F483586

General Info

Members Datasets Scaffolds Average Seq Length
854 293 1708 379

Family's Representative Sequence

Representative Sequence 3300026095|Ga0207676_10226663|Ga0207676_102266632
Length 415
Sequence VQGALDAVPSRIPVVLGGCGSGRSWLLQGLRERAPRGTVQYVNVESCASTPERFLTAITSSSPFPWHGDHTPAPTPRVAFDGALQFLTTATAPGGEACTFLLDEALELRTFESFPGLRHVLKELLTALSASHNRFVLTTRYTARAHRLLRDATARFEVMHVPPLAAADVEDLLASSLNGFDHLSPAERDDLSRSVQVLADGRNSYVKAIGMMMADMGRGSDPISALAALLSPDGGLDRACRFSYELRLHRARGYGALKAILEILAAEEQLNLTEISQRLRRTPGSTKDYLSWLEDVDLVTSRQKRYSFADPLLRVWVRLHCRPLPPTPEDVVREVQQYAFARLPQASAVAVPEGAYAPAQVSTTNGGSTMVLSGALAVIRCSDPSSSRPDTGVSVAVVPSRSTRRRCAWAVQAVV

Samples

Sample ID Description Type Environment
1 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
191 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
200 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
201 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
208 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
243 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
266 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
267 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
289 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
290 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
291 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
293 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.87
Nodule 0
Rhizoplane 2.11
Rhizosphere 96.02
Stem 0
Stem Tuber 0
Unclassified 5.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207676_10226663 3300026095 Bacteria 1668
2 JGI25406J46586_10000625 3300003203 Bacteria 16562
3 JGI25406J46586_10001124 3300003203 Bacteria 12528
4 Ga0065712_10005276 3300005290 Bacteria 6329
5 Ga0065712_10016432 3300005290 Bacteria 1613
6 Ga0065715_10013166 3300005293 Bacteria 2869
7 Ga0065715_10092509 3300005293 Bacteria 5082
8 Ga0065715_10116630 3300005293 Bacteria 2356
9 Ga0065707_10096807 3300005295 Bacteria 3229
10 Ga0065707_10109586 3300005295 Bacteria 2459
11 Ga0070676_10014447 3300005328 Bacteria 4339
12 Ga0070676_10033022 3300005328 Bacteria 2968
13 Ga0070676_10123963 3300005328 Bacteria 1625
14 Ga0070683_100009628 3300005329 Bacteria 8270
15 Ga0070690_100006062 3300005330 Bacteria 6839
16 Ga0070690_100157201 3300005330 Bacteria 1555
17 Ga0070670_100003343 3300005331 Bacteria 13278
18 Ga0070670_100011527 3300005331 Bacteria 7561
19 Ga0070670_100061515 3300005331 Bacteria 3223
20 Ga0070670_100088288 3300005331 Bacteria 2665
21 Ga0070677_10025708 3300005333 Bacteria 2201
22 Ga0070677_10026601 3300005333 Bacteria 2171
23 Ga0070677_10048971 3300005333 Bacteria 1700
24 Ga0068869_100002192 3300005334 Bacteria 11748
25 Ga0068869_100126884 3300005334 Unclassified 1957
26 Ga0068869_100158062 3300005334 Bacteria 1763
27 Ga0068868_100005739 3300005338 Bacteria 8736
28 Ga0068868_100084597 3300005338 Bacteria 2548
29 Ga0070689_100015864 3300005340 Bacteria 5502
30 Ga0070689_100059552 3300005340 Bacteria 2968
31 Ga0070689_100071468 3300005340 Bacteria 2711
32 Ga0070689_100118032 3300005340 Bacteria 2116
33 Ga0070689_100158942 3300005340 Bacteria 1826
34 Ga0070689_100226180 3300005340 Bacteria 1536
35 Ga0070687_100013075 3300005343 Bacteria 3686
36 Ga0070687_100033438 3300005343 Unclassified 2539
37 Ga0070687_100061581 3300005343 Bacteria 1984
38 Ga0070687_100093956 3300005343 Bacteria 1665
39 Ga0070692_10033574 3300005345 Bacteria 2586
40 Ga0070668_100068569 3300005347 Bacteria 2757
41 Ga0070669_100001431 3300005353 Bacteria 17262
42 Ga0070669_100009043 3300005353 Bacteria 7103
43 Ga0070669_100026752 3300005353 Bacteria 4150
44 Ga0070669_100083384 3300005353 Unclassified 2383
45 Ga0070669_100202019 3300005353 Bacteria 1564
46 Ga0070675_100000230 3300005354 Bacteria 35985
47 Ga0070675_100002000 3300005354 Bacteria 15124
48 Ga0070675_100003366 3300005354 Bacteria 12114
49 Ga0070675_100014442 3300005354 Bacteria 6227
50 Ga0070675_100015833 3300005354 Bacteria 5971
51 Ga0070675_100033532 3300005354 Bacteria 4163
52 Ga0070675_100053322 3300005354 Bacteria 3326
53 Ga0070675_100105884 3300005354 Bacteria 2373
54 Ga0070675_100152103 3300005354 Bacteria 1984
55 Ga0070671_100002756 3300005355 Bacteria 13649
56 Ga0070671_100018538 3300005355 Bacteria 5654
57 Ga0070671_100052006 3300005355 Bacteria 3407
58 Ga0070671_100131479 3300005355 Unclassified 2108
59 Ga0070671_100183531 3300005355 Bacteria 1772
60 Ga0070674_100001321 3300005356 Bacteria 13042
61 Ga0070674_100003634 3300005356 Bacteria 8687
62 Ga0070674_100067083 3300005356 Bacteria 2523
63 Ga0070674_100067852 3300005356 Bacteria 2510
64 Ga0070674_100196734 3300005356 Bacteria 1554
65 Ga0070673_100007613 3300005364 Bacteria 7166
66 Ga0070673_100022209 3300005364 Bacteria 4615
67 Ga0070673_100056122 3300005364 Bacteria 3106
68 Ga0070673_100064195 3300005364 Bacteria 2924
69 Ga0070673_100066754 3300005364 Bacteria 2874
70 Ga0070673_100154634 3300005364 Bacteria 1945
71 Ga0070673_100198146 3300005364 Bacteria 1728
72 Ga0070688_100003285 3300005365 Bacteria 8294
73 Ga0070688_100021753 3300005365 Bacteria 3750
74 Ga0070688_100171764 3300005365 Unclassified 1497
75 Ga0070659_100344660 3300005366 Bacteria 1249
76 Ga0070667_100050141 3300005367 Bacteria 3517
77 Ga0070667_100200264 3300005367 Bacteria 1772
78 Ga0070703_10024920 3300005406 Unclassified 1771
79 Ga0070709_10024247 3300005434 Bacteria 3570
80 Ga0070709_10186279 3300005434 Bacteria 1461
81 Ga0070713_100069167 3300005436 Bacteria 2977
82 Ga0070701_10008290 3300005438 Bacteria 4489
83 Ga0070705_100061990 3300005440 Bacteria 2225
84 Ga0070700_100022731 3300005441 Bacteria 3662
85 Ga0070700_100042450 3300005441 Bacteria 2793
86 Ga0070700_100071546 3300005441 Bacteria 2214
87 Ga0070700_100143943 3300005441 Bacteria 1623
88 Ga0070694_100000891 3300005444 Bacteria 16870
89 Ga0070694_100022416 3300005444 Bacteria 4045
90 Ga0070694_100046933 3300005444 Bacteria 2901
91 Ga0070694_100049417 3300005444 Bacteria 2833
92 Ga0070663_100042066 3300005455 Bacteria 3208
93 Ga0070678_100069865 3300005456 Unclassified 2623
94 Ga0070662_100031323 3300005457 Bacteria 3732
95 Ga0070681_10056907 3300005458 Bacteria 3890
96 Ga0070681_10195505 3300005458 Bacteria 1942
97 Ga0068867_100004670 3300005459 Bacteria 9638
98 Ga0068867_100007279 3300005459 Bacteria 7829
99 Ga0068867_100053667 3300005459 Bacteria 2977
100 Ga0068867_100058498 3300005459 Bacteria 2856
101 Ga0070685_10005740 3300005466 Bacteria 6305
102 Ga0070706_100179421 3300005467 Bacteria 1977
103 Ga0070707_100153124 3300005468 Unclassified 2245
104 Ga0070707_100224266 3300005468 Bacteria 1830
105 Ga0070698_100017838 3300005471 Bacteria 7477
106 Ga0070698_100034358 3300005471 Bacteria 5248
107 Ga0070698_100093156 3300005471 Bacteria 2993
108 Ga0070698_100109779 3300005471 Bacteria 2725
109 Ga0070699_100001990 3300005518 Bacteria 18435
110 Ga0070699_100008798 3300005518 Bacteria 8750
111 Ga0070699_100022853 3300005518 Bacteria 5389
112 Ga0070699_100027597 3300005518 Bacteria 4896
113 Ga0070699_100040573 3300005518 Bacteria 4030
114 Ga0070699_100069160 3300005518 Bacteria 3068
115 Ga0070679_100395075 3300005530 Unclassified 1329
116 Ga0070684_100050474 3300005535 Bacteria 3614
117 Ga0070684_100051731 3300005535 Bacteria 3570
118 Ga0070684_100220234 3300005535 Bacteria 1732
119 Ga0070684_100266380 3300005535 Bacteria 1568
120 Ga0070697_100020787 3300005536 Bacteria 5198
121 Ga0070672_100018631 3300005543 Bacteria 5024
122 Ga0070672_100023946 3300005543 Bacteria 4504
123 Ga0070672_100032685 3300005543 Bacteria 3930
124 Ga0070672_100067528 3300005543 Bacteria 2833
125 Ga0070672_100135408 3300005543 Bacteria 2028
126 Ga0070672_100158078 3300005543 Unclassified 1878
127 Ga0070686_100034027 3300005544 Bacteria 3136
128 Ga0070695_100000349 3300005545 Bacteria 23614
129 Ga0070695_100072747 3300005545 Bacteria 2255
130 Ga0070696_100000400 3300005546 Bacteria 26895
131 Ga0070696_100013973 3300005546 Bacteria 5391
132 Ga0070696_100025932 3300005546 Bacteria 3986
133 Ga0070693_100026681 3300005547 Bacteria 3121
134 Ga0070665_100002337 3300005548 Bacteria 21045
135 Ga0070665_100029798 3300005548 Bacteria 5491
136 Ga0070665_100251007 3300005548 Bacteria 1770
137 Ga0070704_100031879 3300005549 Bacteria 3549
138 Ga0068855_100215443 3300005563 Unclassified 2156
139 Ga0068855_100229618 3300005563 Bacteria 2079
140 Ga0070664_100022550 3300005564 Bacteria 5192
141 Ga0070664_100111786 3300005564 Bacteria 2385
142 Ga0068854_100017691 3300005578 Bacteria 4774
143 Ga0068854_100039525 3300005578 Bacteria 3324
144 Ga0068856_100069724 3300005614 Bacteria 3476
145 Ga0068852_100315070 3300005616 Unclassified 1518
146 Ga0068859_100001058 3300005617 Bacteria 28155
147 Ga0068859_100004504 3300005617 Bacteria 14217
148 Ga0068859_100043793 3300005617 Bacteria 4498
149 Ga0068859_100155491 3300005617 Unclassified 2364
150 Ga0068859_100285300 3300005617 Bacteria 1744
151 Ga0068859_100409797 3300005617 Bacteria 1451
152 Ga0068864_100043064 3300005618 Bacteria 3865
153 Ga0068864_100051036 3300005618 Bacteria 3561
154 Ga0068864_100207746 3300005618 Bacteria 1801
155 Ga0068866_10026463 3300005718 Bacteria 2740
156 Ga0068866_10072150 3300005718 Bacteria 1828
157 Ga0068861_100002675 3300005719 Bacteria 11670
158 Ga0068861_100044500 3300005719 Bacteria 3339
159 Ga0068861_100074256 3300005719 Bacteria 2644
160 Ga0068861_100084053 3300005719 Bacteria 2498
161 Ga0068861_100116212 3300005719 Bacteria 2151
162 Ga0068861_100213672 3300005719 Bacteria 1626
163 Ga0068851_10007127 3300005834 Bacteria 5122
164 Ga0068870_10024887 3300005840 Bacteria 2966
165 Ga0068870_10084664 3300005840 Bacteria 1761
166 Ga0068863_100028870 3300005841 Bacteria 5297
167 Ga0068863_100036568 3300005841 Bacteria 4677
168 Ga0068863_100145849 3300005841 Bacteria 2264
169 Ga0068863_100181450 3300005841 Bacteria 2020
170 Ga0068858_100021312 3300005842 Bacteria 6053
171 Ga0068858_100032255 3300005842 Bacteria 4866
172 Ga0068858_100090071 3300005842 Bacteria 2854
173 Ga0068858_100102722 3300005842 Bacteria 2666
174 Ga0068858_100145015 3300005842 Bacteria 2229
175 Ga0068858_100361911 3300005842 Bacteria 1390
176 Ga0068860_100009746 3300005843 Bacteria 9536
177 Ga0068860_100039863 3300005843 Bacteria 4491
178 Ga0068860_100047217 3300005843 Bacteria 4105
179 Ga0068860_100121497 3300005843 Bacteria 2501
180 Ga0068862_100002358 3300005844 Bacteria 16819
181 Ga0068862_100002381 3300005844 Bacteria 16728
182 Ga0068862_100015206 3300005844 Bacteria 6390
183 Ga0081455_10207100 3300005937 Bacteria 1464
184 Ga0081539_10000071 3300005985 Bacteria 233094
185 Ga0081539_10000960 3300005985 Bacteria 54037
186 Ga0081539_10003273 3300005985 Bacteria 20317
187 Ga0081539_10007078 3300005985 Bacteria 10374
188 Ga0081539_10032703 3300005985 Bacteria 3181
189 Ga0075365_10088448 3300006038 Bacteria 2107
190 Ga0075368_10019342 3300006042 Bacteria 2569
191 Ga0075364_10122128 3300006051 Unclassified 1744
192 Ga0075364_10144833 3300006051 Bacteria 1599
193 Ga0075362_10001172 3300006177 Bacteria 8200
194 Ga0075367_10043241 3300006178 Bacteria 2638
195 Ga0075366_10001838 3300006195 Bacteria 10699
196 Ga0097621_100003331 3300006237 Bacteria 11056
197 Ga0097621_100009140 3300006237 Bacteria 7183
198 Ga0097621_100031266 3300006237 Bacteria 4224
199 Ga0097621_100078567 3300006237 Bacteria 2742
200 Ga0097621_100235718 3300006237 Bacteria 1598
201 Ga0097621_100319497 3300006237 Bacteria 1375
202 Ga0075370_10001492 3300006353 Bacteria 10201
203 Ga0068871_100000509 3300006358 Bacteria 26646
204 Ga0068871_100012284 3300006358 Bacteria 6308
205 Ga0075428_100000339 3300006844 Bacteria 46286
206 Ga0075428_100005335 3300006844 Bacteria 14292
207 Ga0075428_100007147 3300006844 Bacteria 12369
208 Ga0075428_100020148 3300006844 Bacteria 7387
209 Ga0075428_100026528 3300006844 Bacteria 6413
210 Ga0075428_100121372 3300006844 Bacteria 2846
211 Ga0075428_100180604 3300006844 Bacteria 2284
212 Ga0075430_100001386 3300006846 Bacteria 19674
213 Ga0075430_100001719 3300006846 Bacteria 17859
214 Ga0075430_100004697 3300006846 Bacteria 11490
215 Ga0075430_100022426 3300006846 Bacteria 5372
216 Ga0075430_100060094 3300006846 Bacteria 3194
217 Ga0075430_100068854 3300006846 Bacteria 2969
218 Ga0075430_100072489 3300006846 Bacteria 2888
219 Ga0075431_100000921 3300006847 Bacteria 25923
220 Ga0075431_100005390 3300006847 Bacteria 12631
221 Ga0075431_100009643 3300006847 Bacteria 9698
222 Ga0075431_100017850 3300006847 Bacteria 7215
223 Ga0075431_100022586 3300006847 Bacteria 6432
224 Ga0075431_100034111 3300006847 Bacteria 5244
225 Ga0075431_100044044 3300006847 Bacteria 4603
226 Ga0075431_100045675 3300006847 Bacteria 4516
227 Ga0075431_100066555 3300006847 Bacteria 3720
228 Ga0075431_100077737 3300006847 Bacteria 3425
229 Ga0075431_100112369 3300006847 Bacteria 2811
230 Ga0075431_100270899 3300006847 Bacteria 1720
231 Ga0075433_10000581 3300006852 Bacteria 24193
232 Ga0075433_10131036 3300006852 Bacteria 2228
233 Ga0075433_10207512 3300006852 Unclassified 1742
234 Ga0075434_100000239 3300006871 Bacteria 38163
235 Ga0075434_100008401 3300006871 Bacteria 9603
236 Ga0075434_100009098 3300006871 Bacteria 9252
237 Ga0075434_100043251 3300006871 Bacteria 4466
238 Ga0075434_100083547 3300006871 Bacteria 3191
239 Ga0075434_100143122 3300006871 Bacteria 2411
240 Ga0075429_100008096 3300006880 Bacteria 9138
241 Ga0075429_100009933 3300006880 Bacteria 8249
242 Ga0075429_100011027 3300006880 Bacteria 7820
243 Ga0075429_100017304 3300006880 Bacteria 6233
244 Ga0075429_100184400 3300006880 Bacteria 1829
245 Ga0068865_100025241 3300006881 Bacteria 3907
246 Ga0075436_100000333 3300006914 Bacteria 30104
247 Ga0075436_100013080 3300006914 Bacteria 5688
248 Ga0075436_100030653 3300006914 Bacteria 3700
249 Ga0097620_100001058 3300006931 Bacteria 28155
250 Ga0097620_100004504 3300006931 Bacteria 14217
251 Ga0097620_100043797 3300006931 Bacteria 4498
252 Ga0097620_100155486 3300006931 Unclassified 2364
253 Ga0097620_100285295 3300006931 Bacteria 1744
254 Ga0097620_100340560 3300006931 Bacteria 1594
255 Ga0097620_100409773 3300006931 Bacteria 1451
256 Ga0075435_100000013 3300007076 Bacteria 106345
257 Ga0075435_100000453 3300007076 Bacteria 25085
258 Ga0075435_100005757 3300007076 Bacteria 8701
259 Ga0075435_100007588 3300007076 Bacteria 7744
260 Ga0075435_100013988 3300007076 Bacteria 5984
261 Ga0075435_100019898 3300007076 Bacteria 5133
262 Ga0075435_100020852 3300007076 Bacteria 5030
263 Ga0075435_100024643 3300007076 Bacteria 4672
264 Ga0075435_100064907 3300007076 Bacteria 2967
265 Ga0075435_100078974 3300007076 Bacteria 2700
266 Ga0075435_100109561 3300007076 Bacteria 2296
267 Ga0099794_10072855 3300007265 Bacteria 1685
268 Ga0105240_10043536 3300009093 Bacteria 5711
269 Ga0105240_10057222 3300009093 Bacteria 4874
270 Ga0111539_10000958 3300009094 Bacteria 37856
271 Ga0111539_10000996 3300009094 Bacteria 37109
272 Ga0111539_10001448 3300009094 Bacteria 31687
273 Ga0111539_10004655 3300009094 Bacteria 17929
274 Ga0111539_10036411 3300009094 Bacteria 5951
275 Ga0111539_10049498 3300009094 Bacteria 5010
276 Ga0111539_10058302 3300009094 Bacteria 4581
277 Ga0111539_10078681 3300009094 Bacteria 3878
278 Ga0111539_10195892 3300009094 Bacteria 2357
279 Ga0111539_10199163 3300009094 Bacteria 2336
280 Ga0111539_10231376 3300009094 Bacteria 2152
281 Ga0111539_10273283 3300009094 Bacteria 1967
282 Ga0111539_10350290 3300009094 Unclassified 1719
283 Ga0111539_10533263 3300009094 Bacteria 1368
284 Ga0111539_10615065 3300009094 Bacteria 1265
285 Ga0105245_10014493 3300009098 Bacteria 6865
286 Ga0105247_10024875 3300009101 Bacteria 3610
287 Ga0114129_10000695 3300009147 Bacteria 42405
288 Ga0114129_10001668 3300009147 Bacteria 30238
289 Ga0114129_10012747 3300009147 Bacteria 11968
290 Ga0114129_10015897 3300009147 Bacteria 10704
291 Ga0114129_10020337 3300009147 Bacteria 9442
292 Ga0114129_10020626 3300009147 Bacteria 9370
293 Ga0114129_10030117 3300009147 Bacteria 7686
294 Ga0114129_10033460 3300009147 Bacteria 7264
295 Ga0114129_10044368 3300009147 Bacteria 6255
296 Ga0114129_10050087 3300009147 Bacteria 5868
297 Ga0114129_10054525 3300009147 Bacteria 5605
298 Ga0114129_10055581 3300009147 Bacteria 5547
299 Ga0114129_10084800 3300009147 Bacteria 4397
300 Ga0114129_10095028 3300009147 Bacteria 4128
301 Ga0114129_10099999 3300009147 Bacteria 4013
302 Ga0114129_10104213 3300009147 Bacteria 3920
303 Ga0114129_10104929 3300009147 Bacteria 3906
304 Ga0114129_10178366 3300009147 Bacteria 2892
305 Ga0114129_10253807 3300009147 Bacteria 2360
306 Ga0114129_10256740 3300009147 Bacteria 2344
307 Ga0114129_10274842 3300009147 Bacteria 2253
308 Ga0114129_10291890 3300009147 Bacteria 2176
309 Ga0114129_10307147 3300009147 Bacteria 2112
310 Ga0114129_10585728 3300009147 Bacteria 1447
311 Ga0105243_10044930 3300009148 Bacteria 3468
312 Ga0105243_10083381 3300009148 Bacteria 2615
313 Ga0105243_10122724 3300009148 Bacteria 2193
314 Ga0105243_10137086 3300009148 Bacteria 2083
315 Ga0105243_10353516 3300009148 Unclassified 1350
316 Ga0105242_10019938 3300009176 Bacteria 5253
317 Ga0105242_10038435 3300009176 Bacteria 3849
318 Ga0105248_10005408 3300009177 Bacteria 14041
319 Ga0105248_10034009 3300009177 Bacteria 5698
320 Ga0105248_10074742 3300009177 Bacteria 3808
321 Ga0105248_10130835 3300009177 Bacteria 2831
322 Ga0105248_10145705 3300009177 Bacteria 2672
323 Ga0105248_10168001 3300009177 Bacteria 2473
324 Ga0105248_10187014 3300009177 Bacteria 2334
325 Ga0105248_10329822 3300009177 Unclassified 1719
326 Ga0105249_10064815 3300009553 Bacteria 3360
327 Ga0105249_10091657 3300009553 Bacteria 2844
328 Ga0105249_10239139 3300009553 Bacteria 1794
329 Ga0105249_10243735 3300009553 Bacteria 1778
330 Ga0105249_10315859 3300009553 Bacteria 1572
331 Ga0105246_10169222 3300011119 Bacteria 1672
332 Ga0157374_10291423 3300013296 Bacteria 1613
333 Ga0157378_10206139 3300013297 Bacteria 1862
334 Ga0157378_10239107 3300013297 Bacteria 1734
335 Ga0157378_10282512 3300013297 Unclassified 1600
336 Ga0163162_10036236 3300013306 Bacteria 4915
337 Ga0163162_10282014 3300013306 Unclassified 1793
338 Ga0157375_10003610 3300013308 Bacteria 13422
339 Ga0157375_10007743 3300013308 Bacteria 9403
340 Ga0157375_10058520 3300013308 Bacteria 3813
341 Ga0157375_10179075 3300013308 Bacteria 2271
342 Ga0157375_10229085 3300013308 Bacteria 2017
343 Ga0157375_10248799 3300013308 Bacteria 1938
344 Ga0157375_10422321 3300013308 Bacteria 1499
345 Ga0163163_10012601 3300014325 Bacteria 7710
346 Ga0163163_10014077 3300014325 Bacteria 7344
347 Ga0163163_10048664 3300014325 Bacteria 4170
348 Ga0163163_10098635 3300014325 Bacteria 2943
349 Ga0163163_10188281 3300014325 Bacteria 2112
350 Ga0157380_10011440 3300014326 Bacteria 6413
351 Ga0157380_10022954 3300014326 Bacteria 4705
352 Ga0157380_10028974 3300014326 Bacteria 4229
353 Ga0157380_10200531 3300014326 Bacteria 1770
354 Ga0157380_10379117 3300014326 Unclassified 1334
355 Ga0157380_10392759 3300014326 Bacteria 1313
356 Ga0157377_10035310 3300014745 Bacteria 2742
357 Ga0157377_10036903 3300014745 Bacteria 2690
358 Ga0157377_10070331 3300014745 Bacteria 2021
359 Ga0157379_10040140 3300014968 Bacteria 4176
360 Ga0157379_10125208 3300014968 Bacteria 2312
361 Ga0157376_10110921 3300014969 Bacteria 2414
362 Ga0157376_10149950 3300014969 Bacteria 2102
363 Ga0157376_10190196 3300014969 Unclassified 1882
364 Ga0157376_10292496 3300014969 Bacteria 1538
365 Ga0163161_10030955 3300017792 Bacteria 3810
366 Ga0207697_10000739 3300025315 Bacteria 18490
367 Ga0207656_10015457 3300025321 Bacteria 2954
368 Ga0207682_10035691 3300025893 Bacteria 2009
369 Ga0207682_10038498 3300025893 Bacteria 1940
370 Ga0207682_10053067 3300025893 Bacteria 1681
371 Ga0207682_10098937 3300025893 Unclassified 1273
372 Ga0207642_10006447 3300025899 Bacteria 3901
373 Ga0207688_10000747 3300025901 Bacteria 16149
374 Ga0207688_10046621 3300025901 Bacteria 2420
375 Ga0207680_10003526 3300025903 Bacteria 7367
376 Ga0207680_10004710 3300025903 Bacteria 6485
377 Ga0207680_10112153 3300025903 Bacteria 1770
378 Ga0207680_10140429 3300025903 Bacteria 1601
379 Ga0207699_10002553 3300025906 Bacteria 8585
380 Ga0207645_10001797 3300025907 Bacteria 17315
381 Ga0207645_10009059 3300025907 Bacteria 6907
382 Ga0207645_10086515 3300025907 Bacteria 2014
383 Ga0207645_10091312 3300025907 Bacteria 1958
384 Ga0207643_10001412 3300025908 Bacteria 13774
385 Ga0207643_10004260 3300025908 Bacteria 7704
386 Ga0207643_10011758 3300025908 Bacteria 4727
387 Ga0207643_10027517 3300025908 Bacteria 3152
388 Ga0207643_10087387 3300025908 Bacteria 1813
389 Ga0207684_10290953 3300025910 Bacteria 1408
390 Ga0207654_10085054 3300025911 Bacteria 1913
391 Ga0207707_10078031 3300025912 Bacteria 2891
392 Ga0207707_10079099 3300025912 Bacteria 2871
393 Ga0207695_10031452 3300025913 Bacteria 5820
394 Ga0207695_10032575 3300025913 Bacteria 5701
395 Ga0207660_10159705 3300025917 Bacteria 1738
396 Ga0207662_10010392 3300025918 Bacteria 5139
397 Ga0207662_10018680 3300025918 Bacteria 3937
398 Ga0207662_10036519 3300025918 Unclassified 2872
399 Ga0207649_10003247 3300025920 Bacteria 8892
400 Ga0207652_10127226 3300025921 Bacteria 2270
401 Ga0207646_10020785 3300025922 Bacteria 6078
402 Ga0207646_10160787 3300025922 Bacteria 2027
403 Ga0207681_10006602 3300025923 Bacteria 7122
404 Ga0207681_10015754 3300025923 Bacteria 4719
405 Ga0207681_10031155 3300025923 Bacteria 3480
406 Ga0207681_10047292 3300025923 Bacteria 2898
407 Ga0207681_10074346 3300025923 Bacteria 2380
408 Ga0207681_10158660 3300025923 Bacteria 1702
409 Ga0207681_10186931 3300025923 Bacteria 1582
410 Ga0207694_10078753 3300025924 Bacteria 2584
411 Ga0207650_10016828 3300025925 Bacteria 5115
412 Ga0207650_10037139 3300025925 Bacteria 3548
413 Ga0207650_10104383 3300025925 Bacteria 2186
414 Ga0207659_10000210 3300025926 Bacteria 35194
415 Ga0207659_10000599 3300025926 Bacteria 21514
416 Ga0207659_10009784 3300025926 Bacteria 5997
417 Ga0207659_10011410 3300025926 Bacteria 5613
418 Ga0207659_10017195 3300025926 Bacteria 4720
419 Ga0207659_10023816 3300025926 Bacteria 4093
420 Ga0207659_10029578 3300025926 Bacteria 3735
421 Ga0207659_10054147 3300025926 Bacteria 2864
422 Ga0207659_10094441 3300025926 Bacteria 2241
423 Ga0207659_10229905 3300025926 Bacteria 1495
424 Ga0207659_10280056 3300025926 Bacteria 1363
425 Ga0207687_10013068 3300025927 Bacteria 5426
426 Ga0207687_10074631 3300025927 Bacteria 2431
427 Ga0207700_10356493 3300025928 Bacteria 1274
428 Ga0207644_10037625 3300025931 Bacteria 3405
429 Ga0207644_10071324 3300025931 Bacteria 2541
430 Ga0207706_10006644 3300025933 Bacteria 10700
431 Ga0207706_10037129 3300025933 Bacteria 4327
432 Ga0207706_10149403 3300025933 Bacteria 2055
433 Ga0207686_10008586 3300025934 Bacteria 5520
434 Ga0207686_10010755 3300025934 Bacteria 4985
435 Ga0207709_10014510 3300025935 Bacteria 4352
436 Ga0207709_10037591 3300025935 Bacteria 2878
437 Ga0207709_10046045 3300025935 Unclassified 2645
438 Ga0207709_10173971 3300025935 Bacteria 1514
439 Ga0207670_10008231 3300025936 Bacteria 5871
440 Ga0207670_10086342 3300025936 Bacteria 2207
441 Ga0207669_10010233 3300025937 Bacteria 4509
442 Ga0207669_10070162 3300025937 Bacteria 2196
443 Ga0207704_10018451 3300025938 Unclassified 3642
444 Ga0207704_10035111 3300025938 Bacteria 2869
445 Ga0207665_10087986 3300025939 Bacteria 2148
446 Ga0207691_10002019 3300025940 Bacteria 19878
447 Ga0207691_10008809 3300025940 Bacteria 9678
448 Ga0207691_10013413 3300025940 Bacteria 7844
449 Ga0207691_10079191 3300025940 Bacteria 2957
450 Ga0207691_10100926 3300025940 Bacteria 2575
451 Ga0207691_10119404 3300025940 Bacteria 2338
452 Ga0207691_10209038 3300025940 Bacteria 1696
453 Ga0207711_10054890 3300025941 Bacteria 3420
454 Ga0207711_10065365 3300025941 Bacteria 3144
455 Ga0207711_10074262 3300025941 Bacteria 2957
456 Ga0207711_10086760 3300025941 Bacteria 2745
457 Ga0207711_10261984 3300025941 Bacteria 1589
458 Ga0207689_10001643 3300025942 Bacteria 21180
459 Ga0207689_10002419 3300025942 Bacteria 17363
460 Ga0207689_10019900 3300025942 Bacteria 5653
461 Ga0207689_10107958 3300025942 Bacteria 2287
462 Ga0207661_10013640 3300025944 Bacteria 5934
463 Ga0207661_10274314 3300025944 Unclassified 1506
464 Ga0207679_10006804 3300025945 Bacteria 7247
465 Ga0207679_10109412 3300025945 Bacteria 2178
466 Ga0207651_10027029 3300025960 Bacteria 3597
467 Ga0207651_10028600 3300025960 Bacteria 3519
468 Ga0207651_10065623 3300025960 Unclassified 2546
469 Ga0207651_10162510 3300025960 Bacteria 1752
470 Ga0207651_10162548 3300025960 Bacteria 1752
471 Ga0207712_10016986 3300025961 Bacteria 4721
472 Ga0207668_10017178 3300025972 Bacteria 4529
473 Ga0207668_10132233 3300025972 Bacteria 1907
474 Ga0207640_10079131 3300025981 Bacteria 2240
475 Ga0207658_10018984 3300025986 Bacteria 4755
476 Ga0207658_10066582 3300025986 Bacteria 2710
477 Ga0207677_10209070 3300026023 Bacteria 1557
478 Ga0207677_10256427 3300026023 Bacteria 1423
479 Ga0207703_10022084 3300026035 Bacteria 4987
480 Ga0207703_10046108 3300026035 Bacteria 3510
481 Ga0207703_10061230 3300026035 Bacteria 3081
482 Ga0207703_10120854 3300026035 Bacteria 2249
483 Ga0207703_10168905 3300026035 Bacteria 1922
484 Ga0207678_10091756 3300026067 Bacteria 2596
485 Ga0207678_10180781 3300026067 Bacteria 1801
486 Ga0207708_10030121 3300026075 Unclassified 4116
487 Ga0207708_10042673 3300026075 Bacteria 3457
488 Ga0207708_10054709 3300026075 Unclassified 3043
489 Ga0207708_10100343 3300026075 Bacteria 2240
490 Ga0207708_10131867 3300026075 Bacteria 1954
491 Ga0207702_10069173 3300026078 Bacteria 3035
492 Ga0207641_10034410 3300026088 Bacteria 4214
493 Ga0207641_10256903 3300026088 Bacteria 1634
494 Ga0207641_10330725 3300026088 Bacteria 1447
495 Ga0207648_10008726 3300026089 Bacteria 9774
496 Ga0207648_10019397 3300026089 Bacteria 6137
497 Ga0207648_10021169 3300026089 Bacteria 5846
498 Ga0207648_10148532 3300026089 Bacteria 2068
499 Ga0207648_10263056 3300026089 Bacteria 1540
500 Ga0207676_10071414 3300026095 Bacteria 2787
501 Ga0207676_10092994 3300026095 Bacteria 2481
502 Ga0207676_10179944 3300026095 Unclassified 1850
503 Ga0207674_10030937 3300026116 Bacteria 5626
504 Ga0207674_10083050 3300026116 Bacteria 3203
505 Ga0207674_10131805 3300026116 Bacteria 2462
506 Ga0207675_100000566 3300026118 Bacteria 36197
507 Ga0207675_100013760 3300026118 Bacteria 7546
508 Ga0207675_100028867 3300026118 Bacteria 5167
509 Ga0207675_100031045 3300026118 Bacteria 4976
510 Ga0207675_100064938 3300026118 Bacteria 3411
511 Ga0207675_100068158 3300026118 Bacteria 3326
512 Ga0207675_100121064 3300026118 Bacteria 2476
513 Ga0207675_100152657 3300026118 Bacteria 2199
514 Ga0207675_100267962 3300026118 Bacteria 1657
515 Ga0207683_10003173 3300026121 Bacteria 14352
516 Ga0207683_10116063 3300026121 Bacteria 2400
517 Ga0209813_10011607 3300027866 Bacteria 2307
518 Ga0207428_10000807 3300027907 Bacteria 35397
519 Ga0207428_10001394 3300027907 Bacteria 25518
520 Ga0207428_10002779 3300027907 Bacteria 17386
521 Ga0207428_10003321 3300027907 Bacteria 15648
522 Ga0207428_10003766 3300027907 Bacteria 14559
523 Ga0207428_10035507 3300027907 Bacteria 4074
524 Ga0207428_10050135 3300027907 Bacteria 3341
525 Ga0268266_10068388 3300028379 Bacteria 3075
526 Ga0268266_10427357 3300028379 Bacteria 1256
527 Ga0268265_10000816 3300028380 Bacteria 29554
528 Ga0268265_10025750 3300028380 Bacteria 4179
529 Ga0268265_10183439 3300028380 Bacteria 1800
530 Ga0268265_10309949 3300028380 Bacteria 1425
531 Ga0268264_10014359 3300028381 Bacteria 6511
532 Ga0268264_10027450 3300028381 Bacteria 4652
533 Ga0268264_10096255 3300028381 Bacteria 2563
534 Ga0265328_10045917 3300031239 Bacteria 1606
535 Ga0307408_100041230 3300031548 Unclassified 3272
536 Ga0307408_100136220 3300031548 Bacteria 1922
537 Ga0307408_100202233 3300031548 Bacteria 1609
538 Ga0307405_10097152 3300031731 Bacteria 1966
539 Ga0307413_10005077 3300031824 Bacteria 5822
540 Ga0307413_10232743 3300031824 Bacteria 1354
541 Ga0307410_10039059 3300031852 Bacteria 3113
542 Ga0307410_10218480 3300031852 Bacteria 1465
543 Ga0307406_10015483 3300031901 Bacteria 4415
544 Ga0307406_10142772 3300031901 Bacteria 1697
545 Ga0307406_10265257 3300031901 Bacteria 1301
546 Ga0307407_10001680 3300031903 Bacteria 8201
547 Ga0307407_10010082 3300031903 Bacteria 4438
548 Ga0307412_10003932 3300031911 Bacteria 8277
549 Ga0307412_10072341 3300031911 Bacteria 2356
550 Ga0307412_10081060 3300031911 Bacteria 2243
551 Ga0307409_100025529 3300031995 Bacteria 4147
552 Ga0307409_100028219 3300031995 Bacteria 3994
553 Ga0307409_100107420 3300031995 Bacteria 2331
554 Ga0307409_100127963 3300031995 Bacteria 2164
555 Ga0307409_100240986 3300031995 Unclassified 1646
556 Ga0307416_100004327 3300032002 Bacteria 8536
557 Ga0307416_100018613 3300032002 Bacteria 4899
558 Ga0307416_100037812 3300032002 Bacteria 3718
559 Ga0307416_100043767 3300032002 Bacteria 3509
560 Ga0307416_100049053 3300032002 Bacteria 3354
561 Ga0307416_100085993 3300032002 Unclassified 2679
562 Ga0307416_100088604 3300032002 Bacteria 2647
563 Ga0307416_100268487 3300032002 Bacteria 1673
564 Ga0307416_100327625 3300032002 Bacteria 1537
565 Ga0307416_100467101 3300032002 Bacteria 1318
566 Ga0307414_10091436 3300032004 Unclassified 2262
567 Ga0307411_10020504 3300032005 Bacteria 3846
568 Ga0307411_10253291 3300032005 Unclassified 1386
569 Ga0307411_10275984 3300032005 Bacteria 1335
570 Ga0307415_100015508 3300032126 Bacteria 4515
571 Ga0307415_100100086 3300032126 Bacteria 2123
572 Ga0307415_100109085 3300032126 Bacteria 2049
573 Ga0307415_100121525 3300032126 Unclassified 1959
574 Ga0307415_100273744 3300032126 Unclassified 1384
575 Ga0373950_0000505 3300034818 Bacteria 4763
576 Ga0373938_0000051 3300034957 Bacteria 15254
577 Ga0373934_0037053 3300035086 Bacteria 1921
578 Ga0373940_0000704 3300035088 Bacteria 5410
579 Ga0373949_0000883 3300035090 Bacteria 9480
580 Ga0373951_0000949 3300035091 Bacteria 7792
581 Ga0373952_0000290 3300035092 Bacteria 8312
582 Ga0373932_0002025 3300035112 Bacteria 5325
583 Ga0373939_0001228 3300035114 Bacteria 6267
584 Ga0373941_0000211 3300035115 Bacteria 11167
585 Ga0373941_0010873 3300035115 Bacteria 2339
586 Ga0373941_0014417 3300035115 Bacteria 2111
587 Ga0373941_0056686 3300035115 Unclassified 1263
588 Ga0373956_0026516 3300035119 Bacteria 2511
589 Ga0373960_0000632 3300035121 Bacteria 7221
590 Ga0373943_0072573 3300035170 Bacteria 1746
591 Ga0373942_0003027 3300035207 Bacteria 3979
592 Ga0373961_0001504 3300035241 Bacteria 6814
593 Ga0373924_0028364 3300035410 Bacteria 2231
594 Ga0373931_0000366 3300035691 Bacteria 18614
595 Ga0373933_0209649 3300035724 Bacteria 1248
596 Ga0373947_0043667 3300035725 Bacteria 2678
597 Ga0373947_0084336 3300035725 Bacteria 1972
598 Ga0373937_0069758 3300036401 Bacteria 3241
599 Ga0373937_0078089 3300036401 Bacteria 3059
600 Ga0439453_0012862 3300041408 Bacteria 1416
601 Ga0439446_0009727 3300042156 Bacteria 2579
602 Ga0439435_0003278 3300042436 Bacteria 3346
603 Ga0439435_0009269 3300042436 Bacteria 2306
604 Ga0451577_0347893 3300042876 Bacteria 1345
605 Ga0466963_0019782 3300044694 Bacteria 4228
606 Ga0451576_0014606 3300045051 Bacteria 8729
607 Ga0451576_0057540 3300045051 Bacteria 4064
608 Ga0451576_0117693 3300045051 Bacteria 2766
609 Ga0451576_0200232 3300045051 Bacteria 2086
610 Ga0466967_0195234 3300045976 Bacteria 1915
611 Ga0466967_0287512 3300045976 Bacteria 1579
612 Ga0495592_0095896 3300046454 Bacteria 2121
613 Ga0495603_0089193 3300046455 Bacteria 1804
614 Ga0495629_0005387 3300046459 Bacteria 9544
615 Ga0495653_0013146 3300046463 Bacteria 6749
616 Ga0495580_0047688 3300046472 Bacteria 3036
617 Ga0495580_0088692 3300046472 Bacteria 2154
618 Ga0495584_0030124 3300046491 Bacteria 2749
619 Ga0495608_0026552 3300046511 Bacteria 3946
620 Ga0495628_0063878 3300046516 Bacteria 2883
621 Ga0495630_0046829 3300046517 Bacteria 3233
622 Ga0495643_0002908 3300046522 Bacteria 12989
623 Ga0495663_0008282 3300046525 Bacteria 2879
624 Ga0495663_0011056 3300046525 Bacteria 2513
625 Ga0495642_0017402 3300046528 Bacteria 2808
626 Ga0495587_0058470 3300046536 Unclassified 2265
627 Ga0495598_0003343 3300046537 Bacteria 3398
628 Ga0495598_0024458 3300046537 Bacteria 1638
629 Ga0495609_0067066 3300046538 Bacteria 1581
630 Ga0495621_0001396 3300046539 Bacteria 6251
631 Ga0495645_0070645 3300046543 Bacteria 2519
632 Ga0495599_0038815 3300046678 Bacteria 2993
633 Ga0495647_0014274 3300046681 Bacteria 2765
634 Ga0495658_0046922 3300046683 Bacteria 2430
635 Ga0495669_0057435 3300046684 Bacteria 1756
636 Ga0495613_0003817 3300046689 Bacteria 11289
637 Ga0495600_0045831 3300046809 Bacteria 2853
638 Ga0495604_0034302 3300047317 Bacteria 4015
639 Ga0495636_0014289 3300047318 Bacteria 3156
640 Ga0495674_0031173 3300047319 Bacteria 4845
641 Ga0495676_0064547 3300047321 Bacteria 2846
642 Ga0495684_0000663 3300047471 Bacteria 27724
643 Ga0496100_0013722 3300048903 Bacteria 4684
644 Ga0496101_0001617 3300048904 Bacteria 13532
645 Ga0496101_0092523 3300048904 Bacteria 2251
646 Ga0496102_0014516 3300048905 Bacteria 6845
647 Ga0496102_0069442 3300048905 Bacteria 3234
648 Ga0496102_0383093 3300048905 Bacteria 1323
649 Ga0496104_0044349 3300048907 Bacteria 4178
650 Ga0496104_0238774 3300048907 Bacteria 1729
651 Ga0496105_0068536 3300048908 Bacteria 2931
652 Ga0496106_0006608 3300048909 Bacteria 8585
653 Ga0496106_0096353 3300048909 Bacteria 2289
654 Ga0496109_0049387 3300048912 Bacteria 3830
655 Ga0496109_0467237 3300048912 Bacteria 1191
656 Ga0496110_0053028 3300048913 Bacteria 3564
657 Ga0496112_0031322 3300048915 Bacteria 5158
658 Ga0496112_0174755 3300048915 Bacteria 2113
659 Ga0496113_0142872 3300048916 Bacteria 1884
660 Ga0496114_0000536 3300048917 Bacteria 28013
661 Ga0501031_0158144 3300049568 Bacteria 1481
662 Ga0501033_0010655 3300049570 Bacteria 7047
663 Ga0501034_0020337 3300049571 Bacteria 6776
664 Ga0501034_0455059 3300049571 Unclassified 1197
665 Ga0501036_0004722 3300049572 Bacteria 10992
666 Ga0501036_0049017 3300049572 Bacteria 3576
667 Ga0501036_0052693 3300049572 Bacteria 3446
668 Ga0501036_0143139 3300049572 Bacteria 2017
669 Ga0501037_0023324 3300049573 Bacteria 4577
670 Ga0501037_0194317 3300049573 Bacteria 1436
671 Ga0501037_0224332 3300049573 Bacteria 1321
672 Ga0501038_0150326 3300049574 Unclassified 1899
673 Ga0501039_0013118 3300049575 Bacteria 6336
674 Ga0501039_0016551 3300049575 Bacteria 5648
675 Ga0501039_0042163 3300049575 Bacteria 3526
676 Ga0501039_0278888 3300049575 Bacteria 1314
677 Ga0501040_0028691 3300049576 Bacteria 3752
678 Ga0501040_0036967 3300049576 Bacteria 3315
679 Ga0501040_0112089 3300049576 Bacteria 1908
680 Ga0501040_0160059 3300049576 Bacteria 1591
681 Ga0501041_0009003 3300049577 Bacteria 5872
682 Ga0501041_0017829 3300049577 Bacteria 4225
683 Ga0501041_0030859 3300049577 Bacteria 3235
684 Ga0501041_0064277 3300049577 Bacteria 2247
685 Ga0501041_0095884 3300049577 Bacteria 1833
686 Ga0501042_0018970 3300049578 Bacteria 4771
687 Ga0501042_0040789 3300049578 Bacteria 3299
688 Ga0501042_0047915 3300049578 Bacteria 3047
689 Ga0501042_0113903 3300049578 Bacteria 1947
690 Ga0501042_0205923 3300049578 Bacteria 1419
691 Ga0501046_0017590 3300049580 Bacteria 5962
692 Ga0501046_0042497 3300049580 Bacteria 3624
693 Ga0501046_0210130 3300049580 Unclassified 1445
694 Ga0501047_0116130 3300049581 Bacteria 2558
695 Ga0501048_0014379 3300049582 Bacteria 5862
696 Ga0501048_0028183 3300049582 Bacteria 4078
697 Ga0501048_0066314 3300049582 Bacteria 2552
698 Ga0501048_0124065 3300049582 Bacteria 1826
699 Ga0501071_0006323 3300049587 Bacteria 7684
700 Ga0501071_0019266 3300049587 Bacteria 4734
701 Ga0501071_0098762 3300049587 Bacteria 2151
702 Ga0501072_0007639 3300049588 Bacteria 8206
703 Ga0501072_0011041 3300049588 Bacteria 6893
704 Ga0501072_0013319 3300049588 Bacteria 6295
705 Ga0501072_0060468 3300049588 Bacteria 2987
706 Ga0501072_0070948 3300049588 Bacteria 2752
707 Ga0501072_0137974 3300049588 Bacteria 1945
708 Ga0501073_0001672 3300049589 Bacteria 16435
709 Ga0501074_0045953 3300049590 Bacteria 3158
710 Ga0501074_0104064 3300049590 Bacteria 2032
711 Ga0501075_0014228 3300049591 Bacteria 5701
712 Ga0501075_0014298 3300049591 Bacteria 5686
713 Ga0501075_0016929 3300049591 Bacteria 5257
714 Ga0501075_0024625 3300049591 Bacteria 4417
715 Ga0501075_0030789 3300049591 Bacteria 3977
716 Ga0501076_0006209 3300049592 Bacteria 8648
717 Ga0501076_0012485 3300049592 Bacteria 6353
718 Ga0501076_0013490 3300049592 Bacteria 6128
719 Ga0501076_0023443 3300049592 Bacteria 4758
720 Ga0501076_0077997 3300049592 Bacteria 2658
721 Ga0501076_0108921 3300049592 Bacteria 2238
722 Ga0501076_0113720 3300049592 Bacteria 2190
723 Ga0501077_0009766 3300049593 Bacteria 5969
724 Ga0501077_0047473 3300049593 Bacteria 2729
725 Ga0501077_0056436 3300049593 Bacteria 2493
726 Ga0501077_0086317 3300049593 Bacteria 1989
727 Ga0501079_0007017 3300049741 Bacteria 8495
728 Ga0501079_0021460 3300049741 Bacteria 4940
729 Ga0501079_0021680 3300049741 Bacteria 4916
730 Ga0501080_0020785 3300049742 Bacteria 6078
731 Ga0501080_0063744 3300049742 Bacteria 3429
732 Ga0501080_0080523 3300049742 Bacteria 3027
733 Ga0501080_0172819 3300049742 Bacteria 1992
734 Ga0501080_0342134 3300049742 Bacteria 1351
735 Ga0501081_0025246 3300049743 Bacteria 3996
736 Ga0501081_0036034 3300049743 Bacteria 3371
737 Ga0501081_0050839 3300049743 Bacteria 2856
738 Ga0501081_0137415 3300049743 Bacteria 1750
739 Ga0501035_0338604 3300049822 Bacteria 1261
740 Ga0501044_0004995 3300049823 Bacteria 14809
741 Ga0501045_0029659 3300049824 Bacteria 3955
742 Ga0501045_0030263 3300049824 Bacteria 3917
743 Ga0501045_0031424 3300049824 Bacteria 3846
744 Ga0501045_0034448 3300049824 Bacteria 3676
745 Ga0501045_0036488 3300049824 Bacteria 3569
746 Ga0501045_0149223 3300049824 Bacteria 1739
747 Ga0501045_0165299 3300049824 Bacteria 1648
748 nmdc:mga03683_20760_c1 3300050489 Bacteria 2525
749 nmdc:mga00v17_12320_c1 3300050491 Bacteria 4717
750 nmdc:mga00v17_9461_c1 3300050491 Bacteria 5276
751 nmdc:mga0k408_61269_c1 3300050493 Bacteria 2187
752 nmdc:mga06z11_2051_c1 3300050494 Bacteria 7645
753 nmdc:mga06z11_48021_c1 3300050494 Bacteria 2171
754 nmdc:mga04h51_21444_c1 3300050495 Bacteria 1944
755 nmdc:mga05p37_10311_c1 3300050507 Bacteria 5927
756 nmdc:mga05p37_1037_c1 3300050507 Bacteria 31680
757 nmdc:mga05p37_158846_c1 3300050507 Bacteria 2761
758 nmdc:mga05p37_16554_c1 3300050507 Bacteria 8882
759 nmdc:mga05p37_28950_c1 3300050507 Bacteria 6758
760 nmdc:mga05p37_30444_c1 3300050507 Bacteria 6585
761 nmdc:mga05p37_3083_c1 3300050507 Bacteria 19357
762 nmdc:mga05p37_31381_c1 3300050507 Bacteria 6489
763 nmdc:mga05p37_35997_c1 3300050507 Bacteria 6073
764 nmdc:mga05p37_397507_c1 3300050507 Bacteria 1610
765 nmdc:mga05p37_51640_c1 3300050507 Bacteria 5055
766 nmdc:mga05p37_58386_c1 3300050507 Bacteria 4752
767 nmdc:mga05p37_614887_c1 3300050507 Bacteria 1224
768 nmdc:mga05p37_8613_c1 3300050507 Bacteria 12059
769 nmdc:mga05p37_90009_c1 3300050507 Bacteria 3782
770 nmdc:mga05p37_92167_c1 3300050507 Bacteria 3734
771 nmdc:mga05p37_99406_c1 3300050507 Bacteria 3583
772 nmdc:mga09592_109670_c1 3300050508 Bacteria 2367
773 nmdc:mga09592_113390_c1 3300050508 Bacteria 2326
774 nmdc:mga09592_14943_c1 3300050508 Bacteria 6342
775 nmdc:mga09592_181042_c1 3300050508 Bacteria 1823
776 nmdc:mga09592_240752_c1 3300050508 Unclassified 1568
777 nmdc:mga09592_5378_c1 3300050508 Bacteria 10412
778 nmdc:mga09592_6459_c1 3300050508 Bacteria 9545
779 nmdc:mga09592_66623_c1 3300050508 Bacteria 3052
780 nmdc:mga0qj67_1375_c1 3300050509 Bacteria 17028
781 nmdc:mga0qj67_202577_c1 3300050509 Bacteria 1612
782 nmdc:mga0qj67_230272_c1 3300050509 Bacteria 1504
783 nmdc:mga0qj67_32473_c1 3300050509 Bacteria 4071
784 nmdc:mga0qj67_435_c1 3300050509 Bacteria 28521
785 nmdc:mga0qj67_60752_c1 3300050509 Bacteria 2999
786 nmdc:mga0qj67_78815_c1 3300050509 Bacteria 2637
787 nmdc:mga0qj67_79668_c1 3300050509 Bacteria 2624
788 nmdc:mga0qj67_9524_c1 3300050509 Bacteria 7235
789 nmdc:mga06r32_1137_c1 3300050510 Bacteria 23887
790 nmdc:mga06r32_162237_c1 3300050510 Bacteria 2218
791 nmdc:mga06r32_20394_c1 3300050510 Bacteria 6103
792 nmdc:mga06r32_22516_c1 3300050510 Bacteria 5825
793 nmdc:mga06r32_273922_c1 3300050510 Bacteria 1675
794 nmdc:mga06r32_283021_c1 3300050510 Bacteria 1645
795 nmdc:mga06r32_33701_c1 3300050510 Bacteria 4824
796 nmdc:mga06r32_33710_c1 3300050510 Bacteria 4824
797 nmdc:mga06r32_594354_c1 3300050510 Bacteria 1078
798 nmdc:mga08y16_10068_c1 3300050511 Bacteria 9924
799 nmdc:mga08y16_10165_c1 3300050511 Bacteria 9878
800 nmdc:mga08y16_1024_c1 3300050511 Bacteria 27419
801 nmdc:mga08y16_130476_c1 3300050511 Bacteria 2614
802 nmdc:mga08y16_180709_c1 3300050511 Bacteria 2190
803 nmdc:mga08y16_257_c1 3300050511 Bacteria 47826
804 nmdc:mga08y16_312951_c1 3300050511 Bacteria 1617
805 nmdc:mga08y16_3443_c1 3300050511 Bacteria 16420
806 nmdc:mga08y16_4780_c1 3300050511 Bacteria 14131
807 nmdc:mga08y16_5187_c1 3300050511 Bacteria 13608
808 nmdc:mga08y16_66195_c1 3300050511 Bacteria 3771
809 nmdc:mga08y16_7027_c1 3300050511 Bacteria 11811
810 nmdc:mga0n895_118569_c1 3300050512 Bacteria 2667
811 nmdc:mga0n895_136_c1 3300050512 Bacteria 44076
812 nmdc:mga0n895_14796_c1 3300050512 Bacteria 7099
813 nmdc:mga0n895_173953_c1 3300050512 Bacteria 2184
814 nmdc:mga0n895_234045_c1 3300050512 Bacteria 1864
815 nmdc:mga0n895_304_c1 3300050512 Bacteria 32605
816 nmdc:mga0n895_44093_c1 3300050512 Bacteria 4350
817 nmdc:mga0rr50_17022_c1 3300050513 Bacteria 4842
818 nmdc:mga0rr50_2762_c1 3300050513 Bacteria 9976
819 nmdc:mga0rr50_36386_c1 3300050513 Bacteria 3545
820 nmdc:mga0rr50_6036_c1 3300050513 Bacteria 7318
821 nmdc:mga0rr50_65542_c1 3300050513 Bacteria 2752
822 nmdc:mga0rr50_9_c1 3300050513 Bacteria 224716
823 nmdc:mga08x19_135528_c1 3300050514 Bacteria 1660
824 nmdc:mga08x19_1629_c1 3300050514 Bacteria 13893
825 nmdc:mga08x19_33193_c1 3300050514 Bacteria 3257
826 nmdc:mga0a205_16118_c1 3300050515 Bacteria 6997
827 nmdc:mga0a205_362_c1 3300050515 Bacteria 34201
828 nmdc:mga0a205_4424_c1 3300050515 Bacteria 12614
829 Ga0495601_0064800 3300053077 Bacteria 2324
830 Ga0495601_0231427 3300053077 Unclassified 1207
831 Ga0495619_0004408 3300053085 Bacteria 8982
832 Ga0501084_0010703 3300054114 Bacteria 7592
833 Ga0501084_0029353 3300054114 Bacteria 4600
834 Ga0501084_0053565 3300054114 Bacteria 3375
835 Ga0501084_0058753 3300054114 Bacteria 3218
836 Ga0590071_000028 3300059421 Bacteria 37548
837 Ga0590071_000623 3300059421 Bacteria 10108
838 Ga0590071_001037 3300059421 Bacteria 7542
839 Ga0590071_004908 3300059421 Bacteria 3231
840 Ga0590074_000296 3300059423 Bacteria 6790
841 Ga0590074_009343 3300059423 Unclassified 1634
842 Ga0590075_000078 3300059424 Bacteria 24962
843 Ga0590075_000099 3300059424 Bacteria 22344
844 Ga0590075_001070 3300059424 Bacteria 7080
845 Ga0590077_000029 3300059426 Bacteria 33548
846 Ga0590077_000093 3300059426 Bacteria 23043
847 Ga0501082_0011448 3300060353 Bacteria 7634
848 Ga0501082_0064427 3300060353 Bacteria 3157
849 Ga0501082_0065015 3300060353 Bacteria 3141
850 Ga0501082_0068749 3300060353 Bacteria 3050
851 Ga0530510_0004330 3300061734 Bacteria 9825
852 Ga0530510_0005054 3300061734 Bacteria 9101
853 Ga0530510_0008503 3300061734 Bacteria 7159
854 Ga0530510_0011662 3300061734 Bacteria 6168
855 Ga0207676_10226663
856 JGI25406J46586_10000625
857 JGI25406J46586_10001124
858 Ga0065712_10005276
859 Ga0065712_10016432
860 Ga0065715_10013166
861 Ga0065715_10092509
862 Ga0065715_10116630
863 Ga0065707_10096807
864 Ga0065707_10109586
865 Ga0070676_10014447
866 Ga0070676_10033022
867 Ga0070676_10123963
868 Ga0070683_100009628
869 Ga0070690_100006062
870 Ga0070690_100157201
871 Ga0070670_100003343
872 Ga0070670_100011527
873 Ga0070670_100061515
874 Ga0070670_100088288
875 Ga0070677_10025708
876 Ga0070677_10026601
877 Ga0070677_10048971
878 Ga0068869_100002192
879 Ga0068869_100126884
880 Ga0068869_100158062
881 Ga0068868_100005739
882 Ga0068868_100084597
883 Ga0070689_100015864
884 Ga0070689_100059552
885 Ga0070689_100071468
886 Ga0070689_100118032
887 Ga0070689_100158942
888 Ga0070689_100226180
889 Ga0070687_100013075
890 Ga0070687_100033438
891 Ga0070687_100061581
892 Ga0070687_100093956
893 Ga0070692_10033574
894 Ga0070668_100068569
895 Ga0070669_100001431
896 Ga0070669_100009043
897 Ga0070669_100026752
898 Ga0070669_100083384
899 Ga0070669_100202019
900 Ga0070675_100000230
901 Ga0070675_100002000
902 Ga0070675_100003366
903 Ga0070675_100014442
904 Ga0070675_100015833
905 Ga0070675_100033532
906 Ga0070675_100053322
907 Ga0070675_100105884
908 Ga0070675_100152103
909 Ga0070671_100002756
910 Ga0070671_100018538
911 Ga0070671_100052006
912 Ga0070671_100131479
913 Ga0070671_100183531
914 Ga0070674_100001321
915 Ga0070674_100003634
916 Ga0070674_100067083
917 Ga0070674_100067852
918 Ga0070674_100196734
919 Ga0070673_100007613
920 Ga0070673_100022209
921 Ga0070673_100056122
922 Ga0070673_100064195
923 Ga0070673_100066754
924 Ga0070673_100154634
925 Ga0070673_100198146
926 Ga0070688_100003285
927 Ga0070688_100021753
928 Ga0070688_100171764
929 Ga0070659_100344660
930 Ga0070667_100050141
931 Ga0070667_100200264
932 Ga0070703_10024920
933 Ga0070709_10024247
934 Ga0070709_10186279
935 Ga0070713_100069167
936 Ga0070701_10008290
937 Ga0070705_100061990
938 Ga0070700_100022731
939 Ga0070700_100042450
940 Ga0070700_100071546
941 Ga0070700_100143943
942 Ga0070694_100000891
943 Ga0070694_100022416
944 Ga0070694_100046933
945 Ga0070694_100049417
946 Ga0070663_100042066
947 Ga0070678_100069865
948 Ga0070662_100031323
949 Ga0070681_10056907
950 Ga0070681_10195505
951 Ga0068867_100004670
952 Ga0068867_100007279
953 Ga0068867_100053667
954 Ga0068867_100058498
955 Ga0070685_10005740
956 Ga0070706_100179421
957 Ga0070707_100153124
958 Ga0070707_100224266
959 Ga0070698_100017838
960 Ga0070698_100034358
961 Ga0070698_100093156
962 Ga0070698_100109779
963 Ga0070699_100001990
964 Ga0070699_100008798
965 Ga0070699_100022853
966 Ga0070699_100027597
967 Ga0070699_100040573
968 Ga0070699_100069160
969 Ga0070679_100395075
970 Ga0070684_100050474
971 Ga0070684_100051731
972 Ga0070684_100220234
973 Ga0070684_100266380
974 Ga0070697_100020787
975 Ga0070672_100018631
976 Ga0070672_100023946
977 Ga0070672_100032685
978 Ga0070672_100067528
979 Ga0070672_100135408
980 Ga0070672_100158078
981 Ga0070686_100034027
982 Ga0070695_100000349
983 Ga0070695_100072747
984 Ga0070696_100000400
985 Ga0070696_100013973
986 Ga0070696_100025932
987 Ga0070693_100026681
988 Ga0070665_100002337
989 Ga0070665_100029798
990 Ga0070665_100251007
991 Ga0070704_100031879
992 Ga0068855_100215443
993 Ga0068855_100229618
994 Ga0070664_100022550
995 Ga0070664_100111786
996 Ga0068854_100017691
997 Ga0068854_100039525
998 Ga0068856_100069724
999 Ga0068852_100315070
1000 Ga0068859_100001058
1001 Ga0068859_100004504
1002 Ga0068859_100043793
1003 Ga0068859_100155491
1004 Ga0068859_100285300
1005 Ga0068859_100409797
1006 Ga0068864_100043064
1007 Ga0068864_100051036
1008 Ga0068864_100207746
1009 Ga0068866_10026463
1010 Ga0068866_10072150
1011 Ga0068861_100002675
1012 Ga0068861_100044500
1013 Ga0068861_100074256
1014 Ga0068861_100084053
1015 Ga0068861_100116212
1016 Ga0068861_100213672
1017 Ga0068851_10007127
1018 Ga0068870_10024887
1019 Ga0068870_10084664
1020 Ga0068863_100028870
1021 Ga0068863_100036568
1022 Ga0068863_100145849
1023 Ga0068863_100181450
1024 Ga0068858_100021312
1025 Ga0068858_100032255
1026 Ga0068858_100090071
1027 Ga0068858_100102722
1028 Ga0068858_100145015
1029 Ga0068858_100361911
1030 Ga0068860_100009746
1031 Ga0068860_100039863
1032 Ga0068860_100047217
1033 Ga0068860_100121497
1034 Ga0068862_100002358
1035 Ga0068862_100002381
1036 Ga0068862_100015206
1037 Ga0081455_10207100
1038 Ga0081539_10000071
1039 Ga0081539_10000960
1040 Ga0081539_10003273
1041 Ga0081539_10007078
1042 Ga0081539_10032703
1043 Ga0075365_10088448
1044 Ga0075368_10019342
1045 Ga0075364_10122128
1046 Ga0075364_10144833
1047 Ga0075362_10001172
1048 Ga0075367_10043241
1049 Ga0075366_10001838
1050 Ga0097621_100003331
1051 Ga0097621_100009140
1052 Ga0097621_100031266
1053 Ga0097621_100078567
1054 Ga0097621_100235718
1055 Ga0097621_100319497
1056 Ga0075370_10001492
1057 Ga0068871_100000509
1058 Ga0068871_100012284
1059 Ga0075428_100000339
1060 Ga0075428_100005335
1061 Ga0075428_100007147
1062 Ga0075428_100020148
1063 Ga0075428_100026528
1064 Ga0075428_100121372
1065 Ga0075428_100180604
1066 Ga0075430_100001386
1067 Ga0075430_100001719
1068 Ga0075430_100004697
1069 Ga0075430_100022426
1070 Ga0075430_100060094
1071 Ga0075430_100068854
1072 Ga0075430_100072489
1073 Ga0075431_100000921
1074 Ga0075431_100005390
1075 Ga0075431_100009643
1076 Ga0075431_100017850
1077 Ga0075431_100022586
1078 Ga0075431_100034111
1079 Ga0075431_100044044
1080 Ga0075431_100045675
1081 Ga0075431_100066555
1082 Ga0075431_100077737
1083 Ga0075431_100112369
1084 Ga0075431_100270899
1085 Ga0075433_10000581
1086 Ga0075433_10131036
1087 Ga0075433_10207512
1088 Ga0075434_100000239
1089 Ga0075434_100008401
1090 Ga0075434_100009098
1091 Ga0075434_100043251
1092 Ga0075434_100083547
1093 Ga0075434_100143122
1094 Ga0075429_100008096
1095 Ga0075429_100009933
1096 Ga0075429_100011027
1097 Ga0075429_100017304
1098 Ga0075429_100184400
1099 Ga0068865_100025241
1100 Ga0075436_100000333
1101 Ga0075436_100013080
1102 Ga0075436_100030653
1103 Ga0097620_100001058
1104 Ga0097620_100004504
1105 Ga0097620_100043797
1106 Ga0097620_100155486
1107 Ga0097620_100285295
1108 Ga0097620_100340560
1109 Ga0097620_100409773
1110 Ga0075435_100000013
1111 Ga0075435_100000453
1112 Ga0075435_100005757
1113 Ga0075435_100007588
1114 Ga0075435_100013988
1115 Ga0075435_100019898
1116 Ga0075435_100020852
1117 Ga0075435_100024643
1118 Ga0075435_100064907
1119 Ga0075435_100078974
1120 Ga0075435_100109561
1121 Ga0099794_10072855
1122 Ga0105240_10043536
1123 Ga0105240_10057222
1124 Ga0111539_10000958
1125 Ga0111539_10000996
1126 Ga0111539_10001448
1127 Ga0111539_10004655
1128 Ga0111539_10036411
1129 Ga0111539_10049498
1130 Ga0111539_10058302
1131 Ga0111539_10078681
1132 Ga0111539_10195892
1133 Ga0111539_10199163
1134 Ga0111539_10231376
1135 Ga0111539_10273283
1136 Ga0111539_10350290
1137 Ga0111539_10533263
1138 Ga0111539_10615065
1139 Ga0105245_10014493
1140 Ga0105247_10024875
1141 Ga0114129_10000695
1142 Ga0114129_10001668
1143 Ga0114129_10012747
1144 Ga0114129_10015897
1145 Ga0114129_10020337
1146 Ga0114129_10020626
1147 Ga0114129_10030117
1148 Ga0114129_10033460
1149 Ga0114129_10044368
1150 Ga0114129_10050087
1151 Ga0114129_10054525
1152 Ga0114129_10055581
1153 Ga0114129_10084800
1154 Ga0114129_10095028
1155 Ga0114129_10099999
1156 Ga0114129_10104213
1157 Ga0114129_10104929
1158 Ga0114129_10178366
1159 Ga0114129_10253807
1160 Ga0114129_10256740
1161 Ga0114129_10274842
1162 Ga0114129_10291890
1163 Ga0114129_10307147
1164 Ga0114129_10585728
1165 Ga0105243_10044930
1166 Ga0105243_10083381
1167 Ga0105243_10122724
1168 Ga0105243_10137086
1169 Ga0105243_10353516
1170 Ga0105242_10019938
1171 Ga0105242_10038435
1172 Ga0105248_10005408
1173 Ga0105248_10034009
1174 Ga0105248_10074742
1175 Ga0105248_10130835
1176 Ga0105248_10145705
1177 Ga0105248_10168001
1178 Ga0105248_10187014
1179 Ga0105248_10329822
1180 Ga0105249_10064815
1181 Ga0105249_10091657
1182 Ga0105249_10239139
1183 Ga0105249_10243735
1184 Ga0105249_10315859
1185 Ga0105246_10169222
1186 Ga0157374_10291423
1187 Ga0157378_10206139
1188 Ga0157378_10239107
1189 Ga0157378_10282512
1190 Ga0163162_10036236
1191 Ga0163162_10282014
1192 Ga0157375_10003610
1193 Ga0157375_10007743
1194 Ga0157375_10058520
1195 Ga0157375_10179075
1196 Ga0157375_10229085
1197 Ga0157375_10248799
1198 Ga0157375_10422321
1199 Ga0163163_10012601
1200 Ga0163163_10014077
1201 Ga0163163_10048664
1202 Ga0163163_10098635
1203 Ga0163163_10188281
1204 Ga0157380_10011440
1205 Ga0157380_10022954
1206 Ga0157380_10028974
1207 Ga0157380_10200531
1208 Ga0157380_10379117
1209 Ga0157380_10392759
1210 Ga0157377_10035310
1211 Ga0157377_10036903
1212 Ga0157377_10070331
1213 Ga0157379_10040140
1214 Ga0157379_10125208
1215 Ga0157376_10110921
1216 Ga0157376_10149950
1217 Ga0157376_10190196
1218 Ga0157376_10292496
1219 Ga0163161_10030955
1220 Ga0207697_10000739
1221 Ga0207656_10015457
1222 Ga0207682_10035691
1223 Ga0207682_10038498
1224 Ga0207682_10053067
1225 Ga0207682_10098937
1226 Ga0207642_10006447
1227 Ga0207688_10000747
1228 Ga0207688_10046621
1229 Ga0207680_10003526
1230 Ga0207680_10004710
1231 Ga0207680_10112153
1232 Ga0207680_10140429
1233 Ga0207699_10002553
1234 Ga0207645_10001797
1235 Ga0207645_10009059
1236 Ga0207645_10086515
1237 Ga0207645_10091312
1238 Ga0207643_10001412
1239 Ga0207643_10004260
1240 Ga0207643_10011758
1241 Ga0207643_10027517
1242 Ga0207643_10087387
1243 Ga0207684_10290953
1244 Ga0207654_10085054
1245 Ga0207707_10078031
1246 Ga0207707_10079099
1247 Ga0207695_10031452
1248 Ga0207695_10032575
1249 Ga0207660_10159705
1250 Ga0207662_10010392
1251 Ga0207662_10018680
1252 Ga0207662_10036519
1253 Ga0207649_10003247
1254 Ga0207652_10127226
1255 Ga0207646_10020785
1256 Ga0207646_10160787
1257 Ga0207681_10006602
1258 Ga0207681_10015754
1259 Ga0207681_10031155
1260 Ga0207681_10047292
1261 Ga0207681_10074346
1262 Ga0207681_10158660
1263 Ga0207681_10186931
1264 Ga0207694_10078753
1265 Ga0207650_10016828
1266 Ga0207650_10037139
1267 Ga0207650_10104383
1268 Ga0207659_10000210
1269 Ga0207659_10000599
1270 Ga0207659_10009784
1271 Ga0207659_10011410
1272 Ga0207659_10017195
1273 Ga0207659_10023816
1274 Ga0207659_10029578
1275 Ga0207659_10054147
1276 Ga0207659_10094441
1277 Ga0207659_10229905
1278 Ga0207659_10280056
1279 Ga0207687_10013068
1280 Ga0207687_10074631
1281 Ga0207700_10356493
1282 Ga0207644_10037625
1283 Ga0207644_10071324
1284 Ga0207706_10006644
1285 Ga0207706_10037129
1286 Ga0207706_10149403
1287 Ga0207686_10008586
1288 Ga0207686_10010755
1289 Ga0207709_10014510
1290 Ga0207709_10037591
1291 Ga0207709_10046045
1292 Ga0207709_10173971
1293 Ga0207670_10008231
1294 Ga0207670_10086342
1295 Ga0207669_10010233
1296 Ga0207669_10070162
1297 Ga0207704_10018451
1298 Ga0207704_10035111
1299 Ga0207665_10087986
1300 Ga0207691_10002019
1301 Ga0207691_10008809
1302 Ga0207691_10013413
1303 Ga0207691_10079191
1304 Ga0207691_10100926
1305 Ga0207691_10119404
1306 Ga0207691_10209038
1307 Ga0207711_10054890
1308 Ga0207711_10065365
1309 Ga0207711_10074262
1310 Ga0207711_10086760
1311 Ga0207711_10261984
1312 Ga0207689_10001643
1313 Ga0207689_10002419
1314 Ga0207689_10019900
1315 Ga0207689_10107958
1316 Ga0207661_10013640
1317 Ga0207661_10274314
1318 Ga0207679_10006804
1319 Ga0207679_10109412
1320 Ga0207651_10027029
1321 Ga0207651_10028600
1322 Ga0207651_10065623
1323 Ga0207651_10162510
1324 Ga0207651_10162548
1325 Ga0207712_10016986
1326 Ga0207668_10017178
1327 Ga0207668_10132233
1328 Ga0207640_10079131
1329 Ga0207658_10018984
1330 Ga0207658_10066582
1331 Ga0207677_10209070
1332 Ga0207677_10256427
1333 Ga0207703_10022084
1334 Ga0207703_10046108
1335 Ga0207703_10061230
1336 Ga0207703_10120854
1337 Ga0207703_10168905
1338 Ga0207678_10091756
1339 Ga0207678_10180781
1340 Ga0207708_10030121
1341 Ga0207708_10042673
1342 Ga0207708_10054709
1343 Ga0207708_10100343
1344 Ga0207708_10131867
1345 Ga0207702_10069173
1346 Ga0207641_10034410
1347 Ga0207641_10256903
1348 Ga0207641_10330725
1349 Ga0207648_10008726
1350 Ga0207648_10019397
1351 Ga0207648_10021169
1352 Ga0207648_10148532
1353 Ga0207648_10263056
1354 Ga0207676_10071414
1355 Ga0207676_10092994
1356 Ga0207676_10179944
1357 Ga0207674_10030937
1358 Ga0207674_10083050
1359 Ga0207674_10131805
1360 Ga0207675_100000566
1361 Ga0207675_100013760
1362 Ga0207675_100028867
1363 Ga0207675_100031045
1364 Ga0207675_100064938
1365 Ga0207675_100068158
1366 Ga0207675_100121064
1367 Ga0207675_100152657
1368 Ga0207675_100267962
1369 Ga0207683_10003173
1370 Ga0207683_10116063
1371 Ga0209813_10011607
1372 Ga0207428_10000807
1373 Ga0207428_10001394
1374 Ga0207428_10002779
1375 Ga0207428_10003321
1376 Ga0207428_10003766
1377 Ga0207428_10035507
1378 Ga0207428_10050135
1379 Ga0268266_10068388
1380 Ga0268266_10427357
1381 Ga0268265_10000816
1382 Ga0268265_10025750
1383 Ga0268265_10183439
1384 Ga0268265_10309949
1385 Ga0268264_10014359
1386 Ga0268264_10027450
1387 Ga0268264_10096255
1388 Ga0265328_10045917
1389 Ga0307408_100041230
1390 Ga0307408_100136220
1391 Ga0307408_100202233
1392 Ga0307405_10097152
1393 Ga0307413_10005077
1394 Ga0307413_10232743
1395 Ga0307410_10039059
1396 Ga0307410_10218480
1397 Ga0307406_10015483
1398 Ga0307406_10142772
1399 Ga0307406_10265257
1400 Ga0307407_10001680
1401 Ga0307407_10010082
1402 Ga0307412_10003932
1403 Ga0307412_10072341
1404 Ga0307412_10081060
1405 Ga0307409_100025529
1406 Ga0307409_100028219
1407 Ga0307409_100107420
1408 Ga0307409_100127963
1409 Ga0307409_100240986
1410 Ga0307416_100004327
1411 Ga0307416_100018613
1412 Ga0307416_100037812
1413 Ga0307416_100043767
1414 Ga0307416_100049053
1415 Ga0307416_100085993
1416 Ga0307416_100088604
1417 Ga0307416_100268487
1418 Ga0307416_100327625
1419 Ga0307416_100467101
1420 Ga0307414_10091436
1421 Ga0307411_10020504
1422 Ga0307411_10253291
1423 Ga0307411_10275984
1424 Ga0307415_100015508
1425 Ga0307415_100100086
1426 Ga0307415_100109085
1427 Ga0307415_100121525
1428 Ga0307415_100273744
1429 Ga0373950_0000505
1430 Ga0373938_0000051
1431 Ga0373934_0037053
1432 Ga0373940_0000704
1433 Ga0373949_0000883
1434 Ga0373951_0000949
1435 Ga0373952_0000290
1436 Ga0373932_0002025
1437 Ga0373939_0001228
1438 Ga0373941_0000211
1439 Ga0373941_0010873
1440 Ga0373941_0014417
1441 Ga0373941_0056686
1442 Ga0373956_0026516
1443 Ga0373960_0000632
1444 Ga0373943_0072573
1445 Ga0373942_0003027
1446 Ga0373961_0001504
1447 Ga0373924_0028364
1448 Ga0373931_0000366
1449 Ga0373933_0209649
1450 Ga0373947_0043667
1451 Ga0373947_0084336
1452 Ga0373937_0069758
1453 Ga0373937_0078089
1454 Ga0439453_0012862
1455 Ga0439446_0009727
1456 Ga0439435_0003278
1457 Ga0439435_0009269
1458 Ga0451577_0347893
1459 Ga0466963_0019782
1460 Ga0451576_0014606
1461 Ga0451576_0057540
1462 Ga0451576_0117693
1463 Ga0451576_0200232
1464 Ga0466967_0195234
1465 Ga0466967_0287512
1466 Ga0495592_0095896
1467 Ga0495603_0089193
1468 Ga0495629_0005387
1469 Ga0495653_0013146
1470 Ga0495580_0047688
1471 Ga0495580_0088692
1472 Ga0495584_0030124
1473 Ga0495608_0026552
1474 Ga0495628_0063878
1475 Ga0495630_0046829
1476 Ga0495643_0002908
1477 Ga0495663_0008282
1478 Ga0495663_0011056
1479 Ga0495642_0017402
1480 Ga0495587_0058470
1481 Ga0495598_0003343
1482 Ga0495598_0024458
1483 Ga0495609_0067066
1484 Ga0495621_0001396
1485 Ga0495645_0070645
1486 Ga0495599_0038815
1487 Ga0495647_0014274
1488 Ga0495658_0046922
1489 Ga0495669_0057435
1490 Ga0495613_0003817
1491 Ga0495600_0045831
1492 Ga0495604_0034302
1493 Ga0495636_0014289
1494 Ga0495674_0031173
1495 Ga0495676_0064547
1496 Ga0495684_0000663
1497 Ga0496100_0013722
1498 Ga0496101_0001617
1499 Ga0496101_0092523
1500 Ga0496102_0014516
1501 Ga0496102_0069442
1502 Ga0496102_0383093
1503 Ga0496104_0044349
1504 Ga0496104_0238774
1505 Ga0496105_0068536
1506 Ga0496106_0006608
1507 Ga0496106_0096353
1508 Ga0496109_0049387
1509 Ga0496109_0467237
1510 Ga0496110_0053028
1511 Ga0496112_0031322
1512 Ga0496112_0174755
1513 Ga0496113_0142872
1514 Ga0496114_0000536
1515 Ga0501031_0158144
1516 Ga0501033_0010655
1517 Ga0501034_0020337
1518 Ga0501034_0455059
1519 Ga0501036_0004722
1520 Ga0501036_0049017
1521 Ga0501036_0052693
1522 Ga0501036_0143139
1523 Ga0501037_0023324
1524 Ga0501037_0194317
1525 Ga0501037_0224332
1526 Ga0501038_0150326
1527 Ga0501039_0013118
1528 Ga0501039_0016551
1529 Ga0501039_0042163
1530 Ga0501039_0278888
1531 Ga0501040_0028691
1532 Ga0501040_0036967
1533 Ga0501040_0112089
1534 Ga0501040_0160059
1535 Ga0501041_0009003
1536 Ga0501041_0017829
1537 Ga0501041_0030859
1538 Ga0501041_0064277
1539 Ga0501041_0095884
1540 Ga0501042_0018970
1541 Ga0501042_0040789
1542 Ga0501042_0047915
1543 Ga0501042_0113903
1544 Ga0501042_0205923
1545 Ga0501046_0017590
1546 Ga0501046_0042497
1547 Ga0501046_0210130
1548 Ga0501047_0116130
1549 Ga0501048_0014379
1550 Ga0501048_0028183
1551 Ga0501048_0066314
1552 Ga0501048_0124065
1553 Ga0501071_0006323
1554 Ga0501071_0019266
1555 Ga0501071_0098762
1556 Ga0501072_0007639
1557 Ga0501072_0011041
1558 Ga0501072_0013319
1559 Ga0501072_0060468
1560 Ga0501072_0070948
1561 Ga0501072_0137974
1562 Ga0501073_0001672
1563 Ga0501074_0045953
1564 Ga0501074_0104064
1565 Ga0501075_0014228
1566 Ga0501075_0014298
1567 Ga0501075_0016929
1568 Ga0501075_0024625
1569 Ga0501075_0030789
1570 Ga0501076_0006209
1571 Ga0501076_0012485
1572 Ga0501076_0013490
1573 Ga0501076_0023443
1574 Ga0501076_0077997
1575 Ga0501076_0108921
1576 Ga0501076_0113720
1577 Ga0501077_0009766
1578 Ga0501077_0047473
1579 Ga0501077_0056436
1580 Ga0501077_0086317
1581 Ga0501079_0007017
1582 Ga0501079_0021460
1583 Ga0501079_0021680
1584 Ga0501080_0020785
1585 Ga0501080_0063744
1586 Ga0501080_0080523
1587 Ga0501080_0172819
1588 Ga0501080_0342134
1589 Ga0501081_0025246
1590 Ga0501081_0036034
1591 Ga0501081_0050839
1592 Ga0501081_0137415
1593 Ga0501035_0338604
1594 Ga0501044_0004995
1595 Ga0501045_0029659
1596 Ga0501045_0030263
1597 Ga0501045_0031424
1598 Ga0501045_0034448
1599 Ga0501045_0036488
1600 Ga0501045_0149223
1601 Ga0501045_0165299
1602 nmdc:mga03683_20760_c1
1603 nmdc:mga00v17_12320_c1
1604 nmdc:mga00v17_9461_c1
1605 nmdc:mga0k408_61269_c1
1606 nmdc:mga06z11_2051_c1
1607 nmdc:mga06z11_48021_c1
1608 nmdc:mga04h51_21444_c1
1609 nmdc:mga05p37_10311_c1
1610 nmdc:mga05p37_1037_c1
1611 nmdc:mga05p37_158846_c1
1612 nmdc:mga05p37_16554_c1
1613 nmdc:mga05p37_28950_c1
1614 nmdc:mga05p37_30444_c1
1615 nmdc:mga05p37_3083_c1
1616 nmdc:mga05p37_31381_c1
1617 nmdc:mga05p37_35997_c1
1618 nmdc:mga05p37_397507_c1
1619 nmdc:mga05p37_51640_c1
1620 nmdc:mga05p37_58386_c1
1621 nmdc:mga05p37_614887_c1
1622 nmdc:mga05p37_8613_c1
1623 nmdc:mga05p37_90009_c1
1624 nmdc:mga05p37_92167_c1
1625 nmdc:mga05p37_99406_c1
1626 nmdc:mga09592_109670_c1
1627 nmdc:mga09592_113390_c1
1628 nmdc:mga09592_14943_c1
1629 nmdc:mga09592_181042_c1
1630 nmdc:mga09592_240752_c1
1631 nmdc:mga09592_5378_c1
1632 nmdc:mga09592_6459_c1
1633 nmdc:mga09592_66623_c1
1634 nmdc:mga0qj67_1375_c1
1635 nmdc:mga0qj67_202577_c1
1636 nmdc:mga0qj67_230272_c1
1637 nmdc:mga0qj67_32473_c1
1638 nmdc:mga0qj67_435_c1
1639 nmdc:mga0qj67_60752_c1
1640 nmdc:mga0qj67_78815_c1
1641 nmdc:mga0qj67_79668_c1
1642 nmdc:mga0qj67_9524_c1
1643 nmdc:mga06r32_1137_c1
1644 nmdc:mga06r32_162237_c1
1645 nmdc:mga06r32_20394_c1
1646 nmdc:mga06r32_22516_c1
1647 nmdc:mga06r32_273922_c1
1648 nmdc:mga06r32_283021_c1
1649 nmdc:mga06r32_33701_c1
1650 nmdc:mga06r32_33710_c1
1651 nmdc:mga06r32_594354_c1
1652 nmdc:mga08y16_10068_c1
1653 nmdc:mga08y16_10165_c1
1654 nmdc:mga08y16_1024_c1
1655 nmdc:mga08y16_130476_c1
1656 nmdc:mga08y16_180709_c1
1657 nmdc:mga08y16_257_c1
1658 nmdc:mga08y16_312951_c1
1659 nmdc:mga08y16_3443_c1
1660 nmdc:mga08y16_4780_c1
1661 nmdc:mga08y16_5187_c1
1662 nmdc:mga08y16_66195_c1
1663 nmdc:mga08y16_7027_c1
1664 nmdc:mga0n895_118569_c1
1665 nmdc:mga0n895_136_c1
1666 nmdc:mga0n895_14796_c1
1667 nmdc:mga0n895_173953_c1
1668 nmdc:mga0n895_234045_c1
1669 nmdc:mga0n895_304_c1
1670 nmdc:mga0n895_44093_c1
1671 nmdc:mga0rr50_17022_c1
1672 nmdc:mga0rr50_2762_c1
1673 nmdc:mga0rr50_36386_c1
1674 nmdc:mga0rr50_6036_c1
1675 nmdc:mga0rr50_65542_c1
1676 nmdc:mga0rr50_9_c1
1677 nmdc:mga08x19_135528_c1
1678 nmdc:mga08x19_1629_c1
1679 nmdc:mga08x19_33193_c1
1680 nmdc:mga0a205_16118_c1
1681 nmdc:mga0a205_362_c1
1682 nmdc:mga0a205_4424_c1
1683 Ga0495601_0064800
1684 Ga0495601_0231427
1685 Ga0495619_0004408
1686 Ga0501084_0010703
1687 Ga0501084_0029353
1688 Ga0501084_0053565
1689 Ga0501084_0058753
1690 Ga0590071_000028
1691 Ga0590071_000623
1692 Ga0590071_001037
1693 Ga0590071_004908
1694 Ga0590074_000296
1695 Ga0590074_009343
1696 Ga0590075_000078
1697 Ga0590075_000099
1698 Ga0590075_001070
1699 Ga0590077_000029
1700 Ga0590077_000093
1701 Ga0501082_0011448
1702 Ga0501082_0064427
1703 Ga0501082_0065015
1704 Ga0501082_0068749
1705 Ga0530510_0004330
1706 Ga0530510_0005054
1707 Ga0530510_0008503
1708 Ga0530510_0011662

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wcg-assembly1.cif.gz_A the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9533 263 318
4ija-assembly1.cif.gz_B structure of s. aureus methicillin resistance factor mecr2 0.9513 267 319
4wcg-assembly1.cif.gz_B the binding mode of cyprinid herpesvirus3 orf112-zalpha to z-dna 0.9502 269 318
1r1t-assembly1.cif.gz_A crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form 0.9309 268 324
8a5y-assembly1.cif.gz_T s. cerevisiae apo unphosphorylated apc/c. 0.9274 278 320
ID Description Score Start End Superfamily
2xrnA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9697 267 318 1.10.10.10
4awxB00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9652 267 318 1.10.10.10
af_P64638_1_78_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9603 270 313 1.10.10.10
af_P0ACK8_1_59_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9537 266 318 1.10.10.10
af_Q5NE14_88_145_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9508 266 318 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A3N5YSN1-F1-model_v4 HTH iclR-type domain-containing protein 0.938 1 357 GO:0003677
GO:0006355
AF-A0A3N5YSN1-F1-model_v4 HTH iclR-type domain-containing protein 0.9205 1 357 GO:0003677
GO:0006355
AF-A0A7C4XI21-F1-model_v4 AAA+ ATPase domain-containing protein 0.9201 1 373 GO:0003677
GO:0016887
AF-A0A7C4XI21-F1-model_v4 AAA+ ATPase domain-containing protein 0.9179 1 373 GO:0003677
GO:0016887
AF-A0A843S2G4-F1-model_v4 Uncharacterized protein 0.9021 7 373

Map