F483572

General Info

Members Datasets Scaffolds Average Seq Length
854 251 854 135

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100036186|Ga0070714_1000361862
Length 147
Sequence MARVPSRHAWGFAFSEISRHRDAGRARVLADSNCVLIDELEREWRDALCRKDMERLQALVHRDFLLIGTRSTGPFMMNRQVEVRDATVFDNMMIGTVQARWRLKYLGRSIEDCVFLTDVWVKDEGRWQAIRRHSTPAPAGACDLKGE

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
35 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
201 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
202 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
203 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
204 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
205 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
206 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
207 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
208 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
211 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
212 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
224 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
225 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
226 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 3.16
Rhizosphere 96.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1033251 3300001976 Bacteria 683
2 JGI24747J21853_1003908 3300001978 Bacteria 1309
3 JGI24740J21852_10021801 3300001979 Bacteria 2215
4 JGI24740J21852_10053770 3300001979 Bacteria 1140
5 JGI24740J21852_10067802 3300001979 Unclassified 964
6 JGI24740J21852_10104779 3300001979 Unclassified 717
7 JGI24739J22299_10012780 3300001989 Bacteria 3077
8 JGI24739J22299_10088317 3300001989 Bacteria 946
9 JGI24737J22298_10014199 3300001990 Bacteria 2587
10 JGI24737J22298_10016841 3300001990 Bacteria 2359
11 JGI24743J22301_10003394 3300001991 Bacteria 2517
12 JGI24735J21928_10002140 3300002067 Bacteria 6953
13 JGI24735J21928_10014828 3300002067 Bacteria 2439
14 JGI24745J21846_1009482 3300002073 Bacteria 1104
15 JGI24738J21930_10007344 3300002075 Bacteria 2547
16 JGI24738J21930_10044252 3300002075 Bacteria 905
17 JGI24744J21845_10000055 3300002077 Bacteria 13381
18 JGI24744J21845_10089105 3300002077 Unclassified 566
19 JGI24742J22300_10010994 3300002244 Bacteria 1500
20 Ga0065704_10291073 3300005289 Bacteria 903
21 Ga0065715_10330324 3300005293 Bacteria 985
22 Ga0070658_10007529 3300005327 Bacteria 8787
23 Ga0070658_10019242 3300005327 Bacteria 5469
24 Ga0070658_10025349 3300005327 Bacteria 4755
25 Ga0070658_10148654 3300005327 Bacteria 1960
26 Ga0070658_10182464 3300005327 Bacteria 1766
27 Ga0070658_10273336 3300005327 Bacteria 1437
28 Ga0070658_10959533 3300005327 Unclassified 743
29 Ga0070676_10004251 3300005328 Bacteria 7527
30 Ga0070676_10145470 3300005328 Bacteria 1513
31 Ga0070676_10278123 3300005328 Bacteria 1127
32 Ga0070683_100019017 3300005329 Bacteria 6095
33 Ga0070683_100172414 3300005329 Bacteria 2053
34 Ga0070683_100392138 3300005329 Bacteria 1324
35 Ga0070683_100675957 3300005329 Bacteria 989
36 Ga0070690_100462654 3300005330 Unclassified 942
37 Ga0070670_100177334 3300005331 Bacteria 1849
38 Ga0070670_100736880 3300005331 Bacteria 887
39 Ga0070677_10009387 3300005333 Bacteria 3315
40 Ga0068869_100196342 3300005334 Bacteria 1589
41 Ga0068869_100303658 3300005334 Bacteria 1289
42 Ga0068869_101536991 3300005334 Bacteria 591
43 Ga0070666_10009331 3300005335 Bacteria 6113
44 Ga0070666_10021579 3300005335 Bacteria 4174
45 Ga0070666_10340076 3300005335 Bacteria 1072
46 Ga0070680_100002432 3300005336 Bacteria 13797
47 Ga0070680_100005513 3300005336 Bacteria 9579
48 Ga0070680_100053617 3300005336 Bacteria 3292
49 Ga0070680_100131326 3300005336 Bacteria 2095
50 Ga0070680_100509936 3300005336 Bacteria 1029
51 Ga0070680_100604808 3300005336 Unclassified 941
52 Ga0070680_100607577 3300005336 Bacteria 939
53 Ga0070682_100041566 3300005337 Bacteria 2834
54 Ga0070682_100843571 3300005337 Unclassified 748
55 Ga0068868_100032532 3300005338 Bacteria 4013
56 Ga0068868_100085855 3300005338 Bacteria 2529
57 Ga0068868_100186385 3300005338 Bacteria 1724
58 Ga0068868_100539636 3300005338 Unclassified 1026
59 Ga0068868_100712910 3300005338 Bacteria 898
60 Ga0070660_100019741 3300005339 Bacteria 4943
61 Ga0070660_100029896 3300005339 Bacteria 4085
62 Ga0070660_100037460 3300005339 Bacteria 3677
63 Ga0070660_100127129 3300005339 Bacteria 2037
64 Ga0070660_100153297 3300005339 Bacteria 1854
65 Ga0070660_100166992 3300005339 Bacteria 1776
66 Ga0070660_100212323 3300005339 Bacteria 1571
67 Ga0070660_100226243 3300005339 Bacteria 1521
68 Ga0070660_100781288 3300005339 Bacteria 803
69 Ga0070660_100785943 3300005339 Unclassified 800
70 Ga0070660_100787198 3300005339 Unclassified 799
71 Ga0070691_10325031 3300005341 Bacteria 847
72 Ga0070687_100038691 3300005343 Bacteria 2392
73 Ga0070687_100383776 3300005343 Bacteria 916
74 Ga0070661_100057631 3300005344 Bacteria 2846
75 Ga0070661_100075836 3300005344 Bacteria 2478
76 Ga0070661_100142394 3300005344 Bacteria 1808
77 Ga0070661_100151892 3300005344 Bacteria 1751
78 Ga0070661_100213325 3300005344 Bacteria 1478
79 Ga0070661_100379166 3300005344 Bacteria 1115
80 Ga0070692_10031841 3300005345 Bacteria 2647
81 Ga0070692_10120867 3300005345 Bacteria 1461
82 Ga0070692_10778940 3300005345 Unclassified 651
83 Ga0070668_100053802 3300005347 Bacteria 3104
84 Ga0070668_100529766 3300005347 Bacteria 1023
85 Ga0070668_100544430 3300005347 Bacteria 1010
86 Ga0070668_100573105 3300005347 Bacteria 985
87 Ga0070669_100038870 3300005353 Bacteria 3456
88 Ga0070669_100187147 3300005353 Bacteria 1622
89 Ga0070669_100274046 3300005353 Bacteria 1350
90 Ga0070669_100313642 3300005353 Bacteria 1265
91 Ga0070669_100701360 3300005353 Bacteria 855
92 Ga0070675_100022320 3300005354 Bacteria 5057
93 Ga0070675_100159534 3300005354 Bacteria 1939
94 Ga0070675_100608643 3300005354 Unclassified 991
95 Ga0070671_100036337 3300005355 Bacteria 4085
96 Ga0070671_100203211 3300005355 Bacteria 1680
97 Ga0070674_100086865 3300005356 Bacteria 2247
98 Ga0070674_100109065 3300005356 Bacteria 2029
99 Ga0070674_100829203 3300005356 Bacteria 801
100 Ga0070674_102206463 3300005356 Unclassified 503
101 Ga0070673_100011901 3300005364 Bacteria 5958
102 Ga0070673_100112245 3300005364 Bacteria 2262
103 Ga0070673_100379226 3300005364 Bacteria 1260
104 Ga0070673_100516919 3300005364 Bacteria 1081
105 Ga0070673_100642726 3300005364 Unclassified 970
106 Ga0070673_101356516 3300005364 Unclassified 668
107 Ga0070659_100012039 3300005366 Bacteria 6404
108 Ga0070659_100024629 3300005366 Bacteria 4615
109 Ga0070659_100125313 3300005366 Bacteria 2084
110 Ga0070659_100174550 3300005366 Bacteria 1762
111 Ga0070659_100197328 3300005366 Bacteria 1656
112 Ga0070659_100349682 3300005366 Bacteria 1240
113 Ga0070659_100403163 3300005366 Bacteria 1155
114 Ga0070659_100495578 3300005366 Bacteria 1041
115 Ga0070667_100018568 3300005367 Bacteria 5769
116 Ga0070667_100081208 3300005367 Bacteria 2774
117 Ga0070667_100240698 3300005367 Bacteria 1615
118 Ga0070709_10044075 3300005434 Bacteria 2761
119 Ga0070714_100036186 3300005435 Bacteria 4139
120 Ga0070714_100095396 3300005435 Bacteria 2612
121 Ga0070714_100120567 3300005435 Bacteria 2333
122 Ga0070714_100191201 3300005435 Bacteria 1868
123 Ga0070714_100326088 3300005435 Bacteria 1437
124 Ga0070713_100005100 3300005436 Bacteria 8935
125 Ga0070713_100065022 3300005436 Bacteria 3063
126 Ga0070713_100165898 3300005436 Bacteria 1975
127 Ga0070713_100388894 3300005436 Unclassified 1301
128 Ga0070663_100065855 3300005455 Bacteria 2624
129 Ga0070663_100509490 3300005455 Unclassified 1000
130 Ga0070663_100571243 3300005455 Bacteria 948
131 Ga0070678_100004224 3300005456 Bacteria 8115
132 Ga0070678_100009114 3300005456 Bacteria 5989
133 Ga0070678_100063425 3300005456 Bacteria 2734
134 Ga0070678_100119549 3300005456 Bacteria 2075
135 Ga0070662_100005197 3300005457 Bacteria 8305
136 Ga0070662_100018155 3300005457 Bacteria 4755
137 Ga0070662_100072350 3300005457 Bacteria 2545
138 Ga0070662_100318324 3300005457 Bacteria 1268
139 Ga0070662_100497510 3300005457 Bacteria 1016
140 Ga0070662_100871747 3300005457 Unclassified 767
141 Ga0070681_10080063 3300005458 Bacteria 3223
142 Ga0070681_10284714 3300005458 Bacteria 1563
143 Ga0070681_10296169 3300005458 Bacteria 1528
144 Ga0068867_100002035 3300005459 Bacteria 14144
145 Ga0068867_100020963 3300005459 Bacteria 4661
146 Ga0070685_10278927 3300005466 Bacteria 1118
147 Ga0070685_10697814 3300005466 Bacteria 740
148 Ga0070706_100254739 3300005467 Bacteria 1639
149 Ga0070679_100077172 3300005530 Bacteria 3320
150 Ga0070679_100088147 3300005530 Bacteria 3090
151 Ga0070679_100144448 3300005530 Bacteria 2357
152 Ga0070679_100362113 3300005530 Bacteria 1397
153 Ga0070679_100370709 3300005530 Bacteria 1379
154 Ga0070679_100433735 3300005530 Bacteria 1259
155 Ga0070679_100829557 3300005530 Bacteria 868
156 Ga0070684_100101991 3300005535 Bacteria 2565
157 Ga0070684_100152215 3300005535 Bacteria 2096
158 Ga0070684_100210151 3300005535 Bacteria 1773
159 Ga0068853_100010905 3300005539 Bacteria 7364
160 Ga0068853_100079727 3300005539 Bacteria 2863
161 Ga0068853_100099466 3300005539 Bacteria 2569
162 Ga0068853_100144427 3300005539 Bacteria 2137
163 Ga0068853_100147081 3300005539 Bacteria 2118
164 Ga0068853_100175357 3300005539 Bacteria 1942
165 Ga0068853_101495863 3300005539 Bacteria 654
166 Ga0070672_100016213 3300005543 Bacteria 5329
167 Ga0070672_100099437 3300005543 Bacteria 2358
168 Ga0070672_100448923 3300005543 Bacteria 1110
169 Ga0070686_100036653 3300005544 Bacteria 3038
170 Ga0070696_100017065 3300005546 Bacteria 4898
171 Ga0070693_100040100 3300005547 Bacteria 2627
172 Ga0070693_100073186 3300005547 Bacteria 2024
173 Ga0070693_100521509 3300005547 Bacteria 846
174 Ga0070665_100006320 3300005548 Bacteria 12090
175 Ga0070665_100053630 3300005548 Bacteria 4044
176 Ga0070665_100064471 3300005548 Bacteria 3674
177 Ga0068855_100048667 3300005563 Bacteria 5003
178 Ga0068855_100050120 3300005563 Bacteria 4921
179 Ga0068855_100111070 3300005563 Bacteria 3147
180 Ga0068855_100207682 3300005563 Bacteria 2202
181 Ga0068855_100208992 3300005563 Bacteria 2194
182 Ga0068855_100243286 3300005563 Bacteria 2009
183 Ga0068855_100267980 3300005563 Bacteria 1900
184 Ga0068855_101095760 3300005563 Bacteria 833
185 Ga0070664_100021210 3300005564 Bacteria 5352
186 Ga0070664_100105909 3300005564 Bacteria 2449
187 Ga0070664_100114810 3300005564 Bacteria 2353
188 Ga0070664_100203269 3300005564 Bacteria 1768
189 Ga0070664_100441537 3300005564 Bacteria 1194
190 Ga0070664_101170914 3300005564 Bacteria 725
191 Ga0070664_101786668 3300005564 Unclassified 583
192 Ga0068857_100019007 3300005577 Bacteria 6028
193 Ga0068857_100023828 3300005577 Bacteria 5388
194 Ga0068857_100062570 3300005577 Bacteria 3308
195 Ga0068857_100482680 3300005577 Bacteria 1161
196 Ga0068857_101037990 3300005577 Unclassified 790
197 Ga0068854_100031274 3300005578 Bacteria 3698
198 Ga0068854_100092871 3300005578 Bacteria 2248
199 Ga0068854_100154935 3300005578 Bacteria 1769
200 Ga0068854_100187654 3300005578 Bacteria 1618
201 Ga0068854_100212190 3300005578 Bacteria 1527
202 Ga0068854_100508400 3300005578 Bacteria 1016
203 Ga0068854_101438166 3300005578 Bacteria 624
204 Ga0068854_101662933 3300005578 Bacteria 583
205 Ga0068856_100051981 3300005614 Bacteria 4040
206 Ga0068856_100098357 3300005614 Bacteria 2916
207 Ga0068856_100144207 3300005614 Bacteria 2389
208 Ga0068856_100172945 3300005614 Bacteria 2172
209 Ga0068856_100629053 3300005614 Bacteria 1094
210 Ga0068856_100796554 3300005614 Bacteria 965
211 Ga0068856_100848773 3300005614 Bacteria 932
212 Ga0068856_101075420 3300005614 Bacteria 822
213 Ga0068856_101339043 3300005614 Bacteria 731
214 Ga0068856_101346078 3300005614 Bacteria 729
215 Ga0068856_101928691 3300005614 Unclassified 601
216 Ga0070702_100975996 3300005615 Unclassified 669
217 Ga0068852_100001069 3300005616 Bacteria 18099
218 Ga0068852_100016289 3300005616 Bacteria 5791
219 Ga0068852_100021969 3300005616 Bacteria 5107
220 Ga0068852_100076960 3300005616 Bacteria 2947
221 Ga0068852_100098987 3300005616 Bacteria 2627
222 Ga0068852_100172565 3300005616 Bacteria 2028
223 Ga0068852_100187189 3300005616 Bacteria 1950
224 Ga0068852_100189039 3300005616 Bacteria 1942
225 Ga0068852_100403049 3300005616 Bacteria 1346
226 Ga0068852_100571183 3300005616 Bacteria 1133
227 Ga0068852_100909462 3300005616 Bacteria 897
228 Ga0068859_100028161 3300005617 Bacteria 5633
229 Ga0068859_100048003 3300005617 Bacteria 4290
230 Ga0068859_100573868 3300005617 Unclassified 1222
231 Ga0068864_100155118 3300005618 Bacteria 2078
232 Ga0068864_100197960 3300005618 Bacteria 1844
233 Ga0068864_100486578 3300005618 Bacteria 1185
234 Ga0068866_10048109 3300005718 Bacteria 2154
235 Ga0068866_10050117 3300005718 Bacteria 2119
236 Ga0068861_100211480 3300005719 Bacteria 1634
237 Ga0068861_100370429 3300005719 Unclassified 1262
238 Ga0068861_100815273 3300005719 Bacteria 877
239 Ga0068851_10008929 3300005834 Bacteria 4648
240 Ga0068851_10030743 3300005834 Bacteria 2665
241 Ga0068851_10039813 3300005834 Bacteria 2361
242 Ga0068851_10197961 3300005834 Bacteria 1120
243 Ga0068870_10068941 3300005840 Unclassified 1923
244 Ga0068870_10283983 3300005840 Bacteria 1039
245 Ga0068870_10346497 3300005840 Bacteria 952
246 Ga0068863_100005224 3300005841 Bacteria 12814
247 Ga0068863_100005699 3300005841 Bacteria 12229
248 Ga0068863_100037268 3300005841 Bacteria 4630
249 Ga0068863_100365270 3300005841 Bacteria 1408
250 Ga0068863_100916996 3300005841 Bacteria 877
251 Ga0068858_100164300 3300005842 Bacteria 2091
252 Ga0068858_100232956 3300005842 Bacteria 1746
253 Ga0068858_101050915 3300005842 Unclassified 799
254 Ga0068860_100028404 3300005843 Bacteria 5384
255 Ga0068860_100192759 3300005843 Bacteria 1973
256 Ga0068860_100295886 3300005843 Bacteria 1585
257 Ga0068860_100554667 3300005843 Unclassified 1151
258 Ga0068862_100012521 3300005844 Bacteria 7021
259 Ga0068862_100034938 3300005844 Bacteria 4255
260 Ga0068862_100344161 3300005844 Bacteria 1382
261 Ga0068862_100880869 3300005844 Bacteria 879
262 Ga0070717_10320000 3300006028 Bacteria 1382
263 Ga0070715_10790453 3300006163 Bacteria 575
264 Ga0070716_100114965 3300006173 Bacteria 1674
265 Ga0070712_100055548 3300006175 Bacteria 2774
266 Ga0075366_10136992 3300006195 Bacteria 1478
267 Ga0097621_100013004 3300006237 Bacteria 6187
268 Ga0097621_100362425 3300006237 Bacteria 1291
269 Ga0068871_100013255 3300006358 Bacteria 6113
270 Ga0068871_100023199 3300006358 Bacteria 4795
271 Ga0075429_100952659 3300006880 Bacteria 751
272 Ga0068865_100364330 3300006881 Bacteria 1175
273 Ga0097620_100028158 3300006931 Bacteria 5633
274 Ga0097620_100048003 3300006931 Bacteria 4290
275 Ga0097620_100573783 3300006931 Unclassified 1222
276 Ga0105240_10056083 3300009093 Bacteria 4931
277 Ga0105240_10211090 3300009093 Bacteria 2269
278 Ga0105240_10224311 3300009093 Bacteria 2187
279 Ga0111539_13473188 3300009094 Unclassified 506
280 Ga0105245_10037973 3300009098 Bacteria 4283
281 Ga0105245_10065426 3300009098 Bacteria 3288
282 Ga0114129_10672017 3300009147 Bacteria 1334
283 Ga0105243_10012496 3300009148 Bacteria 6420
284 Ga0105243_10064552 3300009148 Bacteria 2938
285 Ga0105243_10210720 3300009148 Bacteria 1711
286 Ga0105241_10154098 3300009174 Bacteria 1882
287 Ga0105241_10349370 3300009174 Bacteria 1283
288 Ga0105241_11204122 3300009174 Unclassified 717
289 Ga0105242_10054494 3300009176 Bacteria 3269
290 Ga0105242_10324709 3300009176 Bacteria 1413
291 Ga0105242_11410618 3300009176 Bacteria 724
292 Ga0105248_10085838 3300009177 Bacteria 3542
293 Ga0105248_10149205 3300009177 Bacteria 2638
294 Ga0105248_10589610 3300009177 Bacteria 1254
295 Ga0105248_11494295 3300009177 Bacteria 765
296 Ga0105237_10029154 3300009545 Bacteria 5614
297 Ga0105238_10016800 3300009551 Bacteria 7418
298 Ga0105238_10070567 3300009551 Bacteria 3492
299 Ga0105238_10324055 3300009551 Bacteria 1527
300 Ga0105238_10457204 3300009551 Bacteria 1274
301 Ga0105238_10556030 3300009551 Bacteria 1152
302 Ga0105238_10658903 3300009551 Bacteria 1057
303 Ga0105238_11398598 3300009551 Bacteria 727
304 Ga0105249_10651164 3300009553 Bacteria 1111
305 Ga0105249_12503674 3300009553 Unclassified 588
306 Ga0105239_10081790 3300010375 Bacteria 3555
307 Ga0105239_10083657 3300010375 Bacteria 3514
308 Ga0105239_11762993 3300010375 Bacteria 717
309 Ga0105246_10053188 3300011119 Bacteria 2786
310 Ga0105246_10542597 3300011119 Bacteria 995
311 Ga0157373_10012135 3300013100 Bacteria 6333
312 Ga0157373_10012753 3300013100 Bacteria 6176
313 Ga0157373_10068364 3300013100 Bacteria 2511
314 Ga0157373_10083663 3300013100 Bacteria 2249
315 Ga0157373_10137199 3300013100 Bacteria 1720
316 Ga0157373_10158947 3300013100 Bacteria 1590
317 Ga0157373_10256689 3300013100 Bacteria 1237
318 Ga0157373_10471548 3300013100 Bacteria 905
319 Ga0157373_11240516 3300013100 Bacteria 563
320 Ga0157373_11515958 3300013100 Unclassified 512
321 Ga0157371_10015031 3300013102 Bacteria 5818
322 Ga0157371_10020854 3300013102 Bacteria 4820
323 Ga0157371_10038044 3300013102 Bacteria 3443
324 Ga0157371_10060879 3300013102 Bacteria 2676
325 Ga0157371_10065257 3300013102 Bacteria 2578
326 Ga0157371_10073976 3300013102 Bacteria 2413
327 Ga0157371_10094710 3300013102 Bacteria 2116
328 Ga0157371_10119389 3300013102 Bacteria 1874
329 Ga0157371_10163424 3300013102 Bacteria 1590
330 Ga0157371_10279714 3300013102 Bacteria 1205
331 Ga0157371_10368839 3300013102 Bacteria 1047
332 Ga0157371_11335813 3300013102 Bacteria 555
333 Ga0157370_10048284 3300013104 Bacteria 4077
334 Ga0157370_10048564 3300013104 Bacteria 4065
335 Ga0157370_10065056 3300013104 Bacteria 3451
336 Ga0157370_10086927 3300013104 Bacteria 2937
337 Ga0157370_10089261 3300013104 Bacteria 2896
338 Ga0157370_10139727 3300013104 Bacteria 2257
339 Ga0157370_10577613 3300013104 Bacteria 1030
340 Ga0157369_10007383 3300013105 Bacteria 12652
341 Ga0157369_10031051 3300013105 Bacteria 5888
342 Ga0157369_10067972 3300013105 Bacteria 3829
343 Ga0157369_10125164 3300013105 Bacteria 2726
344 Ga0157369_10132459 3300013105 Bacteria 2641
345 Ga0157369_10135588 3300013105 Bacteria 2606
346 Ga0157369_10208604 3300013105 Bacteria 2048
347 Ga0157369_10213157 3300013105 Bacteria 2024
348 Ga0157369_10472729 3300013105 Bacteria 1297
349 Ga0157369_10610836 3300013105 Bacteria 1125
350 Ga0157369_10649490 3300013105 Bacteria 1088
351 Ga0157369_12073942 3300013105 Bacteria 577
352 Ga0157369_12556255 3300013105 Unclassified 517
353 Ga0157374_10050975 3300013296 Bacteria 3850
354 Ga0157374_10079406 3300013296 Bacteria 3109
355 Ga0157374_10107964 3300013296 Bacteria 2675
356 Ga0157374_10464772 3300013296 Bacteria 1267
357 Ga0157374_10564921 3300013296 Bacteria 1146
358 Ga0157374_10987084 3300013296 Unclassified 861
359 Ga0157374_11503172 3300013296 Unclassified 697
360 Ga0157378_10021644 3300013297 Bacteria 5654
361 Ga0157378_10033817 3300013297 Bacteria 4521
362 Ga0163162_10056100 3300013306 Bacteria 3968
363 Ga0163162_10161503 3300013306 Bacteria 2362
364 Ga0157372_10008752 3300013307 Bacteria 10748
365 Ga0157372_10065325 3300013307 Bacteria 4085
366 Ga0157372_10185390 3300013307 Bacteria 2410
367 Ga0157372_10988526 3300013307 Bacteria 975
368 Ga0157372_11740037 3300013307 Unclassified 717
369 Ga0157375_10016314 3300013308 Bacteria 6668
370 Ga0157375_10027659 3300013308 Bacteria 5304
371 Ga0157375_10312787 3300013308 Bacteria 1735
372 Ga0157375_11810632 3300013308 Bacteria 724
373 Ga0163163_10237948 3300014325 Bacteria 1870
374 Ga0163163_10405083 3300014325 Bacteria 1422
375 Ga0157380_10527351 3300014326 Bacteria 1153
376 Ga0157377_10056992 3300014745 Bacteria 2220
377 Ga0157377_10201160 3300014745 Bacteria 1265
378 Ga0157379_11281722 3300014968 Bacteria 707
379 Ga0157376_10185201 3300014969 Bacteria 1906
380 Ga0157376_10492334 3300014969 Bacteria 1203
381 Ga0157376_10717075 3300014969 Unclassified 1007
382 Ga0163161_10571810 3300017792 Unclassified 929
383 Ga0206354_11586023 3300020081 Bacteria 1471
384 Ga0206353_10738842 3300020082 Bacteria 7517
385 Ga0207697_10011008 3300025315 Bacteria 3839
386 Ga0207697_10034325 3300025315 Bacteria 2077
387 Ga0207697_10066762 3300025315 Bacteria 1503
388 Ga0207697_10155131 3300025315 Bacteria 997
389 Ga0207656_10025165 3300025321 Bacteria 2414
390 Ga0207656_10275334 3300025321 Bacteria 829
391 Ga0207656_10331235 3300025321 Unclassified 757
392 Ga0207656_10540296 3300025321 Unclassified 593
393 Ga0207682_10001342 3300025893 Bacteria 11341
394 Ga0207642_10086534 3300025899 Bacteria 1536
395 Ga0207710_10057212 3300025900 Bacteria 1761
396 Ga0207688_10009382 3300025901 Bacteria 5329
397 Ga0207688_10265839 3300025901 Bacteria 1042
398 Ga0207688_10337600 3300025901 Bacteria 926
399 Ga0207688_10734798 3300025901 Bacteria 625
400 Ga0207680_10003327 3300025903 Bacteria 7573
401 Ga0207680_10007066 3300025903 Bacteria 5454
402 Ga0207680_10630441 3300025903 Bacteria 767
403 Ga0207647_10019866 3300025904 Bacteria 4511
404 Ga0207647_10038542 3300025904 Bacteria 3020
405 Ga0207647_10073031 3300025904 Bacteria 2068
406 Ga0207647_10219558 3300025904 Bacteria 1096
407 Ga0207685_10519340 3300025905 Bacteria 629
408 Ga0207699_10008885 3300025906 Bacteria 4980
409 Ga0207645_10002319 3300025907 Bacteria 15052
410 Ga0207645_10015407 3300025907 Bacteria 5079
411 Ga0207645_10106104 3300025907 Bacteria 1816
412 Ga0207645_10265082 3300025907 Bacteria 1138
413 Ga0207643_10072411 3300025908 Bacteria 1985
414 Ga0207643_10150036 3300025908 Bacteria 1397
415 Ga0207705_10021914 3300025909 Bacteria 4558
416 Ga0207705_10033619 3300025909 Bacteria 3664
417 Ga0207705_10080315 3300025909 Bacteria 2376
418 Ga0207705_10103966 3300025909 Bacteria 2092
419 Ga0207705_10111793 3300025909 Bacteria 2019
420 Ga0207705_10138049 3300025909 Bacteria 1819
421 Ga0207705_10166359 3300025909 Bacteria 1658
422 Ga0207705_10482361 3300025909 Bacteria 962
423 Ga0207684_10159692 3300025910 Bacteria 1941
424 Ga0207654_10598661 3300025911 Bacteria 786
425 Ga0207654_10848306 3300025911 Unclassified 661
426 Ga0207707_10051960 3300025912 Bacteria 3569
427 Ga0207707_10129047 3300025912 Bacteria 2211
428 Ga0207707_10172177 3300025912 Bacteria 1892
429 Ga0207707_10287192 3300025912 Bacteria 1424
430 Ga0207707_10419268 3300025912 Bacteria 1148
431 Ga0207707_10423305 3300025912 Bacteria 1141
432 Ga0207695_10039931 3300025913 Bacteria 5039
433 Ga0207695_10115246 3300025913 Bacteria 2662
434 Ga0207695_10543926 3300025913 Bacteria 1043
435 Ga0207671_10489321 3300025914 Bacteria 981
436 Ga0207660_10000059 3300025917 Bacteria 56766
437 Ga0207660_10001202 3300025917 Bacteria 17345
438 Ga0207660_10009838 3300025917 Bacteria 6191
439 Ga0207660_10078092 3300025917 Bacteria 2425
440 Ga0207660_10537099 3300025917 Bacteria 950
441 Ga0207662_10023202 3300025918 Bacteria 3563
442 Ga0207657_10012830 3300025919 Bacteria 8246
443 Ga0207657_10014934 3300025919 Bacteria 7546
444 Ga0207657_10029689 3300025919 Bacteria 4973
445 Ga0207657_10031052 3300025919 Bacteria 4843
446 Ga0207657_10034236 3300025919 Bacteria 4571
447 Ga0207657_10036827 3300025919 Bacteria 4376
448 Ga0207657_10093145 3300025919 Bacteria 2510
449 Ga0207657_10145426 3300025919 Bacteria 1934
450 Ga0207657_10725073 3300025919 Bacteria 771
451 Ga0207657_10736022 3300025919 Unclassified 764
452 Ga0207657_11313120 3300025919 Unclassified 546
453 Ga0207649_10027742 3300025920 Bacteria 3327
454 Ga0207649_10044044 3300025920 Bacteria 2731
455 Ga0207649_10107540 3300025920 Bacteria 1857
456 Ga0207649_10125061 3300025920 Bacteria 1739
457 Ga0207649_10343523 3300025920 Bacteria 1103
458 Ga0207649_10565012 3300025920 Bacteria 872
459 Ga0207649_10840692 3300025920 Bacteria 718
460 Ga0207649_10857960 3300025920 Unclassified 711
461 Ga0207652_10018990 3300025921 Bacteria 5645
462 Ga0207652_10124163 3300025921 Bacteria 2299
463 Ga0207652_10276410 3300025921 Bacteria 1515
464 Ga0207652_10706897 3300025921 Bacteria 899
465 Ga0207652_11193810 3300025921 Bacteria 662
466 Ga0207681_10008022 3300025923 Bacteria 6460
467 Ga0207681_10031395 3300025923 Bacteria 3469
468 Ga0207681_10830529 3300025923 Bacteria 772
469 Ga0207694_10000966 3300025924 Bacteria 25308
470 Ga0207694_10330707 3300025924 Bacteria 1259
471 Ga0207694_10594715 3300025924 Bacteria 930
472 Ga0207694_11594506 3300025924 Bacteria 550
473 Ga0207650_10004781 3300025925 Bacteria 9254
474 Ga0207650_10019021 3300025925 Bacteria 4828
475 Ga0207650_10075522 3300025925 Bacteria 2543
476 Ga0207659_10196454 3300025926 Bacteria 1608
477 Ga0207687_10107523 3300025927 Bacteria 2064
478 Ga0207687_10160373 3300025927 Bacteria 1725
479 Ga0207687_10169601 3300025927 Bacteria 1682
480 Ga0207700_10115712 3300025928 Bacteria 2166
481 Ga0207700_10258425 3300025928 Bacteria 1490
482 Ga0207700_10462894 3300025928 Bacteria 1119
483 Ga0207664_10013598 3300025929 Bacteria 5850
484 Ga0207664_10016311 3300025929 Bacteria 5417
485 Ga0207664_10023570 3300025929 Bacteria 4614
486 Ga0207664_10116219 3300025929 Bacteria 2232
487 Ga0207664_10125235 3300025929 Bacteria 2156
488 Ga0207664_10609540 3300025929 Bacteria 980
489 Ga0207644_10000142 3300025931 Bacteria 51611
490 Ga0207644_10554064 3300025931 Bacteria 952
491 Ga0207690_10002953 3300025932 Bacteria 10245
492 Ga0207690_10046793 3300025932 Bacteria 2867
493 Ga0207690_10088152 3300025932 Bacteria 2185
494 Ga0207690_10125542 3300025932 Bacteria 1870
495 Ga0207690_10269397 3300025932 Bacteria 1322
496 Ga0207690_10299348 3300025932 Unclassified 1258
497 Ga0207690_10429579 3300025932 Bacteria 1058
498 Ga0207690_10447098 3300025932 Bacteria 1038
499 Ga0207690_10472911 3300025932 Bacteria 1010
500 Ga0207706_10005721 3300025933 Bacteria 11580
501 Ga0207706_10019092 3300025933 Bacteria 6166
502 Ga0207706_10037307 3300025933 Bacteria 4316
503 Ga0207706_10086882 3300025933 Bacteria 2749
504 Ga0207706_10145933 3300025933 Bacteria 2081
505 Ga0207706_10451867 3300025933 Unclassified 1111
506 Ga0207686_10301444 3300025934 Bacteria 1190
507 Ga0207709_10572962 3300025935 Bacteria 891
508 Ga0207709_10705767 3300025935 Bacteria 808
509 Ga0207669_10018773 3300025937 Bacteria 3584
510 Ga0207669_10065902 3300025937 Bacteria 2249
511 Ga0207704_10016287 3300025938 Bacteria 3817
512 Ga0207665_10100078 3300025939 Bacteria 2022
513 Ga0207691_10006169 3300025940 Bacteria 11586
514 Ga0207691_10024129 3300025940 Bacteria 5719
515 Ga0207691_10043385 3300025940 Bacteria 4145
516 Ga0207691_10044757 3300025940 Bacteria 4073
517 Ga0207691_11592727 3300025940 Bacteria 531
518 Ga0207711_10029289 3300025941 Bacteria 4642
519 Ga0207711_10171135 3300025941 Bacteria 1971
520 Ga0207711_10350779 3300025941 Bacteria 1366
521 Ga0207711_10386494 3300025941 Bacteria 1299
522 Ga0207711_10798801 3300025941 Bacteria 879
523 Ga0207689_10012587 3300025942 Bacteria 7226
524 Ga0207689_10047729 3300025942 Bacteria 3533
525 Ga0207661_10071102 3300025944 Bacteria 2842
526 Ga0207661_10085121 3300025944 Bacteria 2620
527 Ga0207661_10231631 3300025944 Bacteria 1636
528 Ga0207679_10016598 3300025945 Bacteria 4893
529 Ga0207679_10107503 3300025945 Bacteria 2195
530 Ga0207679_10314524 3300025945 Bacteria 1354
531 Ga0207679_10318756 3300025945 Bacteria 1345
532 Ga0207679_11253184 3300025945 Bacteria 681
533 Ga0207667_10005262 3300025949 Bacteria 15787
534 Ga0207667_10029624 3300025949 Bacteria 5935
535 Ga0207667_10039670 3300025949 Bacteria 5017
536 Ga0207667_10040206 3300025949 Bacteria 4980
537 Ga0207667_10098120 3300025949 Bacteria 3023
538 Ga0207667_10338450 3300025949 Bacteria 1536
539 Ga0207667_11101816 3300025949 Bacteria 777
540 Ga0207651_10005732 3300025960 Bacteria 6414
541 Ga0207651_10010290 3300025960 Bacteria 5175
542 Ga0207651_10426995 3300025960 Bacteria 1132
543 Ga0207651_10973357 3300025960 Bacteria 757
544 Ga0207712_10510139 3300025961 Bacteria 1029
545 Ga0207668_10018267 3300025972 Bacteria 4408
546 Ga0207668_10261158 3300025972 Unclassified 1411
547 Ga0207668_10368207 3300025972 Bacteria 1206
548 Ga0207640_10062397 3300025981 Bacteria 2473
549 Ga0207640_10067242 3300025981 Bacteria 2397
550 Ga0207640_10100206 3300025981 Bacteria 2029
551 Ga0207640_10244932 3300025981 Bacteria 1388
552 Ga0207640_10264000 3300025981 Bacteria 1343
553 Ga0207640_10339783 3300025981 Bacteria 1202
554 Ga0207640_10471741 3300025981 Bacteria 1039
555 Ga0207640_11193247 3300025981 Bacteria 676
556 Ga0207658_10027405 3300025986 Bacteria 4002
557 Ga0207658_10920118 3300025986 Bacteria 796
558 Ga0207677_10005002 3300026023 Bacteria 7159
559 Ga0207677_10077416 3300026023 Bacteria 2372
560 Ga0207677_10298819 3300026023 Bacteria 1329
561 Ga0207677_10955081 3300026023 Bacteria 775
562 Ga0207677_10982498 3300026023 Unclassified 765
563 Ga0207703_10241762 3300026035 Bacteria 1623
564 Ga0207639_10000744 3300026041 Bacteria 22249
565 Ga0207639_10154043 3300026041 Bacteria 1928
566 Ga0207639_10276366 3300026041 Bacteria 1475
567 Ga0207639_10836987 3300026041 Bacteria 858
568 Ga0207639_11020424 3300026041 Unclassified 775
569 Ga0207678_10008634 3300026067 Bacteria 8980
570 Ga0207678_10010248 3300026067 Bacteria 8226
571 Ga0207678_10032194 3300026067 Bacteria 4570
572 Ga0207678_10058363 3300026067 Bacteria 3321
573 Ga0207678_10067799 3300026067 Bacteria 3062
574 Ga0207702_10043057 3300026078 Bacteria 3789
575 Ga0207702_10150028 3300026078 Bacteria 2119
576 Ga0207702_10153445 3300026078 Bacteria 2097
577 Ga0207702_10176712 3300026078 Bacteria 1963
578 Ga0207702_10204038 3300026078 Bacteria 1834
579 Ga0207702_10271492 3300026078 Bacteria 1600
580 Ga0207702_10501619 3300026078 Bacteria 1183
581 Ga0207702_10698785 3300026078 Bacteria 999
582 Ga0207702_11014447 3300026078 Bacteria 823
583 Ga0207702_11247363 3300026078 Bacteria 737
584 Ga0207641_10006875 3300026088 Bacteria 9522
585 Ga0207641_10025415 3300026088 Bacteria 4883
586 Ga0207641_10067548 3300026088 Bacteria 3063
587 Ga0207641_10170134 3300026088 Bacteria 1988
588 Ga0207641_10856120 3300026088 Bacteria 901
589 Ga0207648_10002458 3300026089 Bacteria 19911
590 Ga0207648_10011602 3300026089 Bacteria 8297
591 Ga0207648_10019695 3300026089 Bacteria 6088
592 Ga0207676_10097044 3300026095 Bacteria 2434
593 Ga0207676_10348835 3300026095 Bacteria 1368
594 Ga0207676_10674280 3300026095 Bacteria 999
595 Ga0207674_10000065 3300026116 Bacteria 109485
596 Ga0207674_10002824 3300026116 Bacteria 21598
597 Ga0207674_10003445 3300026116 Bacteria 19357
598 Ga0207674_10014766 3300026116 Bacteria 8616
599 Ga0207674_10235128 3300026116 Bacteria 1780
600 Ga0207674_10434534 3300026116 Bacteria 1269
601 Ga0207674_11208187 3300026116 Unclassified 726
602 Ga0207675_100036554 3300026118 Bacteria 4581
603 Ga0207675_100147162 3300026118 Bacteria 2240
604 Ga0207675_100340165 3300026118 Bacteria 1469
605 Ga0207683_10002271 3300026121 Bacteria 16845
606 Ga0207683_10013861 3300026121 Bacteria 6875
607 Ga0207683_10025083 3300026121 Bacteria 5141
608 Ga0207683_10026610 3300026121 Bacteria 4994
609 Ga0207698_10003907 3300026142 Bacteria 9024
610 Ga0207698_10011411 3300026142 Bacteria 5761
611 Ga0207698_10011695 3300026142 Bacteria 5704
612 Ga0207698_10036738 3300026142 Bacteria 3599
613 Ga0207698_10079985 3300026142 Bacteria 2631
614 Ga0207698_10093067 3300026142 Bacteria 2474
615 Ga0207698_10223892 3300026142 Bacteria 1702
616 Ga0207698_10545829 3300026142 Bacteria 1135
617 Ga0207698_10606264 3300026142 Bacteria 1080
618 Ga0207698_10683636 3300026142 Bacteria 1020
619 Ga0207698_11053160 3300026142 Bacteria 825
620 Ga0268266_10045835 3300028379 Bacteria 3742
621 Ga0268266_10057167 3300028379 Bacteria 3356
622 Ga0268265_10077818 3300028380 Bacteria 2606
623 Ga0268265_10092192 3300028380 Bacteria 2424
624 Ga0268265_10169604 3300028380 Bacteria 1864
625 Ga0268264_10020803 3300028381 Bacteria 5362
626 Ga0268264_10106161 3300028381 Bacteria 2451
627 Ga0307413_10638425 3300031824 Bacteria 877
628 Ga0307407_10149918 3300031903 Bacteria 1514
629 Ga0307409_100115233 3300031995 Bacteria 2262
630 Ga0307409_102729320 3300031995 Unclassified 522
631 Ga0307414_10438030 3300032004 Bacteria 1143
632 Ga0307411_10037200 3300032005 Bacteria 3058
633 Ga0373948_0152515 3300034817 Unclassified 578
634 Ga0373938_0199973 3300034957 Unclassified 553
635 Ga0373952_0160837 3300035092 Bacteria 636
636 Ga0373952_0290951 3300035092 Unclassified 506
637 Ga0373960_0069579 3300035121 Bacteria 1086
638 Ga0373943_0011671 3300035170 Bacteria 3955
639 Ga0373946_0011556 3300035171 Bacteria 3297
640 Ga0373942_0099976 3300035207 Unclassified 885
641 Ga0373931_0051628 3300035691 Bacteria 2191
642 Ga0373931_0784072 3300035691 Bacteria 634
643 Ga0373935_0006536 3300035692 Bacteria 6964
644 Ga0373935_0020199 3300035692 Bacteria 4067
645 Ga0373927_0022086 3300035695 Bacteria 4170
646 Ga0373947_0006264 3300035725 Bacteria 6916
647 Ga0373937_1473378 3300036401 Bacteria 628
648 Ga0373937_1474027 3300036401 Unclassified 628
649 Ga0373925_0249024 3300037068 Bacteria 1424
650 Ga0395899_0000113 3300037312 Bacteria 136163
651 Ga0395899_0006469 3300037312 Bacteria 9076
652 Ga0395899_0013449 3300037312 Bacteria 6260
653 Ga0395899_0019176 3300037312 Bacteria 5198
654 Ga0395899_0020590 3300037312 Bacteria 5000
655 Ga0395899_0060907 3300037312 Bacteria 2780
656 Ga0395899_0063573 3300037312 Bacteria 2715
657 Ga0395899_0066680 3300037312 Bacteria 2642
658 Ga0395899_0100246 3300037312 Bacteria 2091
659 Ga0395899_0106552 3300037312 Bacteria 2018
660 Ga0395899_0109688 3300037312 Bacteria 1985
661 Ga0395899_0284882 3300037312 Bacteria 1123
662 Ga0395899_0959713 3300037312 Unclassified 518
663 Ga0395900_0000365 3300037418 Bacteria 65054
664 Ga0395900_0000964 3300037418 Bacteria 37445
665 Ga0395900_0008087 3300037418 Bacteria 10828
666 Ga0395900_0011278 3300037418 Bacteria 9140
667 Ga0395900_0013562 3300037418 Bacteria 8325
668 Ga0395900_0023762 3300037418 Bacteria 6270
669 Ga0395900_0024613 3300037418 Bacteria 6161
670 Ga0395900_0056333 3300037418 Bacteria 4046
671 Ga0395900_0069852 3300037418 Bacteria 3610
672 Ga0395900_0086813 3300037418 Bacteria 3215
673 Ga0395900_0091354 3300037418 Bacteria 3129
674 Ga0395900_0093890 3300037418 Bacteria 3081
675 Ga0395900_0158283 3300037418 Bacteria 2312
676 Ga0395900_0167586 3300037418 Bacteria 2238
677 Ga0395900_0198808 3300037418 Bacteria 2029
678 Ga0395900_0252090 3300037418 Unclassified 1766
679 Ga0395900_0353100 3300037418 Bacteria 1443
680 Ga0395900_0513194 3300037418 Unclassified 1147
681 Ga0395900_0692766 3300037418 Bacteria 953
682 Ga0395900_1335932 3300037418 Unclassified 630
683 Ga0395900_1458714 3300037418 Bacteria 597
684 Ga0395898_0000306 3300037466 Bacteria 115940
685 Ga0395898_0008363 3300037466 Bacteria 10939
686 Ga0395898_0022122 3300037466 Bacteria 6441
687 Ga0395898_0038340 3300037466 Bacteria 4750
688 Ga0395898_0049745 3300037466 Bacteria 4106
689 Ga0395898_0088936 3300037466 Bacteria 2973
690 Ga0395898_0247782 3300037466 Bacteria 1699
691 Ga0395898_0256801 3300037466 Bacteria 1666
692 Ga0395898_0281130 3300037466 Bacteria 1587
693 Ga0395898_0329735 3300037466 Bacteria 1455
694 Ga0395898_0476492 3300037466 Bacteria 1187
695 Ga0395898_0746893 3300037466 Bacteria 920
696 Ga0395898_0919109 3300037466 Bacteria 813
697 Ga0395898_1290038 3300037466 Unclassified 660
698 Ga0395898_1292840 3300037466 Unclassified 659
699 Ga0395905_0000005 3300037471 Bacteria 557808
700 Ga0395905_0002956 3300037471 Bacteria 18463
701 Ga0395905_0009966 3300037471 Bacteria 9258
702 Ga0395905_0011079 3300037471 Bacteria 8728
703 Ga0395905_0016924 3300037471 Bacteria 6925
704 Ga0395905_0019166 3300037471 Bacteria 6488
705 Ga0395905_0021922 3300037471 Bacteria 6041
706 Ga0395905_0026212 3300037471 Bacteria 5497
707 Ga0395905_0026426 3300037471 Bacteria 5473
708 Ga0395905_0032743 3300037471 Bacteria 4886
709 Ga0395905_0039456 3300037471 Bacteria 4429
710 Ga0395905_0058925 3300037471 Bacteria 3590
711 Ga0395905_0059475 3300037471 Bacteria 3572
712 Ga0395905_0088779 3300037471 Bacteria 2897
713 Ga0395905_0131320 3300037471 Bacteria 2355
714 Ga0395905_0153323 3300037471 Bacteria 2167
715 Ga0395905_0200174 3300037471 Bacteria 1872
716 Ga0395905_0231601 3300037471 Bacteria 1727
717 Ga0395905_0399924 3300037471 Bacteria 1268
718 Ga0395905_0968691 3300037471 Bacteria 754
719 Ga0395905_0997386 3300037471 Bacteria 740
720 Ga0395905_1230778 3300037471 Unclassified 652
721 Ga0395905_1618297 3300037471 Unclassified 552
722 Ga0395905_1786056 3300037471 Unclassified 520
723 Ga0395901_0000248 3300038443 Bacteria 67155
724 Ga0395901_0001201 3300038443 Bacteria 27555
725 Ga0395901_0005488 3300038443 Bacteria 12849
726 Ga0395901_0012068 3300038443 Bacteria 8766
727 Ga0395901_0020064 3300038443 Bacteria 6839
728 Ga0395901_0033619 3300038443 Bacteria 5294
729 Ga0395901_0036467 3300038443 Bacteria 5083
730 Ga0395901_0037974 3300038443 Bacteria 4981
731 Ga0395901_0053500 3300038443 Bacteria 4194
732 Ga0395901_0071571 3300038443 Bacteria 3613
733 Ga0395901_0112322 3300038443 Bacteria 2861
734 Ga0395901_0188653 3300038443 Bacteria 2162
735 Ga0395901_0221755 3300038443 Bacteria 1976
736 Ga0395901_0230144 3300038443 Bacteria 1935
737 Ga0395901_0232464 3300038443 Bacteria 1924
738 Ga0395901_0264959 3300038443 Bacteria 1788
739 Ga0395901_0266208 3300038443 Bacteria 1783
740 Ga0395901_0320938 3300038443 Bacteria 1602
741 Ga0395901_0368635 3300038443 Bacteria 1480
742 Ga0395901_0963436 3300038443 Bacteria 831
743 Ga0395901_1348648 3300038443 Bacteria 673
744 Ga0395901_1584638 3300038443 Unclassified 609
745 Ga0395901_1585893 3300038443 Bacteria 608
746 Ga0395901_1695383 3300038443 Unclassified 583
747 Ga0450905_000308 3300042142 Bacteria 5840
748 Ga0450889_000193 3300042144 Bacteria 6640
749 Ga0439464_0000878 3300042439 Bacteria 6694
750 Ga0450916_011021 3300042530 Bacteria 1137
751 Ga0466969_0053432 3300044656 Bacteria 1982
752 Ga0466969_0236065 3300044656 Bacteria 830
753 Ga0466972_0013931 3300044658 Bacteria 4033
754 Ga0466972_0333981 3300044658 Unclassified 709
755 Ga0466965_0146056 3300044683 Bacteria 1234
756 Ga0466966_0014830 3300044684 Bacteria 5157
757 Ga0466966_0115883 3300044684 Bacteria 1649
758 Ga0466966_0206842 3300044684 Bacteria 1187
759 Ga0466966_0379329 3300044684 Bacteria 849
760 Ga0466966_0535935 3300044684 Bacteria 704
761 Ga0466961_0019333 3300044693 Bacteria 4383
762 Ga0466961_0067398 3300044693 Bacteria 2273
763 Ga0466961_0071576 3300044693 Bacteria 2200
764 Ga0466963_0011010 3300044694 Bacteria 5499
765 Ga0466963_0026975 3300044694 Bacteria 3674
766 Ga0466963_0073469 3300044694 Bacteria 2305
767 Ga0466963_0106910 3300044694 Bacteria 1919
768 Ga0466963_0109725 3300044694 Bacteria 1893
769 Ga0466963_0200529 3300044694 Bacteria 1396
770 Ga0466963_0312157 3300044694 Bacteria 1106
771 Ga0466963_1223523 3300044694 Unclassified 527
772 Ga0466964_0012076 3300044706 Bacteria 3268
773 Ga0466971_0008654 3300044719 Bacteria 4441
774 Ga0466968_0014457 3300044735 Bacteria 3120
775 Ga0466970_0042966 3300044765 Bacteria 2404
776 Ga0466957_0010249 3300044842 Bacteria 5371
777 Ga0466957_0010341 3300044842 Bacteria 5351
778 Ga0466957_0086722 3300044842 Bacteria 1956
779 Ga0466957_0147311 3300044842 Bacteria 1520
780 Ga0466957_0388337 3300044842 Bacteria 953
781 Ga0466960_0024453 3300044901 Bacteria 2724
782 Ga0466959_0015101 3300045049 Bacteria 5626
783 Ga0466959_0129688 3300045049 Bacteria 1787
784 Ga0466959_0992697 3300045049 Unclassified 559
785 Ga0466958_0004622 3300045836 Bacteria 7295
786 Ga0466958_0032876 3300045836 Bacteria 3088
787 Ga0466958_0094076 3300045836 Bacteria 1856
788 Ga0466958_0160209 3300045836 Bacteria 1421
789 Ga0466967_0031731 3300045976 Bacteria 4452
790 Ga0466967_0048036 3300045976 Bacteria 3725
791 Ga0466967_0059029 3300045976 Bacteria 3393
792 Ga0466967_0077920 3300045976 Bacteria 2985
793 Ga0466967_0092983 3300045976 Bacteria 2743
794 Ga0466967_0107463 3300045976 Bacteria 2559
795 Ga0466967_0115004 3300045976 Bacteria 2477
796 Ga0466967_0142167 3300045976 Bacteria 2236
797 Ga0466967_0142274 3300045976 Bacteria 2235
798 Ga0466967_0160602 3300045976 Bacteria 2109
799 Ga0466967_0182596 3300045976 Bacteria 1980
800 Ga0466967_0418201 3300045976 Bacteria 1306
801 Ga0466967_0476505 3300045976 Bacteria 1222
802 Ga0466967_0570544 3300045976 Bacteria 1115
803 Ga0466967_0824391 3300045976 Bacteria 921
804 Ga0466967_0857472 3300045976 Unclassified 903
805 Ga0495643_0148301 3300046522 Bacteria 1164
806 Ga0495663_0259036 3300046525 Unclassified 619
807 Ga0495586_0575452 3300046535 Bacteria 650
808 Ga0495587_0666300 3300046536 Unclassified 571
809 Ga0495621_0000060 3300046539 Bacteria 21095
810 Ga0495633_0027524 3300046558 Bacteria 2779
811 Ga0495659_0023971 3300046664 Bacteria 2077
812 Ga0495669_0027423 3300046684 Bacteria 2492
813 Ga0495669_0162582 3300046684 Bacteria 1060
814 Ga0495670_0000649 3300046691 Bacteria 16588
815 Ga0496100_0001630 3300048903 Bacteria 11108
816 Ga0496101_0002764 3300048904 Bacteria 10775
817 Ga0496101_0113492 3300048904 Bacteria 2042
818 Ga0496102_0029658 3300048905 Bacteria 4896
819 Ga0496103_0059996 3300048906 Bacteria 2364
820 Ga0496104_0025877 3300048907 Bacteria 5412
821 Ga0496105_0116908 3300048908 Bacteria 2199
822 Ga0496106_0019173 3300048909 Bacteria 5072
823 Ga0496107_0000863 3300048910 Bacteria 17819
824 Ga0496107_0221134 3300048910 Bacteria 1409
825 Ga0496107_0633147 3300048910 Unclassified 789
826 Ga0496108_0000954 3300048911 Bacteria 22471
827 Ga0496109_0008004 3300048912 Bacteria 8962
828 Ga0496109_0349477 3300048912 Bacteria 1397
829 Ga0496109_1069929 3300048912 Bacteria 744
830 Ga0496110_0000754 3300048913 Bacteria 22407
831 Ga0496110_0058166 3300048913 Bacteria 3405
832 Ga0496111_0000069 3300048914 Bacteria 42302
833 Ga0496111_0183123 3300048914 Bacteria 1557
834 Ga0496112_0004068 3300048915 Bacteria 12275
835 Ga0496112_0005549 3300048915 Bacteria 10933
836 Ga0496112_0112500 3300048915 Bacteria 2693
837 Ga0496112_0395488 3300048915 Bacteria 1322
838 Ga0496112_0475481 3300048915 Bacteria 1186
839 Ga0496112_1179228 3300048915 Bacteria 683
840 Ga0496113_0007460 3300048916 Bacteria 7042
841 Ga0496113_0007666 3300048916 Bacteria 6965
842 Ga0501047_0775060 3300049581 Unclassified 774
843 Ga0501068_0022903 3300049584 Bacteria 3657
844 Ga0501068_0091248 3300049584 Bacteria 1880
845 Ga0501079_0600648 3300049741 Unclassified 866
846 Ga0501080_0041798 3300049742 Bacteria 4270
847 Ga0501044_0805947 3300049823 Bacteria 818
848 nmdc:mga0k408_110604_c1 3300050493 Bacteria 1624
849 nmdc:mga05p37_867572_c1 3300050507 Bacteria 978
850 nmdc:mga09592_133478_c1 3300050508 Bacteria 2137
851 Ga0466962_0007173 3300061719 Bacteria 5337
852 Ga0466962_0048447 3300061719 Bacteria 2030
853 Ga0466962_0424683 3300061719 Bacteria 667
854 Ga0530510_0235793 3300061734 Bacteria 1362

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_10107964 Ga0157374_101079642 118
2 3300005435 Ga0070714_100036186 Ga0070714_1000361862 119
3 3300005614 Ga0068856_100796554 Ga0068856_1007965542 119
4 3300025929 Ga0207664_10016311 Ga0207664_100163114 119
5 3300026078 Ga0207702_11014447 Ga0207702_110144472 119
6 3300038443 Ga0395901_1584638 Ga0395901_1584638_147_551 119
7 3300046522 Ga0495643_0148301 Ga0495643_0148301_202_624 119
8 3300005331 Ga0070670_100177334 Ga0070670_1001773341 120
9 3300005339 Ga0070660_100781288 Ga0070660_1007812882 120
10 3300005347 Ga0070668_100529766 Ga0070668_1005297662 120
11 3300005353 Ga0070669_100313642 Ga0070669_1003136422 120
12 3300005435 Ga0070714_100095396 Ga0070714_1000953962 120
13 3300005436 Ga0070713_100065022 Ga0070713_1000650222 120
14 3300005577 Ga0068857_100023828 Ga0068857_1000238286 120
15 3300005719 Ga0068861_100815273 Ga0068861_1008152732 120
16 3300005841 Ga0068863_100005224 Ga0068863_1000052247 120
17 3300005844 Ga0068862_100344161 Ga0068862_1003441612 120
18 3300006195 Ga0075366_10136992 Ga0075366_101369922 120
19 3300011119 Ga0105246_10542597 Ga0105246_105425972 120
20 3300013102 Ga0157371_10368839 Ga0157371_103688392 120
21 3300013296 Ga0157374_10987084 Ga0157374_109870842 120
22 3300014325 Ga0163163_10237948 Ga0163163_102379484 120
23 3300025925 Ga0207650_10075522 Ga0207650_100755224 120
24 3300025928 Ga0207700_10115712 Ga0207700_101157122 120
25 3300025929 Ga0207664_10023570 Ga0207664_100235703 120
26 3300026088 Ga0207641_10025415 Ga0207641_100254152 120
27 3300026116 Ga0207674_10000065 Ga0207674_1000006519 120
28 3300028380 Ga0268265_10169604 Ga0268265_101696042 120
29 3300038443 Ga0395901_0037974 Ga0395901_0037974_1694_2107 120
30 3300050493 nmdc:mga0k408_110604_c1 nmdc:mga0k408_110604_c1_131_535 120
31 3300005435 Ga0070714_100191201 Ga0070714_1001912012 121
32 3300025929 Ga0207664_10116219 Ga0207664_101162192 121
33 3300013102 Ga0157371_11335813 Ga0157371_113358131 122
34 3300044656 Ga0466969_0053432 Ga0466969_0053432_1282_1689 122
35 3300044693 Ga0466961_0067398 Ga0466961_0067398_923_1330 122
36 3300044719 Ga0466971_0008654 Ga0466971_0008654_413_820 122
37 3300044842 Ga0466957_0010249 Ga0466957_0010249_2592_2999 122
38 3300045836 Ga0466958_0094076 Ga0466958_0094076_1351_1758 122
39 3300061719 Ga0466962_0048447 Ga0466962_0048447_318_725 122
40 3300044658 Ga0466972_0333981 Ga0466972_0333981_34_441 124
41 3300044684 Ga0466966_0115883 Ga0466966_0115883_571_1059 124
42 3300044706 Ga0466964_0012076 Ga0466964_0012076_2382_2789 124
43 3300044735 Ga0466968_0014457 Ga0466968_0014457_2409_2816 124
44 3300044765 Ga0466970_0042966 Ga0466970_0042966_1023_1430 124
45 3300045049 Ga0466959_0129688 Ga0466959_0129688_984_1391 124
46 3300045836 Ga0466958_0032876 Ga0466958_0032876_583_990 124
47 3300045976 Ga0466967_0115004 Ga0466967_0115004_321_728 124
48 3300045976 Ga0466967_0570544 Ga0466967_0570544_18_425 124
49 3300036401 Ga0373937_1473378 Ga0373937_1473378_89_505 125
50 3300046535 Ga0495586_0575452 Ga0495586_0575452_125_541 125
51 3300046536 Ga0495587_0666300 Ga0495587_0666300_97_513 125
52 3300005328 Ga0070676_10004251 Ga0070676_100042512 128
53 3300005334 Ga0068869_100303658 Ga0068869_1003036582 128
54 3300005334 Ga0068869_101536991 Ga0068869_1015369912 128
55 3300005335 Ga0070666_10340076 Ga0070666_103400762 128
56 3300005338 Ga0068868_100032532 Ga0068868_1000325322 128
57 3300005353 Ga0070669_100187147 Ga0070669_1001871472 128
58 3300005356 Ga0070674_100086865 Ga0070674_1000868652 128
59 3300005364 Ga0070673_100642726 Ga0070673_1006427262 128
60 3300005456 Ga0070678_100119549 Ga0070678_1001195493 128
61 3300005459 Ga0068867_100002035 Ga0068867_10000203512 128
62 3300005466 Ga0070685_10697814 Ga0070685_106978142 128
63 3300005543 Ga0070672_100099437 Ga0070672_1000994373 128
64 3300005548 Ga0070665_100064471 Ga0070665_1000644714 128
65 3300005617 Ga0068859_100573868 Ga0068859_1005738681 128
66 3300005840 Ga0068870_10346497 Ga0068870_103464972 128
67 3300005841 Ga0068863_100365270 Ga0068863_1003652702 128
68 3300005842 Ga0068858_101050915 Ga0068858_1010509152 128
69 3300005843 Ga0068860_100554667 Ga0068860_1005546671 128
70 3300005844 Ga0068862_100012521 Ga0068862_1000125213 128
71 3300006358 Ga0068871_100023199 Ga0068871_1000231992 128
72 3300006931 Ga0097620_100573783 Ga0097620_1005737832 128
73 3300013100 Ga0157373_10471548 Ga0157373_104715482 128
74 3300013102 Ga0157371_10073976 Ga0157371_100739764 128
75 3300013104 Ga0157370_10577613 Ga0157370_105776134 128
76 3300013307 Ga0157372_10065325 Ga0157372_100653255 128
77 3300014969 Ga0157376_10717075 Ga0157376_107170752 128
78 3300025315 Ga0207697_10011008 Ga0207697_100110083 128
79 3300025903 Ga0207680_10630441 Ga0207680_106304411 128
80 3300025907 Ga0207645_10002319 Ga0207645_100023198 128
81 3300025908 Ga0207643_10072411 Ga0207643_100724112 128
82 3300025923 Ga0207681_10008022 Ga0207681_100080227 128
83 3300025937 Ga0207669_10018773 Ga0207669_100187733 128
84 3300025940 Ga0207691_10044757 Ga0207691_100447573 128
85 3300025941 Ga0207711_10029289 Ga0207711_100292892 128
86 3300025942 Ga0207689_10047729 Ga0207689_100477294 128
87 3300025960 Ga0207651_10426995 Ga0207651_104269952 128
88 3300025972 Ga0207668_10018267 Ga0207668_100182674 128
89 3300025986 Ga0207658_10027405 Ga0207658_100274052 128
90 3300026023 Ga0207677_10077416 Ga0207677_100774162 128
91 3300026088 Ga0207641_10170134 Ga0207641_101701342 128
92 3300026089 Ga0207648_10002458 Ga0207648_1000245816 128
93 3300026118 Ga0207675_100147162 Ga0207675_1001471622 128
94 3300026121 Ga0207683_10026610 Ga0207683_100266104 128
95 3300028379 Ga0268266_10045835 Ga0268266_100458352 128
96 3300028380 Ga0268265_10077818 Ga0268265_100778182 128
97 3300028381 Ga0268264_10106161 Ga0268264_101061612 128
98 3300037312 Ga0395899_0284882 Ga0395899_0284882_724_1110 128
99 3300044684 Ga0466966_0014830 Ga0466966_0014830_4055_4441 128
100 3300037312 Ga0395899_0013449 Ga0395899_0013449_718_1107 129
101 3300037418 Ga0395900_0056333 Ga0395900_0056333_1380_1769 129
102 3300037466 Ga0395898_0049745 Ga0395898_0049745_3311_3700 129
103 3300037471 Ga0395905_0021922 Ga0395905_0021922_4002_4391 129
104 3300038443 Ga0395901_0230144 Ga0395901_0230144_1445_1834 129
105 3300005617 Ga0068859_100048003 Ga0068859_1000480034 130
106 3300005841 Ga0068863_100037268 Ga0068863_1000372683 130
107 3300005843 Ga0068860_100028404 Ga0068860_1000284044 130
108 3300006931 Ga0097620_100048003 Ga0097620_1000480034 130
109 3300009177 Ga0105248_10149205 Ga0105248_101492052 130
110 3300025900 Ga0207710_10057212 Ga0207710_100572123 130
111 3300025941 Ga0207711_10171135 Ga0207711_101711352 130
112 3300026067 Ga0207678_10032194 Ga0207678_100321944 130
113 3300026088 Ga0207641_10067548 Ga0207641_100675483 130
114 3300028381 Ga0268264_10020803 Ga0268264_100208033 130
115 3300035691 Ga0373931_0784072 Ga0373931_0784072_218_610 130
116 3300037418 Ga0395900_0024613 Ga0395900_0024613_5003_5395 130
117 3300037466 Ga0395898_0919109 Ga0395898_0919109_228_620 130
118 3300037471 Ga0395905_0997386 Ga0395905_0997386_83_475 130
119 3300038443 Ga0395901_0320938 Ga0395901_0320938_460_852 130
120 3300005289 Ga0065704_10291073 Ga0065704_102910732 131
121 3300005347 Ga0070668_100573105 Ga0070668_1005731052 131
122 3300005353 Ga0070669_100038870 Ga0070669_1000388702 131
123 3300005434 Ga0070709_10044075 Ga0070709_100440752 131
124 3300005436 Ga0070713_100005100 Ga0070713_1000051003 131
125 3300005578 Ga0068854_101438166 Ga0068854_1014381662 131
126 3300005719 Ga0068861_100370429 Ga0068861_1003704291 131
127 3300005840 Ga0068870_10068941 Ga0068870_100689412 131
128 3300005843 Ga0068860_100295886 Ga0068860_1002958862 131
129 3300005844 Ga0068862_100034938 Ga0068862_1000349384 131
130 3300006028 Ga0070717_10320000 Ga0070717_103200001 131
131 3300006163 Ga0070715_10790453 Ga0070715_107904532 131
132 3300006173 Ga0070716_100114965 Ga0070716_1001149652 131
133 3300006175 Ga0070712_100055548 Ga0070712_1000555482 131
134 3300009148 Ga0105243_10012496 Ga0105243_100124962 131
135 3300009176 Ga0105242_11410618 Ga0105242_114106182 131
136 3300009553 Ga0105249_10651164 Ga0105249_106511642 131
137 3300013100 Ga0157373_10012135 Ga0157373_100121353 131
138 3300025901 Ga0207688_10265839 Ga0207688_102658392 131
139 3300025905 Ga0207685_10519340 Ga0207685_105193402 131
140 3300025906 Ga0207699_10008885 Ga0207699_100088853 131
141 3300025923 Ga0207681_10031395 Ga0207681_100313952 131
142 3300025935 Ga0207709_10705767 Ga0207709_107057672 131
143 3300025939 Ga0207665_10100078 Ga0207665_101000782 131
144 3300025961 Ga0207712_10510139 Ga0207712_105101392 131
145 3300025972 Ga0207668_10261158 Ga0207668_102611581 131
146 3300026118 Ga0207675_100036554 Ga0207675_1000365543 131
147 3300028380 Ga0268265_10092192 Ga0268265_100921922 131
148 3300036401 Ga0373937_1474027 Ga0373937_1474027_186_584 131
149 3300005564 Ga0070664_101786668 Ga0070664_1017866681 132
150 3300005616 Ga0068852_100909462 Ga0068852_1009094622 132
151 3300025904 Ga0207647_10038542 Ga0207647_100385422 132
152 3300025933 Ga0207706_10451867 Ga0207706_104518672 132
153 3300026142 Ga0207698_10606264 Ga0207698_106062642 132
154 3300037471 Ga0395905_0968691 Ga0395905_0968691_169_567 132
155 3300042439 Ga0439464_0000878 Ga0439464_0000878_4291_4722 132
156 3300049584 Ga0501068_0022903 Ga0501068_0022903_1226_1624 132
157 3300061734 Ga0530510_0235793 Ga0530510_0235793_649_1047 132
158 3300001979 JGI24740J21852_10053770 JGI24740J21852_100537702 133
159 3300005327 Ga0070658_10148654 Ga0070658_101486542 133
160 3300005336 Ga0070680_100002432 Ga0070680_1000024328 133
161 3300005339 Ga0070660_100029896 Ga0070660_1000298963 133
162 3300005344 Ga0070661_100142394 Ga0070661_1001423942 133
163 3300005530 Ga0070679_100144448 Ga0070679_1001444482 133
164 3300005563 Ga0068855_100048667 Ga0068855_1000486673 133
165 3300005614 Ga0068856_101075420 Ga0068856_1010754202 133
166 3300005616 Ga0068852_100016289 Ga0068852_1000162894 133
167 3300013104 Ga0157370_10086927 Ga0157370_100869272 133
168 3300025909 Ga0207705_10021914 Ga0207705_100219142 133
169 3300025912 Ga0207707_10423305 Ga0207707_104233051 133
170 3300025917 Ga0207660_10000059 Ga0207660_1000005949 133
171 3300025917 Ga0207660_10001202 Ga0207660_100012028 133
172 3300025919 Ga0207657_10036827 Ga0207657_100368272 133
173 3300025921 Ga0207652_10124163 Ga0207652_101241632 133
174 3300025925 Ga0207650_10019021 Ga0207650_100190213 133
175 3300025981 Ga0207640_10471741 Ga0207640_104717411 133
176 3300026078 Ga0207702_10698785 Ga0207702_106987852 133
177 3300026142 Ga0207698_10011695 Ga0207698_100116952 133
178 3300026142 Ga0207698_10093067 Ga0207698_100930672 133
179 3300031824 Ga0307413_10638425 Ga0307413_106384252 133
180 3300031903 Ga0307407_10149918 Ga0307407_101499183 133
181 3300031995 Ga0307409_100115233 Ga0307409_1001152332 133
182 3300032004 Ga0307414_10438030 Ga0307414_104380302 133
183 3300032005 Ga0307411_10037200 Ga0307411_100372002 133
184 3300037312 Ga0395899_0063573 Ga0395899_0063573_1269_1670 133
185 3300037418 Ga0395900_0013562 Ga0395900_0013562_4529_4930 133
186 3300037418 Ga0395900_0069852 Ga0395900_0069852_1641_2042 133
187 3300037466 Ga0395898_0281130 Ga0395898_0281130_135_536 133
188 3300037466 Ga0395898_1290038 Ga0395898_1290038_215_616 133
189 3300037471 Ga0395905_0039456 Ga0395905_0039456_1922_2323 133
190 3300037471 Ga0395905_0200174 Ga0395905_0200174_88_489 133
191 3300038443 Ga0395901_0071571 Ga0395901_0071571_1641_2042 133
192 3300038443 Ga0395901_0188653 Ga0395901_0188653_1590_1991 133
193 3300045976 Ga0466967_0476505 Ga0466967_0476505_290_691 133
194 3300001979 JGI24740J21852_10021801 JGI24740J21852_100218012 134
195 3300001979 JGI24740J21852_10104779 JGI24740J21852_101047791 134
196 3300001989 JGI24739J22299_10088317 JGI24739J22299_100883172 134
197 3300001990 JGI24737J22298_10014199 JGI24737J22298_100141992 134
198 3300002067 JGI24735J21928_10002140 JGI24735J21928_100021405 134
199 3300002067 JGI24735J21928_10014828 JGI24735J21928_100148282 134
200 3300005327 Ga0070658_10007529 Ga0070658_100075293 134
201 3300005327 Ga0070658_10025349 Ga0070658_100253492 134
202 3300005327 Ga0070658_10182464 Ga0070658_101824641 134
203 3300005327 Ga0070658_10273336 Ga0070658_102733361 134
204 3300005329 Ga0070683_100019017 Ga0070683_1000190174 134
205 3300005329 Ga0070683_100172414 Ga0070683_1001724142 134
206 3300005329 Ga0070683_100392138 Ga0070683_1003921382 134
207 3300005329 Ga0070683_100675957 Ga0070683_1006759571 134
208 3300005336 Ga0070680_100005513 Ga0070680_10000551311 134
209 3300005336 Ga0070680_100053617 Ga0070680_1000536172 134
210 3300005336 Ga0070680_100131326 Ga0070680_1001313262 134
211 3300005336 Ga0070680_100509936 Ga0070680_1005099362 134
212 3300005336 Ga0070680_100604808 Ga0070680_1006048081 134
213 3300005336 Ga0070680_100607577 Ga0070680_1006075772 134
214 3300005337 Ga0070682_100041566 Ga0070682_1000415663 134
215 3300005339 Ga0070660_100019741 Ga0070660_1000197412 134
216 3300005339 Ga0070660_100153297 Ga0070660_1001532972 134
217 3300005339 Ga0070660_100166992 Ga0070660_1001669922 134
218 3300005339 Ga0070660_100212323 Ga0070660_1002123232 134
219 3300005339 Ga0070660_100785943 Ga0070660_1007859432 134
220 3300005339 Ga0070660_100787198 Ga0070660_1007871981 134
221 3300005341 Ga0070691_10325031 Ga0070691_103250311 134
222 3300005344 Ga0070661_100057631 Ga0070661_1000576312 134
223 3300005344 Ga0070661_100213325 Ga0070661_1002133252 134
224 3300005345 Ga0070692_10031841 Ga0070692_100318412 134
225 3300005345 Ga0070692_10120867 Ga0070692_101208672 134
226 3300005345 Ga0070692_10778940 Ga0070692_107789401 134
227 3300005366 Ga0070659_100012039 Ga0070659_1000120391 134
228 3300005366 Ga0070659_100024629 Ga0070659_1000246295 134
229 3300005366 Ga0070659_100125313 Ga0070659_1001253132 134
230 3300005366 Ga0070659_100349682 Ga0070659_1003496822 134
231 3300005366 Ga0070659_100495578 Ga0070659_1004955782 134
232 3300005435 Ga0070714_100120567 Ga0070714_1001205672 134
233 3300005436 Ga0070713_100388894 Ga0070713_1003888942 134
234 3300005455 Ga0070663_100571243 Ga0070663_1005712432 134
235 3300005457 Ga0070662_100871747 Ga0070662_1008717472 134
236 3300005458 Ga0070681_10080063 Ga0070681_100800633 134
237 3300005467 Ga0070706_100254739 Ga0070706_1002547392 134
238 3300005530 Ga0070679_100077172 Ga0070679_1000771722 134
239 3300005530 Ga0070679_100088147 Ga0070679_1000881472 134
240 3300005530 Ga0070679_100362113 Ga0070679_1003621132 134
241 3300005530 Ga0070679_100433735 Ga0070679_1004337352 134
242 3300005530 Ga0070679_100829557 Ga0070679_1008295572 134
243 3300005535 Ga0070684_100101991 Ga0070684_1001019912 134
244 3300005535 Ga0070684_100152215 Ga0070684_1001522152 134
245 3300005535 Ga0070684_100210151 Ga0070684_1002101511 134
246 3300005539 Ga0068853_100010905 Ga0068853_1000109058 134
247 3300005539 Ga0068853_100079727 Ga0068853_1000797273 134
248 3300005539 Ga0068853_100144427 Ga0068853_1001444272 134
249 3300005539 Ga0068853_100147081 Ga0068853_1001470813 134
250 3300005539 Ga0068853_100175357 Ga0068853_1001753572 134
251 3300005539 Ga0068853_101495863 Ga0068853_1014958631 134
252 3300005546 Ga0070696_100017065 Ga0070696_1000170652 134
253 3300005547 Ga0070693_100073186 Ga0070693_1000731863 134
254 3300005547 Ga0070693_100521509 Ga0070693_1005215092 134
255 3300005563 Ga0068855_100050120 Ga0068855_1000501204 134
256 3300005563 Ga0068855_100111070 Ga0068855_1001110702 134
257 3300005563 Ga0068855_100208992 Ga0068855_1002089922 134
258 3300005563 Ga0068855_100267980 Ga0068855_1002679802 134
259 3300005563 Ga0068855_101095760 Ga0068855_1010957602 134
260 3300005564 Ga0070664_101170914 Ga0070664_1011709141 134
261 3300005577 Ga0068857_100019007 Ga0068857_1000190072 134
262 3300005577 Ga0068857_100062570 Ga0068857_1000625702 134
263 3300005578 Ga0068854_100031274 Ga0068854_1000312742 134
264 3300005578 Ga0068854_100092871 Ga0068854_1000928712 134
265 3300005578 Ga0068854_100187654 Ga0068854_1001876542 134
266 3300005578 Ga0068854_100212190 Ga0068854_1002121902 134
267 3300005578 Ga0068854_101662933 Ga0068854_1016629331 134
268 3300005614 Ga0068856_100051981 Ga0068856_1000519814 134
269 3300005614 Ga0068856_100144207 Ga0068856_1001442072 134
270 3300005614 Ga0068856_100629053 Ga0068856_1006290532 134
271 3300005614 Ga0068856_100848773 Ga0068856_1008487732 134
272 3300005614 Ga0068856_101339043 Ga0068856_1013390431 134
273 3300005614 Ga0068856_101928691 Ga0068856_1019286912 134
274 3300005616 Ga0068852_100001069 Ga0068852_1000010697 134
275 3300005616 Ga0068852_100076960 Ga0068852_1000769603 134
276 3300005616 Ga0068852_100098987 Ga0068852_1000989872 134
277 3300005616 Ga0068852_100172565 Ga0068852_1001725652 134
278 3300005616 Ga0068852_100187189 Ga0068852_1001871892 134
279 3300005616 Ga0068852_100403049 Ga0068852_1004030492 134
280 3300005616 Ga0068852_100571183 Ga0068852_1005711832 134
281 3300005834 Ga0068851_10030743 Ga0068851_100307432 134
282 3300005834 Ga0068851_10197961 Ga0068851_101979612 134
283 3300005844 Ga0068862_100880869 Ga0068862_1008808692 134
284 3300006880 Ga0075429_100952659 Ga0075429_1009526592 134
285 3300009093 Ga0105240_10056083 Ga0105240_100560832 134
286 3300009093 Ga0105240_10224311 Ga0105240_102243112 134
287 3300009094 Ga0111539_13473188 Ga0111539_134731881 134
288 3300009147 Ga0114129_10672017 Ga0114129_106720172 134
289 3300009545 Ga0105237_10029154 Ga0105237_100291545 134
290 3300009551 Ga0105238_10016800 Ga0105238_100168002 134
291 3300009551 Ga0105238_10070567 Ga0105238_100705672 134
292 3300009551 Ga0105238_10324055 Ga0105238_103240552 134
293 3300009551 Ga0105238_10556030 Ga0105238_105560302 134
294 3300010375 Ga0105239_10083657 Ga0105239_100836573 134
295 3300013100 Ga0157373_10012753 Ga0157373_100127532 134
296 3300013100 Ga0157373_10068364 Ga0157373_100683642 134
297 3300013100 Ga0157373_10137199 Ga0157373_101371992 134
298 3300013100 Ga0157373_10158947 Ga0157373_101589472 134
299 3300013100 Ga0157373_11240516 Ga0157373_112405161 134
300 3300013102 Ga0157371_10015031 Ga0157371_100150315 134
301 3300013102 Ga0157371_10020854 Ga0157371_100208545 134
302 3300013102 Ga0157371_10060879 Ga0157371_100608792 134
303 3300013102 Ga0157371_10094710 Ga0157371_100947102 134
304 3300013102 Ga0157371_10119389 Ga0157371_101193892 134
305 3300013102 Ga0157371_10163424 Ga0157371_101634242 134
306 3300013102 Ga0157371_10279714 Ga0157371_102797142 134
307 3300013104 Ga0157370_10048284 Ga0157370_100482842 134
308 3300013104 Ga0157370_10048564 Ga0157370_100485643 134
309 3300013104 Ga0157370_10065056 Ga0157370_100650562 134
310 3300013104 Ga0157370_10089261 Ga0157370_100892614 134
311 3300013104 Ga0157370_10139727 Ga0157370_101397272 134
312 3300013105 Ga0157369_10007383 Ga0157369_1000738311 134
313 3300013105 Ga0157369_10031051 Ga0157369_100310513 134
314 3300013105 Ga0157369_10067972 Ga0157369_100679722 134
315 3300013105 Ga0157369_10125164 Ga0157369_101251643 134
316 3300013105 Ga0157369_10132459 Ga0157369_101324592 134
317 3300013105 Ga0157369_10135588 Ga0157369_101355882 134
318 3300013105 Ga0157369_10213157 Ga0157369_102131572 134
319 3300013105 Ga0157369_10472729 Ga0157369_104727292 134
320 3300013105 Ga0157369_10610836 Ga0157369_106108362 134
321 3300013105 Ga0157369_12073942 Ga0157369_120739422 134
322 3300013105 Ga0157369_12556255 Ga0157369_125562551 134
323 3300013307 Ga0157372_10008752 Ga0157372_100087522 134
324 3300013307 Ga0157372_10185390 Ga0157372_101853902 134
325 3300013307 Ga0157372_11740037 Ga0157372_117400372 134
326 3300020081 Ga0206354_11586023 Ga0206354_115860231 134
327 3300020082 Ga0206353_10738842 Ga0206353_107388421 134
328 3300025321 Ga0207656_10275334 Ga0207656_102753342 134
329 3300025321 Ga0207656_10331235 Ga0207656_103312352 134
330 3300025904 Ga0207647_10019866 Ga0207647_100198662 134
331 3300025904 Ga0207647_10073031 Ga0207647_100730312 134
332 3300025909 Ga0207705_10033619 Ga0207705_100336195 134
333 3300025909 Ga0207705_10080315 Ga0207705_100803152 134
334 3300025909 Ga0207705_10166359 Ga0207705_101663592 134
335 3300025909 Ga0207705_10482361 Ga0207705_104823612 134
336 3300025910 Ga0207684_10159692 Ga0207684_101596922 134
337 3300025912 Ga0207707_10051960 Ga0207707_100519603 134
338 3300025912 Ga0207707_10129047 Ga0207707_101290472 134
339 3300025912 Ga0207707_10172177 Ga0207707_101721772 134
340 3300025913 Ga0207695_10039931 Ga0207695_100399315 134
341 3300025913 Ga0207695_10115246 Ga0207695_101152462 134
342 3300025914 Ga0207671_10489321 Ga0207671_104893212 134
343 3300025917 Ga0207660_10009838 Ga0207660_100098382 134
344 3300025917 Ga0207660_10078092 Ga0207660_100780922 134
345 3300025917 Ga0207660_10537099 Ga0207660_105370992 134
346 3300025919 Ga0207657_10012830 Ga0207657_100128305 134
347 3300025919 Ga0207657_10031052 Ga0207657_100310523 134
348 3300025919 Ga0207657_10093145 Ga0207657_100931452 134
349 3300025919 Ga0207657_10725073 Ga0207657_107250731 134
350 3300025919 Ga0207657_10736022 Ga0207657_107360221 134
351 3300025919 Ga0207657_11313120 Ga0207657_113131201 134
352 3300025920 Ga0207649_10044044 Ga0207649_100440442 134
353 3300025920 Ga0207649_10125061 Ga0207649_101250612 134
354 3300025920 Ga0207649_10343523 Ga0207649_103435232 134
355 3300025921 Ga0207652_10018990 Ga0207652_100189905 134
356 3300025921 Ga0207652_10706897 Ga0207652_107068972 134
357 3300025921 Ga0207652_11193810 Ga0207652_111938102 134
358 3300025924 Ga0207694_10000966 Ga0207694_1000096614 134
359 3300025924 Ga0207694_10594715 Ga0207694_105947152 134
360 3300025924 Ga0207694_11594506 Ga0207694_115945061 134
361 3300025929 Ga0207664_10013598 Ga0207664_100135984 134
362 3300025929 Ga0207664_10609540 Ga0207664_106095402 134
363 3300025932 Ga0207690_10002953 Ga0207690_100029538 134
364 3300025932 Ga0207690_10088152 Ga0207690_100881522 134
365 3300025932 Ga0207690_10125542 Ga0207690_101255422 134
366 3300025932 Ga0207690_10447098 Ga0207690_104470982 134
367 3300025932 Ga0207690_10472911 Ga0207690_104729112 134
368 3300025933 Ga0207706_10037307 Ga0207706_100373072 134
369 3300025944 Ga0207661_10071102 Ga0207661_100711022 134
370 3300025944 Ga0207661_10085121 Ga0207661_100851212 134
371 3300025944 Ga0207661_10231631 Ga0207661_102316312 134
372 3300025945 Ga0207679_11253184 Ga0207679_112531842 134
373 3300025949 Ga0207667_10005262 Ga0207667_1000526214 134
374 3300025949 Ga0207667_10029624 Ga0207667_100296244 134
375 3300025949 Ga0207667_10040206 Ga0207667_100402063 134
376 3300025949 Ga0207667_10098120 Ga0207667_100981202 134
377 3300025949 Ga0207667_10338450 Ga0207667_103384502 134
378 3300025949 Ga0207667_11101816 Ga0207667_111018162 134
379 3300025981 Ga0207640_10062397 Ga0207640_100623973 134
380 3300025981 Ga0207640_10067242 Ga0207640_100672423 134
381 3300025981 Ga0207640_10100206 Ga0207640_101002062 134
382 3300025981 Ga0207640_10264000 Ga0207640_102640002 134
383 3300026023 Ga0207677_10982498 Ga0207677_109824982 134
384 3300026041 Ga0207639_10000744 Ga0207639_1000074417 134
385 3300026041 Ga0207639_10154043 Ga0207639_101540432 134
386 3300026041 Ga0207639_10276366 Ga0207639_102763662 134
387 3300026041 Ga0207639_11020424 Ga0207639_110204241 134
388 3300026067 Ga0207678_10008634 Ga0207678_100086345 134
389 3300026067 Ga0207678_10058363 Ga0207678_100583633 134
390 3300026078 Ga0207702_10150028 Ga0207702_101500282 134
391 3300026078 Ga0207702_10153445 Ga0207702_101534452 134
392 3300026078 Ga0207702_10204038 Ga0207702_102040382 134
393 3300026078 Ga0207702_10271492 Ga0207702_102714922 134
394 3300026078 Ga0207702_10501619 Ga0207702_105016192 134
395 3300026116 Ga0207674_10002824 Ga0207674_1000282421 134
396 3300026116 Ga0207674_10003445 Ga0207674_1000344513 134
397 3300026116 Ga0207674_10014766 Ga0207674_100147665 134
398 3300026116 Ga0207674_10434534 Ga0207674_104345342 134
399 3300026142 Ga0207698_10003907 Ga0207698_1000390710 134
400 3300026142 Ga0207698_10011411 Ga0207698_100114113 134
401 3300026142 Ga0207698_10036738 Ga0207698_100367382 134
402 3300026142 Ga0207698_10079985 Ga0207698_100799852 134
403 3300026142 Ga0207698_10223892 Ga0207698_102238922 134
404 3300026142 Ga0207698_10683636 Ga0207698_106836362 134
405 3300031995 Ga0307409_102729320 Ga0307409_1027293201 134
406 3300037312 Ga0395899_0000113 Ga0395899_0000113_84667_85077 134
407 3300037312 Ga0395899_0006469 Ga0395899_0006469_7863_8306 134
408 3300037312 Ga0395899_0019176 Ga0395899_0019176_1181_1585 134
409 3300037312 Ga0395899_0020590 Ga0395899_0020590_4409_4816 134
410 3300037312 Ga0395899_0060907 Ga0395899_0060907_744_1154 134
411 3300037312 Ga0395899_0066680 Ga0395899_0066680_2179_2583 134
412 3300037312 Ga0395899_0100246 Ga0395899_0100246_601_1005 134
413 3300037312 Ga0395899_0106552 Ga0395899_0106552_72_476 134
414 3300037312 Ga0395899_0959713 Ga0395899_0959713_76_480 134
415 3300037418 Ga0395900_0000365 Ga0395900_0000365_62549_62959 134
416 3300037418 Ga0395900_0000964 Ga0395900_0000964_25686_26090 134
417 3300037418 Ga0395900_0008087 Ga0395900_0008087_6390_6797 134
418 3300037418 Ga0395900_0011278 Ga0395900_0011278_2811_3221 134
419 3300037418 Ga0395900_0023762 Ga0395900_0023762_3742_4146 134
420 3300037418 Ga0395900_0086813 Ga0395900_0086813_1988_2431 134
421 3300037418 Ga0395900_0093890 Ga0395900_0093890_2179_2583 134
422 3300037418 Ga0395900_0252090 Ga0395900_0252090_1237_1641 134
423 3300037418 Ga0395900_0353100 Ga0395900_0353100_1007_1411 134
424 3300037418 Ga0395900_0513194 Ga0395900_0513194_30_434 134
425 3300037418 Ga0395900_0692766 Ga0395900_0692766_123_527 134
426 3300037418 Ga0395900_1335932 Ga0395900_1335932_182_586 134
427 3300037418 Ga0395900_1458714 Ga0395900_1458714_148_552 134
428 3300037466 Ga0395898_0000306 Ga0395898_0000306_30864_31274 134
429 3300037466 Ga0395898_0008363 Ga0395898_0008363_5123_5533 134
430 3300037466 Ga0395898_0022122 Ga0395898_0022122_1070_1513 134
431 3300037466 Ga0395898_0088936 Ga0395898_0088936_1220_1624 134
432 3300037466 Ga0395898_0256801 Ga0395898_0256801_941_1345 134
433 3300037466 Ga0395898_0476492 Ga0395898_0476492_185_589 134
434 3300037466 Ga0395898_0746893 Ga0395898_0746893_160_564 134
435 3300037466 Ga0395898_1292840 Ga0395898_1292840_15_419 134
436 3300037471 Ga0395905_0000005 Ga0395905_0000005_275825_276235 134
437 3300037471 Ga0395905_0009966 Ga0395905_0009966_2305_2748 134
438 3300037471 Ga0395905_0016924 Ga0395905_0016924_1131_1541 134
439 3300037471 Ga0395905_0026426 Ga0395905_0026426_4052_4459 134
440 3300037471 Ga0395905_0032743 Ga0395905_0032743_3877_4281 134
441 3300037471 Ga0395905_0088779 Ga0395905_0088779_2042_2446 134
442 3300037471 Ga0395905_0231601 Ga0395905_0231601_898_1302 134
443 3300037471 Ga0395905_0399924 Ga0395905_0399924_178_582 134
444 3300037471 Ga0395905_1618297 Ga0395905_1618297_118_528 134
445 3300037471 Ga0395905_1786056 Ga0395905_1786056_57_461 134
446 3300038443 Ga0395901_0000248 Ga0395901_0000248_21028_21432 134
447 3300038443 Ga0395901_0001201 Ga0395901_0001201_440_850 134
448 3300038443 Ga0395901_0005488 Ga0395901_0005488_5722_6165 134
449 3300038443 Ga0395901_0033619 Ga0395901_0033619_676_1080 134
450 3300038443 Ga0395901_0053500 Ga0395901_0053500_3133_3540 134
451 3300038443 Ga0395901_0112322 Ga0395901_0112322_1405_1809 134
452 3300038443 Ga0395901_0232464 Ga0395901_0232464_1103_1513 134
453 3300038443 Ga0395901_0266208 Ga0395901_0266208_889_1293 134
454 3300038443 Ga0395901_0368635 Ga0395901_0368635_979_1383 134
455 3300038443 Ga0395901_0963436 Ga0395901_0963436_401_805 134
456 3300038443 Ga0395901_1348648 Ga0395901_1348648_109_513 134
457 3300038443 Ga0395901_1585893 Ga0395901_1585893_156_560 134
458 3300042142 Ga0450905_000308 Ga0450905_000308_2946_3371 134
459 3300042144 Ga0450889_000193 Ga0450889_000193_6071_6496 134
460 3300042530 Ga0450916_011021 Ga0450916_011021_720_1127 134
461 3300044656 Ga0466969_0236065 Ga0466969_0236065_290_694 134
462 3300044658 Ga0466972_0013931 Ga0466972_0013931_1543_1947 134
463 3300044684 Ga0466966_0206842 Ga0466966_0206842_375_779 134
464 3300044684 Ga0466966_0379329 Ga0466966_0379329_121_525 134
465 3300044693 Ga0466961_0019333 Ga0466961_0019333_3742_4146 134
466 3300044693 Ga0466961_0071576 Ga0466961_0071576_886_1290 134
467 3300044694 Ga0466963_0011010 Ga0466963_0011010_288_731 134
468 3300044694 Ga0466963_0026975 Ga0466963_0026975_1925_2329 134
469 3300044694 Ga0466963_0073469 Ga0466963_0073469_249_653 134
470 3300044694 Ga0466963_0106910 Ga0466963_0106910_488_892 134
471 3300044694 Ga0466963_0109725 Ga0466963_0109725_818_1222 134
472 3300044694 Ga0466963_0312157 Ga0466963_0312157_95_499 134
473 3300044694 Ga0466963_1223523 Ga0466963_1223523_42_446 134
474 3300044842 Ga0466957_0010341 Ga0466957_0010341_3825_4229 134
475 3300044842 Ga0466957_0086722 Ga0466957_0086722_89_493 134
476 3300044842 Ga0466957_0388337 Ga0466957_0388337_214_618 134
477 3300044901 Ga0466960_0024453 Ga0466960_0024453_454_858 134
478 3300045049 Ga0466959_0015101 Ga0466959_0015101_3387_3791 134
479 3300045836 Ga0466958_0004622 Ga0466958_0004622_5096_5500 134
480 3300045836 Ga0466958_0160209 Ga0466958_0160209_624_1028 134
481 3300045976 Ga0466967_0031731 Ga0466967_0031731_3590_3994 134
482 3300045976 Ga0466967_0077920 Ga0466967_0077920_42_446 134
483 3300045976 Ga0466967_0107463 Ga0466967_0107463_1604_2047 134
484 3300045976 Ga0466967_0142167 Ga0466967_0142167_1030_1473 134
485 3300045976 Ga0466967_0142274 Ga0466967_0142274_1383_1823 134
486 3300045976 Ga0466967_0160602 Ga0466967_0160602_1025_1429 134
487 3300045976 Ga0466967_0182596 Ga0466967_0182596_678_1082 134
488 3300045976 Ga0466967_0418201 Ga0466967_0418201_756_1160 134
489 3300045976 Ga0466967_0824391 Ga0466967_0824391_238_642 134
490 3300045976 Ga0466967_0857472 Ga0466967_0857472_97_501 134
491 3300048912 Ga0496109_1069929 Ga0496109_1069929_139_549 134
492 3300048913 Ga0496110_0058166 Ga0496110_0058166_2383_2793 134
493 3300048914 Ga0496111_0183123 Ga0496111_0183123_840_1250 134
494 3300048915 Ga0496112_0005549 Ga0496112_0005549_2788_3198 134
495 3300048916 Ga0496113_0007460 Ga0496113_0007460_6153_6563 134
496 3300049581 Ga0501047_0775060 Ga0501047_0775060_347_751 134
497 3300049584 Ga0501068_0091248 Ga0501068_0091248_479_883 134
498 3300049741 Ga0501079_0600648 Ga0501079_0600648_381_785 134
499 3300049742 Ga0501080_0041798 Ga0501080_0041798_832_1236 134
500 3300049823 Ga0501044_0805947 Ga0501044_0805947_121_525 134
501 3300050507 nmdc:mga05p37_867572_c1 nmdc:mga05p37_867572_c1_384_791 134
502 3300050508 nmdc:mga09592_133478_c1 nmdc:mga09592_133478_c1_1629_2036 134
503 3300061719 Ga0466962_0007173 Ga0466962_0007173_3227_3631 134
504 3300061719 Ga0466962_0424683 Ga0466962_0424683_141_545 134
505 3300001976 JGI24752J21851_1033251 JGI24752J21851_10332512 135
506 3300001978 JGI24747J21853_1003908 JGI24747J21853_10039082 135
507 3300001979 JGI24740J21852_10067802 JGI24740J21852_100678022 135
508 3300001989 JGI24739J22299_10012780 JGI24739J22299_100127802 135
509 3300001990 JGI24737J22298_10016841 JGI24737J22298_100168412 135
510 3300001991 JGI24743J22301_10003394 JGI24743J22301_100033944 135
511 3300002073 JGI24745J21846_1009482 JGI24745J21846_10094822 135
512 3300002075 JGI24738J21930_10007344 JGI24738J21930_100073442 135
513 3300002075 JGI24738J21930_10044252 JGI24738J21930_100442521 135
514 3300002077 JGI24744J21845_10000055 JGI24744J21845_100000556 135
515 3300002077 JGI24744J21845_10089105 JGI24744J21845_100891052 135
516 3300002244 JGI24742J22300_10010994 JGI24742J22300_100109942 135
517 3300005293 Ga0065715_10330324 Ga0065715_103303242 135
518 3300005327 Ga0070658_10019242 Ga0070658_100192422 135
519 3300005327 Ga0070658_10959533 Ga0070658_109595331 135
520 3300005328 Ga0070676_10145470 Ga0070676_101454702 135
521 3300005328 Ga0070676_10278123 Ga0070676_102781232 135
522 3300005330 Ga0070690_100462654 Ga0070690_1004626542 135
523 3300005331 Ga0070670_100736880 Ga0070670_1007368802 135
524 3300005333 Ga0070677_10009387 Ga0070677_100093873 135
525 3300005334 Ga0068869_100196342 Ga0068869_1001963422 135
526 3300005335 Ga0070666_10009331 Ga0070666_100093314 135
527 3300005335 Ga0070666_10021579 Ga0070666_100215792 135
528 3300005337 Ga0070682_100843571 Ga0070682_1008435711 135
529 3300005338 Ga0068868_100085855 Ga0068868_1000858554 135
530 3300005338 Ga0068868_100186385 Ga0068868_1001863853 135
531 3300005338 Ga0068868_100539636 Ga0068868_1005396362 135
532 3300005338 Ga0068868_100712910 Ga0068868_1007129102 135
533 3300005339 Ga0070660_100037460 Ga0070660_1000374603 135
534 3300005339 Ga0070660_100127129 Ga0070660_1001271292 135
535 3300005339 Ga0070660_100226243 Ga0070660_1002262432 135
536 3300005343 Ga0070687_100038691 Ga0070687_1000386912 135
537 3300005343 Ga0070687_100383776 Ga0070687_1003837761 135
538 3300005344 Ga0070661_100075836 Ga0070661_1000758362 135
539 3300005344 Ga0070661_100151892 Ga0070661_1001518922 135
540 3300005344 Ga0070661_100379166 Ga0070661_1003791662 135
541 3300005347 Ga0070668_100053802 Ga0070668_1000538024 135
542 3300005347 Ga0070668_100544430 Ga0070668_1005444301 135
543 3300005353 Ga0070669_100274046 Ga0070669_1002740462 135
544 3300005353 Ga0070669_100701360 Ga0070669_1007013601 135
545 3300005354 Ga0070675_100022320 Ga0070675_1000223203 135
546 3300005354 Ga0070675_100159534 Ga0070675_1001595342 135
547 3300005354 Ga0070675_100608643 Ga0070675_1006086431 135
548 3300005355 Ga0070671_100036337 Ga0070671_1000363374 135
549 3300005355 Ga0070671_100203211 Ga0070671_1002032113 135
550 3300005356 Ga0070674_100109065 Ga0070674_1001090652 135
551 3300005356 Ga0070674_100829203 Ga0070674_1008292032 135
552 3300005356 Ga0070674_102206463 Ga0070674_1022064631 135
553 3300005364 Ga0070673_100011901 Ga0070673_1000119015 135
554 3300005364 Ga0070673_100112245 Ga0070673_1001122452 135
555 3300005364 Ga0070673_100379226 Ga0070673_1003792261 135
556 3300005364 Ga0070673_100516919 Ga0070673_1005169192 135
557 3300005364 Ga0070673_101356516 Ga0070673_1013565162 135
558 3300005366 Ga0070659_100174550 Ga0070659_1001745502 135
559 3300005366 Ga0070659_100197328 Ga0070659_1001973282 135
560 3300005366 Ga0070659_100403163 Ga0070659_1004031632 135
561 3300005367 Ga0070667_100018568 Ga0070667_1000185683 135
562 3300005367 Ga0070667_100081208 Ga0070667_1000812082 135
563 3300005367 Ga0070667_100240698 Ga0070667_1002406982 135
564 3300005435 Ga0070714_100326088 Ga0070714_1003260882 135
565 3300005436 Ga0070713_100165898 Ga0070713_1001658982 135
566 3300005455 Ga0070663_100065855 Ga0070663_1000658553 135
567 3300005455 Ga0070663_100509490 Ga0070663_1005094902 135
568 3300005456 Ga0070678_100004224 Ga0070678_1000042246 135
569 3300005456 Ga0070678_100009114 Ga0070678_1000091143 135
570 3300005456 Ga0070678_100063425 Ga0070678_1000634252 135
571 3300005457 Ga0070662_100005197 Ga0070662_1000051973 135
572 3300005457 Ga0070662_100018155 Ga0070662_1000181554 135
573 3300005457 Ga0070662_100072350 Ga0070662_1000723502 135
574 3300005457 Ga0070662_100318324 Ga0070662_1003183241 135
575 3300005457 Ga0070662_100497510 Ga0070662_1004975102 135
576 3300005458 Ga0070681_10284714 Ga0070681_102847142 135
577 3300005458 Ga0070681_10296169 Ga0070681_102961692 135
578 3300005459 Ga0068867_100020963 Ga0068867_1000209632 135
579 3300005466 Ga0070685_10278927 Ga0070685_102789272 135
580 3300005530 Ga0070679_100370709 Ga0070679_1003707092 135
581 3300005539 Ga0068853_100099466 Ga0068853_1000994662 135
582 3300005543 Ga0070672_100016213 Ga0070672_1000162132 135
583 3300005543 Ga0070672_100448923 Ga0070672_1004489232 135
584 3300005544 Ga0070686_100036653 Ga0070686_1000366532 135
585 3300005547 Ga0070693_100040100 Ga0070693_1000401003 135
586 3300005548 Ga0070665_100006320 Ga0070665_10000632010 135
587 3300005548 Ga0070665_100053630 Ga0070665_1000536302 135
588 3300005563 Ga0068855_100207682 Ga0068855_1002076823 135
589 3300005563 Ga0068855_100243286 Ga0068855_1002432862 135
590 3300005564 Ga0070664_100021210 Ga0070664_1000212102 135
591 3300005564 Ga0070664_100105909 Ga0070664_1001059092 135
592 3300005564 Ga0070664_100114810 Ga0070664_1001148102 135
593 3300005564 Ga0070664_100203269 Ga0070664_1002032692 135
594 3300005564 Ga0070664_100441537 Ga0070664_1004415372 135
595 3300005577 Ga0068857_100482680 Ga0068857_1004826801 135
596 3300005577 Ga0068857_101037990 Ga0068857_1010379902 135
597 3300005578 Ga0068854_100154935 Ga0068854_1001549351 135
598 3300005578 Ga0068854_100508400 Ga0068854_1005084002 135
599 3300005614 Ga0068856_100098357 Ga0068856_1000983572 135
600 3300005614 Ga0068856_100172945 Ga0068856_1001729452 135
601 3300005614 Ga0068856_101346078 Ga0068856_1013460782 135
602 3300005615 Ga0070702_100975996 Ga0070702_1009759961 135
603 3300005616 Ga0068852_100021969 Ga0068852_1000219695 135
604 3300005616 Ga0068852_100189039 Ga0068852_1001890392 135
605 3300005617 Ga0068859_100028161 Ga0068859_1000281613 135
606 3300005618 Ga0068864_100155118 Ga0068864_1001551183 135
607 3300005618 Ga0068864_100197960 Ga0068864_1001979602 135
608 3300005618 Ga0068864_100486578 Ga0068864_1004865782 135
609 3300005718 Ga0068866_10048109 Ga0068866_100481092 135
610 3300005718 Ga0068866_10050117 Ga0068866_100501173 135
611 3300005719 Ga0068861_100211480 Ga0068861_1002114802 135
612 3300005834 Ga0068851_10008929 Ga0068851_100089295 135
613 3300005834 Ga0068851_10039813 Ga0068851_100398132 135
614 3300005840 Ga0068870_10283983 Ga0068870_102839832 135
615 3300005841 Ga0068863_100005699 Ga0068863_1000056993 135
616 3300005841 Ga0068863_100916996 Ga0068863_1009169961 135
617 3300005842 Ga0068858_100164300 Ga0068858_1001643003 135
618 3300005842 Ga0068858_100232956 Ga0068858_1002329562 135
619 3300005843 Ga0068860_100192759 Ga0068860_1001927593 135
620 3300006237 Ga0097621_100013004 Ga0097621_1000130043 135
621 3300006237 Ga0097621_100362425 Ga0097621_1003624252 135
622 3300006358 Ga0068871_100013255 Ga0068871_1000132555 135
623 3300006881 Ga0068865_100364330 Ga0068865_1003643302 135
624 3300006931 Ga0097620_100028158 Ga0097620_1000281583 135
625 3300009093 Ga0105240_10211090 Ga0105240_102110902 135
626 3300009098 Ga0105245_10037973 Ga0105245_100379734 135
627 3300009098 Ga0105245_10065426 Ga0105245_100654263 135
628 3300009148 Ga0105243_10064552 Ga0105243_100645522 135
629 3300009148 Ga0105243_10210720 Ga0105243_102107203 135
630 3300009174 Ga0105241_10154098 Ga0105241_101540983 135
631 3300009174 Ga0105241_10349370 Ga0105241_103493702 135
632 3300009174 Ga0105241_11204122 Ga0105241_112041221 135
633 3300009176 Ga0105242_10054494 Ga0105242_100544942 135
634 3300009176 Ga0105242_10324709 Ga0105242_103247092 135
635 3300009177 Ga0105248_10085838 Ga0105248_100858384 135
636 3300009177 Ga0105248_10589610 Ga0105248_105896102 135
637 3300009177 Ga0105248_11494295 Ga0105248_114942952 135
638 3300009551 Ga0105238_10457204 Ga0105238_104572043 135
639 3300009551 Ga0105238_10658903 Ga0105238_106589032 135
640 3300009551 Ga0105238_11398598 Ga0105238_113985982 135
641 3300009553 Ga0105249_12503674 Ga0105249_125036742 135
642 3300010375 Ga0105239_10081790 Ga0105239_100817903 135
643 3300010375 Ga0105239_11762993 Ga0105239_117629932 135
644 3300011119 Ga0105246_10053188 Ga0105246_100531882 135
645 3300013100 Ga0157373_10083663 Ga0157373_100836632 135
646 3300013100 Ga0157373_10256689 Ga0157373_102566892 135
647 3300013100 Ga0157373_11515958 Ga0157373_115159581 135
648 3300013102 Ga0157371_10038044 Ga0157371_100380442 135
649 3300013102 Ga0157371_10065257 Ga0157371_100652572 135
650 3300013105 Ga0157369_10208604 Ga0157369_102086041 135
651 3300013105 Ga0157369_10649490 Ga0157369_106494902 135
652 3300013296 Ga0157374_10050975 Ga0157374_100509753 135
653 3300013296 Ga0157374_10079406 Ga0157374_100794062 135
654 3300013296 Ga0157374_10464772 Ga0157374_104647722 135
655 3300013296 Ga0157374_10564921 Ga0157374_105649212 135
656 3300013296 Ga0157374_11503172 Ga0157374_115031722 135
657 3300013297 Ga0157378_10021644 Ga0157378_100216444 135
658 3300013297 Ga0157378_10033817 Ga0157378_100338172 135
659 3300013306 Ga0163162_10056100 Ga0163162_100561003 135
660 3300013306 Ga0163162_10161503 Ga0163162_101615032 135
661 3300013307 Ga0157372_10988526 Ga0157372_109885262 135
662 3300013308 Ga0157375_10016314 Ga0157375_100163146 135
663 3300013308 Ga0157375_10027659 Ga0157375_100276592 135
664 3300013308 Ga0157375_10312787 Ga0157375_103127872 135
665 3300013308 Ga0157375_11810632 Ga0157375_118106321 135
666 3300014325 Ga0163163_10405083 Ga0163163_104050832 135
667 3300014326 Ga0157380_10527351 Ga0157380_105273512 135
668 3300014745 Ga0157377_10056992 Ga0157377_100569922 135
669 3300014745 Ga0157377_10201160 Ga0157377_102011602 135
670 3300014968 Ga0157379_11281722 Ga0157379_112817222 135
671 3300014969 Ga0157376_10185201 Ga0157376_101852013 135
672 3300014969 Ga0157376_10492334 Ga0157376_104923342 135
673 3300017792 Ga0163161_10571810 Ga0163161_105718102 135
674 3300025315 Ga0207697_10034325 Ga0207697_100343255 135
675 3300025315 Ga0207697_10066762 Ga0207697_100667622 135
676 3300025315 Ga0207697_10155131 Ga0207697_101551312 135
677 3300025321 Ga0207656_10025165 Ga0207656_100251653 135
678 3300025321 Ga0207656_10540296 Ga0207656_105402962 135
679 3300025893 Ga0207682_10001342 Ga0207682_100013429 135
680 3300025899 Ga0207642_10086534 Ga0207642_100865342 135
681 3300025901 Ga0207688_10009382 Ga0207688_100093824 135
682 3300025901 Ga0207688_10337600 Ga0207688_103376002 135
683 3300025901 Ga0207688_10734798 Ga0207688_107347982 135
684 3300025903 Ga0207680_10003327 Ga0207680_100033274 135
685 3300025903 Ga0207680_10007066 Ga0207680_100070663 135
686 3300025904 Ga0207647_10219558 Ga0207647_102195582 135
687 3300025907 Ga0207645_10015407 Ga0207645_100154072 135
688 3300025907 Ga0207645_10106104 Ga0207645_101061042 135
689 3300025907 Ga0207645_10265082 Ga0207645_102650822 135
690 3300025908 Ga0207643_10150036 Ga0207643_101500362 135
691 3300025909 Ga0207705_10103966 Ga0207705_101039662 135
692 3300025909 Ga0207705_10111793 Ga0207705_101117932 135
693 3300025909 Ga0207705_10138049 Ga0207705_101380492 135
694 3300025911 Ga0207654_10598661 Ga0207654_105986611 135
695 3300025911 Ga0207654_10848306 Ga0207654_108483061 135
696 3300025912 Ga0207707_10287192 Ga0207707_102871922 135
697 3300025912 Ga0207707_10419268 Ga0207707_104192682 135
698 3300025913 Ga0207695_10543926 Ga0207695_105439262 135
699 3300025918 Ga0207662_10023202 Ga0207662_100232022 135
700 3300025919 Ga0207657_10014934 Ga0207657_100149342 135
701 3300025919 Ga0207657_10029689 Ga0207657_100296894 135
702 3300025919 Ga0207657_10034236 Ga0207657_100342364 135
703 3300025919 Ga0207657_10145426 Ga0207657_101454262 135
704 3300025920 Ga0207649_10027742 Ga0207649_100277423 135
705 3300025920 Ga0207649_10107540 Ga0207649_101075402 135
706 3300025920 Ga0207649_10565012 Ga0207649_105650121 135
707 3300025920 Ga0207649_10840692 Ga0207649_108406922 135
708 3300025920 Ga0207649_10857960 Ga0207649_108579602 135
709 3300025921 Ga0207652_10276410 Ga0207652_102764102 135
710 3300025923 Ga0207681_10830529 Ga0207681_108305291 135
711 3300025924 Ga0207694_10330707 Ga0207694_103307073 135
712 3300025925 Ga0207650_10004781 Ga0207650_100047812 135
713 3300025926 Ga0207659_10196454 Ga0207659_101964542 135
714 3300025927 Ga0207687_10107523 Ga0207687_101075232 135
715 3300025927 Ga0207687_10160373 Ga0207687_101603732 135
716 3300025927 Ga0207687_10169601 Ga0207687_101696012 135
717 3300025928 Ga0207700_10258425 Ga0207700_102584252 135
718 3300025928 Ga0207700_10462894 Ga0207700_104628942 135
719 3300025929 Ga0207664_10125235 Ga0207664_101252352 135
720 3300025931 Ga0207644_10000142 Ga0207644_1000014215 135
721 3300025931 Ga0207644_10554064 Ga0207644_105540642 135
722 3300025932 Ga0207690_10046793 Ga0207690_100467932 135
723 3300025932 Ga0207690_10269397 Ga0207690_102693972 135
724 3300025932 Ga0207690_10299348 Ga0207690_102993481 135
725 3300025932 Ga0207690_10429579 Ga0207690_104295792 135
726 3300025933 Ga0207706_10005721 Ga0207706_100057219 135
727 3300025933 Ga0207706_10019092 Ga0207706_100190923 135
728 3300025933 Ga0207706_10086882 Ga0207706_100868823 135
729 3300025933 Ga0207706_10145933 Ga0207706_101459332 135
730 3300025934 Ga0207686_10301444 Ga0207686_103014442 135
731 3300025935 Ga0207709_10572962 Ga0207709_105729622 135
732 3300025937 Ga0207669_10065902 Ga0207669_100659022 135
733 3300025938 Ga0207704_10016287 Ga0207704_100162873 135
734 3300025940 Ga0207691_10006169 Ga0207691_100061699 135
735 3300025940 Ga0207691_10024129 Ga0207691_100241294 135
736 3300025940 Ga0207691_10043385 Ga0207691_100433854 135
737 3300025940 Ga0207691_11592727 Ga0207691_115927271 135
738 3300025941 Ga0207711_10350779 Ga0207711_103507792 135
739 3300025941 Ga0207711_10386494 Ga0207711_103864942 135
740 3300025941 Ga0207711_10798801 Ga0207711_107988012 135
741 3300025942 Ga0207689_10012587 Ga0207689_100125876 135
742 3300025945 Ga0207679_10016598 Ga0207679_100165982 135
743 3300025945 Ga0207679_10107503 Ga0207679_101075032 135
744 3300025945 Ga0207679_10314524 Ga0207679_103145242 135
745 3300025945 Ga0207679_10318756 Ga0207679_103187561 135
746 3300025949 Ga0207667_10039670 Ga0207667_100396702 135
747 3300025960 Ga0207651_10005732 Ga0207651_100057325 135
748 3300025960 Ga0207651_10010290 Ga0207651_100102906 135
749 3300025960 Ga0207651_10973357 Ga0207651_109733571 135
750 3300025972 Ga0207668_10368207 Ga0207668_103682072 135
751 3300025981 Ga0207640_10244932 Ga0207640_102449322 135
752 3300025981 Ga0207640_10339783 Ga0207640_103397832 135
753 3300025981 Ga0207640_11193247 Ga0207640_111932471 135
754 3300025986 Ga0207658_10920118 Ga0207658_109201182 135
755 3300026023 Ga0207677_10005002 Ga0207677_100050022 135
756 3300026023 Ga0207677_10298819 Ga0207677_102988192 135
757 3300026023 Ga0207677_10955081 Ga0207677_109550812 135
758 3300026035 Ga0207703_10241762 Ga0207703_102417622 135
759 3300026041 Ga0207639_10836987 Ga0207639_108369871 135
760 3300026067 Ga0207678_10010248 Ga0207678_1001024810 135
761 3300026067 Ga0207678_10067799 Ga0207678_100677992 135
762 3300026078 Ga0207702_10043057 Ga0207702_100430573 135
763 3300026078 Ga0207702_10176712 Ga0207702_101767122 135
764 3300026078 Ga0207702_11247363 Ga0207702_112473632 135
765 3300026088 Ga0207641_10006875 Ga0207641_100068752 135
766 3300026088 Ga0207641_10856120 Ga0207641_108561202 135
767 3300026089 Ga0207648_10011602 Ga0207648_100116026 135
768 3300026089 Ga0207648_10019695 Ga0207648_100196952 135
769 3300026095 Ga0207676_10097044 Ga0207676_100970442 135
770 3300026095 Ga0207676_10348835 Ga0207676_103488352 135
771 3300026095 Ga0207676_10674280 Ga0207676_106742802 135
772 3300026116 Ga0207674_10235128 Ga0207674_102351283 135
773 3300026116 Ga0207674_11208187 Ga0207674_112081872 135
774 3300026118 Ga0207675_100340165 Ga0207675_1003401652 135
775 3300026121 Ga0207683_10002271 Ga0207683_1000227111 135
776 3300026121 Ga0207683_10013861 Ga0207683_100138614 135
777 3300026121 Ga0207683_10025083 Ga0207683_100250835 135
778 3300026142 Ga0207698_10545829 Ga0207698_105458292 135
779 3300026142 Ga0207698_11053160 Ga0207698_110531602 135
780 3300028379 Ga0268266_10057167 Ga0268266_100571672 135
781 3300034817 Ga0373948_0152515 Ga0373948_0152515_76_483 135
782 3300034957 Ga0373938_0199973 Ga0373938_0199973_57_464 135
783 3300035092 Ga0373952_0160837 Ga0373952_0160837_82_489 135
784 3300035092 Ga0373952_0290951 Ga0373952_0290951_74_490 135
785 3300035121 Ga0373960_0069579 Ga0373960_0069579_105_512 135
786 3300035170 Ga0373943_0011671 Ga0373943_0011671_2976_3386 135
787 3300035171 Ga0373946_0011556 Ga0373946_0011556_608_1018 135
788 3300035207 Ga0373942_0099976 Ga0373942_0099976_438_845 135
789 3300035691 Ga0373931_0051628 Ga0373931_0051628_1478_1885 135
790 3300035692 Ga0373935_0006536 Ga0373935_0006536_6340_6753 135
791 3300035692 Ga0373935_0020199 Ga0373935_0020199_1802_2212 135
792 3300035695 Ga0373927_0022086 Ga0373927_0022086_1928_2338 135
793 3300035725 Ga0373947_0006264 Ga0373947_0006264_1327_1737 135
794 3300037068 Ga0373925_0249024 Ga0373925_0249024_459_869 135
795 3300037312 Ga0395899_0109688 Ga0395899_0109688_651_1061 135
796 3300037418 Ga0395900_0091354 Ga0395900_0091354_242_655 135
797 3300037418 Ga0395900_0158283 Ga0395900_0158283_502_912 135
798 3300037418 Ga0395900_0167586 Ga0395900_0167586_597_1004 135
799 3300037418 Ga0395900_0198808 Ga0395900_0198808_1046_1456 135
800 3300037466 Ga0395898_0038340 Ga0395898_0038340_3296_3706 135
801 3300037466 Ga0395898_0247782 Ga0395898_0247782_425_832 135
802 3300037466 Ga0395898_0329735 Ga0395898_0329735_606_1016 135
803 3300037471 Ga0395905_0002956 Ga0395905_0002956_17379_17792 135
804 3300037471 Ga0395905_0011079 Ga0395905_0011079_4731_5141 135
805 3300037471 Ga0395905_0019166 Ga0395905_0019166_507_920 135
806 3300037471 Ga0395905_0026212 Ga0395905_0026212_4807_5214 135
807 3300037471 Ga0395905_0058925 Ga0395905_0058925_573_980 135
808 3300037471 Ga0395905_0059475 Ga0395905_0059475_1833_2243 135
809 3300037471 Ga0395905_0131320 Ga0395905_0131320_1343_1753 135
810 3300037471 Ga0395905_0153323 Ga0395905_0153323_415_825 135
811 3300037471 Ga0395905_1230778 Ga0395905_1230778_164_571 135
812 3300038443 Ga0395901_0012068 Ga0395901_0012068_6865_7275 135
813 3300038443 Ga0395901_0020064 Ga0395901_0020064_5933_6346 135
814 3300038443 Ga0395901_0036467 Ga0395901_0036467_922_1335 135
815 3300038443 Ga0395901_0221755 Ga0395901_0221755_1475_1882 135
816 3300038443 Ga0395901_0264959 Ga0395901_0264959_967_1374 135
817 3300038443 Ga0395901_1695383 Ga0395901_1695383_137_544 135
818 3300044683 Ga0466965_0146056 Ga0466965_0146056_68_475 135
819 3300044684 Ga0466966_0535935 Ga0466966_0535935_125_532 135
820 3300044694 Ga0466963_0200529 Ga0466963_0200529_642_1049 135
821 3300044842 Ga0466957_0147311 Ga0466957_0147311_746_1153 135
822 3300045049 Ga0466959_0992697 Ga0466959_0992697_22_429 135
823 3300045976 Ga0466967_0048036 Ga0466967_0048036_201_608 135
824 3300045976 Ga0466967_0059029 Ga0466967_0059029_519_926 135
825 3300045976 Ga0466967_0092983 Ga0466967_0092983_1014_1421 135
826 3300046525 Ga0495663_0259036 Ga0495663_0259036_110_517 135
827 3300046539 Ga0495621_0000060 Ga0495621_0000060_16208_16624 135
828 3300046558 Ga0495633_0027524 Ga0495633_0027524_1959_2375 135
829 3300046664 Ga0495659_0023971 Ga0495659_0023971_37_453 135
830 3300046684 Ga0495669_0027423 Ga0495669_0027423_1555_1971 135
831 3300046684 Ga0495669_0162582 Ga0495669_0162582_382_789 135
832 3300046691 Ga0495670_0000649 Ga0495670_0000649_11701_12117 135
833 3300048903 Ga0496100_0001630 Ga0496100_0001630_6885_7292 135
834 3300048904 Ga0496101_0002764 Ga0496101_0002764_5774_6181 135
835 3300048904 Ga0496101_0113492 Ga0496101_0113492_1385_1801 135
836 3300048905 Ga0496102_0029658 Ga0496102_0029658_4177_4584 135
837 3300048906 Ga0496103_0059996 Ga0496103_0059996_1602_2009 135
838 3300048907 Ga0496104_0025877 Ga0496104_0025877_2954_3361 135
839 3300048908 Ga0496105_0116908 Ga0496105_0116908_1599_2006 135
840 3300048909 Ga0496106_0019173 Ga0496106_0019173_1874_2281 135
841 3300048910 Ga0496107_0000863 Ga0496107_0000863_15053_15460 135
842 3300048910 Ga0496107_0221134 Ga0496107_0221134_200_607 135
843 3300048910 Ga0496107_0633147 Ga0496107_0633147_74_481 135
844 3300048911 Ga0496108_0000954 Ga0496108_0000954_10474_10881 135
845 3300048912 Ga0496109_0008004 Ga0496109_0008004_4365_4772 135
846 3300048912 Ga0496109_0349477 Ga0496109_0349477_551_958 135
847 3300048913 Ga0496110_0000754 Ga0496110_0000754_6280_6687 135
848 3300048914 Ga0496111_0000069 Ga0496111_0000069_11586_11993 135
849 3300048915 Ga0496112_0004068 Ga0496112_0004068_6119_6526 135
850 3300048915 Ga0496112_0112500 Ga0496112_0112500_1516_1923 135
851 3300048915 Ga0496112_0395488 Ga0496112_0395488_499_906 135
852 3300048915 Ga0496112_0475481 Ga0496112_0475481_171_578 135
853 3300048915 Ga0496112_1179228 Ga0496112_1179228_225_632 135
854 3300048916 Ga0496113_0007666 Ga0496113_0007666_248_655 135

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14534

DUF4440

Domain of unknown function (DUF4440)

37

129

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8834 7 123
3fsd-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution 0.8788 9 124
3ksp-assembly1.cif.gz_A-2 crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution 0.8693 9 125
3rob-assembly2.cif.gz_D the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 0.8683 9 124
2r4i-assembly1.cif.gz_B crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution 0.8493 7 123
ID Description Score Start End Superfamily
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.888 7 123 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8665 9 124 3.10.450.50
2r4iB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8603 7 123 3.10.450.50
3fkaD00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8376 9 120 3.10.450.50
3fsdA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8331 9 124 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A7G9SJQ5-F1-model_v4 Nuclear transport factor 2 family protein 0.9826 1 126
AF-A0A7G9SJQ5-F1-model_v4 Nuclear transport factor 2 family protein 0.9384 1 126
AF-A0A6G7ZIC2-F1-model_v4 Nuclear transport factor 2 family protein 0.9308 9 126
AF-A0A3B9LGS6-F1-model_v4 DUF4440 domain-containing protein 0.9126 7 125
AF-A0A2V9YTV2-F1-model_v4 DUF4440 domain-containing protein 0.9107 5 127

Feature Viewer

pLDDT pTM Quality
89.59 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map