F483572
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 854 | 251 | 854 | 135 |
Family's Representative Sequence
| Representative Sequence | 3300005435|Ga0070714_100036186|Ga0070714_1000361862 |
| Length | 147 |
| Sequence | MARVPSRHAWGFAFSEISRHRDAGRARVLADSNCVLIDELEREWRDALCRKDMERLQALVHRDFLLIGTRSTGPFMMNRQVEVRDATVFDNMMIGTVQARWRLKYLGRSIEDCVFLTDVWVKDEGRWQAIRRHSTPAPAGACDLKGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 9 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 21 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 59 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 60 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 61 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 63 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 64 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 65 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 82 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 181 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 182 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 183 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 184 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 186 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 187 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 188 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 190 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 191 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 192 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 193 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 201 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 202 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 203 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 204 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 205 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 206 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 207 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 208 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 209 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 210 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 211 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 212 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 218 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 219 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 229 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 230 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 231 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 232 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 233 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 234 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 235 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 236 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 239 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 240 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 241 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 242 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 248 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 251 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.77 |
| Metatranscriptomes | 0.23 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.23 |
| Nodule | 0 |
| Rhizoplane | 3.16 |
| Rhizosphere | 96.6 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1033251 | 3300001976 | Bacteria | 683 |
| 2 | JGI24747J21853_1003908 | 3300001978 | Bacteria | 1309 |
| 3 | JGI24740J21852_10021801 | 3300001979 | Bacteria | 2215 |
| 4 | JGI24740J21852_10053770 | 3300001979 | Bacteria | 1140 |
| 5 | JGI24740J21852_10067802 | 3300001979 | Unclassified | 964 |
| 6 | JGI24740J21852_10104779 | 3300001979 | Unclassified | 717 |
| 7 | JGI24739J22299_10012780 | 3300001989 | Bacteria | 3077 |
| 8 | JGI24739J22299_10088317 | 3300001989 | Bacteria | 946 |
| 9 | JGI24737J22298_10014199 | 3300001990 | Bacteria | 2587 |
| 10 | JGI24737J22298_10016841 | 3300001990 | Bacteria | 2359 |
| 11 | JGI24743J22301_10003394 | 3300001991 | Bacteria | 2517 |
| 12 | JGI24735J21928_10002140 | 3300002067 | Bacteria | 6953 |
| 13 | JGI24735J21928_10014828 | 3300002067 | Bacteria | 2439 |
| 14 | JGI24745J21846_1009482 | 3300002073 | Bacteria | 1104 |
| 15 | JGI24738J21930_10007344 | 3300002075 | Bacteria | 2547 |
| 16 | JGI24738J21930_10044252 | 3300002075 | Bacteria | 905 |
| 17 | JGI24744J21845_10000055 | 3300002077 | Bacteria | 13381 |
| 18 | JGI24744J21845_10089105 | 3300002077 | Unclassified | 566 |
| 19 | JGI24742J22300_10010994 | 3300002244 | Bacteria | 1500 |
| 20 | Ga0065704_10291073 | 3300005289 | Bacteria | 903 |
| 21 | Ga0065715_10330324 | 3300005293 | Bacteria | 985 |
| 22 | Ga0070658_10007529 | 3300005327 | Bacteria | 8787 |
| 23 | Ga0070658_10019242 | 3300005327 | Bacteria | 5469 |
| 24 | Ga0070658_10025349 | 3300005327 | Bacteria | 4755 |
| 25 | Ga0070658_10148654 | 3300005327 | Bacteria | 1960 |
| 26 | Ga0070658_10182464 | 3300005327 | Bacteria | 1766 |
| 27 | Ga0070658_10273336 | 3300005327 | Bacteria | 1437 |
| 28 | Ga0070658_10959533 | 3300005327 | Unclassified | 743 |
| 29 | Ga0070676_10004251 | 3300005328 | Bacteria | 7527 |
| 30 | Ga0070676_10145470 | 3300005328 | Bacteria | 1513 |
| 31 | Ga0070676_10278123 | 3300005328 | Bacteria | 1127 |
| 32 | Ga0070683_100019017 | 3300005329 | Bacteria | 6095 |
| 33 | Ga0070683_100172414 | 3300005329 | Bacteria | 2053 |
| 34 | Ga0070683_100392138 | 3300005329 | Bacteria | 1324 |
| 35 | Ga0070683_100675957 | 3300005329 | Bacteria | 989 |
| 36 | Ga0070690_100462654 | 3300005330 | Unclassified | 942 |
| 37 | Ga0070670_100177334 | 3300005331 | Bacteria | 1849 |
| 38 | Ga0070670_100736880 | 3300005331 | Bacteria | 887 |
| 39 | Ga0070677_10009387 | 3300005333 | Bacteria | 3315 |
| 40 | Ga0068869_100196342 | 3300005334 | Bacteria | 1589 |
| 41 | Ga0068869_100303658 | 3300005334 | Bacteria | 1289 |
| 42 | Ga0068869_101536991 | 3300005334 | Bacteria | 591 |
| 43 | Ga0070666_10009331 | 3300005335 | Bacteria | 6113 |
| 44 | Ga0070666_10021579 | 3300005335 | Bacteria | 4174 |
| 45 | Ga0070666_10340076 | 3300005335 | Bacteria | 1072 |
| 46 | Ga0070680_100002432 | 3300005336 | Bacteria | 13797 |
| 47 | Ga0070680_100005513 | 3300005336 | Bacteria | 9579 |
| 48 | Ga0070680_100053617 | 3300005336 | Bacteria | 3292 |
| 49 | Ga0070680_100131326 | 3300005336 | Bacteria | 2095 |
| 50 | Ga0070680_100509936 | 3300005336 | Bacteria | 1029 |
| 51 | Ga0070680_100604808 | 3300005336 | Unclassified | 941 |
| 52 | Ga0070680_100607577 | 3300005336 | Bacteria | 939 |
| 53 | Ga0070682_100041566 | 3300005337 | Bacteria | 2834 |
| 54 | Ga0070682_100843571 | 3300005337 | Unclassified | 748 |
| 55 | Ga0068868_100032532 | 3300005338 | Bacteria | 4013 |
| 56 | Ga0068868_100085855 | 3300005338 | Bacteria | 2529 |
| 57 | Ga0068868_100186385 | 3300005338 | Bacteria | 1724 |
| 58 | Ga0068868_100539636 | 3300005338 | Unclassified | 1026 |
| 59 | Ga0068868_100712910 | 3300005338 | Bacteria | 898 |
| 60 | Ga0070660_100019741 | 3300005339 | Bacteria | 4943 |
| 61 | Ga0070660_100029896 | 3300005339 | Bacteria | 4085 |
| 62 | Ga0070660_100037460 | 3300005339 | Bacteria | 3677 |
| 63 | Ga0070660_100127129 | 3300005339 | Bacteria | 2037 |
| 64 | Ga0070660_100153297 | 3300005339 | Bacteria | 1854 |
| 65 | Ga0070660_100166992 | 3300005339 | Bacteria | 1776 |
| 66 | Ga0070660_100212323 | 3300005339 | Bacteria | 1571 |
| 67 | Ga0070660_100226243 | 3300005339 | Bacteria | 1521 |
| 68 | Ga0070660_100781288 | 3300005339 | Bacteria | 803 |
| 69 | Ga0070660_100785943 | 3300005339 | Unclassified | 800 |
| 70 | Ga0070660_100787198 | 3300005339 | Unclassified | 799 |
| 71 | Ga0070691_10325031 | 3300005341 | Bacteria | 847 |
| 72 | Ga0070687_100038691 | 3300005343 | Bacteria | 2392 |
| 73 | Ga0070687_100383776 | 3300005343 | Bacteria | 916 |
| 74 | Ga0070661_100057631 | 3300005344 | Bacteria | 2846 |
| 75 | Ga0070661_100075836 | 3300005344 | Bacteria | 2478 |
| 76 | Ga0070661_100142394 | 3300005344 | Bacteria | 1808 |
| 77 | Ga0070661_100151892 | 3300005344 | Bacteria | 1751 |
| 78 | Ga0070661_100213325 | 3300005344 | Bacteria | 1478 |
| 79 | Ga0070661_100379166 | 3300005344 | Bacteria | 1115 |
| 80 | Ga0070692_10031841 | 3300005345 | Bacteria | 2647 |
| 81 | Ga0070692_10120867 | 3300005345 | Bacteria | 1461 |
| 82 | Ga0070692_10778940 | 3300005345 | Unclassified | 651 |
| 83 | Ga0070668_100053802 | 3300005347 | Bacteria | 3104 |
| 84 | Ga0070668_100529766 | 3300005347 | Bacteria | 1023 |
| 85 | Ga0070668_100544430 | 3300005347 | Bacteria | 1010 |
| 86 | Ga0070668_100573105 | 3300005347 | Bacteria | 985 |
| 87 | Ga0070669_100038870 | 3300005353 | Bacteria | 3456 |
| 88 | Ga0070669_100187147 | 3300005353 | Bacteria | 1622 |
| 89 | Ga0070669_100274046 | 3300005353 | Bacteria | 1350 |
| 90 | Ga0070669_100313642 | 3300005353 | Bacteria | 1265 |
| 91 | Ga0070669_100701360 | 3300005353 | Bacteria | 855 |
| 92 | Ga0070675_100022320 | 3300005354 | Bacteria | 5057 |
| 93 | Ga0070675_100159534 | 3300005354 | Bacteria | 1939 |
| 94 | Ga0070675_100608643 | 3300005354 | Unclassified | 991 |
| 95 | Ga0070671_100036337 | 3300005355 | Bacteria | 4085 |
| 96 | Ga0070671_100203211 | 3300005355 | Bacteria | 1680 |
| 97 | Ga0070674_100086865 | 3300005356 | Bacteria | 2247 |
| 98 | Ga0070674_100109065 | 3300005356 | Bacteria | 2029 |
| 99 | Ga0070674_100829203 | 3300005356 | Bacteria | 801 |
| 100 | Ga0070674_102206463 | 3300005356 | Unclassified | 503 |
| 101 | Ga0070673_100011901 | 3300005364 | Bacteria | 5958 |
| 102 | Ga0070673_100112245 | 3300005364 | Bacteria | 2262 |
| 103 | Ga0070673_100379226 | 3300005364 | Bacteria | 1260 |
| 104 | Ga0070673_100516919 | 3300005364 | Bacteria | 1081 |
| 105 | Ga0070673_100642726 | 3300005364 | Unclassified | 970 |
| 106 | Ga0070673_101356516 | 3300005364 | Unclassified | 668 |
| 107 | Ga0070659_100012039 | 3300005366 | Bacteria | 6404 |
| 108 | Ga0070659_100024629 | 3300005366 | Bacteria | 4615 |
| 109 | Ga0070659_100125313 | 3300005366 | Bacteria | 2084 |
| 110 | Ga0070659_100174550 | 3300005366 | Bacteria | 1762 |
| 111 | Ga0070659_100197328 | 3300005366 | Bacteria | 1656 |
| 112 | Ga0070659_100349682 | 3300005366 | Bacteria | 1240 |
| 113 | Ga0070659_100403163 | 3300005366 | Bacteria | 1155 |
| 114 | Ga0070659_100495578 | 3300005366 | Bacteria | 1041 |
| 115 | Ga0070667_100018568 | 3300005367 | Bacteria | 5769 |
| 116 | Ga0070667_100081208 | 3300005367 | Bacteria | 2774 |
| 117 | Ga0070667_100240698 | 3300005367 | Bacteria | 1615 |
| 118 | Ga0070709_10044075 | 3300005434 | Bacteria | 2761 |
| 119 | Ga0070714_100036186 | 3300005435 | Bacteria | 4139 |
| 120 | Ga0070714_100095396 | 3300005435 | Bacteria | 2612 |
| 121 | Ga0070714_100120567 | 3300005435 | Bacteria | 2333 |
| 122 | Ga0070714_100191201 | 3300005435 | Bacteria | 1868 |
| 123 | Ga0070714_100326088 | 3300005435 | Bacteria | 1437 |
| 124 | Ga0070713_100005100 | 3300005436 | Bacteria | 8935 |
| 125 | Ga0070713_100065022 | 3300005436 | Bacteria | 3063 |
| 126 | Ga0070713_100165898 | 3300005436 | Bacteria | 1975 |
| 127 | Ga0070713_100388894 | 3300005436 | Unclassified | 1301 |
| 128 | Ga0070663_100065855 | 3300005455 | Bacteria | 2624 |
| 129 | Ga0070663_100509490 | 3300005455 | Unclassified | 1000 |
| 130 | Ga0070663_100571243 | 3300005455 | Bacteria | 948 |
| 131 | Ga0070678_100004224 | 3300005456 | Bacteria | 8115 |
| 132 | Ga0070678_100009114 | 3300005456 | Bacteria | 5989 |
| 133 | Ga0070678_100063425 | 3300005456 | Bacteria | 2734 |
| 134 | Ga0070678_100119549 | 3300005456 | Bacteria | 2075 |
| 135 | Ga0070662_100005197 | 3300005457 | Bacteria | 8305 |
| 136 | Ga0070662_100018155 | 3300005457 | Bacteria | 4755 |
| 137 | Ga0070662_100072350 | 3300005457 | Bacteria | 2545 |
| 138 | Ga0070662_100318324 | 3300005457 | Bacteria | 1268 |
| 139 | Ga0070662_100497510 | 3300005457 | Bacteria | 1016 |
| 140 | Ga0070662_100871747 | 3300005457 | Unclassified | 767 |
| 141 | Ga0070681_10080063 | 3300005458 | Bacteria | 3223 |
| 142 | Ga0070681_10284714 | 3300005458 | Bacteria | 1563 |
| 143 | Ga0070681_10296169 | 3300005458 | Bacteria | 1528 |
| 144 | Ga0068867_100002035 | 3300005459 | Bacteria | 14144 |
| 145 | Ga0068867_100020963 | 3300005459 | Bacteria | 4661 |
| 146 | Ga0070685_10278927 | 3300005466 | Bacteria | 1118 |
| 147 | Ga0070685_10697814 | 3300005466 | Bacteria | 740 |
| 148 | Ga0070706_100254739 | 3300005467 | Bacteria | 1639 |
| 149 | Ga0070679_100077172 | 3300005530 | Bacteria | 3320 |
| 150 | Ga0070679_100088147 | 3300005530 | Bacteria | 3090 |
| 151 | Ga0070679_100144448 | 3300005530 | Bacteria | 2357 |
| 152 | Ga0070679_100362113 | 3300005530 | Bacteria | 1397 |
| 153 | Ga0070679_100370709 | 3300005530 | Bacteria | 1379 |
| 154 | Ga0070679_100433735 | 3300005530 | Bacteria | 1259 |
| 155 | Ga0070679_100829557 | 3300005530 | Bacteria | 868 |
| 156 | Ga0070684_100101991 | 3300005535 | Bacteria | 2565 |
| 157 | Ga0070684_100152215 | 3300005535 | Bacteria | 2096 |
| 158 | Ga0070684_100210151 | 3300005535 | Bacteria | 1773 |
| 159 | Ga0068853_100010905 | 3300005539 | Bacteria | 7364 |
| 160 | Ga0068853_100079727 | 3300005539 | Bacteria | 2863 |
| 161 | Ga0068853_100099466 | 3300005539 | Bacteria | 2569 |
| 162 | Ga0068853_100144427 | 3300005539 | Bacteria | 2137 |
| 163 | Ga0068853_100147081 | 3300005539 | Bacteria | 2118 |
| 164 | Ga0068853_100175357 | 3300005539 | Bacteria | 1942 |
| 165 | Ga0068853_101495863 | 3300005539 | Bacteria | 654 |
| 166 | Ga0070672_100016213 | 3300005543 | Bacteria | 5329 |
| 167 | Ga0070672_100099437 | 3300005543 | Bacteria | 2358 |
| 168 | Ga0070672_100448923 | 3300005543 | Bacteria | 1110 |
| 169 | Ga0070686_100036653 | 3300005544 | Bacteria | 3038 |
| 170 | Ga0070696_100017065 | 3300005546 | Bacteria | 4898 |
| 171 | Ga0070693_100040100 | 3300005547 | Bacteria | 2627 |
| 172 | Ga0070693_100073186 | 3300005547 | Bacteria | 2024 |
| 173 | Ga0070693_100521509 | 3300005547 | Bacteria | 846 |
| 174 | Ga0070665_100006320 | 3300005548 | Bacteria | 12090 |
| 175 | Ga0070665_100053630 | 3300005548 | Bacteria | 4044 |
| 176 | Ga0070665_100064471 | 3300005548 | Bacteria | 3674 |
| 177 | Ga0068855_100048667 | 3300005563 | Bacteria | 5003 |
| 178 | Ga0068855_100050120 | 3300005563 | Bacteria | 4921 |
| 179 | Ga0068855_100111070 | 3300005563 | Bacteria | 3147 |
| 180 | Ga0068855_100207682 | 3300005563 | Bacteria | 2202 |
| 181 | Ga0068855_100208992 | 3300005563 | Bacteria | 2194 |
| 182 | Ga0068855_100243286 | 3300005563 | Bacteria | 2009 |
| 183 | Ga0068855_100267980 | 3300005563 | Bacteria | 1900 |
| 184 | Ga0068855_101095760 | 3300005563 | Bacteria | 833 |
| 185 | Ga0070664_100021210 | 3300005564 | Bacteria | 5352 |
| 186 | Ga0070664_100105909 | 3300005564 | Bacteria | 2449 |
| 187 | Ga0070664_100114810 | 3300005564 | Bacteria | 2353 |
| 188 | Ga0070664_100203269 | 3300005564 | Bacteria | 1768 |
| 189 | Ga0070664_100441537 | 3300005564 | Bacteria | 1194 |
| 190 | Ga0070664_101170914 | 3300005564 | Bacteria | 725 |
| 191 | Ga0070664_101786668 | 3300005564 | Unclassified | 583 |
| 192 | Ga0068857_100019007 | 3300005577 | Bacteria | 6028 |
| 193 | Ga0068857_100023828 | 3300005577 | Bacteria | 5388 |
| 194 | Ga0068857_100062570 | 3300005577 | Bacteria | 3308 |
| 195 | Ga0068857_100482680 | 3300005577 | Bacteria | 1161 |
| 196 | Ga0068857_101037990 | 3300005577 | Unclassified | 790 |
| 197 | Ga0068854_100031274 | 3300005578 | Bacteria | 3698 |
| 198 | Ga0068854_100092871 | 3300005578 | Bacteria | 2248 |
| 199 | Ga0068854_100154935 | 3300005578 | Bacteria | 1769 |
| 200 | Ga0068854_100187654 | 3300005578 | Bacteria | 1618 |
| 201 | Ga0068854_100212190 | 3300005578 | Bacteria | 1527 |
| 202 | Ga0068854_100508400 | 3300005578 | Bacteria | 1016 |
| 203 | Ga0068854_101438166 | 3300005578 | Bacteria | 624 |
| 204 | Ga0068854_101662933 | 3300005578 | Bacteria | 583 |
| 205 | Ga0068856_100051981 | 3300005614 | Bacteria | 4040 |
| 206 | Ga0068856_100098357 | 3300005614 | Bacteria | 2916 |
| 207 | Ga0068856_100144207 | 3300005614 | Bacteria | 2389 |
| 208 | Ga0068856_100172945 | 3300005614 | Bacteria | 2172 |
| 209 | Ga0068856_100629053 | 3300005614 | Bacteria | 1094 |
| 210 | Ga0068856_100796554 | 3300005614 | Bacteria | 965 |
| 211 | Ga0068856_100848773 | 3300005614 | Bacteria | 932 |
| 212 | Ga0068856_101075420 | 3300005614 | Bacteria | 822 |
| 213 | Ga0068856_101339043 | 3300005614 | Bacteria | 731 |
| 214 | Ga0068856_101346078 | 3300005614 | Bacteria | 729 |
| 215 | Ga0068856_101928691 | 3300005614 | Unclassified | 601 |
| 216 | Ga0070702_100975996 | 3300005615 | Unclassified | 669 |
| 217 | Ga0068852_100001069 | 3300005616 | Bacteria | 18099 |
| 218 | Ga0068852_100016289 | 3300005616 | Bacteria | 5791 |
| 219 | Ga0068852_100021969 | 3300005616 | Bacteria | 5107 |
| 220 | Ga0068852_100076960 | 3300005616 | Bacteria | 2947 |
| 221 | Ga0068852_100098987 | 3300005616 | Bacteria | 2627 |
| 222 | Ga0068852_100172565 | 3300005616 | Bacteria | 2028 |
| 223 | Ga0068852_100187189 | 3300005616 | Bacteria | 1950 |
| 224 | Ga0068852_100189039 | 3300005616 | Bacteria | 1942 |
| 225 | Ga0068852_100403049 | 3300005616 | Bacteria | 1346 |
| 226 | Ga0068852_100571183 | 3300005616 | Bacteria | 1133 |
| 227 | Ga0068852_100909462 | 3300005616 | Bacteria | 897 |
| 228 | Ga0068859_100028161 | 3300005617 | Bacteria | 5633 |
| 229 | Ga0068859_100048003 | 3300005617 | Bacteria | 4290 |
| 230 | Ga0068859_100573868 | 3300005617 | Unclassified | 1222 |
| 231 | Ga0068864_100155118 | 3300005618 | Bacteria | 2078 |
| 232 | Ga0068864_100197960 | 3300005618 | Bacteria | 1844 |
| 233 | Ga0068864_100486578 | 3300005618 | Bacteria | 1185 |
| 234 | Ga0068866_10048109 | 3300005718 | Bacteria | 2154 |
| 235 | Ga0068866_10050117 | 3300005718 | Bacteria | 2119 |
| 236 | Ga0068861_100211480 | 3300005719 | Bacteria | 1634 |
| 237 | Ga0068861_100370429 | 3300005719 | Unclassified | 1262 |
| 238 | Ga0068861_100815273 | 3300005719 | Bacteria | 877 |
| 239 | Ga0068851_10008929 | 3300005834 | Bacteria | 4648 |
| 240 | Ga0068851_10030743 | 3300005834 | Bacteria | 2665 |
| 241 | Ga0068851_10039813 | 3300005834 | Bacteria | 2361 |
| 242 | Ga0068851_10197961 | 3300005834 | Bacteria | 1120 |
| 243 | Ga0068870_10068941 | 3300005840 | Unclassified | 1923 |
| 244 | Ga0068870_10283983 | 3300005840 | Bacteria | 1039 |
| 245 | Ga0068870_10346497 | 3300005840 | Bacteria | 952 |
| 246 | Ga0068863_100005224 | 3300005841 | Bacteria | 12814 |
| 247 | Ga0068863_100005699 | 3300005841 | Bacteria | 12229 |
| 248 | Ga0068863_100037268 | 3300005841 | Bacteria | 4630 |
| 249 | Ga0068863_100365270 | 3300005841 | Bacteria | 1408 |
| 250 | Ga0068863_100916996 | 3300005841 | Bacteria | 877 |
| 251 | Ga0068858_100164300 | 3300005842 | Bacteria | 2091 |
| 252 | Ga0068858_100232956 | 3300005842 | Bacteria | 1746 |
| 253 | Ga0068858_101050915 | 3300005842 | Unclassified | 799 |
| 254 | Ga0068860_100028404 | 3300005843 | Bacteria | 5384 |
| 255 | Ga0068860_100192759 | 3300005843 | Bacteria | 1973 |
| 256 | Ga0068860_100295886 | 3300005843 | Bacteria | 1585 |
| 257 | Ga0068860_100554667 | 3300005843 | Unclassified | 1151 |
| 258 | Ga0068862_100012521 | 3300005844 | Bacteria | 7021 |
| 259 | Ga0068862_100034938 | 3300005844 | Bacteria | 4255 |
| 260 | Ga0068862_100344161 | 3300005844 | Bacteria | 1382 |
| 261 | Ga0068862_100880869 | 3300005844 | Bacteria | 879 |
| 262 | Ga0070717_10320000 | 3300006028 | Bacteria | 1382 |
| 263 | Ga0070715_10790453 | 3300006163 | Bacteria | 575 |
| 264 | Ga0070716_100114965 | 3300006173 | Bacteria | 1674 |
| 265 | Ga0070712_100055548 | 3300006175 | Bacteria | 2774 |
| 266 | Ga0075366_10136992 | 3300006195 | Bacteria | 1478 |
| 267 | Ga0097621_100013004 | 3300006237 | Bacteria | 6187 |
| 268 | Ga0097621_100362425 | 3300006237 | Bacteria | 1291 |
| 269 | Ga0068871_100013255 | 3300006358 | Bacteria | 6113 |
| 270 | Ga0068871_100023199 | 3300006358 | Bacteria | 4795 |
| 271 | Ga0075429_100952659 | 3300006880 | Bacteria | 751 |
| 272 | Ga0068865_100364330 | 3300006881 | Bacteria | 1175 |
| 273 | Ga0097620_100028158 | 3300006931 | Bacteria | 5633 |
| 274 | Ga0097620_100048003 | 3300006931 | Bacteria | 4290 |
| 275 | Ga0097620_100573783 | 3300006931 | Unclassified | 1222 |
| 276 | Ga0105240_10056083 | 3300009093 | Bacteria | 4931 |
| 277 | Ga0105240_10211090 | 3300009093 | Bacteria | 2269 |
| 278 | Ga0105240_10224311 | 3300009093 | Bacteria | 2187 |
| 279 | Ga0111539_13473188 | 3300009094 | Unclassified | 506 |
| 280 | Ga0105245_10037973 | 3300009098 | Bacteria | 4283 |
| 281 | Ga0105245_10065426 | 3300009098 | Bacteria | 3288 |
| 282 | Ga0114129_10672017 | 3300009147 | Bacteria | 1334 |
| 283 | Ga0105243_10012496 | 3300009148 | Bacteria | 6420 |
| 284 | Ga0105243_10064552 | 3300009148 | Bacteria | 2938 |
| 285 | Ga0105243_10210720 | 3300009148 | Bacteria | 1711 |
| 286 | Ga0105241_10154098 | 3300009174 | Bacteria | 1882 |
| 287 | Ga0105241_10349370 | 3300009174 | Bacteria | 1283 |
| 288 | Ga0105241_11204122 | 3300009174 | Unclassified | 717 |
| 289 | Ga0105242_10054494 | 3300009176 | Bacteria | 3269 |
| 290 | Ga0105242_10324709 | 3300009176 | Bacteria | 1413 |
| 291 | Ga0105242_11410618 | 3300009176 | Bacteria | 724 |
| 292 | Ga0105248_10085838 | 3300009177 | Bacteria | 3542 |
| 293 | Ga0105248_10149205 | 3300009177 | Bacteria | 2638 |
| 294 | Ga0105248_10589610 | 3300009177 | Bacteria | 1254 |
| 295 | Ga0105248_11494295 | 3300009177 | Bacteria | 765 |
| 296 | Ga0105237_10029154 | 3300009545 | Bacteria | 5614 |
| 297 | Ga0105238_10016800 | 3300009551 | Bacteria | 7418 |
| 298 | Ga0105238_10070567 | 3300009551 | Bacteria | 3492 |
| 299 | Ga0105238_10324055 | 3300009551 | Bacteria | 1527 |
| 300 | Ga0105238_10457204 | 3300009551 | Bacteria | 1274 |
| 301 | Ga0105238_10556030 | 3300009551 | Bacteria | 1152 |
| 302 | Ga0105238_10658903 | 3300009551 | Bacteria | 1057 |
| 303 | Ga0105238_11398598 | 3300009551 | Bacteria | 727 |
| 304 | Ga0105249_10651164 | 3300009553 | Bacteria | 1111 |
| 305 | Ga0105249_12503674 | 3300009553 | Unclassified | 588 |
| 306 | Ga0105239_10081790 | 3300010375 | Bacteria | 3555 |
| 307 | Ga0105239_10083657 | 3300010375 | Bacteria | 3514 |
| 308 | Ga0105239_11762993 | 3300010375 | Bacteria | 717 |
| 309 | Ga0105246_10053188 | 3300011119 | Bacteria | 2786 |
| 310 | Ga0105246_10542597 | 3300011119 | Bacteria | 995 |
| 311 | Ga0157373_10012135 | 3300013100 | Bacteria | 6333 |
| 312 | Ga0157373_10012753 | 3300013100 | Bacteria | 6176 |
| 313 | Ga0157373_10068364 | 3300013100 | Bacteria | 2511 |
| 314 | Ga0157373_10083663 | 3300013100 | Bacteria | 2249 |
| 315 | Ga0157373_10137199 | 3300013100 | Bacteria | 1720 |
| 316 | Ga0157373_10158947 | 3300013100 | Bacteria | 1590 |
| 317 | Ga0157373_10256689 | 3300013100 | Bacteria | 1237 |
| 318 | Ga0157373_10471548 | 3300013100 | Bacteria | 905 |
| 319 | Ga0157373_11240516 | 3300013100 | Bacteria | 563 |
| 320 | Ga0157373_11515958 | 3300013100 | Unclassified | 512 |
| 321 | Ga0157371_10015031 | 3300013102 | Bacteria | 5818 |
| 322 | Ga0157371_10020854 | 3300013102 | Bacteria | 4820 |
| 323 | Ga0157371_10038044 | 3300013102 | Bacteria | 3443 |
| 324 | Ga0157371_10060879 | 3300013102 | Bacteria | 2676 |
| 325 | Ga0157371_10065257 | 3300013102 | Bacteria | 2578 |
| 326 | Ga0157371_10073976 | 3300013102 | Bacteria | 2413 |
| 327 | Ga0157371_10094710 | 3300013102 | Bacteria | 2116 |
| 328 | Ga0157371_10119389 | 3300013102 | Bacteria | 1874 |
| 329 | Ga0157371_10163424 | 3300013102 | Bacteria | 1590 |
| 330 | Ga0157371_10279714 | 3300013102 | Bacteria | 1205 |
| 331 | Ga0157371_10368839 | 3300013102 | Bacteria | 1047 |
| 332 | Ga0157371_11335813 | 3300013102 | Bacteria | 555 |
| 333 | Ga0157370_10048284 | 3300013104 | Bacteria | 4077 |
| 334 | Ga0157370_10048564 | 3300013104 | Bacteria | 4065 |
| 335 | Ga0157370_10065056 | 3300013104 | Bacteria | 3451 |
| 336 | Ga0157370_10086927 | 3300013104 | Bacteria | 2937 |
| 337 | Ga0157370_10089261 | 3300013104 | Bacteria | 2896 |
| 338 | Ga0157370_10139727 | 3300013104 | Bacteria | 2257 |
| 339 | Ga0157370_10577613 | 3300013104 | Bacteria | 1030 |
| 340 | Ga0157369_10007383 | 3300013105 | Bacteria | 12652 |
| 341 | Ga0157369_10031051 | 3300013105 | Bacteria | 5888 |
| 342 | Ga0157369_10067972 | 3300013105 | Bacteria | 3829 |
| 343 | Ga0157369_10125164 | 3300013105 | Bacteria | 2726 |
| 344 | Ga0157369_10132459 | 3300013105 | Bacteria | 2641 |
| 345 | Ga0157369_10135588 | 3300013105 | Bacteria | 2606 |
| 346 | Ga0157369_10208604 | 3300013105 | Bacteria | 2048 |
| 347 | Ga0157369_10213157 | 3300013105 | Bacteria | 2024 |
| 348 | Ga0157369_10472729 | 3300013105 | Bacteria | 1297 |
| 349 | Ga0157369_10610836 | 3300013105 | Bacteria | 1125 |
| 350 | Ga0157369_10649490 | 3300013105 | Bacteria | 1088 |
| 351 | Ga0157369_12073942 | 3300013105 | Bacteria | 577 |
| 352 | Ga0157369_12556255 | 3300013105 | Unclassified | 517 |
| 353 | Ga0157374_10050975 | 3300013296 | Bacteria | 3850 |
| 354 | Ga0157374_10079406 | 3300013296 | Bacteria | 3109 |
| 355 | Ga0157374_10107964 | 3300013296 | Bacteria | 2675 |
| 356 | Ga0157374_10464772 | 3300013296 | Bacteria | 1267 |
| 357 | Ga0157374_10564921 | 3300013296 | Bacteria | 1146 |
| 358 | Ga0157374_10987084 | 3300013296 | Unclassified | 861 |
| 359 | Ga0157374_11503172 | 3300013296 | Unclassified | 697 |
| 360 | Ga0157378_10021644 | 3300013297 | Bacteria | 5654 |
| 361 | Ga0157378_10033817 | 3300013297 | Bacteria | 4521 |
| 362 | Ga0163162_10056100 | 3300013306 | Bacteria | 3968 |
| 363 | Ga0163162_10161503 | 3300013306 | Bacteria | 2362 |
| 364 | Ga0157372_10008752 | 3300013307 | Bacteria | 10748 |
| 365 | Ga0157372_10065325 | 3300013307 | Bacteria | 4085 |
| 366 | Ga0157372_10185390 | 3300013307 | Bacteria | 2410 |
| 367 | Ga0157372_10988526 | 3300013307 | Bacteria | 975 |
| 368 | Ga0157372_11740037 | 3300013307 | Unclassified | 717 |
| 369 | Ga0157375_10016314 | 3300013308 | Bacteria | 6668 |
| 370 | Ga0157375_10027659 | 3300013308 | Bacteria | 5304 |
| 371 | Ga0157375_10312787 | 3300013308 | Bacteria | 1735 |
| 372 | Ga0157375_11810632 | 3300013308 | Bacteria | 724 |
| 373 | Ga0163163_10237948 | 3300014325 | Bacteria | 1870 |
| 374 | Ga0163163_10405083 | 3300014325 | Bacteria | 1422 |
| 375 | Ga0157380_10527351 | 3300014326 | Bacteria | 1153 |
| 376 | Ga0157377_10056992 | 3300014745 | Bacteria | 2220 |
| 377 | Ga0157377_10201160 | 3300014745 | Bacteria | 1265 |
| 378 | Ga0157379_11281722 | 3300014968 | Bacteria | 707 |
| 379 | Ga0157376_10185201 | 3300014969 | Bacteria | 1906 |
| 380 | Ga0157376_10492334 | 3300014969 | Bacteria | 1203 |
| 381 | Ga0157376_10717075 | 3300014969 | Unclassified | 1007 |
| 382 | Ga0163161_10571810 | 3300017792 | Unclassified | 929 |
| 383 | Ga0206354_11586023 | 3300020081 | Bacteria | 1471 |
| 384 | Ga0206353_10738842 | 3300020082 | Bacteria | 7517 |
| 385 | Ga0207697_10011008 | 3300025315 | Bacteria | 3839 |
| 386 | Ga0207697_10034325 | 3300025315 | Bacteria | 2077 |
| 387 | Ga0207697_10066762 | 3300025315 | Bacteria | 1503 |
| 388 | Ga0207697_10155131 | 3300025315 | Bacteria | 997 |
| 389 | Ga0207656_10025165 | 3300025321 | Bacteria | 2414 |
| 390 | Ga0207656_10275334 | 3300025321 | Bacteria | 829 |
| 391 | Ga0207656_10331235 | 3300025321 | Unclassified | 757 |
| 392 | Ga0207656_10540296 | 3300025321 | Unclassified | 593 |
| 393 | Ga0207682_10001342 | 3300025893 | Bacteria | 11341 |
| 394 | Ga0207642_10086534 | 3300025899 | Bacteria | 1536 |
| 395 | Ga0207710_10057212 | 3300025900 | Bacteria | 1761 |
| 396 | Ga0207688_10009382 | 3300025901 | Bacteria | 5329 |
| 397 | Ga0207688_10265839 | 3300025901 | Bacteria | 1042 |
| 398 | Ga0207688_10337600 | 3300025901 | Bacteria | 926 |
| 399 | Ga0207688_10734798 | 3300025901 | Bacteria | 625 |
| 400 | Ga0207680_10003327 | 3300025903 | Bacteria | 7573 |
| 401 | Ga0207680_10007066 | 3300025903 | Bacteria | 5454 |
| 402 | Ga0207680_10630441 | 3300025903 | Bacteria | 767 |
| 403 | Ga0207647_10019866 | 3300025904 | Bacteria | 4511 |
| 404 | Ga0207647_10038542 | 3300025904 | Bacteria | 3020 |
| 405 | Ga0207647_10073031 | 3300025904 | Bacteria | 2068 |
| 406 | Ga0207647_10219558 | 3300025904 | Bacteria | 1096 |
| 407 | Ga0207685_10519340 | 3300025905 | Bacteria | 629 |
| 408 | Ga0207699_10008885 | 3300025906 | Bacteria | 4980 |
| 409 | Ga0207645_10002319 | 3300025907 | Bacteria | 15052 |
| 410 | Ga0207645_10015407 | 3300025907 | Bacteria | 5079 |
| 411 | Ga0207645_10106104 | 3300025907 | Bacteria | 1816 |
| 412 | Ga0207645_10265082 | 3300025907 | Bacteria | 1138 |
| 413 | Ga0207643_10072411 | 3300025908 | Bacteria | 1985 |
| 414 | Ga0207643_10150036 | 3300025908 | Bacteria | 1397 |
| 415 | Ga0207705_10021914 | 3300025909 | Bacteria | 4558 |
| 416 | Ga0207705_10033619 | 3300025909 | Bacteria | 3664 |
| 417 | Ga0207705_10080315 | 3300025909 | Bacteria | 2376 |
| 418 | Ga0207705_10103966 | 3300025909 | Bacteria | 2092 |
| 419 | Ga0207705_10111793 | 3300025909 | Bacteria | 2019 |
| 420 | Ga0207705_10138049 | 3300025909 | Bacteria | 1819 |
| 421 | Ga0207705_10166359 | 3300025909 | Bacteria | 1658 |
| 422 | Ga0207705_10482361 | 3300025909 | Bacteria | 962 |
| 423 | Ga0207684_10159692 | 3300025910 | Bacteria | 1941 |
| 424 | Ga0207654_10598661 | 3300025911 | Bacteria | 786 |
| 425 | Ga0207654_10848306 | 3300025911 | Unclassified | 661 |
| 426 | Ga0207707_10051960 | 3300025912 | Bacteria | 3569 |
| 427 | Ga0207707_10129047 | 3300025912 | Bacteria | 2211 |
| 428 | Ga0207707_10172177 | 3300025912 | Bacteria | 1892 |
| 429 | Ga0207707_10287192 | 3300025912 | Bacteria | 1424 |
| 430 | Ga0207707_10419268 | 3300025912 | Bacteria | 1148 |
| 431 | Ga0207707_10423305 | 3300025912 | Bacteria | 1141 |
| 432 | Ga0207695_10039931 | 3300025913 | Bacteria | 5039 |
| 433 | Ga0207695_10115246 | 3300025913 | Bacteria | 2662 |
| 434 | Ga0207695_10543926 | 3300025913 | Bacteria | 1043 |
| 435 | Ga0207671_10489321 | 3300025914 | Bacteria | 981 |
| 436 | Ga0207660_10000059 | 3300025917 | Bacteria | 56766 |
| 437 | Ga0207660_10001202 | 3300025917 | Bacteria | 17345 |
| 438 | Ga0207660_10009838 | 3300025917 | Bacteria | 6191 |
| 439 | Ga0207660_10078092 | 3300025917 | Bacteria | 2425 |
| 440 | Ga0207660_10537099 | 3300025917 | Bacteria | 950 |
| 441 | Ga0207662_10023202 | 3300025918 | Bacteria | 3563 |
| 442 | Ga0207657_10012830 | 3300025919 | Bacteria | 8246 |
| 443 | Ga0207657_10014934 | 3300025919 | Bacteria | 7546 |
| 444 | Ga0207657_10029689 | 3300025919 | Bacteria | 4973 |
| 445 | Ga0207657_10031052 | 3300025919 | Bacteria | 4843 |
| 446 | Ga0207657_10034236 | 3300025919 | Bacteria | 4571 |
| 447 | Ga0207657_10036827 | 3300025919 | Bacteria | 4376 |
| 448 | Ga0207657_10093145 | 3300025919 | Bacteria | 2510 |
| 449 | Ga0207657_10145426 | 3300025919 | Bacteria | 1934 |
| 450 | Ga0207657_10725073 | 3300025919 | Bacteria | 771 |
| 451 | Ga0207657_10736022 | 3300025919 | Unclassified | 764 |
| 452 | Ga0207657_11313120 | 3300025919 | Unclassified | 546 |
| 453 | Ga0207649_10027742 | 3300025920 | Bacteria | 3327 |
| 454 | Ga0207649_10044044 | 3300025920 | Bacteria | 2731 |
| 455 | Ga0207649_10107540 | 3300025920 | Bacteria | 1857 |
| 456 | Ga0207649_10125061 | 3300025920 | Bacteria | 1739 |
| 457 | Ga0207649_10343523 | 3300025920 | Bacteria | 1103 |
| 458 | Ga0207649_10565012 | 3300025920 | Bacteria | 872 |
| 459 | Ga0207649_10840692 | 3300025920 | Bacteria | 718 |
| 460 | Ga0207649_10857960 | 3300025920 | Unclassified | 711 |
| 461 | Ga0207652_10018990 | 3300025921 | Bacteria | 5645 |
| 462 | Ga0207652_10124163 | 3300025921 | Bacteria | 2299 |
| 463 | Ga0207652_10276410 | 3300025921 | Bacteria | 1515 |
| 464 | Ga0207652_10706897 | 3300025921 | Bacteria | 899 |
| 465 | Ga0207652_11193810 | 3300025921 | Bacteria | 662 |
| 466 | Ga0207681_10008022 | 3300025923 | Bacteria | 6460 |
| 467 | Ga0207681_10031395 | 3300025923 | Bacteria | 3469 |
| 468 | Ga0207681_10830529 | 3300025923 | Bacteria | 772 |
| 469 | Ga0207694_10000966 | 3300025924 | Bacteria | 25308 |
| 470 | Ga0207694_10330707 | 3300025924 | Bacteria | 1259 |
| 471 | Ga0207694_10594715 | 3300025924 | Bacteria | 930 |
| 472 | Ga0207694_11594506 | 3300025924 | Bacteria | 550 |
| 473 | Ga0207650_10004781 | 3300025925 | Bacteria | 9254 |
| 474 | Ga0207650_10019021 | 3300025925 | Bacteria | 4828 |
| 475 | Ga0207650_10075522 | 3300025925 | Bacteria | 2543 |
| 476 | Ga0207659_10196454 | 3300025926 | Bacteria | 1608 |
| 477 | Ga0207687_10107523 | 3300025927 | Bacteria | 2064 |
| 478 | Ga0207687_10160373 | 3300025927 | Bacteria | 1725 |
| 479 | Ga0207687_10169601 | 3300025927 | Bacteria | 1682 |
| 480 | Ga0207700_10115712 | 3300025928 | Bacteria | 2166 |
| 481 | Ga0207700_10258425 | 3300025928 | Bacteria | 1490 |
| 482 | Ga0207700_10462894 | 3300025928 | Bacteria | 1119 |
| 483 | Ga0207664_10013598 | 3300025929 | Bacteria | 5850 |
| 484 | Ga0207664_10016311 | 3300025929 | Bacteria | 5417 |
| 485 | Ga0207664_10023570 | 3300025929 | Bacteria | 4614 |
| 486 | Ga0207664_10116219 | 3300025929 | Bacteria | 2232 |
| 487 | Ga0207664_10125235 | 3300025929 | Bacteria | 2156 |
| 488 | Ga0207664_10609540 | 3300025929 | Bacteria | 980 |
| 489 | Ga0207644_10000142 | 3300025931 | Bacteria | 51611 |
| 490 | Ga0207644_10554064 | 3300025931 | Bacteria | 952 |
| 491 | Ga0207690_10002953 | 3300025932 | Bacteria | 10245 |
| 492 | Ga0207690_10046793 | 3300025932 | Bacteria | 2867 |
| 493 | Ga0207690_10088152 | 3300025932 | Bacteria | 2185 |
| 494 | Ga0207690_10125542 | 3300025932 | Bacteria | 1870 |
| 495 | Ga0207690_10269397 | 3300025932 | Bacteria | 1322 |
| 496 | Ga0207690_10299348 | 3300025932 | Unclassified | 1258 |
| 497 | Ga0207690_10429579 | 3300025932 | Bacteria | 1058 |
| 498 | Ga0207690_10447098 | 3300025932 | Bacteria | 1038 |
| 499 | Ga0207690_10472911 | 3300025932 | Bacteria | 1010 |
| 500 | Ga0207706_10005721 | 3300025933 | Bacteria | 11580 |
| 501 | Ga0207706_10019092 | 3300025933 | Bacteria | 6166 |
| 502 | Ga0207706_10037307 | 3300025933 | Bacteria | 4316 |
| 503 | Ga0207706_10086882 | 3300025933 | Bacteria | 2749 |
| 504 | Ga0207706_10145933 | 3300025933 | Bacteria | 2081 |
| 505 | Ga0207706_10451867 | 3300025933 | Unclassified | 1111 |
| 506 | Ga0207686_10301444 | 3300025934 | Bacteria | 1190 |
| 507 | Ga0207709_10572962 | 3300025935 | Bacteria | 891 |
| 508 | Ga0207709_10705767 | 3300025935 | Bacteria | 808 |
| 509 | Ga0207669_10018773 | 3300025937 | Bacteria | 3584 |
| 510 | Ga0207669_10065902 | 3300025937 | Bacteria | 2249 |
| 511 | Ga0207704_10016287 | 3300025938 | Bacteria | 3817 |
| 512 | Ga0207665_10100078 | 3300025939 | Bacteria | 2022 |
| 513 | Ga0207691_10006169 | 3300025940 | Bacteria | 11586 |
| 514 | Ga0207691_10024129 | 3300025940 | Bacteria | 5719 |
| 515 | Ga0207691_10043385 | 3300025940 | Bacteria | 4145 |
| 516 | Ga0207691_10044757 | 3300025940 | Bacteria | 4073 |
| 517 | Ga0207691_11592727 | 3300025940 | Bacteria | 531 |
| 518 | Ga0207711_10029289 | 3300025941 | Bacteria | 4642 |
| 519 | Ga0207711_10171135 | 3300025941 | Bacteria | 1971 |
| 520 | Ga0207711_10350779 | 3300025941 | Bacteria | 1366 |
| 521 | Ga0207711_10386494 | 3300025941 | Bacteria | 1299 |
| 522 | Ga0207711_10798801 | 3300025941 | Bacteria | 879 |
| 523 | Ga0207689_10012587 | 3300025942 | Bacteria | 7226 |
| 524 | Ga0207689_10047729 | 3300025942 | Bacteria | 3533 |
| 525 | Ga0207661_10071102 | 3300025944 | Bacteria | 2842 |
| 526 | Ga0207661_10085121 | 3300025944 | Bacteria | 2620 |
| 527 | Ga0207661_10231631 | 3300025944 | Bacteria | 1636 |
| 528 | Ga0207679_10016598 | 3300025945 | Bacteria | 4893 |
| 529 | Ga0207679_10107503 | 3300025945 | Bacteria | 2195 |
| 530 | Ga0207679_10314524 | 3300025945 | Bacteria | 1354 |
| 531 | Ga0207679_10318756 | 3300025945 | Bacteria | 1345 |
| 532 | Ga0207679_11253184 | 3300025945 | Bacteria | 681 |
| 533 | Ga0207667_10005262 | 3300025949 | Bacteria | 15787 |
| 534 | Ga0207667_10029624 | 3300025949 | Bacteria | 5935 |
| 535 | Ga0207667_10039670 | 3300025949 | Bacteria | 5017 |
| 536 | Ga0207667_10040206 | 3300025949 | Bacteria | 4980 |
| 537 | Ga0207667_10098120 | 3300025949 | Bacteria | 3023 |
| 538 | Ga0207667_10338450 | 3300025949 | Bacteria | 1536 |
| 539 | Ga0207667_11101816 | 3300025949 | Bacteria | 777 |
| 540 | Ga0207651_10005732 | 3300025960 | Bacteria | 6414 |
| 541 | Ga0207651_10010290 | 3300025960 | Bacteria | 5175 |
| 542 | Ga0207651_10426995 | 3300025960 | Bacteria | 1132 |
| 543 | Ga0207651_10973357 | 3300025960 | Bacteria | 757 |
| 544 | Ga0207712_10510139 | 3300025961 | Bacteria | 1029 |
| 545 | Ga0207668_10018267 | 3300025972 | Bacteria | 4408 |
| 546 | Ga0207668_10261158 | 3300025972 | Unclassified | 1411 |
| 547 | Ga0207668_10368207 | 3300025972 | Bacteria | 1206 |
| 548 | Ga0207640_10062397 | 3300025981 | Bacteria | 2473 |
| 549 | Ga0207640_10067242 | 3300025981 | Bacteria | 2397 |
| 550 | Ga0207640_10100206 | 3300025981 | Bacteria | 2029 |
| 551 | Ga0207640_10244932 | 3300025981 | Bacteria | 1388 |
| 552 | Ga0207640_10264000 | 3300025981 | Bacteria | 1343 |
| 553 | Ga0207640_10339783 | 3300025981 | Bacteria | 1202 |
| 554 | Ga0207640_10471741 | 3300025981 | Bacteria | 1039 |
| 555 | Ga0207640_11193247 | 3300025981 | Bacteria | 676 |
| 556 | Ga0207658_10027405 | 3300025986 | Bacteria | 4002 |
| 557 | Ga0207658_10920118 | 3300025986 | Bacteria | 796 |
| 558 | Ga0207677_10005002 | 3300026023 | Bacteria | 7159 |
| 559 | Ga0207677_10077416 | 3300026023 | Bacteria | 2372 |
| 560 | Ga0207677_10298819 | 3300026023 | Bacteria | 1329 |
| 561 | Ga0207677_10955081 | 3300026023 | Bacteria | 775 |
| 562 | Ga0207677_10982498 | 3300026023 | Unclassified | 765 |
| 563 | Ga0207703_10241762 | 3300026035 | Bacteria | 1623 |
| 564 | Ga0207639_10000744 | 3300026041 | Bacteria | 22249 |
| 565 | Ga0207639_10154043 | 3300026041 | Bacteria | 1928 |
| 566 | Ga0207639_10276366 | 3300026041 | Bacteria | 1475 |
| 567 | Ga0207639_10836987 | 3300026041 | Bacteria | 858 |
| 568 | Ga0207639_11020424 | 3300026041 | Unclassified | 775 |
| 569 | Ga0207678_10008634 | 3300026067 | Bacteria | 8980 |
| 570 | Ga0207678_10010248 | 3300026067 | Bacteria | 8226 |
| 571 | Ga0207678_10032194 | 3300026067 | Bacteria | 4570 |
| 572 | Ga0207678_10058363 | 3300026067 | Bacteria | 3321 |
| 573 | Ga0207678_10067799 | 3300026067 | Bacteria | 3062 |
| 574 | Ga0207702_10043057 | 3300026078 | Bacteria | 3789 |
| 575 | Ga0207702_10150028 | 3300026078 | Bacteria | 2119 |
| 576 | Ga0207702_10153445 | 3300026078 | Bacteria | 2097 |
| 577 | Ga0207702_10176712 | 3300026078 | Bacteria | 1963 |
| 578 | Ga0207702_10204038 | 3300026078 | Bacteria | 1834 |
| 579 | Ga0207702_10271492 | 3300026078 | Bacteria | 1600 |
| 580 | Ga0207702_10501619 | 3300026078 | Bacteria | 1183 |
| 581 | Ga0207702_10698785 | 3300026078 | Bacteria | 999 |
| 582 | Ga0207702_11014447 | 3300026078 | Bacteria | 823 |
| 583 | Ga0207702_11247363 | 3300026078 | Bacteria | 737 |
| 584 | Ga0207641_10006875 | 3300026088 | Bacteria | 9522 |
| 585 | Ga0207641_10025415 | 3300026088 | Bacteria | 4883 |
| 586 | Ga0207641_10067548 | 3300026088 | Bacteria | 3063 |
| 587 | Ga0207641_10170134 | 3300026088 | Bacteria | 1988 |
| 588 | Ga0207641_10856120 | 3300026088 | Bacteria | 901 |
| 589 | Ga0207648_10002458 | 3300026089 | Bacteria | 19911 |
| 590 | Ga0207648_10011602 | 3300026089 | Bacteria | 8297 |
| 591 | Ga0207648_10019695 | 3300026089 | Bacteria | 6088 |
| 592 | Ga0207676_10097044 | 3300026095 | Bacteria | 2434 |
| 593 | Ga0207676_10348835 | 3300026095 | Bacteria | 1368 |
| 594 | Ga0207676_10674280 | 3300026095 | Bacteria | 999 |
| 595 | Ga0207674_10000065 | 3300026116 | Bacteria | 109485 |
| 596 | Ga0207674_10002824 | 3300026116 | Bacteria | 21598 |
| 597 | Ga0207674_10003445 | 3300026116 | Bacteria | 19357 |
| 598 | Ga0207674_10014766 | 3300026116 | Bacteria | 8616 |
| 599 | Ga0207674_10235128 | 3300026116 | Bacteria | 1780 |
| 600 | Ga0207674_10434534 | 3300026116 | Bacteria | 1269 |
| 601 | Ga0207674_11208187 | 3300026116 | Unclassified | 726 |
| 602 | Ga0207675_100036554 | 3300026118 | Bacteria | 4581 |
| 603 | Ga0207675_100147162 | 3300026118 | Bacteria | 2240 |
| 604 | Ga0207675_100340165 | 3300026118 | Bacteria | 1469 |
| 605 | Ga0207683_10002271 | 3300026121 | Bacteria | 16845 |
| 606 | Ga0207683_10013861 | 3300026121 | Bacteria | 6875 |
| 607 | Ga0207683_10025083 | 3300026121 | Bacteria | 5141 |
| 608 | Ga0207683_10026610 | 3300026121 | Bacteria | 4994 |
| 609 | Ga0207698_10003907 | 3300026142 | Bacteria | 9024 |
| 610 | Ga0207698_10011411 | 3300026142 | Bacteria | 5761 |
| 611 | Ga0207698_10011695 | 3300026142 | Bacteria | 5704 |
| 612 | Ga0207698_10036738 | 3300026142 | Bacteria | 3599 |
| 613 | Ga0207698_10079985 | 3300026142 | Bacteria | 2631 |
| 614 | Ga0207698_10093067 | 3300026142 | Bacteria | 2474 |
| 615 | Ga0207698_10223892 | 3300026142 | Bacteria | 1702 |
| 616 | Ga0207698_10545829 | 3300026142 | Bacteria | 1135 |
| 617 | Ga0207698_10606264 | 3300026142 | Bacteria | 1080 |
| 618 | Ga0207698_10683636 | 3300026142 | Bacteria | 1020 |
| 619 | Ga0207698_11053160 | 3300026142 | Bacteria | 825 |
| 620 | Ga0268266_10045835 | 3300028379 | Bacteria | 3742 |
| 621 | Ga0268266_10057167 | 3300028379 | Bacteria | 3356 |
| 622 | Ga0268265_10077818 | 3300028380 | Bacteria | 2606 |
| 623 | Ga0268265_10092192 | 3300028380 | Bacteria | 2424 |
| 624 | Ga0268265_10169604 | 3300028380 | Bacteria | 1864 |
| 625 | Ga0268264_10020803 | 3300028381 | Bacteria | 5362 |
| 626 | Ga0268264_10106161 | 3300028381 | Bacteria | 2451 |
| 627 | Ga0307413_10638425 | 3300031824 | Bacteria | 877 |
| 628 | Ga0307407_10149918 | 3300031903 | Bacteria | 1514 |
| 629 | Ga0307409_100115233 | 3300031995 | Bacteria | 2262 |
| 630 | Ga0307409_102729320 | 3300031995 | Unclassified | 522 |
| 631 | Ga0307414_10438030 | 3300032004 | Bacteria | 1143 |
| 632 | Ga0307411_10037200 | 3300032005 | Bacteria | 3058 |
| 633 | Ga0373948_0152515 | 3300034817 | Unclassified | 578 |
| 634 | Ga0373938_0199973 | 3300034957 | Unclassified | 553 |
| 635 | Ga0373952_0160837 | 3300035092 | Bacteria | 636 |
| 636 | Ga0373952_0290951 | 3300035092 | Unclassified | 506 |
| 637 | Ga0373960_0069579 | 3300035121 | Bacteria | 1086 |
| 638 | Ga0373943_0011671 | 3300035170 | Bacteria | 3955 |
| 639 | Ga0373946_0011556 | 3300035171 | Bacteria | 3297 |
| 640 | Ga0373942_0099976 | 3300035207 | Unclassified | 885 |
| 641 | Ga0373931_0051628 | 3300035691 | Bacteria | 2191 |
| 642 | Ga0373931_0784072 | 3300035691 | Bacteria | 634 |
| 643 | Ga0373935_0006536 | 3300035692 | Bacteria | 6964 |
| 644 | Ga0373935_0020199 | 3300035692 | Bacteria | 4067 |
| 645 | Ga0373927_0022086 | 3300035695 | Bacteria | 4170 |
| 646 | Ga0373947_0006264 | 3300035725 | Bacteria | 6916 |
| 647 | Ga0373937_1473378 | 3300036401 | Bacteria | 628 |
| 648 | Ga0373937_1474027 | 3300036401 | Unclassified | 628 |
| 649 | Ga0373925_0249024 | 3300037068 | Bacteria | 1424 |
| 650 | Ga0395899_0000113 | 3300037312 | Bacteria | 136163 |
| 651 | Ga0395899_0006469 | 3300037312 | Bacteria | 9076 |
| 652 | Ga0395899_0013449 | 3300037312 | Bacteria | 6260 |
| 653 | Ga0395899_0019176 | 3300037312 | Bacteria | 5198 |
| 654 | Ga0395899_0020590 | 3300037312 | Bacteria | 5000 |
| 655 | Ga0395899_0060907 | 3300037312 | Bacteria | 2780 |
| 656 | Ga0395899_0063573 | 3300037312 | Bacteria | 2715 |
| 657 | Ga0395899_0066680 | 3300037312 | Bacteria | 2642 |
| 658 | Ga0395899_0100246 | 3300037312 | Bacteria | 2091 |
| 659 | Ga0395899_0106552 | 3300037312 | Bacteria | 2018 |
| 660 | Ga0395899_0109688 | 3300037312 | Bacteria | 1985 |
| 661 | Ga0395899_0284882 | 3300037312 | Bacteria | 1123 |
| 662 | Ga0395899_0959713 | 3300037312 | Unclassified | 518 |
| 663 | Ga0395900_0000365 | 3300037418 | Bacteria | 65054 |
| 664 | Ga0395900_0000964 | 3300037418 | Bacteria | 37445 |
| 665 | Ga0395900_0008087 | 3300037418 | Bacteria | 10828 |
| 666 | Ga0395900_0011278 | 3300037418 | Bacteria | 9140 |
| 667 | Ga0395900_0013562 | 3300037418 | Bacteria | 8325 |
| 668 | Ga0395900_0023762 | 3300037418 | Bacteria | 6270 |
| 669 | Ga0395900_0024613 | 3300037418 | Bacteria | 6161 |
| 670 | Ga0395900_0056333 | 3300037418 | Bacteria | 4046 |
| 671 | Ga0395900_0069852 | 3300037418 | Bacteria | 3610 |
| 672 | Ga0395900_0086813 | 3300037418 | Bacteria | 3215 |
| 673 | Ga0395900_0091354 | 3300037418 | Bacteria | 3129 |
| 674 | Ga0395900_0093890 | 3300037418 | Bacteria | 3081 |
| 675 | Ga0395900_0158283 | 3300037418 | Bacteria | 2312 |
| 676 | Ga0395900_0167586 | 3300037418 | Bacteria | 2238 |
| 677 | Ga0395900_0198808 | 3300037418 | Bacteria | 2029 |
| 678 | Ga0395900_0252090 | 3300037418 | Unclassified | 1766 |
| 679 | Ga0395900_0353100 | 3300037418 | Bacteria | 1443 |
| 680 | Ga0395900_0513194 | 3300037418 | Unclassified | 1147 |
| 681 | Ga0395900_0692766 | 3300037418 | Bacteria | 953 |
| 682 | Ga0395900_1335932 | 3300037418 | Unclassified | 630 |
| 683 | Ga0395900_1458714 | 3300037418 | Bacteria | 597 |
| 684 | Ga0395898_0000306 | 3300037466 | Bacteria | 115940 |
| 685 | Ga0395898_0008363 | 3300037466 | Bacteria | 10939 |
| 686 | Ga0395898_0022122 | 3300037466 | Bacteria | 6441 |
| 687 | Ga0395898_0038340 | 3300037466 | Bacteria | 4750 |
| 688 | Ga0395898_0049745 | 3300037466 | Bacteria | 4106 |
| 689 | Ga0395898_0088936 | 3300037466 | Bacteria | 2973 |
| 690 | Ga0395898_0247782 | 3300037466 | Bacteria | 1699 |
| 691 | Ga0395898_0256801 | 3300037466 | Bacteria | 1666 |
| 692 | Ga0395898_0281130 | 3300037466 | Bacteria | 1587 |
| 693 | Ga0395898_0329735 | 3300037466 | Bacteria | 1455 |
| 694 | Ga0395898_0476492 | 3300037466 | Bacteria | 1187 |
| 695 | Ga0395898_0746893 | 3300037466 | Bacteria | 920 |
| 696 | Ga0395898_0919109 | 3300037466 | Bacteria | 813 |
| 697 | Ga0395898_1290038 | 3300037466 | Unclassified | 660 |
| 698 | Ga0395898_1292840 | 3300037466 | Unclassified | 659 |
| 699 | Ga0395905_0000005 | 3300037471 | Bacteria | 557808 |
| 700 | Ga0395905_0002956 | 3300037471 | Bacteria | 18463 |
| 701 | Ga0395905_0009966 | 3300037471 | Bacteria | 9258 |
| 702 | Ga0395905_0011079 | 3300037471 | Bacteria | 8728 |
| 703 | Ga0395905_0016924 | 3300037471 | Bacteria | 6925 |
| 704 | Ga0395905_0019166 | 3300037471 | Bacteria | 6488 |
| 705 | Ga0395905_0021922 | 3300037471 | Bacteria | 6041 |
| 706 | Ga0395905_0026212 | 3300037471 | Bacteria | 5497 |
| 707 | Ga0395905_0026426 | 3300037471 | Bacteria | 5473 |
| 708 | Ga0395905_0032743 | 3300037471 | Bacteria | 4886 |
| 709 | Ga0395905_0039456 | 3300037471 | Bacteria | 4429 |
| 710 | Ga0395905_0058925 | 3300037471 | Bacteria | 3590 |
| 711 | Ga0395905_0059475 | 3300037471 | Bacteria | 3572 |
| 712 | Ga0395905_0088779 | 3300037471 | Bacteria | 2897 |
| 713 | Ga0395905_0131320 | 3300037471 | Bacteria | 2355 |
| 714 | Ga0395905_0153323 | 3300037471 | Bacteria | 2167 |
| 715 | Ga0395905_0200174 | 3300037471 | Bacteria | 1872 |
| 716 | Ga0395905_0231601 | 3300037471 | Bacteria | 1727 |
| 717 | Ga0395905_0399924 | 3300037471 | Bacteria | 1268 |
| 718 | Ga0395905_0968691 | 3300037471 | Bacteria | 754 |
| 719 | Ga0395905_0997386 | 3300037471 | Bacteria | 740 |
| 720 | Ga0395905_1230778 | 3300037471 | Unclassified | 652 |
| 721 | Ga0395905_1618297 | 3300037471 | Unclassified | 552 |
| 722 | Ga0395905_1786056 | 3300037471 | Unclassified | 520 |
| 723 | Ga0395901_0000248 | 3300038443 | Bacteria | 67155 |
| 724 | Ga0395901_0001201 | 3300038443 | Bacteria | 27555 |
| 725 | Ga0395901_0005488 | 3300038443 | Bacteria | 12849 |
| 726 | Ga0395901_0012068 | 3300038443 | Bacteria | 8766 |
| 727 | Ga0395901_0020064 | 3300038443 | Bacteria | 6839 |
| 728 | Ga0395901_0033619 | 3300038443 | Bacteria | 5294 |
| 729 | Ga0395901_0036467 | 3300038443 | Bacteria | 5083 |
| 730 | Ga0395901_0037974 | 3300038443 | Bacteria | 4981 |
| 731 | Ga0395901_0053500 | 3300038443 | Bacteria | 4194 |
| 732 | Ga0395901_0071571 | 3300038443 | Bacteria | 3613 |
| 733 | Ga0395901_0112322 | 3300038443 | Bacteria | 2861 |
| 734 | Ga0395901_0188653 | 3300038443 | Bacteria | 2162 |
| 735 | Ga0395901_0221755 | 3300038443 | Bacteria | 1976 |
| 736 | Ga0395901_0230144 | 3300038443 | Bacteria | 1935 |
| 737 | Ga0395901_0232464 | 3300038443 | Bacteria | 1924 |
| 738 | Ga0395901_0264959 | 3300038443 | Bacteria | 1788 |
| 739 | Ga0395901_0266208 | 3300038443 | Bacteria | 1783 |
| 740 | Ga0395901_0320938 | 3300038443 | Bacteria | 1602 |
| 741 | Ga0395901_0368635 | 3300038443 | Bacteria | 1480 |
| 742 | Ga0395901_0963436 | 3300038443 | Bacteria | 831 |
| 743 | Ga0395901_1348648 | 3300038443 | Bacteria | 673 |
| 744 | Ga0395901_1584638 | 3300038443 | Unclassified | 609 |
| 745 | Ga0395901_1585893 | 3300038443 | Bacteria | 608 |
| 746 | Ga0395901_1695383 | 3300038443 | Unclassified | 583 |
| 747 | Ga0450905_000308 | 3300042142 | Bacteria | 5840 |
| 748 | Ga0450889_000193 | 3300042144 | Bacteria | 6640 |
| 749 | Ga0439464_0000878 | 3300042439 | Bacteria | 6694 |
| 750 | Ga0450916_011021 | 3300042530 | Bacteria | 1137 |
| 751 | Ga0466969_0053432 | 3300044656 | Bacteria | 1982 |
| 752 | Ga0466969_0236065 | 3300044656 | Bacteria | 830 |
| 753 | Ga0466972_0013931 | 3300044658 | Bacteria | 4033 |
| 754 | Ga0466972_0333981 | 3300044658 | Unclassified | 709 |
| 755 | Ga0466965_0146056 | 3300044683 | Bacteria | 1234 |
| 756 | Ga0466966_0014830 | 3300044684 | Bacteria | 5157 |
| 757 | Ga0466966_0115883 | 3300044684 | Bacteria | 1649 |
| 758 | Ga0466966_0206842 | 3300044684 | Bacteria | 1187 |
| 759 | Ga0466966_0379329 | 3300044684 | Bacteria | 849 |
| 760 | Ga0466966_0535935 | 3300044684 | Bacteria | 704 |
| 761 | Ga0466961_0019333 | 3300044693 | Bacteria | 4383 |
| 762 | Ga0466961_0067398 | 3300044693 | Bacteria | 2273 |
| 763 | Ga0466961_0071576 | 3300044693 | Bacteria | 2200 |
| 764 | Ga0466963_0011010 | 3300044694 | Bacteria | 5499 |
| 765 | Ga0466963_0026975 | 3300044694 | Bacteria | 3674 |
| 766 | Ga0466963_0073469 | 3300044694 | Bacteria | 2305 |
| 767 | Ga0466963_0106910 | 3300044694 | Bacteria | 1919 |
| 768 | Ga0466963_0109725 | 3300044694 | Bacteria | 1893 |
| 769 | Ga0466963_0200529 | 3300044694 | Bacteria | 1396 |
| 770 | Ga0466963_0312157 | 3300044694 | Bacteria | 1106 |
| 771 | Ga0466963_1223523 | 3300044694 | Unclassified | 527 |
| 772 | Ga0466964_0012076 | 3300044706 | Bacteria | 3268 |
| 773 | Ga0466971_0008654 | 3300044719 | Bacteria | 4441 |
| 774 | Ga0466968_0014457 | 3300044735 | Bacteria | 3120 |
| 775 | Ga0466970_0042966 | 3300044765 | Bacteria | 2404 |
| 776 | Ga0466957_0010249 | 3300044842 | Bacteria | 5371 |
| 777 | Ga0466957_0010341 | 3300044842 | Bacteria | 5351 |
| 778 | Ga0466957_0086722 | 3300044842 | Bacteria | 1956 |
| 779 | Ga0466957_0147311 | 3300044842 | Bacteria | 1520 |
| 780 | Ga0466957_0388337 | 3300044842 | Bacteria | 953 |
| 781 | Ga0466960_0024453 | 3300044901 | Bacteria | 2724 |
| 782 | Ga0466959_0015101 | 3300045049 | Bacteria | 5626 |
| 783 | Ga0466959_0129688 | 3300045049 | Bacteria | 1787 |
| 784 | Ga0466959_0992697 | 3300045049 | Unclassified | 559 |
| 785 | Ga0466958_0004622 | 3300045836 | Bacteria | 7295 |
| 786 | Ga0466958_0032876 | 3300045836 | Bacteria | 3088 |
| 787 | Ga0466958_0094076 | 3300045836 | Bacteria | 1856 |
| 788 | Ga0466958_0160209 | 3300045836 | Bacteria | 1421 |
| 789 | Ga0466967_0031731 | 3300045976 | Bacteria | 4452 |
| 790 | Ga0466967_0048036 | 3300045976 | Bacteria | 3725 |
| 791 | Ga0466967_0059029 | 3300045976 | Bacteria | 3393 |
| 792 | Ga0466967_0077920 | 3300045976 | Bacteria | 2985 |
| 793 | Ga0466967_0092983 | 3300045976 | Bacteria | 2743 |
| 794 | Ga0466967_0107463 | 3300045976 | Bacteria | 2559 |
| 795 | Ga0466967_0115004 | 3300045976 | Bacteria | 2477 |
| 796 | Ga0466967_0142167 | 3300045976 | Bacteria | 2236 |
| 797 | Ga0466967_0142274 | 3300045976 | Bacteria | 2235 |
| 798 | Ga0466967_0160602 | 3300045976 | Bacteria | 2109 |
| 799 | Ga0466967_0182596 | 3300045976 | Bacteria | 1980 |
| 800 | Ga0466967_0418201 | 3300045976 | Bacteria | 1306 |
| 801 | Ga0466967_0476505 | 3300045976 | Bacteria | 1222 |
| 802 | Ga0466967_0570544 | 3300045976 | Bacteria | 1115 |
| 803 | Ga0466967_0824391 | 3300045976 | Bacteria | 921 |
| 804 | Ga0466967_0857472 | 3300045976 | Unclassified | 903 |
| 805 | Ga0495643_0148301 | 3300046522 | Bacteria | 1164 |
| 806 | Ga0495663_0259036 | 3300046525 | Unclassified | 619 |
| 807 | Ga0495586_0575452 | 3300046535 | Bacteria | 650 |
| 808 | Ga0495587_0666300 | 3300046536 | Unclassified | 571 |
| 809 | Ga0495621_0000060 | 3300046539 | Bacteria | 21095 |
| 810 | Ga0495633_0027524 | 3300046558 | Bacteria | 2779 |
| 811 | Ga0495659_0023971 | 3300046664 | Bacteria | 2077 |
| 812 | Ga0495669_0027423 | 3300046684 | Bacteria | 2492 |
| 813 | Ga0495669_0162582 | 3300046684 | Bacteria | 1060 |
| 814 | Ga0495670_0000649 | 3300046691 | Bacteria | 16588 |
| 815 | Ga0496100_0001630 | 3300048903 | Bacteria | 11108 |
| 816 | Ga0496101_0002764 | 3300048904 | Bacteria | 10775 |
| 817 | Ga0496101_0113492 | 3300048904 | Bacteria | 2042 |
| 818 | Ga0496102_0029658 | 3300048905 | Bacteria | 4896 |
| 819 | Ga0496103_0059996 | 3300048906 | Bacteria | 2364 |
| 820 | Ga0496104_0025877 | 3300048907 | Bacteria | 5412 |
| 821 | Ga0496105_0116908 | 3300048908 | Bacteria | 2199 |
| 822 | Ga0496106_0019173 | 3300048909 | Bacteria | 5072 |
| 823 | Ga0496107_0000863 | 3300048910 | Bacteria | 17819 |
| 824 | Ga0496107_0221134 | 3300048910 | Bacteria | 1409 |
| 825 | Ga0496107_0633147 | 3300048910 | Unclassified | 789 |
| 826 | Ga0496108_0000954 | 3300048911 | Bacteria | 22471 |
| 827 | Ga0496109_0008004 | 3300048912 | Bacteria | 8962 |
| 828 | Ga0496109_0349477 | 3300048912 | Bacteria | 1397 |
| 829 | Ga0496109_1069929 | 3300048912 | Bacteria | 744 |
| 830 | Ga0496110_0000754 | 3300048913 | Bacteria | 22407 |
| 831 | Ga0496110_0058166 | 3300048913 | Bacteria | 3405 |
| 832 | Ga0496111_0000069 | 3300048914 | Bacteria | 42302 |
| 833 | Ga0496111_0183123 | 3300048914 | Bacteria | 1557 |
| 834 | Ga0496112_0004068 | 3300048915 | Bacteria | 12275 |
| 835 | Ga0496112_0005549 | 3300048915 | Bacteria | 10933 |
| 836 | Ga0496112_0112500 | 3300048915 | Bacteria | 2693 |
| 837 | Ga0496112_0395488 | 3300048915 | Bacteria | 1322 |
| 838 | Ga0496112_0475481 | 3300048915 | Bacteria | 1186 |
| 839 | Ga0496112_1179228 | 3300048915 | Bacteria | 683 |
| 840 | Ga0496113_0007460 | 3300048916 | Bacteria | 7042 |
| 841 | Ga0496113_0007666 | 3300048916 | Bacteria | 6965 |
| 842 | Ga0501047_0775060 | 3300049581 | Unclassified | 774 |
| 843 | Ga0501068_0022903 | 3300049584 | Bacteria | 3657 |
| 844 | Ga0501068_0091248 | 3300049584 | Bacteria | 1880 |
| 845 | Ga0501079_0600648 | 3300049741 | Unclassified | 866 |
| 846 | Ga0501080_0041798 | 3300049742 | Bacteria | 4270 |
| 847 | Ga0501044_0805947 | 3300049823 | Bacteria | 818 |
| 848 | nmdc:mga0k408_110604_c1 | 3300050493 | Bacteria | 1624 |
| 849 | nmdc:mga05p37_867572_c1 | 3300050507 | Bacteria | 978 |
| 850 | nmdc:mga09592_133478_c1 | 3300050508 | Bacteria | 2137 |
| 851 | Ga0466962_0007173 | 3300061719 | Bacteria | 5337 |
| 852 | Ga0466962_0048447 | 3300061719 | Bacteria | 2030 |
| 853 | Ga0466962_0424683 | 3300061719 | Bacteria | 667 |
| 854 | Ga0530510_0235793 | 3300061734 | Bacteria | 1362 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_10107964 | Ga0157374_101079642 | 118 |
| 2 | 3300005435 | Ga0070714_100036186 | Ga0070714_1000361862 | 119 |
| 3 | 3300005614 | Ga0068856_100796554 | Ga0068856_1007965542 | 119 |
| 4 | 3300025929 | Ga0207664_10016311 | Ga0207664_100163114 | 119 |
| 5 | 3300026078 | Ga0207702_11014447 | Ga0207702_110144472 | 119 |
| 6 | 3300038443 | Ga0395901_1584638 | Ga0395901_1584638_147_551 | 119 |
| 7 | 3300046522 | Ga0495643_0148301 | Ga0495643_0148301_202_624 | 119 |
| 8 | 3300005331 | Ga0070670_100177334 | Ga0070670_1001773341 | 120 |
| 9 | 3300005339 | Ga0070660_100781288 | Ga0070660_1007812882 | 120 |
| 10 | 3300005347 | Ga0070668_100529766 | Ga0070668_1005297662 | 120 |
| 11 | 3300005353 | Ga0070669_100313642 | Ga0070669_1003136422 | 120 |
| 12 | 3300005435 | Ga0070714_100095396 | Ga0070714_1000953962 | 120 |
| 13 | 3300005436 | Ga0070713_100065022 | Ga0070713_1000650222 | 120 |
| 14 | 3300005577 | Ga0068857_100023828 | Ga0068857_1000238286 | 120 |
| 15 | 3300005719 | Ga0068861_100815273 | Ga0068861_1008152732 | 120 |
| 16 | 3300005841 | Ga0068863_100005224 | Ga0068863_1000052247 | 120 |
| 17 | 3300005844 | Ga0068862_100344161 | Ga0068862_1003441612 | 120 |
| 18 | 3300006195 | Ga0075366_10136992 | Ga0075366_101369922 | 120 |
| 19 | 3300011119 | Ga0105246_10542597 | Ga0105246_105425972 | 120 |
| 20 | 3300013102 | Ga0157371_10368839 | Ga0157371_103688392 | 120 |
| 21 | 3300013296 | Ga0157374_10987084 | Ga0157374_109870842 | 120 |
| 22 | 3300014325 | Ga0163163_10237948 | Ga0163163_102379484 | 120 |
| 23 | 3300025925 | Ga0207650_10075522 | Ga0207650_100755224 | 120 |
| 24 | 3300025928 | Ga0207700_10115712 | Ga0207700_101157122 | 120 |
| 25 | 3300025929 | Ga0207664_10023570 | Ga0207664_100235703 | 120 |
| 26 | 3300026088 | Ga0207641_10025415 | Ga0207641_100254152 | 120 |
| 27 | 3300026116 | Ga0207674_10000065 | Ga0207674_1000006519 | 120 |
| 28 | 3300028380 | Ga0268265_10169604 | Ga0268265_101696042 | 120 |
| 29 | 3300038443 | Ga0395901_0037974 | Ga0395901_0037974_1694_2107 | 120 |
| 30 | 3300050493 | nmdc:mga0k408_110604_c1 | nmdc:mga0k408_110604_c1_131_535 | 120 |
| 31 | 3300005435 | Ga0070714_100191201 | Ga0070714_1001912012 | 121 |
| 32 | 3300025929 | Ga0207664_10116219 | Ga0207664_101162192 | 121 |
| 33 | 3300013102 | Ga0157371_11335813 | Ga0157371_113358131 | 122 |
| 34 | 3300044656 | Ga0466969_0053432 | Ga0466969_0053432_1282_1689 | 122 |
| 35 | 3300044693 | Ga0466961_0067398 | Ga0466961_0067398_923_1330 | 122 |
| 36 | 3300044719 | Ga0466971_0008654 | Ga0466971_0008654_413_820 | 122 |
| 37 | 3300044842 | Ga0466957_0010249 | Ga0466957_0010249_2592_2999 | 122 |
| 38 | 3300045836 | Ga0466958_0094076 | Ga0466958_0094076_1351_1758 | 122 |
| 39 | 3300061719 | Ga0466962_0048447 | Ga0466962_0048447_318_725 | 122 |
| 40 | 3300044658 | Ga0466972_0333981 | Ga0466972_0333981_34_441 | 124 |
| 41 | 3300044684 | Ga0466966_0115883 | Ga0466966_0115883_571_1059 | 124 |
| 42 | 3300044706 | Ga0466964_0012076 | Ga0466964_0012076_2382_2789 | 124 |
| 43 | 3300044735 | Ga0466968_0014457 | Ga0466968_0014457_2409_2816 | 124 |
| 44 | 3300044765 | Ga0466970_0042966 | Ga0466970_0042966_1023_1430 | 124 |
| 45 | 3300045049 | Ga0466959_0129688 | Ga0466959_0129688_984_1391 | 124 |
| 46 | 3300045836 | Ga0466958_0032876 | Ga0466958_0032876_583_990 | 124 |
| 47 | 3300045976 | Ga0466967_0115004 | Ga0466967_0115004_321_728 | 124 |
| 48 | 3300045976 | Ga0466967_0570544 | Ga0466967_0570544_18_425 | 124 |
| 49 | 3300036401 | Ga0373937_1473378 | Ga0373937_1473378_89_505 | 125 |
| 50 | 3300046535 | Ga0495586_0575452 | Ga0495586_0575452_125_541 | 125 |
| 51 | 3300046536 | Ga0495587_0666300 | Ga0495587_0666300_97_513 | 125 |
| 52 | 3300005328 | Ga0070676_10004251 | Ga0070676_100042512 | 128 |
| 53 | 3300005334 | Ga0068869_100303658 | Ga0068869_1003036582 | 128 |
| 54 | 3300005334 | Ga0068869_101536991 | Ga0068869_1015369912 | 128 |
| 55 | 3300005335 | Ga0070666_10340076 | Ga0070666_103400762 | 128 |
| 56 | 3300005338 | Ga0068868_100032532 | Ga0068868_1000325322 | 128 |
| 57 | 3300005353 | Ga0070669_100187147 | Ga0070669_1001871472 | 128 |
| 58 | 3300005356 | Ga0070674_100086865 | Ga0070674_1000868652 | 128 |
| 59 | 3300005364 | Ga0070673_100642726 | Ga0070673_1006427262 | 128 |
| 60 | 3300005456 | Ga0070678_100119549 | Ga0070678_1001195493 | 128 |
| 61 | 3300005459 | Ga0068867_100002035 | Ga0068867_10000203512 | 128 |
| 62 | 3300005466 | Ga0070685_10697814 | Ga0070685_106978142 | 128 |
| 63 | 3300005543 | Ga0070672_100099437 | Ga0070672_1000994373 | 128 |
| 64 | 3300005548 | Ga0070665_100064471 | Ga0070665_1000644714 | 128 |
| 65 | 3300005617 | Ga0068859_100573868 | Ga0068859_1005738681 | 128 |
| 66 | 3300005840 | Ga0068870_10346497 | Ga0068870_103464972 | 128 |
| 67 | 3300005841 | Ga0068863_100365270 | Ga0068863_1003652702 | 128 |
| 68 | 3300005842 | Ga0068858_101050915 | Ga0068858_1010509152 | 128 |
| 69 | 3300005843 | Ga0068860_100554667 | Ga0068860_1005546671 | 128 |
| 70 | 3300005844 | Ga0068862_100012521 | Ga0068862_1000125213 | 128 |
| 71 | 3300006358 | Ga0068871_100023199 | Ga0068871_1000231992 | 128 |
| 72 | 3300006931 | Ga0097620_100573783 | Ga0097620_1005737832 | 128 |
| 73 | 3300013100 | Ga0157373_10471548 | Ga0157373_104715482 | 128 |
| 74 | 3300013102 | Ga0157371_10073976 | Ga0157371_100739764 | 128 |
| 75 | 3300013104 | Ga0157370_10577613 | Ga0157370_105776134 | 128 |
| 76 | 3300013307 | Ga0157372_10065325 | Ga0157372_100653255 | 128 |
| 77 | 3300014969 | Ga0157376_10717075 | Ga0157376_107170752 | 128 |
| 78 | 3300025315 | Ga0207697_10011008 | Ga0207697_100110083 | 128 |
| 79 | 3300025903 | Ga0207680_10630441 | Ga0207680_106304411 | 128 |
| 80 | 3300025907 | Ga0207645_10002319 | Ga0207645_100023198 | 128 |
| 81 | 3300025908 | Ga0207643_10072411 | Ga0207643_100724112 | 128 |
| 82 | 3300025923 | Ga0207681_10008022 | Ga0207681_100080227 | 128 |
| 83 | 3300025937 | Ga0207669_10018773 | Ga0207669_100187733 | 128 |
| 84 | 3300025940 | Ga0207691_10044757 | Ga0207691_100447573 | 128 |
| 85 | 3300025941 | Ga0207711_10029289 | Ga0207711_100292892 | 128 |
| 86 | 3300025942 | Ga0207689_10047729 | Ga0207689_100477294 | 128 |
| 87 | 3300025960 | Ga0207651_10426995 | Ga0207651_104269952 | 128 |
| 88 | 3300025972 | Ga0207668_10018267 | Ga0207668_100182674 | 128 |
| 89 | 3300025986 | Ga0207658_10027405 | Ga0207658_100274052 | 128 |
| 90 | 3300026023 | Ga0207677_10077416 | Ga0207677_100774162 | 128 |
| 91 | 3300026088 | Ga0207641_10170134 | Ga0207641_101701342 | 128 |
| 92 | 3300026089 | Ga0207648_10002458 | Ga0207648_1000245816 | 128 |
| 93 | 3300026118 | Ga0207675_100147162 | Ga0207675_1001471622 | 128 |
| 94 | 3300026121 | Ga0207683_10026610 | Ga0207683_100266104 | 128 |
| 95 | 3300028379 | Ga0268266_10045835 | Ga0268266_100458352 | 128 |
| 96 | 3300028380 | Ga0268265_10077818 | Ga0268265_100778182 | 128 |
| 97 | 3300028381 | Ga0268264_10106161 | Ga0268264_101061612 | 128 |
| 98 | 3300037312 | Ga0395899_0284882 | Ga0395899_0284882_724_1110 | 128 |
| 99 | 3300044684 | Ga0466966_0014830 | Ga0466966_0014830_4055_4441 | 128 |
| 100 | 3300037312 | Ga0395899_0013449 | Ga0395899_0013449_718_1107 | 129 |
| 101 | 3300037418 | Ga0395900_0056333 | Ga0395900_0056333_1380_1769 | 129 |
| 102 | 3300037466 | Ga0395898_0049745 | Ga0395898_0049745_3311_3700 | 129 |
| 103 | 3300037471 | Ga0395905_0021922 | Ga0395905_0021922_4002_4391 | 129 |
| 104 | 3300038443 | Ga0395901_0230144 | Ga0395901_0230144_1445_1834 | 129 |
| 105 | 3300005617 | Ga0068859_100048003 | Ga0068859_1000480034 | 130 |
| 106 | 3300005841 | Ga0068863_100037268 | Ga0068863_1000372683 | 130 |
| 107 | 3300005843 | Ga0068860_100028404 | Ga0068860_1000284044 | 130 |
| 108 | 3300006931 | Ga0097620_100048003 | Ga0097620_1000480034 | 130 |
| 109 | 3300009177 | Ga0105248_10149205 | Ga0105248_101492052 | 130 |
| 110 | 3300025900 | Ga0207710_10057212 | Ga0207710_100572123 | 130 |
| 111 | 3300025941 | Ga0207711_10171135 | Ga0207711_101711352 | 130 |
| 112 | 3300026067 | Ga0207678_10032194 | Ga0207678_100321944 | 130 |
| 113 | 3300026088 | Ga0207641_10067548 | Ga0207641_100675483 | 130 |
| 114 | 3300028381 | Ga0268264_10020803 | Ga0268264_100208033 | 130 |
| 115 | 3300035691 | Ga0373931_0784072 | Ga0373931_0784072_218_610 | 130 |
| 116 | 3300037418 | Ga0395900_0024613 | Ga0395900_0024613_5003_5395 | 130 |
| 117 | 3300037466 | Ga0395898_0919109 | Ga0395898_0919109_228_620 | 130 |
| 118 | 3300037471 | Ga0395905_0997386 | Ga0395905_0997386_83_475 | 130 |
| 119 | 3300038443 | Ga0395901_0320938 | Ga0395901_0320938_460_852 | 130 |
| 120 | 3300005289 | Ga0065704_10291073 | Ga0065704_102910732 | 131 |
| 121 | 3300005347 | Ga0070668_100573105 | Ga0070668_1005731052 | 131 |
| 122 | 3300005353 | Ga0070669_100038870 | Ga0070669_1000388702 | 131 |
| 123 | 3300005434 | Ga0070709_10044075 | Ga0070709_100440752 | 131 |
| 124 | 3300005436 | Ga0070713_100005100 | Ga0070713_1000051003 | 131 |
| 125 | 3300005578 | Ga0068854_101438166 | Ga0068854_1014381662 | 131 |
| 126 | 3300005719 | Ga0068861_100370429 | Ga0068861_1003704291 | 131 |
| 127 | 3300005840 | Ga0068870_10068941 | Ga0068870_100689412 | 131 |
| 128 | 3300005843 | Ga0068860_100295886 | Ga0068860_1002958862 | 131 |
| 129 | 3300005844 | Ga0068862_100034938 | Ga0068862_1000349384 | 131 |
| 130 | 3300006028 | Ga0070717_10320000 | Ga0070717_103200001 | 131 |
| 131 | 3300006163 | Ga0070715_10790453 | Ga0070715_107904532 | 131 |
| 132 | 3300006173 | Ga0070716_100114965 | Ga0070716_1001149652 | 131 |
| 133 | 3300006175 | Ga0070712_100055548 | Ga0070712_1000555482 | 131 |
| 134 | 3300009148 | Ga0105243_10012496 | Ga0105243_100124962 | 131 |
| 135 | 3300009176 | Ga0105242_11410618 | Ga0105242_114106182 | 131 |
| 136 | 3300009553 | Ga0105249_10651164 | Ga0105249_106511642 | 131 |
| 137 | 3300013100 | Ga0157373_10012135 | Ga0157373_100121353 | 131 |
| 138 | 3300025901 | Ga0207688_10265839 | Ga0207688_102658392 | 131 |
| 139 | 3300025905 | Ga0207685_10519340 | Ga0207685_105193402 | 131 |
| 140 | 3300025906 | Ga0207699_10008885 | Ga0207699_100088853 | 131 |
| 141 | 3300025923 | Ga0207681_10031395 | Ga0207681_100313952 | 131 |
| 142 | 3300025935 | Ga0207709_10705767 | Ga0207709_107057672 | 131 |
| 143 | 3300025939 | Ga0207665_10100078 | Ga0207665_101000782 | 131 |
| 144 | 3300025961 | Ga0207712_10510139 | Ga0207712_105101392 | 131 |
| 145 | 3300025972 | Ga0207668_10261158 | Ga0207668_102611581 | 131 |
| 146 | 3300026118 | Ga0207675_100036554 | Ga0207675_1000365543 | 131 |
| 147 | 3300028380 | Ga0268265_10092192 | Ga0268265_100921922 | 131 |
| 148 | 3300036401 | Ga0373937_1474027 | Ga0373937_1474027_186_584 | 131 |
| 149 | 3300005564 | Ga0070664_101786668 | Ga0070664_1017866681 | 132 |
| 150 | 3300005616 | Ga0068852_100909462 | Ga0068852_1009094622 | 132 |
| 151 | 3300025904 | Ga0207647_10038542 | Ga0207647_100385422 | 132 |
| 152 | 3300025933 | Ga0207706_10451867 | Ga0207706_104518672 | 132 |
| 153 | 3300026142 | Ga0207698_10606264 | Ga0207698_106062642 | 132 |
| 154 | 3300037471 | Ga0395905_0968691 | Ga0395905_0968691_169_567 | 132 |
| 155 | 3300042439 | Ga0439464_0000878 | Ga0439464_0000878_4291_4722 | 132 |
| 156 | 3300049584 | Ga0501068_0022903 | Ga0501068_0022903_1226_1624 | 132 |
| 157 | 3300061734 | Ga0530510_0235793 | Ga0530510_0235793_649_1047 | 132 |
| 158 | 3300001979 | JGI24740J21852_10053770 | JGI24740J21852_100537702 | 133 |
| 159 | 3300005327 | Ga0070658_10148654 | Ga0070658_101486542 | 133 |
| 160 | 3300005336 | Ga0070680_100002432 | Ga0070680_1000024328 | 133 |
| 161 | 3300005339 | Ga0070660_100029896 | Ga0070660_1000298963 | 133 |
| 162 | 3300005344 | Ga0070661_100142394 | Ga0070661_1001423942 | 133 |
| 163 | 3300005530 | Ga0070679_100144448 | Ga0070679_1001444482 | 133 |
| 164 | 3300005563 | Ga0068855_100048667 | Ga0068855_1000486673 | 133 |
| 165 | 3300005614 | Ga0068856_101075420 | Ga0068856_1010754202 | 133 |
| 166 | 3300005616 | Ga0068852_100016289 | Ga0068852_1000162894 | 133 |
| 167 | 3300013104 | Ga0157370_10086927 | Ga0157370_100869272 | 133 |
| 168 | 3300025909 | Ga0207705_10021914 | Ga0207705_100219142 | 133 |
| 169 | 3300025912 | Ga0207707_10423305 | Ga0207707_104233051 | 133 |
| 170 | 3300025917 | Ga0207660_10000059 | Ga0207660_1000005949 | 133 |
| 171 | 3300025917 | Ga0207660_10001202 | Ga0207660_100012028 | 133 |
| 172 | 3300025919 | Ga0207657_10036827 | Ga0207657_100368272 | 133 |
| 173 | 3300025921 | Ga0207652_10124163 | Ga0207652_101241632 | 133 |
| 174 | 3300025925 | Ga0207650_10019021 | Ga0207650_100190213 | 133 |
| 175 | 3300025981 | Ga0207640_10471741 | Ga0207640_104717411 | 133 |
| 176 | 3300026078 | Ga0207702_10698785 | Ga0207702_106987852 | 133 |
| 177 | 3300026142 | Ga0207698_10011695 | Ga0207698_100116952 | 133 |
| 178 | 3300026142 | Ga0207698_10093067 | Ga0207698_100930672 | 133 |
| 179 | 3300031824 | Ga0307413_10638425 | Ga0307413_106384252 | 133 |
| 180 | 3300031903 | Ga0307407_10149918 | Ga0307407_101499183 | 133 |
| 181 | 3300031995 | Ga0307409_100115233 | Ga0307409_1001152332 | 133 |
| 182 | 3300032004 | Ga0307414_10438030 | Ga0307414_104380302 | 133 |
| 183 | 3300032005 | Ga0307411_10037200 | Ga0307411_100372002 | 133 |
| 184 | 3300037312 | Ga0395899_0063573 | Ga0395899_0063573_1269_1670 | 133 |
| 185 | 3300037418 | Ga0395900_0013562 | Ga0395900_0013562_4529_4930 | 133 |
| 186 | 3300037418 | Ga0395900_0069852 | Ga0395900_0069852_1641_2042 | 133 |
| 187 | 3300037466 | Ga0395898_0281130 | Ga0395898_0281130_135_536 | 133 |
| 188 | 3300037466 | Ga0395898_1290038 | Ga0395898_1290038_215_616 | 133 |
| 189 | 3300037471 | Ga0395905_0039456 | Ga0395905_0039456_1922_2323 | 133 |
| 190 | 3300037471 | Ga0395905_0200174 | Ga0395905_0200174_88_489 | 133 |
| 191 | 3300038443 | Ga0395901_0071571 | Ga0395901_0071571_1641_2042 | 133 |
| 192 | 3300038443 | Ga0395901_0188653 | Ga0395901_0188653_1590_1991 | 133 |
| 193 | 3300045976 | Ga0466967_0476505 | Ga0466967_0476505_290_691 | 133 |
| 194 | 3300001979 | JGI24740J21852_10021801 | JGI24740J21852_100218012 | 134 |
| 195 | 3300001979 | JGI24740J21852_10104779 | JGI24740J21852_101047791 | 134 |
| 196 | 3300001989 | JGI24739J22299_10088317 | JGI24739J22299_100883172 | 134 |
| 197 | 3300001990 | JGI24737J22298_10014199 | JGI24737J22298_100141992 | 134 |
| 198 | 3300002067 | JGI24735J21928_10002140 | JGI24735J21928_100021405 | 134 |
| 199 | 3300002067 | JGI24735J21928_10014828 | JGI24735J21928_100148282 | 134 |
| 200 | 3300005327 | Ga0070658_10007529 | Ga0070658_100075293 | 134 |
| 201 | 3300005327 | Ga0070658_10025349 | Ga0070658_100253492 | 134 |
| 202 | 3300005327 | Ga0070658_10182464 | Ga0070658_101824641 | 134 |
| 203 | 3300005327 | Ga0070658_10273336 | Ga0070658_102733361 | 134 |
| 204 | 3300005329 | Ga0070683_100019017 | Ga0070683_1000190174 | 134 |
| 205 | 3300005329 | Ga0070683_100172414 | Ga0070683_1001724142 | 134 |
| 206 | 3300005329 | Ga0070683_100392138 | Ga0070683_1003921382 | 134 |
| 207 | 3300005329 | Ga0070683_100675957 | Ga0070683_1006759571 | 134 |
| 208 | 3300005336 | Ga0070680_100005513 | Ga0070680_10000551311 | 134 |
| 209 | 3300005336 | Ga0070680_100053617 | Ga0070680_1000536172 | 134 |
| 210 | 3300005336 | Ga0070680_100131326 | Ga0070680_1001313262 | 134 |
| 211 | 3300005336 | Ga0070680_100509936 | Ga0070680_1005099362 | 134 |
| 212 | 3300005336 | Ga0070680_100604808 | Ga0070680_1006048081 | 134 |
| 213 | 3300005336 | Ga0070680_100607577 | Ga0070680_1006075772 | 134 |
| 214 | 3300005337 | Ga0070682_100041566 | Ga0070682_1000415663 | 134 |
| 215 | 3300005339 | Ga0070660_100019741 | Ga0070660_1000197412 | 134 |
| 216 | 3300005339 | Ga0070660_100153297 | Ga0070660_1001532972 | 134 |
| 217 | 3300005339 | Ga0070660_100166992 | Ga0070660_1001669922 | 134 |
| 218 | 3300005339 | Ga0070660_100212323 | Ga0070660_1002123232 | 134 |
| 219 | 3300005339 | Ga0070660_100785943 | Ga0070660_1007859432 | 134 |
| 220 | 3300005339 | Ga0070660_100787198 | Ga0070660_1007871981 | 134 |
| 221 | 3300005341 | Ga0070691_10325031 | Ga0070691_103250311 | 134 |
| 222 | 3300005344 | Ga0070661_100057631 | Ga0070661_1000576312 | 134 |
| 223 | 3300005344 | Ga0070661_100213325 | Ga0070661_1002133252 | 134 |
| 224 | 3300005345 | Ga0070692_10031841 | Ga0070692_100318412 | 134 |
| 225 | 3300005345 | Ga0070692_10120867 | Ga0070692_101208672 | 134 |
| 226 | 3300005345 | Ga0070692_10778940 | Ga0070692_107789401 | 134 |
| 227 | 3300005366 | Ga0070659_100012039 | Ga0070659_1000120391 | 134 |
| 228 | 3300005366 | Ga0070659_100024629 | Ga0070659_1000246295 | 134 |
| 229 | 3300005366 | Ga0070659_100125313 | Ga0070659_1001253132 | 134 |
| 230 | 3300005366 | Ga0070659_100349682 | Ga0070659_1003496822 | 134 |
| 231 | 3300005366 | Ga0070659_100495578 | Ga0070659_1004955782 | 134 |
| 232 | 3300005435 | Ga0070714_100120567 | Ga0070714_1001205672 | 134 |
| 233 | 3300005436 | Ga0070713_100388894 | Ga0070713_1003888942 | 134 |
| 234 | 3300005455 | Ga0070663_100571243 | Ga0070663_1005712432 | 134 |
| 235 | 3300005457 | Ga0070662_100871747 | Ga0070662_1008717472 | 134 |
| 236 | 3300005458 | Ga0070681_10080063 | Ga0070681_100800633 | 134 |
| 237 | 3300005467 | Ga0070706_100254739 | Ga0070706_1002547392 | 134 |
| 238 | 3300005530 | Ga0070679_100077172 | Ga0070679_1000771722 | 134 |
| 239 | 3300005530 | Ga0070679_100088147 | Ga0070679_1000881472 | 134 |
| 240 | 3300005530 | Ga0070679_100362113 | Ga0070679_1003621132 | 134 |
| 241 | 3300005530 | Ga0070679_100433735 | Ga0070679_1004337352 | 134 |
| 242 | 3300005530 | Ga0070679_100829557 | Ga0070679_1008295572 | 134 |
| 243 | 3300005535 | Ga0070684_100101991 | Ga0070684_1001019912 | 134 |
| 244 | 3300005535 | Ga0070684_100152215 | Ga0070684_1001522152 | 134 |
| 245 | 3300005535 | Ga0070684_100210151 | Ga0070684_1002101511 | 134 |
| 246 | 3300005539 | Ga0068853_100010905 | Ga0068853_1000109058 | 134 |
| 247 | 3300005539 | Ga0068853_100079727 | Ga0068853_1000797273 | 134 |
| 248 | 3300005539 | Ga0068853_100144427 | Ga0068853_1001444272 | 134 |
| 249 | 3300005539 | Ga0068853_100147081 | Ga0068853_1001470813 | 134 |
| 250 | 3300005539 | Ga0068853_100175357 | Ga0068853_1001753572 | 134 |
| 251 | 3300005539 | Ga0068853_101495863 | Ga0068853_1014958631 | 134 |
| 252 | 3300005546 | Ga0070696_100017065 | Ga0070696_1000170652 | 134 |
| 253 | 3300005547 | Ga0070693_100073186 | Ga0070693_1000731863 | 134 |
| 254 | 3300005547 | Ga0070693_100521509 | Ga0070693_1005215092 | 134 |
| 255 | 3300005563 | Ga0068855_100050120 | Ga0068855_1000501204 | 134 |
| 256 | 3300005563 | Ga0068855_100111070 | Ga0068855_1001110702 | 134 |
| 257 | 3300005563 | Ga0068855_100208992 | Ga0068855_1002089922 | 134 |
| 258 | 3300005563 | Ga0068855_100267980 | Ga0068855_1002679802 | 134 |
| 259 | 3300005563 | Ga0068855_101095760 | Ga0068855_1010957602 | 134 |
| 260 | 3300005564 | Ga0070664_101170914 | Ga0070664_1011709141 | 134 |
| 261 | 3300005577 | Ga0068857_100019007 | Ga0068857_1000190072 | 134 |
| 262 | 3300005577 | Ga0068857_100062570 | Ga0068857_1000625702 | 134 |
| 263 | 3300005578 | Ga0068854_100031274 | Ga0068854_1000312742 | 134 |
| 264 | 3300005578 | Ga0068854_100092871 | Ga0068854_1000928712 | 134 |
| 265 | 3300005578 | Ga0068854_100187654 | Ga0068854_1001876542 | 134 |
| 266 | 3300005578 | Ga0068854_100212190 | Ga0068854_1002121902 | 134 |
| 267 | 3300005578 | Ga0068854_101662933 | Ga0068854_1016629331 | 134 |
| 268 | 3300005614 | Ga0068856_100051981 | Ga0068856_1000519814 | 134 |
| 269 | 3300005614 | Ga0068856_100144207 | Ga0068856_1001442072 | 134 |
| 270 | 3300005614 | Ga0068856_100629053 | Ga0068856_1006290532 | 134 |
| 271 | 3300005614 | Ga0068856_100848773 | Ga0068856_1008487732 | 134 |
| 272 | 3300005614 | Ga0068856_101339043 | Ga0068856_1013390431 | 134 |
| 273 | 3300005614 | Ga0068856_101928691 | Ga0068856_1019286912 | 134 |
| 274 | 3300005616 | Ga0068852_100001069 | Ga0068852_1000010697 | 134 |
| 275 | 3300005616 | Ga0068852_100076960 | Ga0068852_1000769603 | 134 |
| 276 | 3300005616 | Ga0068852_100098987 | Ga0068852_1000989872 | 134 |
| 277 | 3300005616 | Ga0068852_100172565 | Ga0068852_1001725652 | 134 |
| 278 | 3300005616 | Ga0068852_100187189 | Ga0068852_1001871892 | 134 |
| 279 | 3300005616 | Ga0068852_100403049 | Ga0068852_1004030492 | 134 |
| 280 | 3300005616 | Ga0068852_100571183 | Ga0068852_1005711832 | 134 |
| 281 | 3300005834 | Ga0068851_10030743 | Ga0068851_100307432 | 134 |
| 282 | 3300005834 | Ga0068851_10197961 | Ga0068851_101979612 | 134 |
| 283 | 3300005844 | Ga0068862_100880869 | Ga0068862_1008808692 | 134 |
| 284 | 3300006880 | Ga0075429_100952659 | Ga0075429_1009526592 | 134 |
| 285 | 3300009093 | Ga0105240_10056083 | Ga0105240_100560832 | 134 |
| 286 | 3300009093 | Ga0105240_10224311 | Ga0105240_102243112 | 134 |
| 287 | 3300009094 | Ga0111539_13473188 | Ga0111539_134731881 | 134 |
| 288 | 3300009147 | Ga0114129_10672017 | Ga0114129_106720172 | 134 |
| 289 | 3300009545 | Ga0105237_10029154 | Ga0105237_100291545 | 134 |
| 290 | 3300009551 | Ga0105238_10016800 | Ga0105238_100168002 | 134 |
| 291 | 3300009551 | Ga0105238_10070567 | Ga0105238_100705672 | 134 |
| 292 | 3300009551 | Ga0105238_10324055 | Ga0105238_103240552 | 134 |
| 293 | 3300009551 | Ga0105238_10556030 | Ga0105238_105560302 | 134 |
| 294 | 3300010375 | Ga0105239_10083657 | Ga0105239_100836573 | 134 |
| 295 | 3300013100 | Ga0157373_10012753 | Ga0157373_100127532 | 134 |
| 296 | 3300013100 | Ga0157373_10068364 | Ga0157373_100683642 | 134 |
| 297 | 3300013100 | Ga0157373_10137199 | Ga0157373_101371992 | 134 |
| 298 | 3300013100 | Ga0157373_10158947 | Ga0157373_101589472 | 134 |
| 299 | 3300013100 | Ga0157373_11240516 | Ga0157373_112405161 | 134 |
| 300 | 3300013102 | Ga0157371_10015031 | Ga0157371_100150315 | 134 |
| 301 | 3300013102 | Ga0157371_10020854 | Ga0157371_100208545 | 134 |
| 302 | 3300013102 | Ga0157371_10060879 | Ga0157371_100608792 | 134 |
| 303 | 3300013102 | Ga0157371_10094710 | Ga0157371_100947102 | 134 |
| 304 | 3300013102 | Ga0157371_10119389 | Ga0157371_101193892 | 134 |
| 305 | 3300013102 | Ga0157371_10163424 | Ga0157371_101634242 | 134 |
| 306 | 3300013102 | Ga0157371_10279714 | Ga0157371_102797142 | 134 |
| 307 | 3300013104 | Ga0157370_10048284 | Ga0157370_100482842 | 134 |
| 308 | 3300013104 | Ga0157370_10048564 | Ga0157370_100485643 | 134 |
| 309 | 3300013104 | Ga0157370_10065056 | Ga0157370_100650562 | 134 |
| 310 | 3300013104 | Ga0157370_10089261 | Ga0157370_100892614 | 134 |
| 311 | 3300013104 | Ga0157370_10139727 | Ga0157370_101397272 | 134 |
| 312 | 3300013105 | Ga0157369_10007383 | Ga0157369_1000738311 | 134 |
| 313 | 3300013105 | Ga0157369_10031051 | Ga0157369_100310513 | 134 |
| 314 | 3300013105 | Ga0157369_10067972 | Ga0157369_100679722 | 134 |
| 315 | 3300013105 | Ga0157369_10125164 | Ga0157369_101251643 | 134 |
| 316 | 3300013105 | Ga0157369_10132459 | Ga0157369_101324592 | 134 |
| 317 | 3300013105 | Ga0157369_10135588 | Ga0157369_101355882 | 134 |
| 318 | 3300013105 | Ga0157369_10213157 | Ga0157369_102131572 | 134 |
| 319 | 3300013105 | Ga0157369_10472729 | Ga0157369_104727292 | 134 |
| 320 | 3300013105 | Ga0157369_10610836 | Ga0157369_106108362 | 134 |
| 321 | 3300013105 | Ga0157369_12073942 | Ga0157369_120739422 | 134 |
| 322 | 3300013105 | Ga0157369_12556255 | Ga0157369_125562551 | 134 |
| 323 | 3300013307 | Ga0157372_10008752 | Ga0157372_100087522 | 134 |
| 324 | 3300013307 | Ga0157372_10185390 | Ga0157372_101853902 | 134 |
| 325 | 3300013307 | Ga0157372_11740037 | Ga0157372_117400372 | 134 |
| 326 | 3300020081 | Ga0206354_11586023 | Ga0206354_115860231 | 134 |
| 327 | 3300020082 | Ga0206353_10738842 | Ga0206353_107388421 | 134 |
| 328 | 3300025321 | Ga0207656_10275334 | Ga0207656_102753342 | 134 |
| 329 | 3300025321 | Ga0207656_10331235 | Ga0207656_103312352 | 134 |
| 330 | 3300025904 | Ga0207647_10019866 | Ga0207647_100198662 | 134 |
| 331 | 3300025904 | Ga0207647_10073031 | Ga0207647_100730312 | 134 |
| 332 | 3300025909 | Ga0207705_10033619 | Ga0207705_100336195 | 134 |
| 333 | 3300025909 | Ga0207705_10080315 | Ga0207705_100803152 | 134 |
| 334 | 3300025909 | Ga0207705_10166359 | Ga0207705_101663592 | 134 |
| 335 | 3300025909 | Ga0207705_10482361 | Ga0207705_104823612 | 134 |
| 336 | 3300025910 | Ga0207684_10159692 | Ga0207684_101596922 | 134 |
| 337 | 3300025912 | Ga0207707_10051960 | Ga0207707_100519603 | 134 |
| 338 | 3300025912 | Ga0207707_10129047 | Ga0207707_101290472 | 134 |
| 339 | 3300025912 | Ga0207707_10172177 | Ga0207707_101721772 | 134 |
| 340 | 3300025913 | Ga0207695_10039931 | Ga0207695_100399315 | 134 |
| 341 | 3300025913 | Ga0207695_10115246 | Ga0207695_101152462 | 134 |
| 342 | 3300025914 | Ga0207671_10489321 | Ga0207671_104893212 | 134 |
| 343 | 3300025917 | Ga0207660_10009838 | Ga0207660_100098382 | 134 |
| 344 | 3300025917 | Ga0207660_10078092 | Ga0207660_100780922 | 134 |
| 345 | 3300025917 | Ga0207660_10537099 | Ga0207660_105370992 | 134 |
| 346 | 3300025919 | Ga0207657_10012830 | Ga0207657_100128305 | 134 |
| 347 | 3300025919 | Ga0207657_10031052 | Ga0207657_100310523 | 134 |
| 348 | 3300025919 | Ga0207657_10093145 | Ga0207657_100931452 | 134 |
| 349 | 3300025919 | Ga0207657_10725073 | Ga0207657_107250731 | 134 |
| 350 | 3300025919 | Ga0207657_10736022 | Ga0207657_107360221 | 134 |
| 351 | 3300025919 | Ga0207657_11313120 | Ga0207657_113131201 | 134 |
| 352 | 3300025920 | Ga0207649_10044044 | Ga0207649_100440442 | 134 |
| 353 | 3300025920 | Ga0207649_10125061 | Ga0207649_101250612 | 134 |
| 354 | 3300025920 | Ga0207649_10343523 | Ga0207649_103435232 | 134 |
| 355 | 3300025921 | Ga0207652_10018990 | Ga0207652_100189905 | 134 |
| 356 | 3300025921 | Ga0207652_10706897 | Ga0207652_107068972 | 134 |
| 357 | 3300025921 | Ga0207652_11193810 | Ga0207652_111938102 | 134 |
| 358 | 3300025924 | Ga0207694_10000966 | Ga0207694_1000096614 | 134 |
| 359 | 3300025924 | Ga0207694_10594715 | Ga0207694_105947152 | 134 |
| 360 | 3300025924 | Ga0207694_11594506 | Ga0207694_115945061 | 134 |
| 361 | 3300025929 | Ga0207664_10013598 | Ga0207664_100135984 | 134 |
| 362 | 3300025929 | Ga0207664_10609540 | Ga0207664_106095402 | 134 |
| 363 | 3300025932 | Ga0207690_10002953 | Ga0207690_100029538 | 134 |
| 364 | 3300025932 | Ga0207690_10088152 | Ga0207690_100881522 | 134 |
| 365 | 3300025932 | Ga0207690_10125542 | Ga0207690_101255422 | 134 |
| 366 | 3300025932 | Ga0207690_10447098 | Ga0207690_104470982 | 134 |
| 367 | 3300025932 | Ga0207690_10472911 | Ga0207690_104729112 | 134 |
| 368 | 3300025933 | Ga0207706_10037307 | Ga0207706_100373072 | 134 |
| 369 | 3300025944 | Ga0207661_10071102 | Ga0207661_100711022 | 134 |
| 370 | 3300025944 | Ga0207661_10085121 | Ga0207661_100851212 | 134 |
| 371 | 3300025944 | Ga0207661_10231631 | Ga0207661_102316312 | 134 |
| 372 | 3300025945 | Ga0207679_11253184 | Ga0207679_112531842 | 134 |
| 373 | 3300025949 | Ga0207667_10005262 | Ga0207667_1000526214 | 134 |
| 374 | 3300025949 | Ga0207667_10029624 | Ga0207667_100296244 | 134 |
| 375 | 3300025949 | Ga0207667_10040206 | Ga0207667_100402063 | 134 |
| 376 | 3300025949 | Ga0207667_10098120 | Ga0207667_100981202 | 134 |
| 377 | 3300025949 | Ga0207667_10338450 | Ga0207667_103384502 | 134 |
| 378 | 3300025949 | Ga0207667_11101816 | Ga0207667_111018162 | 134 |
| 379 | 3300025981 | Ga0207640_10062397 | Ga0207640_100623973 | 134 |
| 380 | 3300025981 | Ga0207640_10067242 | Ga0207640_100672423 | 134 |
| 381 | 3300025981 | Ga0207640_10100206 | Ga0207640_101002062 | 134 |
| 382 | 3300025981 | Ga0207640_10264000 | Ga0207640_102640002 | 134 |
| 383 | 3300026023 | Ga0207677_10982498 | Ga0207677_109824982 | 134 |
| 384 | 3300026041 | Ga0207639_10000744 | Ga0207639_1000074417 | 134 |
| 385 | 3300026041 | Ga0207639_10154043 | Ga0207639_101540432 | 134 |
| 386 | 3300026041 | Ga0207639_10276366 | Ga0207639_102763662 | 134 |
| 387 | 3300026041 | Ga0207639_11020424 | Ga0207639_110204241 | 134 |
| 388 | 3300026067 | Ga0207678_10008634 | Ga0207678_100086345 | 134 |
| 389 | 3300026067 | Ga0207678_10058363 | Ga0207678_100583633 | 134 |
| 390 | 3300026078 | Ga0207702_10150028 | Ga0207702_101500282 | 134 |
| 391 | 3300026078 | Ga0207702_10153445 | Ga0207702_101534452 | 134 |
| 392 | 3300026078 | Ga0207702_10204038 | Ga0207702_102040382 | 134 |
| 393 | 3300026078 | Ga0207702_10271492 | Ga0207702_102714922 | 134 |
| 394 | 3300026078 | Ga0207702_10501619 | Ga0207702_105016192 | 134 |
| 395 | 3300026116 | Ga0207674_10002824 | Ga0207674_1000282421 | 134 |
| 396 | 3300026116 | Ga0207674_10003445 | Ga0207674_1000344513 | 134 |
| 397 | 3300026116 | Ga0207674_10014766 | Ga0207674_100147665 | 134 |
| 398 | 3300026116 | Ga0207674_10434534 | Ga0207674_104345342 | 134 |
| 399 | 3300026142 | Ga0207698_10003907 | Ga0207698_1000390710 | 134 |
| 400 | 3300026142 | Ga0207698_10011411 | Ga0207698_100114113 | 134 |
| 401 | 3300026142 | Ga0207698_10036738 | Ga0207698_100367382 | 134 |
| 402 | 3300026142 | Ga0207698_10079985 | Ga0207698_100799852 | 134 |
| 403 | 3300026142 | Ga0207698_10223892 | Ga0207698_102238922 | 134 |
| 404 | 3300026142 | Ga0207698_10683636 | Ga0207698_106836362 | 134 |
| 405 | 3300031995 | Ga0307409_102729320 | Ga0307409_1027293201 | 134 |
| 406 | 3300037312 | Ga0395899_0000113 | Ga0395899_0000113_84667_85077 | 134 |
| 407 | 3300037312 | Ga0395899_0006469 | Ga0395899_0006469_7863_8306 | 134 |
| 408 | 3300037312 | Ga0395899_0019176 | Ga0395899_0019176_1181_1585 | 134 |
| 409 | 3300037312 | Ga0395899_0020590 | Ga0395899_0020590_4409_4816 | 134 |
| 410 | 3300037312 | Ga0395899_0060907 | Ga0395899_0060907_744_1154 | 134 |
| 411 | 3300037312 | Ga0395899_0066680 | Ga0395899_0066680_2179_2583 | 134 |
| 412 | 3300037312 | Ga0395899_0100246 | Ga0395899_0100246_601_1005 | 134 |
| 413 | 3300037312 | Ga0395899_0106552 | Ga0395899_0106552_72_476 | 134 |
| 414 | 3300037312 | Ga0395899_0959713 | Ga0395899_0959713_76_480 | 134 |
| 415 | 3300037418 | Ga0395900_0000365 | Ga0395900_0000365_62549_62959 | 134 |
| 416 | 3300037418 | Ga0395900_0000964 | Ga0395900_0000964_25686_26090 | 134 |
| 417 | 3300037418 | Ga0395900_0008087 | Ga0395900_0008087_6390_6797 | 134 |
| 418 | 3300037418 | Ga0395900_0011278 | Ga0395900_0011278_2811_3221 | 134 |
| 419 | 3300037418 | Ga0395900_0023762 | Ga0395900_0023762_3742_4146 | 134 |
| 420 | 3300037418 | Ga0395900_0086813 | Ga0395900_0086813_1988_2431 | 134 |
| 421 | 3300037418 | Ga0395900_0093890 | Ga0395900_0093890_2179_2583 | 134 |
| 422 | 3300037418 | Ga0395900_0252090 | Ga0395900_0252090_1237_1641 | 134 |
| 423 | 3300037418 | Ga0395900_0353100 | Ga0395900_0353100_1007_1411 | 134 |
| 424 | 3300037418 | Ga0395900_0513194 | Ga0395900_0513194_30_434 | 134 |
| 425 | 3300037418 | Ga0395900_0692766 | Ga0395900_0692766_123_527 | 134 |
| 426 | 3300037418 | Ga0395900_1335932 | Ga0395900_1335932_182_586 | 134 |
| 427 | 3300037418 | Ga0395900_1458714 | Ga0395900_1458714_148_552 | 134 |
| 428 | 3300037466 | Ga0395898_0000306 | Ga0395898_0000306_30864_31274 | 134 |
| 429 | 3300037466 | Ga0395898_0008363 | Ga0395898_0008363_5123_5533 | 134 |
| 430 | 3300037466 | Ga0395898_0022122 | Ga0395898_0022122_1070_1513 | 134 |
| 431 | 3300037466 | Ga0395898_0088936 | Ga0395898_0088936_1220_1624 | 134 |
| 432 | 3300037466 | Ga0395898_0256801 | Ga0395898_0256801_941_1345 | 134 |
| 433 | 3300037466 | Ga0395898_0476492 | Ga0395898_0476492_185_589 | 134 |
| 434 | 3300037466 | Ga0395898_0746893 | Ga0395898_0746893_160_564 | 134 |
| 435 | 3300037466 | Ga0395898_1292840 | Ga0395898_1292840_15_419 | 134 |
| 436 | 3300037471 | Ga0395905_0000005 | Ga0395905_0000005_275825_276235 | 134 |
| 437 | 3300037471 | Ga0395905_0009966 | Ga0395905_0009966_2305_2748 | 134 |
| 438 | 3300037471 | Ga0395905_0016924 | Ga0395905_0016924_1131_1541 | 134 |
| 439 | 3300037471 | Ga0395905_0026426 | Ga0395905_0026426_4052_4459 | 134 |
| 440 | 3300037471 | Ga0395905_0032743 | Ga0395905_0032743_3877_4281 | 134 |
| 441 | 3300037471 | Ga0395905_0088779 | Ga0395905_0088779_2042_2446 | 134 |
| 442 | 3300037471 | Ga0395905_0231601 | Ga0395905_0231601_898_1302 | 134 |
| 443 | 3300037471 | Ga0395905_0399924 | Ga0395905_0399924_178_582 | 134 |
| 444 | 3300037471 | Ga0395905_1618297 | Ga0395905_1618297_118_528 | 134 |
| 445 | 3300037471 | Ga0395905_1786056 | Ga0395905_1786056_57_461 | 134 |
| 446 | 3300038443 | Ga0395901_0000248 | Ga0395901_0000248_21028_21432 | 134 |
| 447 | 3300038443 | Ga0395901_0001201 | Ga0395901_0001201_440_850 | 134 |
| 448 | 3300038443 | Ga0395901_0005488 | Ga0395901_0005488_5722_6165 | 134 |
| 449 | 3300038443 | Ga0395901_0033619 | Ga0395901_0033619_676_1080 | 134 |
| 450 | 3300038443 | Ga0395901_0053500 | Ga0395901_0053500_3133_3540 | 134 |
| 451 | 3300038443 | Ga0395901_0112322 | Ga0395901_0112322_1405_1809 | 134 |
| 452 | 3300038443 | Ga0395901_0232464 | Ga0395901_0232464_1103_1513 | 134 |
| 453 | 3300038443 | Ga0395901_0266208 | Ga0395901_0266208_889_1293 | 134 |
| 454 | 3300038443 | Ga0395901_0368635 | Ga0395901_0368635_979_1383 | 134 |
| 455 | 3300038443 | Ga0395901_0963436 | Ga0395901_0963436_401_805 | 134 |
| 456 | 3300038443 | Ga0395901_1348648 | Ga0395901_1348648_109_513 | 134 |
| 457 | 3300038443 | Ga0395901_1585893 | Ga0395901_1585893_156_560 | 134 |
| 458 | 3300042142 | Ga0450905_000308 | Ga0450905_000308_2946_3371 | 134 |
| 459 | 3300042144 | Ga0450889_000193 | Ga0450889_000193_6071_6496 | 134 |
| 460 | 3300042530 | Ga0450916_011021 | Ga0450916_011021_720_1127 | 134 |
| 461 | 3300044656 | Ga0466969_0236065 | Ga0466969_0236065_290_694 | 134 |
| 462 | 3300044658 | Ga0466972_0013931 | Ga0466972_0013931_1543_1947 | 134 |
| 463 | 3300044684 | Ga0466966_0206842 | Ga0466966_0206842_375_779 | 134 |
| 464 | 3300044684 | Ga0466966_0379329 | Ga0466966_0379329_121_525 | 134 |
| 465 | 3300044693 | Ga0466961_0019333 | Ga0466961_0019333_3742_4146 | 134 |
| 466 | 3300044693 | Ga0466961_0071576 | Ga0466961_0071576_886_1290 | 134 |
| 467 | 3300044694 | Ga0466963_0011010 | Ga0466963_0011010_288_731 | 134 |
| 468 | 3300044694 | Ga0466963_0026975 | Ga0466963_0026975_1925_2329 | 134 |
| 469 | 3300044694 | Ga0466963_0073469 | Ga0466963_0073469_249_653 | 134 |
| 470 | 3300044694 | Ga0466963_0106910 | Ga0466963_0106910_488_892 | 134 |
| 471 | 3300044694 | Ga0466963_0109725 | Ga0466963_0109725_818_1222 | 134 |
| 472 | 3300044694 | Ga0466963_0312157 | Ga0466963_0312157_95_499 | 134 |
| 473 | 3300044694 | Ga0466963_1223523 | Ga0466963_1223523_42_446 | 134 |
| 474 | 3300044842 | Ga0466957_0010341 | Ga0466957_0010341_3825_4229 | 134 |
| 475 | 3300044842 | Ga0466957_0086722 | Ga0466957_0086722_89_493 | 134 |
| 476 | 3300044842 | Ga0466957_0388337 | Ga0466957_0388337_214_618 | 134 |
| 477 | 3300044901 | Ga0466960_0024453 | Ga0466960_0024453_454_858 | 134 |
| 478 | 3300045049 | Ga0466959_0015101 | Ga0466959_0015101_3387_3791 | 134 |
| 479 | 3300045836 | Ga0466958_0004622 | Ga0466958_0004622_5096_5500 | 134 |
| 480 | 3300045836 | Ga0466958_0160209 | Ga0466958_0160209_624_1028 | 134 |
| 481 | 3300045976 | Ga0466967_0031731 | Ga0466967_0031731_3590_3994 | 134 |
| 482 | 3300045976 | Ga0466967_0077920 | Ga0466967_0077920_42_446 | 134 |
| 483 | 3300045976 | Ga0466967_0107463 | Ga0466967_0107463_1604_2047 | 134 |
| 484 | 3300045976 | Ga0466967_0142167 | Ga0466967_0142167_1030_1473 | 134 |
| 485 | 3300045976 | Ga0466967_0142274 | Ga0466967_0142274_1383_1823 | 134 |
| 486 | 3300045976 | Ga0466967_0160602 | Ga0466967_0160602_1025_1429 | 134 |
| 487 | 3300045976 | Ga0466967_0182596 | Ga0466967_0182596_678_1082 | 134 |
| 488 | 3300045976 | Ga0466967_0418201 | Ga0466967_0418201_756_1160 | 134 |
| 489 | 3300045976 | Ga0466967_0824391 | Ga0466967_0824391_238_642 | 134 |
| 490 | 3300045976 | Ga0466967_0857472 | Ga0466967_0857472_97_501 | 134 |
| 491 | 3300048912 | Ga0496109_1069929 | Ga0496109_1069929_139_549 | 134 |
| 492 | 3300048913 | Ga0496110_0058166 | Ga0496110_0058166_2383_2793 | 134 |
| 493 | 3300048914 | Ga0496111_0183123 | Ga0496111_0183123_840_1250 | 134 |
| 494 | 3300048915 | Ga0496112_0005549 | Ga0496112_0005549_2788_3198 | 134 |
| 495 | 3300048916 | Ga0496113_0007460 | Ga0496113_0007460_6153_6563 | 134 |
| 496 | 3300049581 | Ga0501047_0775060 | Ga0501047_0775060_347_751 | 134 |
| 497 | 3300049584 | Ga0501068_0091248 | Ga0501068_0091248_479_883 | 134 |
| 498 | 3300049741 | Ga0501079_0600648 | Ga0501079_0600648_381_785 | 134 |
| 499 | 3300049742 | Ga0501080_0041798 | Ga0501080_0041798_832_1236 | 134 |
| 500 | 3300049823 | Ga0501044_0805947 | Ga0501044_0805947_121_525 | 134 |
| 501 | 3300050507 | nmdc:mga05p37_867572_c1 | nmdc:mga05p37_867572_c1_384_791 | 134 |
| 502 | 3300050508 | nmdc:mga09592_133478_c1 | nmdc:mga09592_133478_c1_1629_2036 | 134 |
| 503 | 3300061719 | Ga0466962_0007173 | Ga0466962_0007173_3227_3631 | 134 |
| 504 | 3300061719 | Ga0466962_0424683 | Ga0466962_0424683_141_545 | 134 |
| 505 | 3300001976 | JGI24752J21851_1033251 | JGI24752J21851_10332512 | 135 |
| 506 | 3300001978 | JGI24747J21853_1003908 | JGI24747J21853_10039082 | 135 |
| 507 | 3300001979 | JGI24740J21852_10067802 | JGI24740J21852_100678022 | 135 |
| 508 | 3300001989 | JGI24739J22299_10012780 | JGI24739J22299_100127802 | 135 |
| 509 | 3300001990 | JGI24737J22298_10016841 | JGI24737J22298_100168412 | 135 |
| 510 | 3300001991 | JGI24743J22301_10003394 | JGI24743J22301_100033944 | 135 |
| 511 | 3300002073 | JGI24745J21846_1009482 | JGI24745J21846_10094822 | 135 |
| 512 | 3300002075 | JGI24738J21930_10007344 | JGI24738J21930_100073442 | 135 |
| 513 | 3300002075 | JGI24738J21930_10044252 | JGI24738J21930_100442521 | 135 |
| 514 | 3300002077 | JGI24744J21845_10000055 | JGI24744J21845_100000556 | 135 |
| 515 | 3300002077 | JGI24744J21845_10089105 | JGI24744J21845_100891052 | 135 |
| 516 | 3300002244 | JGI24742J22300_10010994 | JGI24742J22300_100109942 | 135 |
| 517 | 3300005293 | Ga0065715_10330324 | Ga0065715_103303242 | 135 |
| 518 | 3300005327 | Ga0070658_10019242 | Ga0070658_100192422 | 135 |
| 519 | 3300005327 | Ga0070658_10959533 | Ga0070658_109595331 | 135 |
| 520 | 3300005328 | Ga0070676_10145470 | Ga0070676_101454702 | 135 |
| 521 | 3300005328 | Ga0070676_10278123 | Ga0070676_102781232 | 135 |
| 522 | 3300005330 | Ga0070690_100462654 | Ga0070690_1004626542 | 135 |
| 523 | 3300005331 | Ga0070670_100736880 | Ga0070670_1007368802 | 135 |
| 524 | 3300005333 | Ga0070677_10009387 | Ga0070677_100093873 | 135 |
| 525 | 3300005334 | Ga0068869_100196342 | Ga0068869_1001963422 | 135 |
| 526 | 3300005335 | Ga0070666_10009331 | Ga0070666_100093314 | 135 |
| 527 | 3300005335 | Ga0070666_10021579 | Ga0070666_100215792 | 135 |
| 528 | 3300005337 | Ga0070682_100843571 | Ga0070682_1008435711 | 135 |
| 529 | 3300005338 | Ga0068868_100085855 | Ga0068868_1000858554 | 135 |
| 530 | 3300005338 | Ga0068868_100186385 | Ga0068868_1001863853 | 135 |
| 531 | 3300005338 | Ga0068868_100539636 | Ga0068868_1005396362 | 135 |
| 532 | 3300005338 | Ga0068868_100712910 | Ga0068868_1007129102 | 135 |
| 533 | 3300005339 | Ga0070660_100037460 | Ga0070660_1000374603 | 135 |
| 534 | 3300005339 | Ga0070660_100127129 | Ga0070660_1001271292 | 135 |
| 535 | 3300005339 | Ga0070660_100226243 | Ga0070660_1002262432 | 135 |
| 536 | 3300005343 | Ga0070687_100038691 | Ga0070687_1000386912 | 135 |
| 537 | 3300005343 | Ga0070687_100383776 | Ga0070687_1003837761 | 135 |
| 538 | 3300005344 | Ga0070661_100075836 | Ga0070661_1000758362 | 135 |
| 539 | 3300005344 | Ga0070661_100151892 | Ga0070661_1001518922 | 135 |
| 540 | 3300005344 | Ga0070661_100379166 | Ga0070661_1003791662 | 135 |
| 541 | 3300005347 | Ga0070668_100053802 | Ga0070668_1000538024 | 135 |
| 542 | 3300005347 | Ga0070668_100544430 | Ga0070668_1005444301 | 135 |
| 543 | 3300005353 | Ga0070669_100274046 | Ga0070669_1002740462 | 135 |
| 544 | 3300005353 | Ga0070669_100701360 | Ga0070669_1007013601 | 135 |
| 545 | 3300005354 | Ga0070675_100022320 | Ga0070675_1000223203 | 135 |
| 546 | 3300005354 | Ga0070675_100159534 | Ga0070675_1001595342 | 135 |
| 547 | 3300005354 | Ga0070675_100608643 | Ga0070675_1006086431 | 135 |
| 548 | 3300005355 | Ga0070671_100036337 | Ga0070671_1000363374 | 135 |
| 549 | 3300005355 | Ga0070671_100203211 | Ga0070671_1002032113 | 135 |
| 550 | 3300005356 | Ga0070674_100109065 | Ga0070674_1001090652 | 135 |
| 551 | 3300005356 | Ga0070674_100829203 | Ga0070674_1008292032 | 135 |
| 552 | 3300005356 | Ga0070674_102206463 | Ga0070674_1022064631 | 135 |
| 553 | 3300005364 | Ga0070673_100011901 | Ga0070673_1000119015 | 135 |
| 554 | 3300005364 | Ga0070673_100112245 | Ga0070673_1001122452 | 135 |
| 555 | 3300005364 | Ga0070673_100379226 | Ga0070673_1003792261 | 135 |
| 556 | 3300005364 | Ga0070673_100516919 | Ga0070673_1005169192 | 135 |
| 557 | 3300005364 | Ga0070673_101356516 | Ga0070673_1013565162 | 135 |
| 558 | 3300005366 | Ga0070659_100174550 | Ga0070659_1001745502 | 135 |
| 559 | 3300005366 | Ga0070659_100197328 | Ga0070659_1001973282 | 135 |
| 560 | 3300005366 | Ga0070659_100403163 | Ga0070659_1004031632 | 135 |
| 561 | 3300005367 | Ga0070667_100018568 | Ga0070667_1000185683 | 135 |
| 562 | 3300005367 | Ga0070667_100081208 | Ga0070667_1000812082 | 135 |
| 563 | 3300005367 | Ga0070667_100240698 | Ga0070667_1002406982 | 135 |
| 564 | 3300005435 | Ga0070714_100326088 | Ga0070714_1003260882 | 135 |
| 565 | 3300005436 | Ga0070713_100165898 | Ga0070713_1001658982 | 135 |
| 566 | 3300005455 | Ga0070663_100065855 | Ga0070663_1000658553 | 135 |
| 567 | 3300005455 | Ga0070663_100509490 | Ga0070663_1005094902 | 135 |
| 568 | 3300005456 | Ga0070678_100004224 | Ga0070678_1000042246 | 135 |
| 569 | 3300005456 | Ga0070678_100009114 | Ga0070678_1000091143 | 135 |
| 570 | 3300005456 | Ga0070678_100063425 | Ga0070678_1000634252 | 135 |
| 571 | 3300005457 | Ga0070662_100005197 | Ga0070662_1000051973 | 135 |
| 572 | 3300005457 | Ga0070662_100018155 | Ga0070662_1000181554 | 135 |
| 573 | 3300005457 | Ga0070662_100072350 | Ga0070662_1000723502 | 135 |
| 574 | 3300005457 | Ga0070662_100318324 | Ga0070662_1003183241 | 135 |
| 575 | 3300005457 | Ga0070662_100497510 | Ga0070662_1004975102 | 135 |
| 576 | 3300005458 | Ga0070681_10284714 | Ga0070681_102847142 | 135 |
| 577 | 3300005458 | Ga0070681_10296169 | Ga0070681_102961692 | 135 |
| 578 | 3300005459 | Ga0068867_100020963 | Ga0068867_1000209632 | 135 |
| 579 | 3300005466 | Ga0070685_10278927 | Ga0070685_102789272 | 135 |
| 580 | 3300005530 | Ga0070679_100370709 | Ga0070679_1003707092 | 135 |
| 581 | 3300005539 | Ga0068853_100099466 | Ga0068853_1000994662 | 135 |
| 582 | 3300005543 | Ga0070672_100016213 | Ga0070672_1000162132 | 135 |
| 583 | 3300005543 | Ga0070672_100448923 | Ga0070672_1004489232 | 135 |
| 584 | 3300005544 | Ga0070686_100036653 | Ga0070686_1000366532 | 135 |
| 585 | 3300005547 | Ga0070693_100040100 | Ga0070693_1000401003 | 135 |
| 586 | 3300005548 | Ga0070665_100006320 | Ga0070665_10000632010 | 135 |
| 587 | 3300005548 | Ga0070665_100053630 | Ga0070665_1000536302 | 135 |
| 588 | 3300005563 | Ga0068855_100207682 | Ga0068855_1002076823 | 135 |
| 589 | 3300005563 | Ga0068855_100243286 | Ga0068855_1002432862 | 135 |
| 590 | 3300005564 | Ga0070664_100021210 | Ga0070664_1000212102 | 135 |
| 591 | 3300005564 | Ga0070664_100105909 | Ga0070664_1001059092 | 135 |
| 592 | 3300005564 | Ga0070664_100114810 | Ga0070664_1001148102 | 135 |
| 593 | 3300005564 | Ga0070664_100203269 | Ga0070664_1002032692 | 135 |
| 594 | 3300005564 | Ga0070664_100441537 | Ga0070664_1004415372 | 135 |
| 595 | 3300005577 | Ga0068857_100482680 | Ga0068857_1004826801 | 135 |
| 596 | 3300005577 | Ga0068857_101037990 | Ga0068857_1010379902 | 135 |
| 597 | 3300005578 | Ga0068854_100154935 | Ga0068854_1001549351 | 135 |
| 598 | 3300005578 | Ga0068854_100508400 | Ga0068854_1005084002 | 135 |
| 599 | 3300005614 | Ga0068856_100098357 | Ga0068856_1000983572 | 135 |
| 600 | 3300005614 | Ga0068856_100172945 | Ga0068856_1001729452 | 135 |
| 601 | 3300005614 | Ga0068856_101346078 | Ga0068856_1013460782 | 135 |
| 602 | 3300005615 | Ga0070702_100975996 | Ga0070702_1009759961 | 135 |
| 603 | 3300005616 | Ga0068852_100021969 | Ga0068852_1000219695 | 135 |
| 604 | 3300005616 | Ga0068852_100189039 | Ga0068852_1001890392 | 135 |
| 605 | 3300005617 | Ga0068859_100028161 | Ga0068859_1000281613 | 135 |
| 606 | 3300005618 | Ga0068864_100155118 | Ga0068864_1001551183 | 135 |
| 607 | 3300005618 | Ga0068864_100197960 | Ga0068864_1001979602 | 135 |
| 608 | 3300005618 | Ga0068864_100486578 | Ga0068864_1004865782 | 135 |
| 609 | 3300005718 | Ga0068866_10048109 | Ga0068866_100481092 | 135 |
| 610 | 3300005718 | Ga0068866_10050117 | Ga0068866_100501173 | 135 |
| 611 | 3300005719 | Ga0068861_100211480 | Ga0068861_1002114802 | 135 |
| 612 | 3300005834 | Ga0068851_10008929 | Ga0068851_100089295 | 135 |
| 613 | 3300005834 | Ga0068851_10039813 | Ga0068851_100398132 | 135 |
| 614 | 3300005840 | Ga0068870_10283983 | Ga0068870_102839832 | 135 |
| 615 | 3300005841 | Ga0068863_100005699 | Ga0068863_1000056993 | 135 |
| 616 | 3300005841 | Ga0068863_100916996 | Ga0068863_1009169961 | 135 |
| 617 | 3300005842 | Ga0068858_100164300 | Ga0068858_1001643003 | 135 |
| 618 | 3300005842 | Ga0068858_100232956 | Ga0068858_1002329562 | 135 |
| 619 | 3300005843 | Ga0068860_100192759 | Ga0068860_1001927593 | 135 |
| 620 | 3300006237 | Ga0097621_100013004 | Ga0097621_1000130043 | 135 |
| 621 | 3300006237 | Ga0097621_100362425 | Ga0097621_1003624252 | 135 |
| 622 | 3300006358 | Ga0068871_100013255 | Ga0068871_1000132555 | 135 |
| 623 | 3300006881 | Ga0068865_100364330 | Ga0068865_1003643302 | 135 |
| 624 | 3300006931 | Ga0097620_100028158 | Ga0097620_1000281583 | 135 |
| 625 | 3300009093 | Ga0105240_10211090 | Ga0105240_102110902 | 135 |
| 626 | 3300009098 | Ga0105245_10037973 | Ga0105245_100379734 | 135 |
| 627 | 3300009098 | Ga0105245_10065426 | Ga0105245_100654263 | 135 |
| 628 | 3300009148 | Ga0105243_10064552 | Ga0105243_100645522 | 135 |
| 629 | 3300009148 | Ga0105243_10210720 | Ga0105243_102107203 | 135 |
| 630 | 3300009174 | Ga0105241_10154098 | Ga0105241_101540983 | 135 |
| 631 | 3300009174 | Ga0105241_10349370 | Ga0105241_103493702 | 135 |
| 632 | 3300009174 | Ga0105241_11204122 | Ga0105241_112041221 | 135 |
| 633 | 3300009176 | Ga0105242_10054494 | Ga0105242_100544942 | 135 |
| 634 | 3300009176 | Ga0105242_10324709 | Ga0105242_103247092 | 135 |
| 635 | 3300009177 | Ga0105248_10085838 | Ga0105248_100858384 | 135 |
| 636 | 3300009177 | Ga0105248_10589610 | Ga0105248_105896102 | 135 |
| 637 | 3300009177 | Ga0105248_11494295 | Ga0105248_114942952 | 135 |
| 638 | 3300009551 | Ga0105238_10457204 | Ga0105238_104572043 | 135 |
| 639 | 3300009551 | Ga0105238_10658903 | Ga0105238_106589032 | 135 |
| 640 | 3300009551 | Ga0105238_11398598 | Ga0105238_113985982 | 135 |
| 641 | 3300009553 | Ga0105249_12503674 | Ga0105249_125036742 | 135 |
| 642 | 3300010375 | Ga0105239_10081790 | Ga0105239_100817903 | 135 |
| 643 | 3300010375 | Ga0105239_11762993 | Ga0105239_117629932 | 135 |
| 644 | 3300011119 | Ga0105246_10053188 | Ga0105246_100531882 | 135 |
| 645 | 3300013100 | Ga0157373_10083663 | Ga0157373_100836632 | 135 |
| 646 | 3300013100 | Ga0157373_10256689 | Ga0157373_102566892 | 135 |
| 647 | 3300013100 | Ga0157373_11515958 | Ga0157373_115159581 | 135 |
| 648 | 3300013102 | Ga0157371_10038044 | Ga0157371_100380442 | 135 |
| 649 | 3300013102 | Ga0157371_10065257 | Ga0157371_100652572 | 135 |
| 650 | 3300013105 | Ga0157369_10208604 | Ga0157369_102086041 | 135 |
| 651 | 3300013105 | Ga0157369_10649490 | Ga0157369_106494902 | 135 |
| 652 | 3300013296 | Ga0157374_10050975 | Ga0157374_100509753 | 135 |
| 653 | 3300013296 | Ga0157374_10079406 | Ga0157374_100794062 | 135 |
| 654 | 3300013296 | Ga0157374_10464772 | Ga0157374_104647722 | 135 |
| 655 | 3300013296 | Ga0157374_10564921 | Ga0157374_105649212 | 135 |
| 656 | 3300013296 | Ga0157374_11503172 | Ga0157374_115031722 | 135 |
| 657 | 3300013297 | Ga0157378_10021644 | Ga0157378_100216444 | 135 |
| 658 | 3300013297 | Ga0157378_10033817 | Ga0157378_100338172 | 135 |
| 659 | 3300013306 | Ga0163162_10056100 | Ga0163162_100561003 | 135 |
| 660 | 3300013306 | Ga0163162_10161503 | Ga0163162_101615032 | 135 |
| 661 | 3300013307 | Ga0157372_10988526 | Ga0157372_109885262 | 135 |
| 662 | 3300013308 | Ga0157375_10016314 | Ga0157375_100163146 | 135 |
| 663 | 3300013308 | Ga0157375_10027659 | Ga0157375_100276592 | 135 |
| 664 | 3300013308 | Ga0157375_10312787 | Ga0157375_103127872 | 135 |
| 665 | 3300013308 | Ga0157375_11810632 | Ga0157375_118106321 | 135 |
| 666 | 3300014325 | Ga0163163_10405083 | Ga0163163_104050832 | 135 |
| 667 | 3300014326 | Ga0157380_10527351 | Ga0157380_105273512 | 135 |
| 668 | 3300014745 | Ga0157377_10056992 | Ga0157377_100569922 | 135 |
| 669 | 3300014745 | Ga0157377_10201160 | Ga0157377_102011602 | 135 |
| 670 | 3300014968 | Ga0157379_11281722 | Ga0157379_112817222 | 135 |
| 671 | 3300014969 | Ga0157376_10185201 | Ga0157376_101852013 | 135 |
| 672 | 3300014969 | Ga0157376_10492334 | Ga0157376_104923342 | 135 |
| 673 | 3300017792 | Ga0163161_10571810 | Ga0163161_105718102 | 135 |
| 674 | 3300025315 | Ga0207697_10034325 | Ga0207697_100343255 | 135 |
| 675 | 3300025315 | Ga0207697_10066762 | Ga0207697_100667622 | 135 |
| 676 | 3300025315 | Ga0207697_10155131 | Ga0207697_101551312 | 135 |
| 677 | 3300025321 | Ga0207656_10025165 | Ga0207656_100251653 | 135 |
| 678 | 3300025321 | Ga0207656_10540296 | Ga0207656_105402962 | 135 |
| 679 | 3300025893 | Ga0207682_10001342 | Ga0207682_100013429 | 135 |
| 680 | 3300025899 | Ga0207642_10086534 | Ga0207642_100865342 | 135 |
| 681 | 3300025901 | Ga0207688_10009382 | Ga0207688_100093824 | 135 |
| 682 | 3300025901 | Ga0207688_10337600 | Ga0207688_103376002 | 135 |
| 683 | 3300025901 | Ga0207688_10734798 | Ga0207688_107347982 | 135 |
| 684 | 3300025903 | Ga0207680_10003327 | Ga0207680_100033274 | 135 |
| 685 | 3300025903 | Ga0207680_10007066 | Ga0207680_100070663 | 135 |
| 686 | 3300025904 | Ga0207647_10219558 | Ga0207647_102195582 | 135 |
| 687 | 3300025907 | Ga0207645_10015407 | Ga0207645_100154072 | 135 |
| 688 | 3300025907 | Ga0207645_10106104 | Ga0207645_101061042 | 135 |
| 689 | 3300025907 | Ga0207645_10265082 | Ga0207645_102650822 | 135 |
| 690 | 3300025908 | Ga0207643_10150036 | Ga0207643_101500362 | 135 |
| 691 | 3300025909 | Ga0207705_10103966 | Ga0207705_101039662 | 135 |
| 692 | 3300025909 | Ga0207705_10111793 | Ga0207705_101117932 | 135 |
| 693 | 3300025909 | Ga0207705_10138049 | Ga0207705_101380492 | 135 |
| 694 | 3300025911 | Ga0207654_10598661 | Ga0207654_105986611 | 135 |
| 695 | 3300025911 | Ga0207654_10848306 | Ga0207654_108483061 | 135 |
| 696 | 3300025912 | Ga0207707_10287192 | Ga0207707_102871922 | 135 |
| 697 | 3300025912 | Ga0207707_10419268 | Ga0207707_104192682 | 135 |
| 698 | 3300025913 | Ga0207695_10543926 | Ga0207695_105439262 | 135 |
| 699 | 3300025918 | Ga0207662_10023202 | Ga0207662_100232022 | 135 |
| 700 | 3300025919 | Ga0207657_10014934 | Ga0207657_100149342 | 135 |
| 701 | 3300025919 | Ga0207657_10029689 | Ga0207657_100296894 | 135 |
| 702 | 3300025919 | Ga0207657_10034236 | Ga0207657_100342364 | 135 |
| 703 | 3300025919 | Ga0207657_10145426 | Ga0207657_101454262 | 135 |
| 704 | 3300025920 | Ga0207649_10027742 | Ga0207649_100277423 | 135 |
| 705 | 3300025920 | Ga0207649_10107540 | Ga0207649_101075402 | 135 |
| 706 | 3300025920 | Ga0207649_10565012 | Ga0207649_105650121 | 135 |
| 707 | 3300025920 | Ga0207649_10840692 | Ga0207649_108406922 | 135 |
| 708 | 3300025920 | Ga0207649_10857960 | Ga0207649_108579602 | 135 |
| 709 | 3300025921 | Ga0207652_10276410 | Ga0207652_102764102 | 135 |
| 710 | 3300025923 | Ga0207681_10830529 | Ga0207681_108305291 | 135 |
| 711 | 3300025924 | Ga0207694_10330707 | Ga0207694_103307073 | 135 |
| 712 | 3300025925 | Ga0207650_10004781 | Ga0207650_100047812 | 135 |
| 713 | 3300025926 | Ga0207659_10196454 | Ga0207659_101964542 | 135 |
| 714 | 3300025927 | Ga0207687_10107523 | Ga0207687_101075232 | 135 |
| 715 | 3300025927 | Ga0207687_10160373 | Ga0207687_101603732 | 135 |
| 716 | 3300025927 | Ga0207687_10169601 | Ga0207687_101696012 | 135 |
| 717 | 3300025928 | Ga0207700_10258425 | Ga0207700_102584252 | 135 |
| 718 | 3300025928 | Ga0207700_10462894 | Ga0207700_104628942 | 135 |
| 719 | 3300025929 | Ga0207664_10125235 | Ga0207664_101252352 | 135 |
| 720 | 3300025931 | Ga0207644_10000142 | Ga0207644_1000014215 | 135 |
| 721 | 3300025931 | Ga0207644_10554064 | Ga0207644_105540642 | 135 |
| 722 | 3300025932 | Ga0207690_10046793 | Ga0207690_100467932 | 135 |
| 723 | 3300025932 | Ga0207690_10269397 | Ga0207690_102693972 | 135 |
| 724 | 3300025932 | Ga0207690_10299348 | Ga0207690_102993481 | 135 |
| 725 | 3300025932 | Ga0207690_10429579 | Ga0207690_104295792 | 135 |
| 726 | 3300025933 | Ga0207706_10005721 | Ga0207706_100057219 | 135 |
| 727 | 3300025933 | Ga0207706_10019092 | Ga0207706_100190923 | 135 |
| 728 | 3300025933 | Ga0207706_10086882 | Ga0207706_100868823 | 135 |
| 729 | 3300025933 | Ga0207706_10145933 | Ga0207706_101459332 | 135 |
| 730 | 3300025934 | Ga0207686_10301444 | Ga0207686_103014442 | 135 |
| 731 | 3300025935 | Ga0207709_10572962 | Ga0207709_105729622 | 135 |
| 732 | 3300025937 | Ga0207669_10065902 | Ga0207669_100659022 | 135 |
| 733 | 3300025938 | Ga0207704_10016287 | Ga0207704_100162873 | 135 |
| 734 | 3300025940 | Ga0207691_10006169 | Ga0207691_100061699 | 135 |
| 735 | 3300025940 | Ga0207691_10024129 | Ga0207691_100241294 | 135 |
| 736 | 3300025940 | Ga0207691_10043385 | Ga0207691_100433854 | 135 |
| 737 | 3300025940 | Ga0207691_11592727 | Ga0207691_115927271 | 135 |
| 738 | 3300025941 | Ga0207711_10350779 | Ga0207711_103507792 | 135 |
| 739 | 3300025941 | Ga0207711_10386494 | Ga0207711_103864942 | 135 |
| 740 | 3300025941 | Ga0207711_10798801 | Ga0207711_107988012 | 135 |
| 741 | 3300025942 | Ga0207689_10012587 | Ga0207689_100125876 | 135 |
| 742 | 3300025945 | Ga0207679_10016598 | Ga0207679_100165982 | 135 |
| 743 | 3300025945 | Ga0207679_10107503 | Ga0207679_101075032 | 135 |
| 744 | 3300025945 | Ga0207679_10314524 | Ga0207679_103145242 | 135 |
| 745 | 3300025945 | Ga0207679_10318756 | Ga0207679_103187561 | 135 |
| 746 | 3300025949 | Ga0207667_10039670 | Ga0207667_100396702 | 135 |
| 747 | 3300025960 | Ga0207651_10005732 | Ga0207651_100057325 | 135 |
| 748 | 3300025960 | Ga0207651_10010290 | Ga0207651_100102906 | 135 |
| 749 | 3300025960 | Ga0207651_10973357 | Ga0207651_109733571 | 135 |
| 750 | 3300025972 | Ga0207668_10368207 | Ga0207668_103682072 | 135 |
| 751 | 3300025981 | Ga0207640_10244932 | Ga0207640_102449322 | 135 |
| 752 | 3300025981 | Ga0207640_10339783 | Ga0207640_103397832 | 135 |
| 753 | 3300025981 | Ga0207640_11193247 | Ga0207640_111932471 | 135 |
| 754 | 3300025986 | Ga0207658_10920118 | Ga0207658_109201182 | 135 |
| 755 | 3300026023 | Ga0207677_10005002 | Ga0207677_100050022 | 135 |
| 756 | 3300026023 | Ga0207677_10298819 | Ga0207677_102988192 | 135 |
| 757 | 3300026023 | Ga0207677_10955081 | Ga0207677_109550812 | 135 |
| 758 | 3300026035 | Ga0207703_10241762 | Ga0207703_102417622 | 135 |
| 759 | 3300026041 | Ga0207639_10836987 | Ga0207639_108369871 | 135 |
| 760 | 3300026067 | Ga0207678_10010248 | Ga0207678_1001024810 | 135 |
| 761 | 3300026067 | Ga0207678_10067799 | Ga0207678_100677992 | 135 |
| 762 | 3300026078 | Ga0207702_10043057 | Ga0207702_100430573 | 135 |
| 763 | 3300026078 | Ga0207702_10176712 | Ga0207702_101767122 | 135 |
| 764 | 3300026078 | Ga0207702_11247363 | Ga0207702_112473632 | 135 |
| 765 | 3300026088 | Ga0207641_10006875 | Ga0207641_100068752 | 135 |
| 766 | 3300026088 | Ga0207641_10856120 | Ga0207641_108561202 | 135 |
| 767 | 3300026089 | Ga0207648_10011602 | Ga0207648_100116026 | 135 |
| 768 | 3300026089 | Ga0207648_10019695 | Ga0207648_100196952 | 135 |
| 769 | 3300026095 | Ga0207676_10097044 | Ga0207676_100970442 | 135 |
| 770 | 3300026095 | Ga0207676_10348835 | Ga0207676_103488352 | 135 |
| 771 | 3300026095 | Ga0207676_10674280 | Ga0207676_106742802 | 135 |
| 772 | 3300026116 | Ga0207674_10235128 | Ga0207674_102351283 | 135 |
| 773 | 3300026116 | Ga0207674_11208187 | Ga0207674_112081872 | 135 |
| 774 | 3300026118 | Ga0207675_100340165 | Ga0207675_1003401652 | 135 |
| 775 | 3300026121 | Ga0207683_10002271 | Ga0207683_1000227111 | 135 |
| 776 | 3300026121 | Ga0207683_10013861 | Ga0207683_100138614 | 135 |
| 777 | 3300026121 | Ga0207683_10025083 | Ga0207683_100250835 | 135 |
| 778 | 3300026142 | Ga0207698_10545829 | Ga0207698_105458292 | 135 |
| 779 | 3300026142 | Ga0207698_11053160 | Ga0207698_110531602 | 135 |
| 780 | 3300028379 | Ga0268266_10057167 | Ga0268266_100571672 | 135 |
| 781 | 3300034817 | Ga0373948_0152515 | Ga0373948_0152515_76_483 | 135 |
| 782 | 3300034957 | Ga0373938_0199973 | Ga0373938_0199973_57_464 | 135 |
| 783 | 3300035092 | Ga0373952_0160837 | Ga0373952_0160837_82_489 | 135 |
| 784 | 3300035092 | Ga0373952_0290951 | Ga0373952_0290951_74_490 | 135 |
| 785 | 3300035121 | Ga0373960_0069579 | Ga0373960_0069579_105_512 | 135 |
| 786 | 3300035170 | Ga0373943_0011671 | Ga0373943_0011671_2976_3386 | 135 |
| 787 | 3300035171 | Ga0373946_0011556 | Ga0373946_0011556_608_1018 | 135 |
| 788 | 3300035207 | Ga0373942_0099976 | Ga0373942_0099976_438_845 | 135 |
| 789 | 3300035691 | Ga0373931_0051628 | Ga0373931_0051628_1478_1885 | 135 |
| 790 | 3300035692 | Ga0373935_0006536 | Ga0373935_0006536_6340_6753 | 135 |
| 791 | 3300035692 | Ga0373935_0020199 | Ga0373935_0020199_1802_2212 | 135 |
| 792 | 3300035695 | Ga0373927_0022086 | Ga0373927_0022086_1928_2338 | 135 |
| 793 | 3300035725 | Ga0373947_0006264 | Ga0373947_0006264_1327_1737 | 135 |
| 794 | 3300037068 | Ga0373925_0249024 | Ga0373925_0249024_459_869 | 135 |
| 795 | 3300037312 | Ga0395899_0109688 | Ga0395899_0109688_651_1061 | 135 |
| 796 | 3300037418 | Ga0395900_0091354 | Ga0395900_0091354_242_655 | 135 |
| 797 | 3300037418 | Ga0395900_0158283 | Ga0395900_0158283_502_912 | 135 |
| 798 | 3300037418 | Ga0395900_0167586 | Ga0395900_0167586_597_1004 | 135 |
| 799 | 3300037418 | Ga0395900_0198808 | Ga0395900_0198808_1046_1456 | 135 |
| 800 | 3300037466 | Ga0395898_0038340 | Ga0395898_0038340_3296_3706 | 135 |
| 801 | 3300037466 | Ga0395898_0247782 | Ga0395898_0247782_425_832 | 135 |
| 802 | 3300037466 | Ga0395898_0329735 | Ga0395898_0329735_606_1016 | 135 |
| 803 | 3300037471 | Ga0395905_0002956 | Ga0395905_0002956_17379_17792 | 135 |
| 804 | 3300037471 | Ga0395905_0011079 | Ga0395905_0011079_4731_5141 | 135 |
| 805 | 3300037471 | Ga0395905_0019166 | Ga0395905_0019166_507_920 | 135 |
| 806 | 3300037471 | Ga0395905_0026212 | Ga0395905_0026212_4807_5214 | 135 |
| 807 | 3300037471 | Ga0395905_0058925 | Ga0395905_0058925_573_980 | 135 |
| 808 | 3300037471 | Ga0395905_0059475 | Ga0395905_0059475_1833_2243 | 135 |
| 809 | 3300037471 | Ga0395905_0131320 | Ga0395905_0131320_1343_1753 | 135 |
| 810 | 3300037471 | Ga0395905_0153323 | Ga0395905_0153323_415_825 | 135 |
| 811 | 3300037471 | Ga0395905_1230778 | Ga0395905_1230778_164_571 | 135 |
| 812 | 3300038443 | Ga0395901_0012068 | Ga0395901_0012068_6865_7275 | 135 |
| 813 | 3300038443 | Ga0395901_0020064 | Ga0395901_0020064_5933_6346 | 135 |
| 814 | 3300038443 | Ga0395901_0036467 | Ga0395901_0036467_922_1335 | 135 |
| 815 | 3300038443 | Ga0395901_0221755 | Ga0395901_0221755_1475_1882 | 135 |
| 816 | 3300038443 | Ga0395901_0264959 | Ga0395901_0264959_967_1374 | 135 |
| 817 | 3300038443 | Ga0395901_1695383 | Ga0395901_1695383_137_544 | 135 |
| 818 | 3300044683 | Ga0466965_0146056 | Ga0466965_0146056_68_475 | 135 |
| 819 | 3300044684 | Ga0466966_0535935 | Ga0466966_0535935_125_532 | 135 |
| 820 | 3300044694 | Ga0466963_0200529 | Ga0466963_0200529_642_1049 | 135 |
| 821 | 3300044842 | Ga0466957_0147311 | Ga0466957_0147311_746_1153 | 135 |
| 822 | 3300045049 | Ga0466959_0992697 | Ga0466959_0992697_22_429 | 135 |
| 823 | 3300045976 | Ga0466967_0048036 | Ga0466967_0048036_201_608 | 135 |
| 824 | 3300045976 | Ga0466967_0059029 | Ga0466967_0059029_519_926 | 135 |
| 825 | 3300045976 | Ga0466967_0092983 | Ga0466967_0092983_1014_1421 | 135 |
| 826 | 3300046525 | Ga0495663_0259036 | Ga0495663_0259036_110_517 | 135 |
| 827 | 3300046539 | Ga0495621_0000060 | Ga0495621_0000060_16208_16624 | 135 |
| 828 | 3300046558 | Ga0495633_0027524 | Ga0495633_0027524_1959_2375 | 135 |
| 829 | 3300046664 | Ga0495659_0023971 | Ga0495659_0023971_37_453 | 135 |
| 830 | 3300046684 | Ga0495669_0027423 | Ga0495669_0027423_1555_1971 | 135 |
| 831 | 3300046684 | Ga0495669_0162582 | Ga0495669_0162582_382_789 | 135 |
| 832 | 3300046691 | Ga0495670_0000649 | Ga0495670_0000649_11701_12117 | 135 |
| 833 | 3300048903 | Ga0496100_0001630 | Ga0496100_0001630_6885_7292 | 135 |
| 834 | 3300048904 | Ga0496101_0002764 | Ga0496101_0002764_5774_6181 | 135 |
| 835 | 3300048904 | Ga0496101_0113492 | Ga0496101_0113492_1385_1801 | 135 |
| 836 | 3300048905 | Ga0496102_0029658 | Ga0496102_0029658_4177_4584 | 135 |
| 837 | 3300048906 | Ga0496103_0059996 | Ga0496103_0059996_1602_2009 | 135 |
| 838 | 3300048907 | Ga0496104_0025877 | Ga0496104_0025877_2954_3361 | 135 |
| 839 | 3300048908 | Ga0496105_0116908 | Ga0496105_0116908_1599_2006 | 135 |
| 840 | 3300048909 | Ga0496106_0019173 | Ga0496106_0019173_1874_2281 | 135 |
| 841 | 3300048910 | Ga0496107_0000863 | Ga0496107_0000863_15053_15460 | 135 |
| 842 | 3300048910 | Ga0496107_0221134 | Ga0496107_0221134_200_607 | 135 |
| 843 | 3300048910 | Ga0496107_0633147 | Ga0496107_0633147_74_481 | 135 |
| 844 | 3300048911 | Ga0496108_0000954 | Ga0496108_0000954_10474_10881 | 135 |
| 845 | 3300048912 | Ga0496109_0008004 | Ga0496109_0008004_4365_4772 | 135 |
| 846 | 3300048912 | Ga0496109_0349477 | Ga0496109_0349477_551_958 | 135 |
| 847 | 3300048913 | Ga0496110_0000754 | Ga0496110_0000754_6280_6687 | 135 |
| 848 | 3300048914 | Ga0496111_0000069 | Ga0496111_0000069_11586_11993 | 135 |
| 849 | 3300048915 | Ga0496112_0004068 | Ga0496112_0004068_6119_6526 | 135 |
| 850 | 3300048915 | Ga0496112_0112500 | Ga0496112_0112500_1516_1923 | 135 |
| 851 | 3300048915 | Ga0496112_0395488 | Ga0496112_0395488_499_906 | 135 |
| 852 | 3300048915 | Ga0496112_0475481 | Ga0496112_0475481_171_578 | 135 |
| 853 | 3300048915 | Ga0496112_1179228 | Ga0496112_1179228_225_632 | 135 |
| 854 | 3300048916 | Ga0496113_0007666 | Ga0496113_0007666_248_655 | 135 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2r4i-assembly1.cif.gz_B | crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution | 0.8834 | 7 | 123 |
| 3fsd-assembly1.cif.gz_A-2 | crystal structure of ntf2-like protein of unknown function in nutrient uptake (yp_427473.1) from rhodospirillum rubrum atcc 11170 at 1.70 a resolution | 0.8788 | 9 | 124 |
| 3ksp-assembly1.cif.gz_A-2 | crystal structure of a putative ca/calmodulin-dependent kinase ii association domain (exig_1688) from exiguobacterium sibiricum 255-15 at 2.59 a resolution | 0.8693 | 9 | 125 |
| 3rob-assembly2.cif.gz_D | the crystal structure of a conserved protein from planctomyces limnophilus dsm 3776 | 0.8683 | 9 | 124 |
| 2r4i-assembly1.cif.gz_B | crystal structure of a ntf2-like protein (chu_1428) from cytophaga hutchinsonii atcc 33406 at 1.60 a resolution | 0.8493 | 7 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2r4iB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.888 | 7 | 123 | 3.10.450.50 |
| 3fsdA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8665 | 9 | 124 | 3.10.450.50 |
| 2r4iB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8603 | 7 | 123 | 3.10.450.50 |
| 3fkaD00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8376 | 9 | 120 | 3.10.450.50 |
| 3fsdA00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.8331 | 9 | 124 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7G9SJQ5-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9826 | 1 | 126 |
|
| AF-A0A7G9SJQ5-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9384 | 1 | 126 |
|
| AF-A0A6G7ZIC2-F1-model_v4 | Nuclear transport factor 2 family protein | 0.9308 | 9 | 126 |
|
| AF-A0A3B9LGS6-F1-model_v4 | DUF4440 domain-containing protein | 0.9126 | 7 | 125 |
|
| AF-A0A2V9YTV2-F1-model_v4 | DUF4440 domain-containing protein | 0.9107 | 5 | 127 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar