 | Ga0495672_0004619 | 3300047320 | Bacteria | 11174 |
| 556 | Ga0495672_0008985 | 3300047320 | Bacteria | 7292 |
| 557 | Ga0495672_0009137 | 3300047320 | Bacteria | 7224 |
| 558 | Ga0495672_0009191 | 3300047320 | Bacteria | 7197 |
| 559 | Ga0495672_0033904 | 3300047320 | Bacteria | 3160 |
| 560 | Ga0495672_0034522 | 3300047320 | Bacteria | 3124 |
| 561 | Ga0495672_0051836 | 3300047320 | Bacteria | 2414 |
| 562 | Ga0495672_0061802 | 3300047320 | Bacteria | 2157 |
| 563 | Ga0495672_0102697 | 3300047320 | Bacteria | 1547 |
| 564 | Ga0495672_0171934 | 3300047320 | Bacteria | 1104 |
| 565 | Ga0495676_0024333 | 3300047321 | Bacteria | 5244 |
| 566 | Ga0495676_0037406 | 3300047321 | Bacteria | 4039 |
| 567 | Ga0495680_0008892 | 3300047322 | Bacteria | 9079 |
| 568 | Ga0495680_0040858 | 3300047322 | Bacteria | 3691 |
| 569 | Ga0495680_0158885 | 3300047322 | Bacteria | 1642 |
| 570 | Ga0495680_0305255 | 3300047322 | Bacteria | 1116 |
| 571 | Ga0495683_0000032 | 3300047323 | Bacteria | 149612 |
| 572 | Ga0495683_0000584 | 3300047323 | Bacteria | 27512 |
| 573 | Ga0495683_0000905 | 3300047323 | Bacteria | 20921 |
| 574 | Ga0495683_0011935 | 3300047323 | Bacteria | 4567 |
| 575 | Ga0495683_0017678 | 3300047323 | Bacteria | 3693 |
| 576 | Ga0495683_0022727 | 3300047323 | Bacteria | 3224 |
| 577 | Ga0495687_001410 | 3300047443 | Bacteria | 22145 |
| 578 | Ga0495687_001593 | 3300047443 | Bacteria | 20495 |
| 579 | Ga0495687_001720 | 3300047443 | Bacteria | 19389 |
| 580 | Ga0495675_0007362 | 3300047444 | Bacteria | 6780 |
| 581 | Ga0495675_0195133 | 3300047444 | Bacteria | 1234 |
| 582 | Ga0495677_0001304 | 3300047445 | Bacteria | 9965 |
| 583 | Ga0495679_000721 | 3300047446 | Bacteria | 21281 |
| 584 | Ga0495679_005501 | 3300047446 | Bacteria | 5604 |
| 585 | Ga0495679_006071 | 3300047446 | Bacteria | 5271 |
| 586 | Ga0495679_019394 | 3300047446 | Bacteria | 2390 |
| 587 | Ga0495679_024712 | 3300047446 | Bacteria | 2021 |
| 588 | Ga0495685_038423 | 3300047447 | Bacteria | 1640 |
| 589 | Ga0495673_0001703 | 3300047469 | Bacteria | 16856 |
| 590 | Ga0495673_0001708 | 3300047469 | Bacteria | 16794 |
| 591 | Ga0495673_0001879 | 3300047469 | Bacteria | 15762 |
| 592 | Ga0495673_0002166 | 3300047469 | Bacteria | 14269 |
| 593 | Ga0495673_0003787 | 3300047469 | Bacteria | 9785 |
| 594 | Ga0495673_0004038 | 3300047469 | Bacteria | 9351 |
| 595 | Ga0495673_0004292 | 3300047469 | Bacteria | 8987 |
| 596 | Ga0495673_0005096 | 3300047469 | Bacteria | 8029 |
| 597 | Ga0495673_0005300 | 3300047469 | Bacteria | 7825 |
| 598 | Ga0495673_0011643 | 3300047469 | Bacteria | 4718 |
| 599 | Ga0495673_0050441 | 3300047469 | Bacteria | 1826 |
| 600 | Ga0495673_0061429 | 3300047469 | Bacteria | 1608 |
| 601 | Ga0495681_0001535 | 3300047470 | Bacteria | 17232 |
| 602 | Ga0495681_0002339 | 3300047470 | Bacteria | 13621 |
| 603 | Ga0495681_0002940 | 3300047470 | Bacteria | 12036 |
| 604 | Ga0495681_0004215 | 3300047470 | Bacteria | 9862 |
| 605 | Ga0495681_0005581 | 3300047470 | Bacteria | 8396 |
| 606 | Ga0495681_0014801 | 3300047470 | Bacteria | 4451 |
| 607 | Ga0495681_0015012 | 3300047470 | Bacteria | 4403 |
| 608 | Ga0495681_0022720 | 3300047470 | Bacteria | 3350 |
| 609 | Ga0495681_0041300 | 3300047470 | Bacteria | 2239 |
| 610 | Ga0495681_0048687 | 3300047470 | Bacteria | 2007 |
| 611 | Ga0495684_0025758 | 3300047471 | Bacteria | 4519 |
| 612 | Ga0495686_0005103 | 3300047472 | Bacteria | 10496 |
| 613 | Ga0495686_0006282 | 3300047472 | Bacteria | 9139 |
| 614 | Ga0495686_0015694 | 3300047472 | Bacteria | 5161 |
| 615 | Ga0495593_0067458 | 3300047673 | Bacteria | 1862 |
| 616 | Ga0495602_0030875 | 3300048088 | Bacteria | 5074 |
| 617 | Ga0495626_0000831 | 3300048091 | Bacteria | 27665 |
| 618 | Ga0495626_0001108 | 3300048091 | Bacteria | 22736 |
| 619 | Ga0495626_0002541 | 3300048091 | Bacteria | 12532 |
| 620 | Ga0495626_0005222 | 3300048091 | Bacteria | 7688 |
| 621 | Ga0495626_0006203 | 3300048091 | Bacteria | 6831 |
| 622 | Ga0495626_0016707 | 3300048091 | Bacteria | 3721 |
| 623 | Ga0495626_0053489 | 3300048091 | Bacteria | 1857 |
| 624 | Ga0496102_0002311 | 3300048905 | Bacteria | 16292 |
| 625 | Ga0496103_0002862 | 3300048906 | Bacteria | 10730 |
| 626 | Ga0496116_0002775 | 3300048919 | Bacteria | 18000 |
| 627 | Ga0496116_0004594 | 3300048919 | Bacteria | 13090 |
| 628 | Ga0496116_0006605 | 3300048919 | Bacteria | 10494 |
| 629 | Ga0496116_0007417 | 3300048919 | Bacteria | 9732 |
| 630 | Ga0496116_0014607 | 3300048919 | Bacteria | 6260 |
| 631 | Ga0496117_0005359 | 3300048920 | Bacteria | 13510 |
| 632 | Ga0496117_0031812 | 3300048920 | Bacteria | 4023 |
| 633 | Ga0496117_0211872 | 3300048920 | Bacteria | 1085 |
| 634 | Ga0496117_0211885 | 3300048920 | Bacteria | 1085 |
| 635 | Ga0496118_0007335 | 3300048921 | Bacteria | 11728 |
| 636 | Ga0496118_0007906 | 3300048921 | Bacteria | 11136 |
| 637 | Ga0496118_0009100 | 3300048921 | Bacteria | 10111 |
| 638 | Ga0496118_0036847 | 3300048921 | Bacteria | 3947 |
| 639 | Ga0496118_0079709 | 3300048921 | Bacteria | 2309 |
| 640 | Ga0496118_0156456 | 3300048921 | Bacteria | 1417 |
| 641 | Ga0496119_0000071 | 3300048922 | Bacteria | 153652 |
| 642 | Ga0496120_0002726 | 3300048923 | Bacteria | 17252 |
| 643 | Ga0496121_0007900 | 3300048924 | Bacteria | 12731 |
| 644 | Ga0496121_0037516 | 3300048924 | Bacteria | 4303 |
| 645 | Ga0496122_0002157 | 3300048925 | Bacteria | 28836 |
| 646 | Ga0496122_0006460 | 3300048925 | Bacteria | 13445 |
| 647 | Ga0496122_0010517 | 3300048925 | Bacteria | 9515 |
| 648 | Ga0496122_0037573 | 3300048925 | Bacteria | 3894 |
| 649 | Ga0496122_0094946 | 3300048925 | Bacteria | 2017 |
| 650 | Ga0496123_0001464 | 3300048926 | Bacteria | 32764 |
| 651 | Ga0496123_0011812 | 3300048926 | Bacteria | 7519 |
| 652 | Ga0496123_0016348 | 3300048926 | Bacteria | 6033 |
| 653 | Ga0496123_0049495 | 3300048926 | Bacteria | 2817 |
| 654 | Ga0496123_0143414 | 3300048926 | Bacteria | 1301 |
| 655 | Ga0496124_0000407 | 3300048927 | Bacteria | 78013 |
| 656 | Ga0496124_0005384 | 3300048927 | Bacteria | 14446 |
| 657 | Ga0496124_0006059 | 3300048927 | Bacteria | 13308 |
| 658 | Ga0496124_0015951 | 3300048927 | Bacteria | 7171 |
| 659 | Ga0496124_0022335 | 3300048927 | Bacteria | 5801 |
| 660 | Ga0496124_0039119 | 3300048927 | Bacteria | 4113 |
| 661 | Ga0496124_0039847 | 3300048927 | Bacteria | 4068 |
| 662 | Ga0496124_0188712 | 3300048927 | Bacteria | 1579 |
| 663 | Ga0496124_0352512 | 3300048927 | Bacteria | 1040 |
| 664 | Ga0496125_0002636 | 3300048928 | Bacteria | 22968 |
| 665 | Ga0496125_0002716 | 3300048928 | Bacteria | 22480 |
| 666 | Ga0496125_0017906 | 3300048928 | Bacteria | 6736 |
| 667 | Ga0496126_0062641 | 3300048929 | Bacteria | 3336 |
| 668 | Ga0495678_000541 | 3300049459 | Bacteria | 36468 |
| 669 | Ga0495678_001270 | 3300049459 | Bacteria | 20477 |
| 670 | Ga0495678_001393 | 3300049459 | Bacteria | 19214 |
| 671 | Ga0495678_002041 | 3300049459 | Bacteria | 14449 |
| 672 | Ga0495678_003217 | 3300049459 | Bacteria | 10254 |
| 673 | Ga0495678_008652 | 3300049459 | Bacteria | 5116 |
| 674 | Ga0495678_028588 | 3300049459 | Bacteria | 2350 |
| 675 | Ga0495678_036912 | 3300049459 | Bacteria | 1990 |
| 676 | Ga0495678_052112 | 3300049459 | Bacteria | 1577 |
| 677 | Ga0495682_0001635 | 3300049460 | Bacteria | 11536 |
| 678 | Ga0495682_0003896 | 3300049460 | Bacteria | 6520 |
| 679 | Ga0495682_0022278 | 3300049460 | Bacteria | 2369 |
| 680 | Ga0495682_0055634 | 3300049460 | Bacteria | 1434 |
| 681 | Ga0501032_0041522 | 3300049569 | Bacteria | 3123 |
| 682 | Ga0501033_0093077 | 3300049570 | Bacteria | 2204 |
| 683 | Ga0501034_0041130 | 3300049571 | Bacteria | 4676 |
| 684 | Ga0501034_0150183 | 3300049571 | Bacteria | 2306 |
| 685 | Ga0501034_0179197 | 3300049571 | Bacteria | 2084 |
| 686 | Ga0501037_0101041 | 3300049573 | Bacteria | 2082 |
| 687 | Ga0501035_0204272 | 3300049822 | Bacteria | 1693 |
| 688 | Ga0501226_000065 | 3300049853 | Bacteria | 34452 |
| 689 | nmdc:mga03683_579_c1 | 3300050489 | Bacteria | 10505 |
| 690 | Ga0500572_003770 | 3300053111 | Bacteria | 3439 |
| 691 | Ga0500659_0005178 | 3300053135 | Bacteria | 7339 |
| 692 | Ga0500573_0036557 | 3300053140 | Bacteria | 2836 |
| 693 | Ga0500634_0013813 | 3300053161 | Bacteria | 4244 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842815866 | 2842819367 | 253 |
| 2 | iso_pu_bacteria | 2842849001 | 2842852345 | 253 |
| 3 | 3300046506 | Ga0495583_0003018 | Ga0495583_0003018_12445_13338 | 270 |
| 4 | 3300013102 | Ga0157371_10002492 | Ga0157371_1000249210 | 271 |
| 5 | 3300013100 | Ga0157373_10204153 | Ga0157373_102041532 | 275 |
| 6 | 3300049570 | Ga0501033_0093077 | Ga0501033_0093077_832_1719 | 278 |
| 7 | 3300049571 | Ga0501034_0179197 | Ga0501034_0179197_442_1329 | 278 |
| 8 | 3300049822 | Ga0501035_0204272 | Ga0501035_0204272_665_1552 | 278 |
| 9 | 3300049853 | Ga0501226_000065 | Ga0501226_000065_10919_11806 | 278 |
| 10 | 3300042013 | Ga0439456_004119 | Ga0439456_004119_1505_2392 | 279 |
| 11 | 3300042115 | Ga0450911_000003 | Ga0450911_000003_167265_168152 | 279 |
| 12 | 3300042120 | Ga0450917_001206 | Ga0450917_001206_716_1603 | 279 |
| 13 | 3300042530 | Ga0450916_000325 | Ga0450916_000325_800_1687 | 279 |
| 14 | 3300048921 | Ga0496118_0156456 | Ga0496118_0156456_183_1076 | 279 |
| 15 | 3300048927 | Ga0496124_0039847 | Ga0496124_0039847_648_1541 | 279 |
| 16 | 3300025935 | Ga0207709_10008628 | Ga0207709_100086287 | 280 |
| 17 | 3300042139 | Ga0450904_000051 | Ga0450904_000051_2931_3818 | 280 |
| 18 | 3300042439 | Ga0439464_0000142 | Ga0439464_0000142_7942_8835 | 280 |
| 19 | 3300042006 | Ga0439432_035953 | Ga0439432_035953_304_1197 | 281 |
| 20 | 3300047323 | Ga0495683_0022727 | Ga0495683_0022727_511_1356 | 281 |
| 21 | iso_pu_bacteria | 2643221672 | 2644398185 | 281 |
| 22 | iso_pu_bacteria | 2904456579 | 2904459093 | 281 |
| 23 | iso_pu_bacteria | 2929520902 | 2929522408 | 281 |
| 24 | 3300046458 | Ga0495591_001960 | Ga0495591_001960_3049_3936 | 282 |
| 25 | 3300006944 | Ga0099823_1001650 | Ga0099823_100165010 | 283 |
| 26 | 3300009036 | Ga0105244_10001478 | Ga0105244_100014789 | 283 |
| 27 | 3300009036 | Ga0105244_10065901 | Ga0105244_100659012 | 283 |
| 28 | 3300013104 | Ga0157370_10133835 | Ga0157370_101338352 | 283 |
| 29 | 3300025711 | Ga0207696_1002997 | Ga0207696_10029978 | 283 |
| 30 | 3300025711 | Ga0207696_1037243 | Ga0207696_10372432 | 283 |
| 31 | 3300025728 | Ga0207655_1000455 | Ga0207655_100045510 | 283 |
| 32 | 3300025728 | Ga0207655_1000847 | Ga0207655_100084710 | 283 |
| 33 | 3300027296 | Ga0209389_1000095 | Ga0209389_10000955 | 283 |
| 34 | 3300042006 | Ga0439432_000859 | Ga0439432_000859_4067_4954 | 283 |
| 35 | 3300046522 | Ga0495643_0006720 | Ga0495643_0006720_6586_7473 | 283 |
| 36 | 3300048920 | Ga0496117_0031812 | Ga0496117_0031812_3059_3946 | 283 |
| 37 | 3300048921 | Ga0496118_0009100 | Ga0496118_0009100_3099_3986 | 283 |
| 38 | 3300048925 | Ga0496122_0002157 | Ga0496122_0002157_26554_27441 | 283 |
| 39 | 3300048925 | Ga0496122_0094946 | Ga0496122_0094946_792_1679 | 283 |
| 40 | 3300048926 | Ga0496123_0001464 | Ga0496123_0001464_30482_31369 | 283 |
| 41 | 3300048927 | Ga0496124_0006059 | Ga0496124_0006059_8946_9833 | 283 |
| 42 | 3300049571 | Ga0501034_0041130 | Ga0501034_0041130_831_1718 | 283 |
| 43 | 3300053135 | Ga0500659_0005178 | Ga0500659_0005178_663_1550 | 283 |
| 44 | 3300032002 | Ga0307416_100162343 | Ga0307416_1001623432 | 284 |
| 45 | 3300046522 | Ga0495643_0001214 | Ga0495643_0001214_14616_15506 | 284 |
| 46 | iso_pu_bacteria | 2904449895 | 2904453576 | 284 |
| 47 | 3300003792 | Ga0055540_1001425 | Ga0055540_100142510 | 285 |
| 48 | 3300005289 | Ga0065704_10001207 | Ga0065704_100012079 | 285 |
| 49 | 3300006177 | Ga0075362_10001209 | Ga0075362_100012095 | 285 |
| 50 | 3300014497 | Ga0182008_10014722 | Ga0182008_100147223 | 285 |
| 51 | 3300015261 | Ga0182006_1033011 | Ga0182006_10330114 | 285 |
| 52 | 3300025303 | Ga0209051_1000144 | Ga0209051_1000144110 | 285 |
| 53 | 3300025711 | Ga0207696_1000064 | Ga0207696_100006490 | 285 |
| 54 | 3300025728 | Ga0207655_1032389 | Ga0207655_10323892 | 285 |
| 55 | 3300025735 | Ga0207713_1015928 | Ga0207713_10159283 | 285 |
| 56 | 3300031548 | Ga0307408_100001812 | Ga0307408_1000018128 | 285 |
| 57 | 3300031731 | Ga0307405_10431161 | Ga0307405_104311612 | 285 |
| 58 | 3300031901 | Ga0307406_10000970 | Ga0307406_100009706 | 285 |
| 59 | 3300046515 | Ga0495620_0001871 | Ga0495620_0001871_11430_12320 | 285 |
| 60 | 3300046519 | Ga0495632_0070666 | Ga0495632_0070666_38_928 | 285 |
| 61 | 3300046524 | Ga0495648_0094826 | Ga0495648_0094826_39_929 | 285 |
| 62 | 3300048920 | Ga0496117_0005359 | Ga0496117_0005359_9583_10470 | 285 |
| 63 | 3300048921 | Ga0496118_0036847 | Ga0496118_0036847_93_980 | 285 |
| 64 | 3300048926 | Ga0496123_0049495 | Ga0496123_0049495_232_1119 | 285 |
| 65 | 3300048927 | Ga0496124_0015951 | Ga0496124_0015951_6197_7084 | 285 |
| 66 | 3300048928 | Ga0496125_0002636 | Ga0496125_0002636_12650_13537 | 285 |
| 67 | 3300048929 | Ga0496126_0062641 | Ga0496126_0062641_1706_2593 | 285 |
| 68 | 3300050489 | nmdc:mga03683_579_c1 | nmdc:mga03683_579_c1_7756_8628 | 285 |
| 69 | 3300003578 | Ga0006562J51391_1056221 | Ga0006562J51391_10562212 | 286 |
| 70 | 3300003578 | Ga0006562J51391_1056222 | Ga0006562J51391_10562228 | 286 |
| 71 | 3300025292 | Ga0209676_1000917 | Ga0209676_100091726 | 286 |
| 72 | 3300041405 | Ga0439438_000779 | Ga0439438_000779_8766_9662 | 286 |
| 73 | 3300044712 | Ga0453684_0052308 | Ga0453684_0052308_190_1098 | 286 |
| 74 | 3300048927 | Ga0496124_0039119 | Ga0496124_0039119_415_1302 | 286 |
| 75 | 3300037471 | Ga0395905_0010256 | Ga0395905_0010256_2385_3281 | 287 |
| 76 | 3300047320 | Ga0495672_0001187 | Ga0495672_0001187_1552_2418 | 287 |
| 77 | iso_pu_bacteria | 2917832318 | 2917834574 | 287 |
| 78 | iso_pu_bacteria | 2919125081 | 2919127218 | 287 |
| 79 | iso_pu_bacteria | 2984504281 | 2984506952 | 287 |
| 80 | iso_pu_bacteria | 2599185167 | 2599400758 | 288 |
| 81 | iso_pu_bacteria | 2599185179 | 2599450085 | 288 |
| 82 | iso_pu_bacteria | 2599185190 | 2599512157 | 288 |
| 83 | iso_pu_bacteria | 2599185191 | 2599517138 | 288 |
| 84 | iso_pu_bacteria | 2599185288 | 2599878821 | 288 |
| 85 | iso_pu_bacteria | 2599185290 | 2599892481 | 288 |
| 86 | iso_pu_bacteria | 2738541294 | 2738807038 | 288 |
| 87 | iso_pu_bacteria | 2738541309 | 2738894398 | 288 |
| 88 | iso_pu_bacteria | 2947233263 | 2947234205 | 288 |
| 89 | iso_pu_bacteria | 8056148874 | 8056151716 | 288 |
| 90 | iso_pu_bacteria | 2510065053 | 2510285356 | 289 |
| 91 | iso_pu_bacteria | 2510065055 | 2510294772 | 289 |
| 92 | iso_pu_bacteria | 2510065058 | 2510311368 | 289 |
| 93 | iso_pu_bacteria | 2773857672 | 2774129606 | 289 |
| 94 | iso_pu_bacteria | 2919155634 | 2919155733 | 289 |
| 95 | iso_pu_bacteria | 2974298342 | 2974301993 | 289 |
| 96 | iso_pu_bacteria | 2984499530 | 2984500439 | 289 |
| 97 | iso_pu_bacteria | 8011350971 | 8011352503 | 289 |
| 98 | iso_pu_bacteria | 2511231007 | 2511270896 | 290 |
| 99 | iso_pu_bacteria | 2597489888 | 2597866412 | 290 |
| 100 | iso_pu_bacteria | 2597489889 | 2597872255 | 290 |
| 101 | iso_pu_bacteria | 2599185189 | 2599505542 | 290 |
| 102 | iso_pu_bacteria | 2600255296 | 2601693654 | 290 |
| 103 | iso_pu_bacteria | 2623620446 | 2624494720 | 290 |
| 104 | iso_pu_bacteria | 2721755607 | 2723251151 | 290 |
| 105 | iso_pu_bacteria | 2808606373 | 2808906349 | 290 |
| 106 | iso_pu_bacteria | 2842826826 | 2842829224 | 290 |
| 107 | iso_pu_bacteria | 2842837860 | 2842842073 | 290 |
| 108 | iso_pu_bacteria | 2919501602 | 2919505669 | 290 |
| 109 | iso_pu_bacteria | 2919697872 | 2919700784 | 290 |
| 110 | iso_pu_bacteria | 2926063275 | 2926068053 | 290 |
| 111 | iso_pu_bacteria | 2929189879 | 2929194933 | 290 |
| 112 | iso_pu_bacteria | 8019775933 | 8019777892 | 290 |
| 113 | iso_pu_bacteria | 8054347763 | 8054349792 | 290 |
| 114 | iso_pu_bacteria | 8056155041 | 8056160631 | 290 |
| 115 | iso_pu_bacteria | 2511231006 | 2511265662 | 291 |
| 116 | iso_pu_bacteria | 2511231008 | 2511279504 | 291 |
| 117 | iso_pu_bacteria | 2511231011 | 2511294543 | 291 |
| 118 | iso_pu_bacteria | 2511231012 | 2511304699 | 291 |
| 119 | iso_pu_bacteria | 2511231014 | 2511311273 | 291 |
| 120 | iso_pu_bacteria | 2511231015 | 2511318009 | 291 |
| 121 | iso_pu_bacteria | 2511231017 | 2511333215 | 291 |
| 122 | iso_pu_bacteria | 2511231020 | 2511349274 | 291 |
| 123 | iso_pu_bacteria | 2511231021 | 2511355360 | 291 |
| 124 | iso_pu_bacteria | 2511231023 | 2511367081 | 291 |
| 125 | iso_pu_bacteria | 2511231024 | 2511376013 | 291 |
| 126 | iso_pu_bacteria | 2511231031 | 2511411566 | 291 |
| 127 | iso_pu_bacteria | 2512047018 | 2512327592 | 291 |
| 128 | iso_pu_bacteria | 2554235231 | 2555247811 | 291 |
| 129 | iso_pu_bacteria | 2582580891 | 2583795157 | 291 |
| 130 | iso_pu_bacteria | 2597489887 | 2597860674 | 291 |
| 131 | iso_pu_bacteria | 2599185155 | 2599330728 | 291 |
| 132 | iso_pu_bacteria | 2599185185 | 2599486093 | 291 |
| 133 | iso_pu_bacteria | 2599185257 | 2599804874 | 291 |
| 134 | iso_pu_bacteria | 2599185303 | 2599951033 | 291 |
| 135 | iso_pu_bacteria | 2599185307 | 2599975156 | 291 |
| 136 | iso_pu_bacteria | 2619619299 | 2621297052 | 291 |
| 137 | iso_pu_bacteria | 2623620443 | 2624483195 | 291 |
| 138 | iso_pu_bacteria | 2643221565 | 2643842759 | 291 |
| 139 | iso_pu_bacteria | 2643221571 | 2643872049 | 291 |
| 140 | iso_pu_bacteria | 2643221589 | 2643955845 | 291 |
| 141 | iso_pu_bacteria | 2643221602 | 2644020639 | 291 |
| 142 | iso_pu_bacteria | 2643221633 | 2644186155 | 291 |
| 143 | iso_pu_bacteria | 2671180172 | 2671771881 | 291 |
| 144 | iso_pu_bacteria | 2675903420 | 2677896914 | 291 |
| 145 | iso_pu_bacteria | 2713897148 | 2715750036 | 291 |
| 146 | iso_pu_bacteria | 2718217725 | 2718636398 | 291 |
| 147 | iso_pu_bacteria | 2738541265 | 2738671873 | 291 |
| 148 | iso_pu_bacteria | 2738541271 | 2738690246 | 291 |
| 149 | iso_pu_bacteria | 2738541282 | 2738750267 | 291 |
| 150 | iso_pu_bacteria | 2738541303 | 2738859307 | 291 |
| 151 | iso_pu_bacteria | 2738543004 | 2739198846 | 291 |
| 152 | iso_pu_bacteria | 2738543015 | 2739261575 | 291 |
| 153 | iso_pu_bacteria | 2738543016 | 2739266020 | 291 |
| 154 | iso_pu_bacteria | 2738543020 | 2739289708 | 291 |
| 155 | iso_pu_bacteria | 2738543021 | 2739295020 | 291 |
| 156 | iso_pu_bacteria | 2738543025 | 2739312727 | 291 |
| 157 | iso_pu_bacteria | 2740892503 | 2743740221 | 291 |
| 158 | iso_pu_bacteria | 2765235841 | 2765586420 | 291 |
| 159 | iso_pu_bacteria | 2773857670 | 2774118597 | 291 |
| 160 | iso_pu_bacteria | 2773857673 | 2774135784 | 291 |
| 161 | iso_pu_bacteria | 2784132063 | 2784262037 | 291 |
| 162 | iso_pu_bacteria | 2784132072 | 2784313270 | 291 |
| 163 | iso_pu_bacteria | 2806310737 | 2807410665 | 291 |
| 164 | iso_pu_bacteria | 2806310745 | 2807459006 | 291 |
| 165 | iso_pu_bacteria | 2808606377 | 2808928664 | 291 |
| 166 | iso_pu_bacteria | 2808606381 | 2808950153 | 291 |
| 167 | iso_pu_bacteria | 2808606385 | 2808975928 | 291 |
| 168 | iso_pu_bacteria | 2808606388 | 2808993037 | 291 |
| 169 | iso_pu_bacteria | 2811994881 | 2812369281 | 291 |
| 170 | iso_pu_bacteria | 2816332298 | 2817493834 | 291 |
| 171 | iso_pu_bacteria | 2818991456 | 2819654917 | 291 |
| 172 | iso_pu_bacteria | 2823421272 | 2823421792 | 291 |
| 173 | iso_pu_bacteria | 2826581358 | 2826582010 | 291 |
| 174 | iso_pu_bacteria | 2834028612 | 2834030741 | 291 |
| 175 | iso_pu_bacteria | 2842832357 | 2842833256 | 291 |
| 176 | iso_pu_bacteria | 2842843487 | 2842845484 | 291 |
| 177 | iso_pu_bacteria | 2852612431 | 2852616139 | 291 |
| 178 | iso_pu_bacteria | 2852657418 | 2852662464 | 291 |
| 179 | iso_pu_bacteria | 2852667396 | 2852671107 | 291 |
| 180 | iso_pu_bacteria | 2860339153 | 2860341501 | 291 |
| 181 | iso_pu_bacteria | 2880230671 | 2880235780 | 291 |
| 182 | iso_pu_bacteria | 2904518522 | 2904519169 | 291 |
| 183 | iso_pu_bacteria | 2904550169 | 2904552198 | 291 |
| 184 | iso_pu_bacteria | 2908446538 | 2908452355 | 291 |
| 185 | iso_pu_bacteria | 2912963787 | 2912968699 | 291 |
| 186 | iso_pu_bacteria | 2919063839 | 2919065740 | 291 |
| 187 | iso_pu_bacteria | 2919385768 | 2919389405 | 291 |
| 188 | iso_pu_bacteria | 2919456309 | 2919457336 | 291 |
| 189 | iso_pu_bacteria | 2919487758 | 2919488370 | 291 |
| 190 | iso_pu_bacteria | 2923153595 | 2923159313 | 291 |
| 191 | iso_pu_bacteria | 2923519811 | 2923523366 | 291 |
| 192 | iso_pu_bacteria | 2931390751 | 2931396204 | 291 |
| 193 | iso_pu_bacteria | 2931396565 | 2931397854 | 291 |
| 194 | iso_pu_bacteria | 2939636861 | 2939642082 | 291 |
| 195 | iso_pu_bacteria | 2939651529 | 2939654039 | 291 |
| 196 | iso_pu_bacteria | 2945928738 | 2945931128 | 291 |
| 197 | iso_pu_bacteria | 2945961074 | 2945966625 | 291 |
| 198 | iso_pu_bacteria | 2946006987 | 2946007153 | 291 |
| 199 | iso_pu_bacteria | 2946027586 | 2946027692 | 291 |
| 200 | iso_pu_bacteria | 2969304461 | 2969309960 | 291 |
| 201 | iso_pu_bacteria | 2974289157 | 2974294291 | 291 |
| 202 | iso_pu_bacteria | 2990196909 | 2990199557 | 291 |
| 203 | iso_pu_bacteria | 2998139840 | 2998145186 | 291 |
| 204 | iso_pu_bacteria | 3007252601 | 3007254680 | 291 |
| 205 | iso_pu_bacteria | 3007315729 | 3007316542 | 291 |
| 206 | iso_pu_bacteria | 3007614139 | 3007616544 | 291 |
| 207 | iso_pu_bacteria | 3007718800 | 3007719297 | 291 |
| 208 | iso_pu_bacteria | 3007803356 | 3007805369 | 291 |
| 209 | iso_pu_bacteria | 3007855910 | 3007858103 | 291 |
| 210 | iso_pu_bacteria | 3007872151 | 3007872404 | 291 |
| 211 | iso_pu_bacteria | 8015687852 | 8015693402 | 291 |
| 212 | iso_pu_bacteria | 8029995093 | 8029995710 | 291 |
| 213 | iso_pu_bacteria | 8034962539 | 8034966408 | 291 |
| 214 | iso_pu_bacteria | 8052494512 | 8052499634 | 291 |
| 215 | iso_pu_bacteria | 8054285046 | 8054291592 | 291 |
| 216 | iso_pu_bacteria | 8054503363 | 8054508705 | 291 |
| 217 | iso_pu_bacteria | 8054929484 | 8054934191 | 291 |
| 218 | iso_pu_bacteria | 8055770955 | 8055776653 | 291 |
| 219 | iso_pu_bacteria | 8055817908 | 8055823679 | 291 |
| 220 | iso_pu_bacteria | 8056115690 | 8056115957 | 291 |
| 221 | iso_pu_bacteria | 8056120720 | 8056121089 | 291 |
| 222 | iso_pu_bacteria | 8056125926 | 8056131396 | 291 |
| 223 | iso_pu_bacteria | 8056131705 | 8056137106 | 291 |
| 224 | iso_pu_bacteria | 8056137416 | 8056137806 | 291 |
| 225 | iso_pu_bacteria | 8056161164 | 8056163405 | 291 |
| 226 | iso_pu_bacteria | 8056166840 | 8056171382 | 291 |
| 227 | iso_pu_bacteria | 8056172158 | 8056177626 | 291 |
| 228 | iso_pu_bacteria | 8056177738 | 8056181792 | 291 |
| 229 | iso_pu_bacteria | 8056569372 | 8056570253 | 291 |
| 230 | 3300005578 | Ga0068854_100003965 | Ga0068854_1000039655 | 292 |
| 231 | 3300013105 | Ga0157369_10057638 | Ga0157369_100576385 | 292 |
| 232 | 3300015261 | Ga0182006_1001598 | Ga0182006_10015989 | 292 |
| 233 | 3300025735 | Ga0207713_1001139 | Ga0207713_100113920 | 292 |
| 234 | 3300031731 | Ga0307405_10019766 | Ga0307405_100197664 | 292 |
| 235 | 3300031911 | Ga0307412_10024028 | Ga0307412_100240284 | 292 |
| 236 | 3300046463 | Ga0495653_0002339 | Ga0495653_0002339_12682_13560 | 292 |
| 237 | 3300046492 | Ga0495585_0000705 | Ga0495585_0000705_26183_27061 | 292 |
| 238 | 3300046507 | Ga0495606_0018269 | Ga0495606_0018269_2726_3604 | 292 |
| 239 | 3300046507 | Ga0495606_0022823 | Ga0495606_0022823_2625_3503 | 292 |
| 240 | 3300046518 | Ga0495631_0100615 | Ga0495631_0100615_273_1151 | 292 |
| 241 | 3300046665 | Ga0495661_0000027 | Ga0495661_0000027_27746_28624 | 292 |
| 242 | 3300047470 | Ga0495681_0015012 | Ga0495681_0015012_497_1375 | 292 |
| 243 | 3300049459 | Ga0495678_008652 | Ga0495678_008652_819_1697 | 292 |
| 244 | 3300005288 | Ga0065714_10079851 | Ga0065714_100798513 | 293 |
| 245 | 3300009011 | Ga0105251_10001642 | Ga0105251_100016429 | 293 |
| 246 | 3300009036 | Ga0105244_10082667 | Ga0105244_100826672 | 293 |
| 247 | 3300013105 | Ga0157369_10007915 | Ga0157369_1000791510 | 293 |
| 248 | 3300013307 | Ga0157372_10012514 | Ga0157372_100125143 | 293 |
| 249 | 3300013307 | Ga0157372_10059867 | Ga0157372_100598672 | 293 |
| 250 | 3300025728 | Ga0207655_1017834 | Ga0207655_10178342 | 293 |
| 251 | 3300025735 | Ga0207713_1008495 | Ga0207713_10084952 | 293 |
| 252 | 3300027312 | Ga0209371_1004519 | Ga0209371_10045196 | 293 |
| 253 | 3300030500 | Ga0268256_1003588 | Ga0268256_10035882 | 293 |
| 254 | 3300039110 | Ga0400487_09819 | Ga0400487_09819_107_1006 | 293 |
| 255 | 3300046491 | Ga0495584_0007191 | Ga0495584_0007191_562_1443 | 293 |
| 256 | 3300048922 | Ga0496119_0000071 | Ga0496119_0000071_115936_116817 | 293 |
| 257 | 3300048923 | Ga0496120_0002726 | Ga0496120_0002726_3296_4177 | 293 |
| 258 | 3300002738 | JGI25154J39366_1005394 | JGI25154J39366_10053941 | 294 |
| 259 | 3300003751 | Ga0055538_1000074 | Ga0055538_100007468 | 294 |
| 260 | 3300003752 | Ga0055539_1000112 | Ga0055539_100011268 | 294 |
| 261 | 3300003756 | Ga0055533_1000118 | Ga0055533_100011868 | 294 |
| 262 | 3300003758 | Ga0055532_1000106 | Ga0055532_100010615 | 294 |
| 263 | 3300003759 | Ga0055525_1000157 | Ga0055525_100015715 | 294 |
| 264 | 3300003761 | Ga0055535_1002953 | Ga0055535_10029535 | 294 |
| 265 | 3300003841 | Ga0055541_1000075 | Ga0055541_100007568 | 294 |
| 266 | 3300005288 | Ga0065714_10006723 | Ga0065714_100067232 | 294 |
| 267 | 3300006058 | Ga0075432_10009609 | Ga0075432_100096093 | 294 |
| 268 | 3300009036 | Ga0105244_10037387 | Ga0105244_100373872 | 294 |
| 269 | 3300014497 | Ga0182008_10018747 | Ga0182008_100187474 | 294 |
| 270 | 3300014497 | Ga0182008_10021787 | Ga0182008_100217872 | 294 |
| 271 | 3300015261 | Ga0182006_1001586 | Ga0182006_10015864 | 294 |
| 272 | 3300015262 | Ga0182007_10001004 | Ga0182007_1000100411 | 294 |
| 273 | 3300015265 | Ga0182005_1003776 | Ga0182005_10037762 | 294 |
| 274 | 3300025224 | Ga0209784_100007 | Ga0209784_100007596 | 294 |
| 275 | 3300025225 | Ga0209566_100062 | Ga0209566_10006281 | 294 |
| 276 | 3300025226 | Ga0209674_100132 | Ga0209674_10013215 | 294 |
| 277 | 3300025229 | Ga0209147_100009 | Ga0209147_100009596 | 294 |
| 278 | 3300025230 | Ga0209563_100018 | Ga0209563_100018596 | 294 |
| 279 | 3300025242 | Ga0209258_100330 | Ga0209258_10033039 | 294 |
| 280 | 3300025246 | Ga0209646_1000185 | Ga0209646_100018510 | 294 |
| 281 | 3300025253 | Ga0209677_100056 | Ga0209677_10005681 | 294 |
| 282 | 3300025256 | Ga0209759_1014981 | Ga0209759_10149811 | 294 |
| 283 | 3300025728 | Ga0207655_1002303 | Ga0207655_10023032 | 294 |
| 284 | 3300028573 | Ga0265334_10000011 | Ga0265334_10000011104 | 294 |
| 285 | 3300037068 | Ga0373925_0199427 | Ga0373925_0199427_117_1019 | 294 |
| 286 | 3300042006 | Ga0439432_009057 | Ga0439432_009057_2386_3270 | 294 |
| 287 | 3300042009 | Ga0439451_005341 | Ga0439451_005341_449_1336 | 294 |
| 288 | 3300046452 | Ga0495617_000582 | Ga0495617_000582_5397_6281 | 294 |
| 289 | 3300046457 | Ga0495590_0001252 | Ga0495590_0001252_5303_6187 | 294 |
| 290 | 3300046475 | Ga0495639_0000577 | Ga0495639_0000577_6666_7550 | 294 |
| 291 | 3300046491 | Ga0495584_0001354 | Ga0495584_0001354_7463_8347 | 294 |
| 292 | 3300046491 | Ga0495584_0031642 | Ga0495584_0031642_937_1821 | 294 |
| 293 | 3300046501 | Ga0495607_0001688 | Ga0495607_0001688_7561_8445 | 294 |
| 294 | 3300046501 | Ga0495607_0004123 | Ga0495607_0004123_8158_9042 | 294 |
| 295 | 3300046506 | Ga0495583_0053729 | Ga0495583_0053729_555_1439 | 294 |
| 296 | 3300046513 | Ga0495616_0002193 | Ga0495616_0002193_2758_3642 | 294 |
| 297 | 3300046519 | Ga0495632_0002244 | Ga0495632_0002244_8381_9265 | 294 |
| 298 | 3300046520 | Ga0495637_0020252 | Ga0495637_0020252_2115_2999 | 294 |
| 299 | 3300046528 | Ga0495642_0000574 | Ga0495642_0000574_15106_15990 | 294 |
| 300 | 3300046530 | Ga0495654_0002168 | Ga0495654_0002168_2554_3438 | 294 |
| 301 | 3300046530 | Ga0495654_0023761 | Ga0495654_0023761_1557_2441 | 294 |
| 302 | 3300046538 | Ga0495609_0012057 | Ga0495609_0012057_2932_3816 | 294 |
| 303 | 3300046538 | Ga0495609_0016335 | Ga0495609_0016335_732_1616 | 294 |
| 304 | 3300046557 | Ga0495622_0000871 | Ga0495622_0000871_9490_10374 | 294 |
| 305 | 3300046660 | Ga0495625_0015095 | Ga0495625_0015095_1259_2143 | 294 |
| 306 | 3300046660 | Ga0495625_0055556 | Ga0495625_0055556_1100_1984 | 294 |
| 307 | 3300046691 | Ga0495670_0000898 | Ga0495670_0000898_6184_7068 | 294 |
| 308 | 3300046692 | Ga0495671_0003121 | Ga0495671_0003121_912_1796 | 294 |
| 309 | 3300046694 | Ga0495649_0000950 | Ga0495649_0000950_5078_5962 | 294 |
| 310 | 3300046794 | Ga0495589_0013075 | Ga0495589_0013075_1019_1903 | 294 |
| 311 | 3300046810 | Ga0495660_0037445 | Ga0495660_0037445_737_1621 | 294 |
| 312 | 3300047318 | Ga0495636_0008286 | Ga0495636_0008286_2932_3816 | 294 |
| 313 | 3300047320 | Ga0495672_0061802 | Ga0495672_0061802_288_1172 | 294 |
| 314 | 3300047320 | Ga0495672_0102697 | Ga0495672_0102697_576_1460 | 294 |
| 315 | 3300047323 | Ga0495683_0017678 | Ga0495683_0017678_1743_2627 | 294 |
| 316 | 3300047443 | Ga0495687_001720 | Ga0495687_001720_1696_2580 | 294 |
| 317 | 3300047469 | Ga0495673_0003787 | Ga0495673_0003787_5970_6854 | 294 |
| 318 | 3300048091 | Ga0495626_0002541 | Ga0495626_0002541_9517_10401 | 294 |
| 319 | 3300048091 | Ga0495626_0006203 | Ga0495626_0006203_2425_3309 | 294 |
| 320 | 3300048919 | Ga0496116_0006605 | Ga0496116_0006605_2124_3008 | 294 |
| 321 | 3300048924 | Ga0496121_0037516 | Ga0496121_0037516_637_1521 | 294 |
| 322 | 3300048925 | Ga0496122_0006460 | Ga0496122_0006460_3619_4503 | 294 |
| 323 | 3300049459 | Ga0495678_001270 | Ga0495678_001270_2572_3456 | 294 |
| 324 | 3300049459 | Ga0495678_002041 | Ga0495678_002041_6354_7238 | 294 |
| 325 | 2124908027 | MRS2a_Contig_1749 | MRS2a_00606860 | 295 |
| 326 | 3300001915 | JGI24741J21665_1002957 | JGI24741J21665_10029573 | 295 |
| 327 | 3300002737 | JGI25162J39368_1000076 | JGI25162J39368_100007660 | 295 |
| 328 | 3300002737 | JGI25162J39368_1000104 | JGI25162J39368_100010468 | 295 |
| 329 | 3300002771 | JGI25163J39215_1000198 | JGI25163J39215_10001989 | 295 |
| 330 | 3300002772 | JGI25164J39214_1000083 | JGI25164J39214_100008319 | 295 |
| 331 | 3300002772 | JGI25164J39214_1000084 | JGI25164J39214_100008460 | 295 |
| 332 | 3300003214 | JGI25165J46597_1000140 | JGI25165J46597_100014045 | 295 |
| 333 | 3300003214 | JGI25165J46597_1000186 | JGI25165J46597_100018668 | 295 |
| 334 | 3300003781 | Ga0055536_1000289 | Ga0055536_100028919 | 295 |
| 335 | 3300003781 | Ga0055536_1000620 | Ga0055536_100062015 | 295 |
| 336 | 3300003781 | Ga0055536_1000625 | Ga0055536_10006259 | 295 |
| 337 | 3300003791 | Ga0055530_10000389 | Ga0055530_100003899 | 295 |
| 338 | 3300003791 | Ga0055530_10000757 | Ga0055530_1000075710 | 295 |
| 339 | 3300003791 | Ga0055530_10001107 | Ga0055530_1000110715 | 295 |
| 340 | 3300003792 | Ga0055540_1000259 | Ga0055540_100025925 | 295 |
| 341 | 3300003792 | Ga0055540_1000366 | Ga0055540_100036619 | 295 |
| 342 | 3300003794 | Ga0055531_10000109 | Ga0055531_1000010910 | 295 |
| 343 | 3300003856 | Ga0058692_1010636 | Ga0058692_10106363 | 295 |
| 344 | 3300005288 | Ga0065714_10000526 | Ga0065714_100005264 | 295 |
| 345 | 3300005288 | Ga0065714_10095472 | Ga0065714_100954722 | 295 |
| 346 | 3300005289 | Ga0065704_10079943 | Ga0065704_100799434 | 295 |
| 347 | 3300005290 | Ga0065712_10017828 | Ga0065712_100178282 | 295 |
| 348 | 3300005331 | Ga0070670_100000368 | Ga0070670_10000036835 | 295 |
| 349 | 3300005331 | Ga0070670_100056184 | Ga0070670_1000561843 | 295 |
| 350 | 3300005344 | Ga0070661_100000038 | Ga0070661_10000003855 | 295 |
| 351 | 3300005353 | Ga0070669_100000626 | Ga0070669_10000062610 | 295 |
| 352 | 3300005353 | Ga0070669_100003116 | Ga0070669_1000031165 | 295 |
| 353 | 3300005457 | Ga0070662_100000787 | Ga0070662_10000078710 | 295 |
| 354 | 3300005457 | Ga0070662_100032555 | Ga0070662_1000325553 | 295 |
| 355 | 3300005539 | Ga0068853_100000155 | Ga0068853_10000015531 | 295 |
| 356 | 3300005548 | Ga0070665_100011929 | Ga0070665_1000119298 | 295 |
| 357 | 3300005548 | Ga0070665_100080326 | Ga0070665_1000803264 | 295 |
| 358 | 3300005564 | Ga0070664_100001315 | Ga0070664_10000131515 | 295 |
| 359 | 3300005564 | Ga0070664_100038811 | Ga0070664_1000388115 | 295 |
| 360 | 3300005834 | Ga0068851_10000012 | Ga0068851_1000001241 | 295 |
| 361 | 3300006051 | Ga0075364_10093140 | Ga0075364_100931402 | 295 |
| 362 | 3300006051 | Ga0075364_10286262 | Ga0075364_102862622 | 295 |
| 363 | 3300006058 | Ga0075432_10002115 | Ga0075432_100021155 | 295 |
| 364 | 3300006177 | Ga0075362_10023071 | Ga0075362_100230713 | 295 |
| 365 | 3300006946 | Ga0079104_1000752 | Ga0079104_100075218 | 295 |
| 366 | 3300009011 | Ga0105251_10000019 | Ga0105251_1000001966 | 295 |
| 367 | 3300009011 | Ga0105251_10001508 | Ga0105251_100015085 | 295 |
| 368 | 3300009011 | Ga0105251_10001556 | Ga0105251_1000155615 | 295 |
| 369 | 3300009011 | Ga0105251_10002891 | Ga0105251_100028918 | 295 |
| 370 | 3300009011 | Ga0105251_10014004 | Ga0105251_100140042 | 295 |
| 371 | 3300009036 | Ga0105244_10000150 | Ga0105244_1000015061 | 295 |
| 372 | 3300009036 | Ga0105244_10000711 | Ga0105244_100007116 | 295 |
| 373 | 3300009036 | Ga0105244_10006568 | Ga0105244_100065684 | 295 |
| 374 | 3300009036 | Ga0105244_10007253 | Ga0105244_100072536 | 295 |
| 375 | 3300009036 | Ga0105244_10061700 | Ga0105244_100617002 | 295 |
| 376 | 3300009036 | Ga0105244_10069185 | Ga0105244_100691853 | 295 |
| 377 | 3300009092 | Ga0105250_10000519 | Ga0105250_1000051924 | 295 |
| 378 | 3300009092 | Ga0105250_10000752 | Ga0105250_1000075213 | 295 |
| 379 | 3300009092 | Ga0105250_10023832 | Ga0105250_100238322 | 295 |
| 380 | 3300009092 | Ga0105250_10053748 | Ga0105250_100537481 | 295 |
| 381 | 3300009148 | Ga0105243_10119166 | Ga0105243_101191663 | 295 |
| 382 | 3300009176 | Ga0105242_10000169 | Ga0105242_1000016916 | 295 |
| 383 | 3300009176 | Ga0105242_10030577 | Ga0105242_100305776 | 295 |
| 384 | 3300009177 | Ga0105248_10232939 | Ga0105248_102329393 | 295 |
| 385 | 3300009545 | Ga0105237_10005893 | Ga0105237_100058938 | 295 |
| 386 | 3300011119 | Ga0105246_10000617 | Ga0105246_1000061715 | 295 |
| 387 | 3300011119 | Ga0105246_10001973 | Ga0105246_100019739 | 295 |
| 388 | 3300012498 | Ga0157345_1000021 | Ga0157345_100002130 | 295 |
| 389 | 3300013100 | Ga0157373_10001281 | Ga0157373_100012817 | 295 |
| 390 | 3300013100 | Ga0157373_10004690 | Ga0157373_100046904 | 295 |
| 391 | 3300013100 | Ga0157373_10023736 | Ga0157373_100237362 | 295 |
| 392 | 3300013100 | Ga0157373_10043580 | Ga0157373_100435802 | 295 |
| 393 | 3300013100 | Ga0157373_10106007 | Ga0157373_101060072 | 295 |
| 394 | 3300013100 | Ga0157373_10138254 | Ga0157373_101382542 | 295 |
| 395 | 3300013102 | Ga0157371_10001747 | Ga0157371_100017479 | 295 |
| 396 | 3300013102 | Ga0157371_10006333 | Ga0157371_100063337 | 295 |
| 397 | 3300013104 | Ga0157370_10016538 | Ga0157370_100165384 | 295 |
| 398 | 3300013104 | Ga0157370_10067825 | Ga0157370_100678252 | 295 |
| 399 | 3300013105 | Ga0157369_10006372 | Ga0157369_1000637212 | 295 |
| 400 | 3300013105 | Ga0157369_10028628 | Ga0157369_100286284 | 295 |
| 401 | 3300013105 | Ga0157369_10073051 | Ga0157369_100730513 | 295 |
| 402 | 3300013306 | Ga0163162_10001061 | Ga0163162_1000106115 | 295 |
| 403 | 3300013306 | Ga0163162_10240437 | Ga0163162_102404372 | 295 |
| 404 | 3300013307 | Ga0157372_10022580 | Ga0157372_100225805 | 295 |
| 405 | 3300013308 | Ga0157375_10005580 | Ga0157375_100055806 | 295 |
| 406 | 3300013308 | Ga0157375_10069687 | Ga0157375_100696874 | 295 |
| 407 | 3300014497 | Ga0182008_10006385 | Ga0182008_100063855 | 295 |
| 408 | 3300014497 | Ga0182008_10023826 | Ga0182008_100238262 | 295 |
| 409 | 3300014497 | Ga0182008_10030419 | Ga0182008_100304193 | 295 |
| 410 | 3300014497 | Ga0182008_10034988 | Ga0182008_100349885 | 295 |
| 411 | 3300015261 | Ga0182006_1001027 | Ga0182006_10010278 | 295 |
| 412 | 3300015261 | Ga0182006_1023686 | Ga0182006_10236863 | 295 |
| 413 | 3300015261 | Ga0182006_1035592 | Ga0182006_10355922 | 295 |
| 414 | 3300015262 | Ga0182007_10000408 | Ga0182007_1000040823 | 295 |
| 415 | 3300015265 | Ga0182005_1002494 | Ga0182005_10024947 | 295 |
| 416 | 3300015265 | Ga0182005_1003495 | Ga0182005_10034956 | 295 |
| 417 | 3300015265 | Ga0182005_1017337 | Ga0182005_10173371 | 295 |
| 418 | 3300015265 | Ga0182005_1023792 | Ga0182005_10237922 | 295 |
| 419 | 3300017792 | Ga0163161_10001087 | Ga0163161_1000108715 | 295 |
| 420 | 3300017792 | Ga0163161_10044753 | Ga0163161_100447534 | 295 |
| 421 | 3300017792 | Ga0163161_10107479 | Ga0163161_101074793 | 295 |
| 422 | 3300017792 | Ga0163161_10339589 | Ga0163161_103395891 | 295 |
| 423 | 3300017792 | Ga0163161_10425647 | Ga0163161_104256471 | 295 |
| 424 | 3300025207 | Ga0209760_100098 | Ga0209760_10009813 | 295 |
| 425 | 3300025207 | Ga0209760_100274 | Ga0209760_10027410 | 295 |
| 426 | 3300025231 | Ga0207427_100005 | Ga0207427_100005109 | 295 |
| 427 | 3300025231 | Ga0207427_100006 | Ga0207427_100006647 | 295 |
| 428 | 3300025233 | Ga0209437_100013 | Ga0209437_100013647 | 295 |
| 429 | 3300025233 | Ga0209437_100018 | Ga0209437_10001819 | 295 |
| 430 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021109 | 295 |
| 431 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022647 | 295 |
| 432 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015627 | 295 |
| 433 | 3300025292 | Ga0209676_1000030 | Ga0209676_100003056 | 295 |
| 434 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041380 | 295 |
| 435 | 3300025298 | Ga0209050_1000075 | Ga0209050_100007566 | 295 |
| 436 | 3300025298 | Ga0209050_1000128 | Ga0209050_1000128101 | 295 |
| 437 | 3300025298 | Ga0209050_1001373 | Ga0209050_100137314 | 295 |
| 438 | 3300025303 | Ga0209051_1000012 | Ga0209051_100001256 | 295 |
| 439 | 3300025303 | Ga0209051_1000041 | Ga0209051_100004199 | 295 |
| 440 | 3300025303 | Ga0209051_1009490 | Ga0209051_10094907 | 295 |
| 441 | 3300025304 | Ga0209257_1000069 | Ga0209257_1000069210 | 295 |
| 442 | 3300025321 | Ga0207656_10000006 | Ga0207656_10000006275 | 295 |
| 443 | 3300025711 | Ga0207696_1000031 | Ga0207696_100003119 | 295 |
| 444 | 3300025711 | Ga0207696_1000094 | Ga0207696_1000094108 | 295 |
| 445 | 3300025711 | Ga0207696_1000095 | Ga0207696_100009595 | 295 |
| 446 | 3300025711 | Ga0207696_1000149 | Ga0207696_100014954 | 295 |
| 447 | 3300025711 | Ga0207696_1008634 | Ga0207696_10086344 | 295 |
| 448 | 3300025711 | Ga0207696_1017447 | Ga0207696_10174471 | 295 |
| 449 | 3300025728 | Ga0207655_1000107 | Ga0207655_100010753 | 295 |
| 450 | 3300025728 | Ga0207655_1000992 | Ga0207655_10009929 | 295 |
| 451 | 3300025728 | Ga0207655_1001195 | Ga0207655_10011959 | 295 |
| 452 | 3300025728 | Ga0207655_1001311 | Ga0207655_100131114 | 295 |
| 453 | 3300025728 | Ga0207655_1012388 | Ga0207655_10123885 | 295 |
| 454 | 3300025728 | Ga0207655_1012657 | Ga0207655_10126574 | 295 |
| 455 | 3300025728 | Ga0207655_1013711 | Ga0207655_10137112 | 295 |
| 456 | 3300025728 | Ga0207655_1031824 | Ga0207655_10318243 | 295 |
| 457 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010114 | 295 |
| 458 | 3300025735 | Ga0207713_1001437 | Ga0207713_100143710 | 295 |
| 459 | 3300025735 | Ga0207713_1001904 | Ga0207713_10019045 | 295 |
| 460 | 3300025735 | Ga0207713_1002108 | Ga0207713_100210811 | 295 |
| 461 | 3300025735 | Ga0207713_1002895 | Ga0207713_10028955 | 295 |
| 462 | 3300025735 | Ga0207713_1011728 | Ga0207713_10117284 | 295 |
| 463 | 3300025735 | Ga0207713_1013045 | Ga0207713_10130452 | 295 |
| 464 | 3300025735 | Ga0207713_1024358 | Ga0207713_10243582 | 295 |
| 465 | 3300025914 | Ga0207671_10000299 | Ga0207671_1000029959 | 295 |
| 466 | 3300025920 | Ga0207649_10000022 | Ga0207649_10000022125 | 295 |
| 467 | 3300025923 | Ga0207681_10000422 | Ga0207681_1000042215 | 295 |
| 468 | 3300025923 | Ga0207681_10002906 | Ga0207681_100029065 | 295 |
| 469 | 3300025925 | Ga0207650_10000138 | Ga0207650_1000013832 | 295 |
| 470 | 3300025925 | Ga0207650_10000159 | Ga0207650_1000015970 | 295 |
| 471 | 3300025933 | Ga0207706_10000290 | Ga0207706_1000029035 | 295 |
| 472 | 3300025933 | Ga0207706_10004400 | Ga0207706_100044007 | 295 |
| 473 | 3300025934 | Ga0207686_10000305 | Ga0207686_100003059 | 295 |
| 474 | 3300025934 | Ga0207686_10171489 | Ga0207686_101714892 | 295 |
| 475 | 3300025935 | Ga0207709_10000086 | Ga0207709_1000008661 | 295 |
| 476 | 3300025941 | Ga0207711_10158830 | Ga0207711_101588302 | 295 |
| 477 | 3300025945 | Ga0207679_10000027 | Ga0207679_1000002777 | 295 |
| 478 | 3300026041 | Ga0207639_10001167 | Ga0207639_1000116713 | 295 |
| 479 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016106 | 295 |
| 480 | 3300027111 | Ga0209281_1001719 | Ga0209281_10017196 | 295 |
| 481 | 3300027312 | Ga0209371_1000066 | Ga0209371_1000066172 | 295 |
| 482 | 3300027907 | Ga0207428_10011576 | Ga0207428_100115764 | 295 |
| 483 | 3300027907 | Ga0207428_10042461 | Ga0207428_100424611 | 295 |
| 484 | 3300027907 | Ga0207428_10049641 | Ga0207428_100496415 | 295 |
| 485 | 3300027907 | Ga0207428_10049870 | Ga0207428_100498703 | 295 |
| 486 | 3300027907 | Ga0207428_10082591 | Ga0207428_100825913 | 295 |
| 487 | 3300027907 | Ga0207428_10158677 | Ga0207428_101586771 | 295 |
| 488 | 3300027907 | Ga0207428_10177269 | Ga0207428_101772692 | 295 |
| 489 | 3300028379 | Ga0268266_10006578 | Ga0268266_100065783 | 295 |
| 490 | 3300030500 | Ga0268256_1000063 | Ga0268256_1000063172 | 295 |
| 491 | 3300030521 | Ga0307511_10040857 | Ga0307511_100408575 | 295 |
| 492 | 3300030734 | Ga0316179_1031537 | Ga0316179_10315371 | 295 |
| 493 | 3300030735 | Ga0316178_1083275 | Ga0316178_108327544 | 295 |
| 494 | 3300031548 | Ga0307408_100000019 | Ga0307408_10000001918 | 295 |
| 495 | 3300031548 | Ga0307408_100127531 | Ga0307408_1001275311 | 295 |
| 496 | 3300031824 | Ga0307413_10132296 | Ga0307413_101322962 | 295 |
| 497 | 3300031911 | Ga0307412_10151144 | Ga0307412_101511442 | 295 |
| 498 | 3300031995 | Ga0307409_100020735 | Ga0307409_1000207355 | 295 |
| 499 | 3300032004 | Ga0307414_10077621 | Ga0307414_100776213 | 295 |
| 500 | 3300032005 | Ga0307411_10003310 | Ga0307411_100033105 | 295 |
| 501 | 3300032005 | Ga0307411_10204196 | Ga0307411_102041962 | 295 |
| 502 | 3300033180 | Ga0307510_10002877 | Ga0307510_1000287711 | 295 |
| 503 | 3300038705 | Ga0237819_00209 | Ga0237819_00209_19364_20251 | 295 |
| 504 | 3300041404 | Ga0439436_0003377 | Ga0439436_0003377_2430_3323 | 295 |
| 505 | 3300041405 | Ga0439438_000931 | Ga0439438_000931_7300_8187 | 295 |
| 506 | 3300041405 | Ga0439438_012440 | Ga0439438_012440_1197_2090 | 295 |
| 507 | 3300041407 | Ga0439447_023349 | Ga0439447_023349_566_1459 | 295 |
| 508 | 3300041411 | Ga0439466_0001641 | Ga0439466_0001641_4143_5030 | 295 |
| 509 | 3300041411 | Ga0439466_0003559 | Ga0439466_0003559_3787_4680 | 295 |
| 510 | 3300041411 | Ga0439466_0011358 | Ga0439466_0011358_335_1234 | 295 |
| 511 | 3300042006 | Ga0439432_003308 | Ga0439432_003308_4128_5021 | 295 |
| 512 | 3300042006 | Ga0439432_014193 | Ga0439432_014193_719_1606 | 295 |
| 513 | 3300042010 | Ga0439452_000507 | Ga0439452_000507_12844_13731 | 295 |
| 514 | 3300042010 | Ga0439452_000648 | Ga0439452_000648_7884_8771 | 295 |
| 515 | 3300042010 | Ga0439452_003067 | Ga0439452_003067_2612_3505 | 295 |
| 516 | 3300042013 | Ga0439456_000068 | Ga0439456_000068_26624_27511 | 295 |
| 517 | 3300042013 | Ga0439456_002218 | Ga0439456_002218_1720_2607 | 295 |
| 518 | 3300042016 | Ga0439463_000149 | Ga0439463_000149_2986_3879 | 295 |
| 519 | 3300042016 | Ga0439463_000438 | Ga0439463_000438_1849_2736 | 295 |
| 520 | 3300042115 | Ga0450911_000581 | Ga0450911_000581_1995_2882 | 295 |
| 521 | 3300042124 | Ga0450922_000034 | Ga0450922_000034_9325_10212 | 295 |
| 522 | 3300042125 | Ga0450923_000592 | Ga0450923_000592_1002_1895 | 295 |
| 523 | 3300042139 | Ga0450904_000479 | Ga0450904_000479_1222_2109 | 295 |
| 524 | 3300042145 | Ga0450906_007442 | Ga0450906_007442_134_1021 | 295 |
| 525 | 3300042146 | Ga0450907_000760 | Ga0450907_000760_5670_6557 | 295 |
| 526 | 3300042156 | Ga0439446_0002675 | Ga0439446_0002675_2504_3397 | 295 |
| 527 | 3300042184 | Ga0450908_003667 | Ga0450908_003667_1704_2591 | 295 |
| 528 | 3300042461 | Ga0439460_0003661 | Ga0439460_0003661_2390_3277 | 295 |
| 529 | 3300042993 | Ga0439440_0001743 | Ga0439440_0001743_914_1801 | 295 |
| 530 | 3300046452 | Ga0495617_002152 | Ga0495617_002152_1242_2129 | 295 |
| 531 | 3300046452 | Ga0495617_010002 | Ga0495617_010002_342_1229 | 295 |
| 532 | 3300046452 | Ga0495617_027341 | Ga0495617_027341_869_1756 | 295 |
| 533 | 3300046452 | Ga0495617_031435 | Ga0495617_031435_723_1745 | 295 |
| 534 | 3300046453 | Ga0495627_000023 | Ga0495627_000023_209046_209939 | 295 |
| 535 | 3300046453 | Ga0495627_000134 | Ga0495627_000134_15061_15951 | 295 |
| 536 | 3300046453 | Ga0495627_001005 | Ga0495627_001005_8567_9454 | 295 |
| 537 | 3300046453 | Ga0495627_002276 | Ga0495627_002276_6507_7394 | 295 |
| 538 | 3300046453 | Ga0495627_004374 | Ga0495627_004374_2641_3528 | 295 |
| 539 | 3300046453 | Ga0495627_014907 | Ga0495627_014907_20_907 | 295 |
| 540 | 3300046455 | Ga0495603_0063755 | Ga0495603_0063755_1086_1973 | 295 |
| 541 | 3300046457 | Ga0495590_0000356 | Ga0495590_0000356_15756_16643 | 295 |
| 542 | 3300046457 | Ga0495590_0056514 | Ga0495590_0056514_447_1334 | 295 |
| 543 | 3300046458 | Ga0495591_000025 | Ga0495591_000025_149875_150828 | 295 |
| 544 | 3300046458 | Ga0495591_000728 | Ga0495591_000728_15701_16588 | 295 |
| 545 | 3300046458 | Ga0495591_000970 | Ga0495591_000970_2650_3537 | 295 |
| 546 | 3300046458 | Ga0495591_001914 | Ga0495591_001914_3547_4434 | 295 |
| 547 | 3300046458 | Ga0495591_003795 | Ga0495591_003795_6189_7076 | 295 |
| 548 | 3300046458 | Ga0495591_006789 | Ga0495591_006789_4000_4887 | 295 |
| 549 | 3300046458 | Ga0495591_012572 | Ga0495591_012572_2025_2912 | 295 |
| 550 | 3300046458 | Ga0495591_017961 | Ga0495591_017961_628_1515 | 295 |
| 551 | 3300046458 | Ga0495591_025601 | Ga0495591_025601_549_1436 | 295 |
| 552 | 3300046460 | Ga0495638_0002423 | Ga0495638_0002423_9299_10186 | 295 |
| 553 | 3300046460 | Ga0495638_0009363 | Ga0495638_0009363_3023_3910 | 295 |
| 554 | 3300046460 | Ga0495638_0016132 | Ga0495638_0016132_435_1322 | 295 |
| 555 | 3300046460 | Ga0495638_0022024 | Ga0495638_0022024_65_952 | 295 |
| 556 | 3300046460 | Ga0495638_0023288 | Ga0495638_0023288_2841_3758 | 295 |
| 557 | 3300046460 | Ga0495638_0026660 | Ga0495638_0026660_356_1243 | 295 |
| 558 | 3300046460 | Ga0495638_0077315 | Ga0495638_0077315_534_1421 | 295 |
| 559 | 3300046463 | Ga0495653_0003298 | Ga0495653_0003298_5185_6105 | 295 |
| 560 | 3300046463 | Ga0495653_0017970 | Ga0495653_0017970_147_1034 | 295 |
| 561 | 3300046471 | Ga0495650_0002155 | Ga0495650_0002155_2085_2972 | 295 |
| 562 | 3300046471 | Ga0495650_0003462 | Ga0495650_0003462_2626_3546 | 295 |
| 563 | 3300046471 | Ga0495650_0009445 | Ga0495650_0009445_3132_4019 | 295 |
| 564 | 3300046471 | Ga0495650_0016777 | Ga0495650_0016777_665_1552 | 295 |
| 565 | 3300046474 | Ga0495605_0001169 | Ga0495605_0001169_15690_16577 | 295 |
| 566 | 3300046474 | Ga0495605_0003351 | Ga0495605_0003351_874_1821 | 295 |
| 567 | 3300046474 | Ga0495605_0015636 | Ga0495605_0015636_282_1169 | 295 |
| 568 | 3300046474 | Ga0495605_0040265 | Ga0495605_0040265_843_1730 | 295 |
| 569 | 3300046475 | Ga0495639_0015405 | Ga0495639_0015405_1116_2003 | 295 |
| 570 | 3300046491 | Ga0495584_0010611 | Ga0495584_0010611_3793_4680 | 295 |
| 571 | 3300046491 | Ga0495584_0020423 | Ga0495584_0020423_1274_2161 | 295 |
| 572 | 3300046491 | Ga0495584_0039065 | Ga0495584_0039065_857_1744 | 295 |
| 573 | 3300046491 | Ga0495584_0055637 | Ga0495584_0055637_498_1385 | 295 |
| 574 | 3300046492 | Ga0495585_0001233 | Ga0495585_0001233_7739_8626 | 295 |
| 575 | 3300046492 | Ga0495585_0003913 | Ga0495585_0003913_760_1647 | 295 |
| 576 | 3300046492 | Ga0495585_0012245 | Ga0495585_0012245_2238_3125 | 295 |
| 577 | 3300046492 | Ga0495585_0014493 | Ga0495585_0014493_598_1485 | 295 |
| 578 | 3300046492 | Ga0495585_0018776 | Ga0495585_0018776_1119_2006 | 295 |
| 579 | 3300046492 | Ga0495585_0021613 | Ga0495585_0021613_657_1544 | 295 |
| 580 | 3300046499 | Ga0495594_0066064 | Ga0495594_0066064_522_1409 | 295 |
| 581 | 3300046500 | Ga0495596_0000478 | Ga0495596_0000478_16237_17124 | 295 |
| 582 | 3300046501 | Ga0495607_0000069 | Ga0495607_0000069_26473_27366 | 295 |
| 583 | 3300046501 | Ga0495607_0003172 | Ga0495607_0003172_11378_12268 | 295 |
| 584 | 3300046501 | Ga0495607_0003303 | Ga0495607_0003303_8618_9505 | 295 |
| 585 | 3300046501 | Ga0495607_0009558 | Ga0495607_0009558_4879_5766 | 295 |
| 586 | 3300046501 | Ga0495607_0011736 | Ga0495607_0011736_1334_2221 | 295 |
| 587 | 3300046501 | Ga0495607_0012648 | Ga0495607_0012648_94_981 | 295 |
| 588 | 3300046501 | Ga0495607_0055511 | Ga0495607_0055511_193_1080 | 295 |
| 589 | 3300046501 | Ga0495607_0090195 | Ga0495607_0090195_728_1615 | 295 |
| 590 | 3300046501 | Ga0495607_0119073 | Ga0495607_0119073_398_1291 | 295 |
| 591 | 3300046506 | Ga0495583_0002951 | Ga0495583_0002951_8651_9538 | 295 |
| 592 | 3300046506 | Ga0495583_0043336 | Ga0495583_0043336_586_1473 | 295 |
| 593 | 3300046507 | Ga0495606_0004110 | Ga0495606_0004110_9670_10557 | 295 |
| 594 | 3300046507 | Ga0495606_0006032 | Ga0495606_0006032_6702_7589 | 295 |
| 595 | 3300046507 | Ga0495606_0006404 | Ga0495606_0006404_1299_2294 | 295 |
| 596 | 3300046507 | Ga0495606_0010755 | Ga0495606_0010755_3765_4652 | 295 |
| 597 | 3300046507 | Ga0495606_0070275 | Ga0495606_0070275_973_1860 | 295 |
| 598 | 3300046507 | Ga0495606_0089323 | Ga0495606_0089323_481_1368 | 295 |
| 599 | 3300046512 | Ga0495610_0002777 | Ga0495610_0002777_3697_4584 | 295 |
| 600 | 3300046512 | Ga0495610_0005863 | Ga0495610_0005863_4577_5464 | 295 |
| 601 | 3300046512 | Ga0495610_0013003 | Ga0495610_0013003_2687_3574 | 295 |
| 602 | 3300046512 | Ga0495610_0023436 | Ga0495610_0023436_19_906 | 295 |
| 603 | 3300046513 | Ga0495616_0002782 | Ga0495616_0002782_2625_3545 | 295 |
| 604 | 3300046513 | Ga0495616_0017155 | Ga0495616_0017155_28_915 | 295 |
| 605 | 3300046513 | Ga0495616_0057430 | Ga0495616_0057430_534_1421 | 295 |
| 606 | 3300046513 | Ga0495616_0072336 | Ga0495616_0072336_632_1519 | 295 |
| 607 | 3300046515 | Ga0495620_0000879 | Ga0495620_0000879_6219_7106 | 295 |
| 608 | 3300046515 | Ga0495620_0001236 | Ga0495620_0001236_3789_4682 | 295 |
| 609 | 3300046515 | Ga0495620_0005263 | Ga0495620_0005263_2147_3142 | 295 |
| 610 | 3300046515 | Ga0495620_0005831 | Ga0495620_0005831_613_1500 | 295 |
| 611 | 3300046515 | Ga0495620_0082316 | Ga0495620_0082316_367_1254 | 295 |
| 612 | 3300046517 | Ga0495630_0128933 | Ga0495630_0128933_987_1874 | 295 |
| 613 | 3300046518 | Ga0495631_0000557 | Ga0495631_0000557_15234_16121 | 295 |
| 614 | 3300046518 | Ga0495631_0001273 | Ga0495631_0001273_3612_4505 | 295 |
| 615 | 3300046518 | Ga0495631_0001898 | Ga0495631_0001898_8003_8998 | 295 |
| 616 | 3300046518 | Ga0495631_0009216 | Ga0495631_0009216_529_1416 | 295 |
| 617 | 3300046518 | Ga0495631_0022766 | Ga0495631_0022766_662_1552 | 295 |
| 618 | 3300046519 | Ga0495632_0002203 | Ga0495632_0002203_8597_9484 | 295 |
| 619 | 3300046519 | Ga0495632_0002355 | Ga0495632_0002355_8399_9286 | 295 |
| 620 | 3300046519 | Ga0495632_0006993 | Ga0495632_0006993_2203_3090 | 295 |
| 621 | 3300046519 | Ga0495632_0028208 | Ga0495632_0028208_642_1529 | 295 |
| 622 | 3300046519 | Ga0495632_0044728 | Ga0495632_0044728_716_1603 | 295 |
| 623 | 3300046519 | Ga0495632_0064361 | Ga0495632_0064361_512_1402 | 295 |
| 624 | 3300046519 | Ga0495632_0071073 | Ga0495632_0071073_244_1134 | 295 |
| 625 | 3300046520 | Ga0495637_0000982 | Ga0495637_0000982_8719_9606 | 295 |
| 626 | 3300046520 | Ga0495637_0001013 | Ga0495637_0001013_3581_4474 | 295 |
| 627 | 3300046520 | Ga0495637_0002185 | Ga0495637_0002185_8533_9420 | 295 |
| 628 | 3300046520 | Ga0495637_0004272 | Ga0495637_0004272_630_1523 | 295 |
| 629 | 3300046520 | Ga0495637_0005147 | Ga0495637_0005147_1841_2734 | 295 |
| 630 | 3300046520 | Ga0495637_0007429 | Ga0495637_0007429_3753_4640 | 295 |
| 631 | 3300046520 | Ga0495637_0016381 | Ga0495637_0016381_2388_3275 | 295 |
| 632 | 3300046520 | Ga0495637_0018073 | Ga0495637_0018073_1925_2818 | 295 |
| 633 | 3300046520 | Ga0495637_0018784 | Ga0495637_0018784_1882_2769 | 295 |
| 634 | 3300046520 | Ga0495637_0024037 | Ga0495637_0024037_853_1740 | 295 |
| 635 | 3300046520 | Ga0495637_0034885 | Ga0495637_0034885_715_1602 | 295 |
| 636 | 3300046520 | Ga0495637_0053008 | Ga0495637_0053008_546_1433 | 295 |
| 637 | 3300046520 | Ga0495637_0057048 | Ga0495637_0057048_120_1007 | 295 |
| 638 | 3300046522 | Ga0495643_0013302 | Ga0495643_0013302_426_1448 | 295 |
| 639 | 3300046522 | Ga0495643_0030237 | Ga0495643_0030237_193_1080 | 295 |
| 640 | 3300046522 | Ga0495643_0056107 | Ga0495643_0056107_203_1090 | 295 |
| 641 | 3300046522 | Ga0495643_0087371 | Ga0495643_0087371_534_1421 | 295 |
| 642 | 3300046523 | Ga0495644_0000474 | Ga0495644_0000474_2042_2929 | 295 |
| 643 | 3300046523 | Ga0495644_0033998 | Ga0495644_0033998_215_1102 | 295 |
| 644 | 3300046523 | Ga0495644_0045073 | Ga0495644_0045073_274_1161 | 295 |
| 645 | 3300046524 | Ga0495648_0001169 | Ga0495648_0001169_6177_7064 | 295 |
| 646 | 3300046524 | Ga0495648_0001874 | Ga0495648_0001874_14813_15700 | 295 |
| 647 | 3300046524 | Ga0495648_0002169 | Ga0495648_0002169_7883_8770 | 295 |
| 648 | 3300046524 | Ga0495648_0004794 | Ga0495648_0004794_3512_4399 | 295 |
| 649 | 3300046524 | Ga0495648_0005415 | Ga0495648_0005415_2689_3684 | 295 |
| 650 | 3300046524 | Ga0495648_0023508 | Ga0495648_0023508_1876_2763 | 295 |
| 651 | 3300046524 | Ga0495648_0028304 | Ga0495648_0028304_2456_3343 | 295 |
| 652 | 3300046524 | Ga0495648_0038394 | Ga0495648_0038394_1694_2581 | 295 |
| 653 | 3300046524 | Ga0495648_0093759 | Ga0495648_0093759_149_1036 | 295 |
| 654 | 3300046524 | Ga0495648_0139352 | Ga0495648_0139352_264_1259 | 295 |
| 655 | 3300046528 | Ga0495642_0000253 | Ga0495642_0000253_28440_29327 | 295 |
| 656 | 3300046528 | Ga0495642_0001251 | Ga0495642_0001251_8616_9503 | 295 |
| 657 | 3300046530 | Ga0495654_0000947 | Ga0495654_0000947_18443_19330 | 295 |
| 658 | 3300046530 | Ga0495654_0001612 | Ga0495654_0001612_10754_11647 | 295 |
| 659 | 3300046530 | Ga0495654_0002089 | Ga0495654_0002089_8879_9766 | 295 |
| 660 | 3300046530 | Ga0495654_0002476 | Ga0495654_0002476_2308_3195 | 295 |
| 661 | 3300046530 | Ga0495654_0010516 | Ga0495654_0010516_3515_4537 | 295 |
| 662 | 3300046530 | Ga0495654_0015217 | Ga0495654_0015217_675_1562 | 295 |
| 663 | 3300046530 | Ga0495654_0018982 | Ga0495654_0018982_141_1031 | 295 |
| 664 | 3300046530 | Ga0495654_0028857 | Ga0495654_0028857_1790_2785 | 295 |
| 665 | 3300046530 | Ga0495654_0031052 | Ga0495654_0031052_1722_2609 | 295 |
| 666 | 3300046530 | Ga0495654_0047218 | Ga0495654_0047218_764_1711 | 295 |
| 667 | 3300046536 | Ga0495587_0009814 | Ga0495587_0009814_4580_5467 | 295 |
| 668 | 3300046538 | Ga0495609_0000057 | Ga0495609_0000057_50645_51538 | 295 |
| 669 | 3300046538 | Ga0495609_0010555 | Ga0495609_0010555_65_952 | 295 |
| 670 | 3300046538 | Ga0495609_0126374 | Ga0495609_0126374_97_984 | 295 |
| 671 | 3300046542 | Ga0495597_0000229 | Ga0495597_0000229_41348_42301 | 295 |
| 672 | 3300046542 | Ga0495597_0001472 | Ga0495597_0001472_12584_13477 | 295 |
| 673 | 3300046542 | Ga0495597_0002031 | Ga0495597_0002031_8131_9126 | 295 |
| 674 | 3300046542 | Ga0495597_0004119 | Ga0495597_0004119_2063_2950 | 295 |
| 675 | 3300046542 | Ga0495597_0010651 | Ga0495597_0010651_349_1236 | 295 |
| 676 | 3300046542 | Ga0495597_0031005 | Ga0495597_0031005_638_1525 | 295 |
| 677 | 3300046557 | Ga0495622_0001113 | Ga0495622_0001113_10139_11026 | 295 |
| 678 | 3300046557 | Ga0495622_0003393 | Ga0495622_0003393_3310_4305 | 295 |
| 679 | 3300046557 | Ga0495622_0051148 | Ga0495622_0051148_839_1726 | 295 |
| 680 | 3300046558 | Ga0495633_0002371 | Ga0495633_0002371_8354_9241 | 295 |
| 681 | 3300046615 | Ga0495656_0032589 | Ga0495656_0032589_1099_2031 | 295 |
| 682 | 3300046616 | Ga0495668_0001637 | Ga0495668_0001637_14668_15555 | 295 |
| 683 | 3300046616 | Ga0495668_0010876 | Ga0495668_0010876_1493_2386 | 295 |
| 684 | 3300046616 | Ga0495668_0011902 | Ga0495668_0011902_494_1381 | 295 |
| 685 | 3300046616 | Ga0495668_0013844 | Ga0495668_0013844_2246_3133 | 295 |
| 686 | 3300046648 | Ga0495611_0000398 | Ga0495611_0000398_9449_10471 | 295 |
| 687 | 3300046660 | Ga0495625_0001611 | Ga0495625_0001611_18841_19728 | 295 |
| 688 | 3300046660 | Ga0495625_0005979 | Ga0495625_0005979_5462_6349 | 295 |
| 689 | 3300046660 | Ga0495625_0008586 | Ga0495625_0008586_3427_4314 | 295 |
| 690 | 3300046660 | Ga0495625_0010435 | Ga0495625_0010435_4635_5522 | 295 |
| 691 | 3300046660 | Ga0495625_0024032 | Ga0495625_0024032_481_1368 | 295 |
| 692 | 3300046660 | Ga0495625_0028783 | Ga0495625_0028783_64_951 | 295 |
| 693 | 3300046660 | Ga0495625_0061846 | Ga0495625_0061846_1060_1947 | 295 |
| 694 | 3300046663 | Ga0495635_0002400 | Ga0495635_0002400_6178_7065 | 295 |
| 695 | 3300046663 | Ga0495635_0014787 | Ga0495635_0014787_879_1817 | 295 |
| 696 | 3300046664 | Ga0495659_0024028 | Ga0495659_0024028_335_1222 | 295 |
| 697 | 3300046665 | Ga0495661_0000571 | Ga0495661_0000571_9006_9893 | 295 |
| 698 | 3300046665 | Ga0495661_0003441 | Ga0495661_0003441_8780_9667 | 295 |
| 699 | 3300046665 | Ga0495661_0012541 | Ga0495661_0012541_556_1443 | 295 |
| 700 | 3300046665 | Ga0495661_0027461 | Ga0495661_0027461_1975_2862 | 295 |
| 701 | 3300046665 | Ga0495661_0129785 | Ga0495661_0129785_59_1054 | 295 |
| 702 | 3300046665 | Ga0495661_0132934 | Ga0495661_0132934_383_1270 | 295 |
| 703 | 3300046674 | Ga0495588_0003618 | Ga0495588_0003618_3208_4095 | 295 |
| 704 | 3300046674 | Ga0495588_0015925 | Ga0495588_0015925_1168_2055 | 295 |
| 705 | 3300046679 | Ga0495623_0004003 | Ga0495623_0004003_6143_7030 | 295 |
| 706 | 3300046680 | Ga0495646_0003143 | Ga0495646_0003143_3646_4533 | 295 |
| 707 | 3300046680 | Ga0495646_0014400 | Ga0495646_0014400_595_1515 | 295 |
| 708 | 3300046689 | Ga0495613_0023434 | Ga0495613_0023434_3032_3952 | 295 |
| 709 | 3300046690 | Ga0495624_0001016 | Ga0495624_0001016_14969_15889 | 295 |
| 710 | 3300046691 | Ga0495670_0001148 | Ga0495670_0001148_8277_9299 | 295 |
| 711 | 3300046691 | Ga0495670_0001629 | Ga0495670_0001629_5144_6031 | 295 |
| 712 | 3300046692 | Ga0495671_0000860 | Ga0495671_0000860_3049_3936 | 295 |
| 713 | 3300046692 | Ga0495671_0001062 | Ga0495671_0001062_11540_12427 | 295 |
| 714 | 3300046692 | Ga0495671_0002728 | Ga0495671_0002728_5895_6782 | 295 |
| 715 | 3300046692 | Ga0495671_0006460 | Ga0495671_0006460_4622_5512 | 295 |
| 716 | 3300046692 | Ga0495671_0016960 | Ga0495671_0016960_465_1352 | 295 |
| 717 | 3300046692 | Ga0495671_0025098 | Ga0495671_0025098_2093_2980 | 295 |
| 718 | 3300046692 | Ga0495671_0031230 | Ga0495671_0031230_534_1421 | 295 |
| 719 | 3300046692 | Ga0495671_0073639 | Ga0495671_0073639_517_1449 | 295 |
| 720 | 3300046692 | Ga0495671_0082388 | Ga0495671_0082388_638_1525 | 295 |
| 721 | 3300046692 | Ga0495671_0087314 | Ga0495671_0087314_63_950 | 295 |
| 722 | 3300046692 | Ga0495671_0096697 | Ga0495671_0096697_241_1128 | 295 |
| 723 | 3300046694 | Ga0495649_0003030 | Ga0495649_0003030_3788_4675 | 295 |
| 724 | 3300046694 | Ga0495649_0009177 | Ga0495649_0009177_1539_2426 | 295 |
| 725 | 3300046694 | Ga0495649_0009407 | Ga0495649_0009407_119_1006 | 295 |
| 726 | 3300046694 | Ga0495649_0012447 | Ga0495649_0012447_1707_2594 | 295 |
| 727 | 3300046694 | Ga0495649_0024115 | Ga0495649_0024115_1572_2576 | 295 |
| 728 | 3300046694 | Ga0495649_0094265 | Ga0495649_0094265_216_1103 | 295 |
| 729 | 3300046694 | Ga0495649_0096994 | Ga0495649_0096994_661_1548 | 295 |
| 730 | 3300046694 | Ga0495649_0180428 | Ga0495649_0180428_62_949 | 295 |
| 731 | 3300046794 | Ga0495589_0001444 | Ga0495589_0001444_8706_9593 | 295 |
| 732 | 3300046794 | Ga0495589_0006684 | Ga0495589_0006684_704_1591 | 295 |
| 733 | 3300046794 | Ga0495589_0011088 | Ga0495589_0011088_907_1794 | 295 |
| 734 | 3300046809 | Ga0495600_0015051 | Ga0495600_0015051_2431_3318 | 295 |
| 735 | 3300046810 | Ga0495660_0001871 | Ga0495660_0001871_1693_2586 | 295 |
| 736 | 3300046810 | Ga0495660_0001949 | Ga0495660_0001949_6357_7250 | 295 |
| 737 | 3300046810 | Ga0495660_0004554 | Ga0495660_0004554_1293_2180 | 295 |
| 738 | 3300046810 | Ga0495660_0009310 | Ga0495660_0009310_753_1640 | 295 |
| 739 | 3300046810 | Ga0495660_0009972 | Ga0495660_0009972_1512_2399 | 295 |
| 740 | 3300046810 | Ga0495660_0010711 | Ga0495660_0010711_4394_5281 | 295 |
| 741 | 3300046810 | Ga0495660_0013744 | Ga0495660_0013744_269_1162 | 295 |
| 742 | 3300046810 | Ga0495660_0020234 | Ga0495660_0020234_48_935 | 295 |
| 743 | 3300046810 | Ga0495660_0066718 | Ga0495660_0066718_727_1614 | 295 |
| 744 | 3300046810 | Ga0495660_0071553 | Ga0495660_0071553_900_1787 | 295 |
| 745 | 3300046810 | Ga0495660_0100319 | Ga0495660_0100319_505_1392 | 295 |
| 746 | 3300046810 | Ga0495660_0101481 | Ga0495660_0101481_146_1033 | 295 |
| 747 | 3300047317 | Ga0495604_0004835 | Ga0495604_0004835_4750_5637 | 295 |
| 748 | 3300047317 | Ga0495604_0042857 | Ga0495604_0042857_2548_3468 | 295 |
| 749 | 3300047319 | Ga0495674_0010280 | Ga0495674_0010280_3165_4052 | 295 |
| 750 | 3300047320 | Ga0495672_0001861 | Ga0495672_0001861_16443_17330 | 295 |
| 751 | 3300047320 | Ga0495672_0002241 | Ga0495672_0002241_1821_2708 | 295 |
| 752 | 3300047320 | Ga0495672_0002630 | Ga0495672_0002630_5591_6478 | 295 |
| 753 | 3300047320 | Ga0495672_0004619 | Ga0495672_0004619_3284_4171 | 295 |
| 754 | 3300047320 | Ga0495672_0008985 | Ga0495672_0008985_5260_6192 | 295 |
| 755 | 3300047320 | Ga0495672_0009137 | Ga0495672_0009137_1211_2098 | 295 |
| 756 | 3300047320 | Ga0495672_0009191 | Ga0495672_0009191_5409_6296 | 295 |
| 757 | 3300047320 | Ga0495672_0033904 | Ga0495672_0033904_924_1811 | 295 |
| 758 | 3300047320 | Ga0495672_0034522 | Ga0495672_0034522_1213_2106 | 295 |
| 759 | 3300047320 | Ga0495672_0051836 | Ga0495672_0051836_1096_2049 | 295 |
| 760 | 3300047320 | Ga0495672_0171934 | Ga0495672_0171934_35_922 | 295 |
| 761 | 3300047321 | Ga0495676_0024333 | Ga0495676_0024333_781_1668 | 295 |
| 762 | 3300047321 | Ga0495676_0037406 | Ga0495676_0037406_2975_3895 | 295 |
| 763 | 3300047322 | Ga0495680_0008892 | Ga0495680_0008892_3547_4467 | 295 |
| 764 | 3300047322 | Ga0495680_0040858 | Ga0495680_0040858_1025_1912 | 295 |
| 765 | 3300047322 | Ga0495680_0158885 | Ga0495680_0158885_143_1030 | 295 |
| 766 | 3300047322 | Ga0495680_0305255 | Ga0495680_0305255_92_1030 | 295 |
| 767 | 3300047323 | Ga0495683_0000032 | Ga0495683_0000032_98079_98972 | 295 |
| 768 | 3300047323 | Ga0495683_0000584 | Ga0495683_0000584_19615_20502 | 295 |
| 769 | 3300047323 | Ga0495683_0000905 | Ga0495683_0000905_8898_9785 | 295 |
| 770 | 3300047323 | Ga0495683_0011935 | Ga0495683_0011935_2595_3482 | 295 |
| 771 | 3300047443 | Ga0495687_001410 | Ga0495687_001410_13163_14050 | 295 |
| 772 | 3300047443 | Ga0495687_001593 | Ga0495687_001593_2321_3208 | 295 |
| 773 | 3300047444 | Ga0495675_0007362 | Ga0495675_0007362_2678_3616 | 295 |
| 774 | 3300047444 | Ga0495675_0195133 | Ga0495675_0195133_64_951 | 295 |
| 775 | 3300047445 | Ga0495677_0001304 | Ga0495677_0001304_2818_3705 | 295 |
| 776 | 3300047446 | Ga0495679_000721 | Ga0495679_000721_16118_17005 | 295 |
| 777 | 3300047446 | Ga0495679_005501 | Ga0495679_005501_4295_5182 | 295 |
| 778 | 3300047446 | Ga0495679_006071 | Ga0495679_006071_2769_3716 | 295 |
| 779 | 3300047446 | Ga0495679_019394 | Ga0495679_019394_1357_2244 | 295 |
| 780 | 3300047446 | Ga0495679_024712 | Ga0495679_024712_928_1815 | 295 |
| 781 | 3300047447 | Ga0495685_038423 | Ga0495685_038423_145_1032 | 295 |
| 782 | 3300047469 | Ga0495673_0001703 | Ga0495673_0001703_3871_4764 | 295 |
| 783 | 3300047469 | Ga0495673_0001708 | Ga0495673_0001708_424_1311 | 295 |
| 784 | 3300047469 | Ga0495673_0001879 | Ga0495673_0001879_4759_5646 | 295 |
| 785 | 3300047469 | Ga0495673_0002166 | Ga0495673_0002166_3262_4155 | 295 |
| 786 | 3300047469 | Ga0495673_0004038 | Ga0495673_0004038_5810_6697 | 295 |
| 787 | 3300047469 | Ga0495673_0004292 | Ga0495673_0004292_4769_5656 | 295 |
| 788 | 3300047469 | Ga0495673_0005096 | Ga0495673_0005096_959_1846 | 295 |
| 789 | 3300047469 | Ga0495673_0005300 | Ga0495673_0005300_3964_4857 | 295 |
| 790 | 3300047469 | Ga0495673_0011643 | Ga0495673_0011643_2063_2950 | 295 |
| 791 | 3300047469 | Ga0495673_0050441 | Ga0495673_0050441_534_1421 | 295 |
| 792 | 3300047469 | Ga0495673_0061429 | Ga0495673_0061429_628_1515 | 295 |
| 793 | 3300047470 | Ga0495681_0001535 | Ga0495681_0001535_3679_4566 | 295 |
| 794 | 3300047470 | Ga0495681_0002339 | Ga0495681_0002339_4343_5230 | 295 |
| 795 | 3300047470 | Ga0495681_0002940 | Ga0495681_0002940_8494_9414 | 295 |
| 796 | 3300047470 | Ga0495681_0004215 | Ga0495681_0004215_6610_7497 | 295 |
| 797 | 3300047470 | Ga0495681_0005581 | Ga0495681_0005581_2615_3502 | 295 |
| 798 | 3300047470 | Ga0495681_0014801 | Ga0495681_0014801_385_1272 | 295 |
| 799 | 3300047470 | Ga0495681_0022720 | Ga0495681_0022720_749_1636 | 295 |
| 800 | 3300047470 | Ga0495681_0041300 | Ga0495681_0041300_638_1525 | 295 |
| 801 | 3300047470 | Ga0495681_0048687 | Ga0495681_0048687_259_1146 | 295 |
| 802 | 3300047471 | Ga0495684_0025758 | Ga0495684_0025758_2984_3904 | 295 |
| 803 | 3300047472 | Ga0495686_0005103 | Ga0495686_0005103_4059_4946 | 295 |
| 804 | 3300047472 | Ga0495686_0006282 | Ga0495686_0006282_2065_2952 | 295 |
| 805 | 3300047472 | Ga0495686_0015694 | Ga0495686_0015694_3495_4382 | 295 |
| 806 | 3300047673 | Ga0495593_0067458 | Ga0495593_0067458_396_1316 | 295 |
| 807 | 3300048088 | Ga0495602_0030875 | Ga0495602_0030875_3560_4480 | 295 |
| 808 | 3300048091 | Ga0495626_0000831 | Ga0495626_0000831_19449_20336 | 295 |
| 809 | 3300048091 | Ga0495626_0001108 | Ga0495626_0001108_9129_10016 | 295 |
| 810 | 3300048091 | Ga0495626_0005222 | Ga0495626_0005222_2344_3231 | 295 |
| 811 | 3300048091 | Ga0495626_0016707 | Ga0495626_0016707_638_1525 | 295 |
| 812 | 3300048091 | Ga0495626_0053489 | Ga0495626_0053489_919_1806 | 295 |
| 813 | 3300048905 | Ga0496102_0002311 | Ga0496102_0002311_6066_6953 | 295 |
| 814 | 3300048906 | Ga0496103_0002862 | Ga0496103_0002862_4235_5122 | 295 |
| 815 | 3300048919 | Ga0496116_0002775 | Ga0496116_0002775_9929_10816 | 295 |
| 816 | 3300048919 | Ga0496116_0004594 | Ga0496116_0004594_3222_4142 | 295 |
| 817 | 3300048919 | Ga0496116_0007417 | Ga0496116_0007417_5931_6818 | 295 |
| 818 | 3300048919 | Ga0496116_0014607 | Ga0496116_0014607_2361_3248 | 295 |
| 819 | 3300048920 | Ga0496117_0211872 | Ga0496117_0211872_33_920 | 295 |
| 820 | 3300048920 | Ga0496117_0211885 | Ga0496117_0211885_33_920 | 295 |
| 821 | 3300048921 | Ga0496118_0007335 | Ga0496118_0007335_1692_2612 | 295 |
| 822 | 3300048921 | Ga0496118_0007906 | Ga0496118_0007906_5274_6161 | 295 |
| 823 | 3300048921 | Ga0496118_0079709 | Ga0496118_0079709_761_1648 | 295 |
| 824 | 3300048924 | Ga0496121_0007900 | Ga0496121_0007900_3215_4135 | 295 |
| 825 | 3300048925 | Ga0496122_0010517 | Ga0496122_0010517_5797_6684 | 295 |
| 826 | 3300048925 | Ga0496122_0037573 | Ga0496122_0037573_819_1706 | 295 |
| 827 | 3300048926 | Ga0496123_0011812 | Ga0496123_0011812_1430_2317 | 295 |
| 828 | 3300048926 | Ga0496123_0016348 | Ga0496123_0016348_3922_4809 | 295 |
| 829 | 3300048926 | Ga0496123_0143414 | Ga0496123_0143414_145_1032 | 295 |
| 830 | 3300048927 | Ga0496124_0000407 | Ga0496124_0000407_8160_9137 | 295 |
| 831 | 3300048927 | Ga0496124_0005384 | Ga0496124_0005384_10084_10971 | 295 |
| 832 | 3300048927 | Ga0496124_0022335 | Ga0496124_0022335_1875_2762 | 295 |
| 833 | 3300048927 | Ga0496124_0188712 | Ga0496124_0188712_20_940 | 295 |
| 834 | 3300048927 | Ga0496124_0352512 | Ga0496124_0352512_101_1021 | 295 |
| 835 | 3300048928 | Ga0496125_0002716 | Ga0496125_0002716_5904_6791 | 295 |
| 836 | 3300048928 | Ga0496125_0017906 | Ga0496125_0017906_1052_1939 | 295 |
| 837 | 3300049459 | Ga0495678_000541 | Ga0495678_000541_22363_23256 | 295 |
| 838 | 3300049459 | Ga0495678_001393 | Ga0495678_001393_2243_3130 | 295 |
| 839 | 3300049459 | Ga0495678_003217 | Ga0495678_003217_8707_9594 | 295 |
| 840 | 3300049459 | Ga0495678_028588 | Ga0495678_028588_816_1703 | 295 |
| 841 | 3300049459 | Ga0495678_036912 | Ga0495678_036912_606_1493 | 295 |
| 842 | 3300049459 | Ga0495678_052112 | Ga0495678_052112_496_1383 | 295 |
| 843 | 3300049460 | Ga0495682_0001635 | Ga0495682_0001635_3301_4296 | 295 |
| 844 | 3300049460 | Ga0495682_0003896 | Ga0495682_0003896_4686_5573 | 295 |
| 845 | 3300049460 | Ga0495682_0022278 | Ga0495682_0022278_473_1405 | 295 |
| 846 | 3300049460 | Ga0495682_0055634 | Ga0495682_0055634_91_1023 | 295 |
| 847 | 3300049569 | Ga0501032_0041522 | Ga0501032_0041522_1628_2527 | 295 |
| 848 | 3300049571 | Ga0501034_0150183 | Ga0501034_0150183_504_1397 | 295 |
| 849 | 3300049573 | Ga0501037_0101041 | Ga0501037_0101041_312_1211 | 295 |
| 850 | 3300053111 | Ga0500572_003770 | Ga0500572_003770_2283_3170 | 295 |
| 851 | 3300053140 | Ga0500573_0036557 | Ga0500573_0036557_877_1770 | 295 |
| 852 | 3300053161 | Ga0500634_0013813 | Ga0500634_0013813_563_1450 | 295 |
| 853 | iso_pu_bacteria | 2554235341 | 2555672609 | 295 |
| 854 | iso_pu_bacteria | 3007861166 | 3007865315 | 295 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bqt-assembly1.cif.gz_B | complex of 14-3-3 theta with an irsp53 peptide doubly-phosphorylated at t340 and t360 | 0.7467 | 21 | 69 |
| 6qk8-assembly2.cif.gz_B | crystal structure of yeast 14-3-3 protein (bmh1) from saccharomyces cerevisiae with the nha1p (yeast na+/h+ antiporter) 14-3-3 binding motif ser481 | 0.7205 | 28 | 67 |
| 6r7z-assembly1.cif.gz_B | cryoem structure of calcium-free human tmem16k / anoctamin 10 in detergent (closed form) | 0.6135 | 2 | 64 |
| 5kym-assembly1.cif.gz_A | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6058 | 1 | 279 |
| 5kym-assembly2.cif.gz_B | crystal structure of the 1-acyl-sn-glycerophosphate (lpa) acyltransferase, plsc, from thermotoga maritima | 0.6003 | 2 | 279 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pu8A02 | Alpha Beta;Alpha-Beta Complex;Aminoglycoside 3'-phosphotransferase; Chain: A, domain 2;Aminoglycoside phosphotransferase (APH), C-terminal lobe | 0.8584 | 28 | 65 | 3.90.1200.10 |
| af_P32129_82_238_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8484 | 69 | 222 | 3.40.50.620 |
| af_P32129_82_238_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.8289 | 69 | 222 | 3.40.50.620 |
| af_Q9NRZ5_70_233_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.7348 | 82 | 222 | 3.40.50.620 |
| af_Q22267_77_205_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.7295 | 74 | 210 | 3.40.50.2000 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9SIR0-F1-model_v4 | Acyltransferase | 0.9786 | 181 | 293 |
GO:0016746
|
| AF-A0A0P9CUI6-F1-model_v4 | Acyltransferase | 0.9763 | 168 | 293 |
GO:0016746
|
| AF-A0A656H741-F1-model_v4 | deleted | 0.9731 | 52 | 284 |
|
| AF-A0A136Q9J9-F1-model_v4 | deleted | 0.9698 | 97 | 295 |
|
| AF-A0A433FBK4-F1-model_v4 | deleted | 0.9652 | 168 | 294 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar