F483570

General Info

Members Datasets Scaffolds Average Seq Length
854 297 1708 261

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10463844|Ga0070658_104638442
Length 275
Sequence VIEFHEVVVRYRHREQPALAKVSLLAKRHRITAVVGPNGSGKSTLVRALVGSVPIQAGAITLDGQPIISSGRRSLATRIAVMTQREEPAFPLTVREYIALGRYPHLGMWRLAGREDRDAITRAVDLTETAEFQDRAITELSGGEWQRVRLARALAQGGDAIVLDEPTTFLDVGHEMGIFELLSRLAGEGQAVLLVSHQLNLVARFADHMVLLHRGRVAAAGDVPSVMRGPILERVYDWPLVVTRDPAVGAPALVPLRVRPRGERTDNPSEPDSPR

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
96 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
187 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
190 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
191 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
195 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
196 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
199 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
202 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
209 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
210 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
213 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
214 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
217 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
218 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
219 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
220 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
231 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
245 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
248 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
249 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
250 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
262 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
268 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
279 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
280 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
283 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
284 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
285 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
289 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 2643221618 Ensifer sp. Root231 Isolate Unclassified
293 2643221626 Ensifer sp. Root31 Isolate Unclassified
294 2643221655 Ensifer sp. Root1252 Isolate Unclassified
295 2643221659 Ensifer sp. Root127 Isolate Unclassified
296 2643221698 Ensifer sp. Root142 Isolate Unclassified
297 2643221712 Ensifer sp. Root258 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 97.78
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10463844 3300005327 Bacteria 1092
2 MBSR1b_contig_10693841 2162886012 Bacteria 1125
3 MBSR1b_contig_11866738 2162886012 Bacteria 1256
4 MBSR1b_contig_1198787 2162886012 Bacteria 1256
5 JGI25406J46586_10049612 3300003203 Bacteria 1414
6 Ga0065715_10192997 3300005293 Unclassified 1404
7 Ga0065715_10295900 3300005293 Bacteria 1052
8 Ga0070658_10003398 3300005327 Bacteria 13094
9 Ga0070658_10005732 3300005327 Bacteria 10070
10 Ga0070658_10010035 3300005327 Bacteria 7606
11 Ga0070658_10015915 3300005327 Bacteria 6015
12 Ga0070658_10248439 3300005327 Bacteria 1509
13 Ga0070676_10018096 3300005328 Bacteria 3901
14 Ga0070676_10024158 3300005328 Bacteria 3421
15 Ga0070676_10112118 3300005328 Bacteria 1700
16 Ga0070683_100002801 3300005329 Bacteria 13945
17 Ga0070683_100007767 3300005329 Bacteria 9083
18 Ga0070683_100080952 3300005329 Bacteria 3040
19 Ga0070683_100112162 3300005329 Bacteria 2573
20 Ga0070683_100392244 3300005329 Bacteria 1323
21 Ga0070690_100061561 3300005330 Bacteria 2418
22 Ga0070690_100108243 3300005330 Unclassified 1851
23 Ga0070670_100000989 3300005331 Bacteria 22326
24 Ga0070670_100063923 3300005331 Bacteria 3158
25 Ga0070670_100089463 3300005331 Bacteria 2646
26 Ga0070670_100229470 3300005331 Unclassified 1615
27 Ga0070670_100298614 3300005331 Bacteria 1408
28 Ga0068869_100001309 3300005334 Bacteria 14735
29 Ga0068869_100006175 3300005334 Bacteria 7584
30 Ga0068869_100032195 3300005334 Bacteria 3693
31 Ga0070666_10066798 3300005335 Bacteria 2441
32 Ga0070680_100000691 3300005336 Bacteria 23416
33 Ga0070680_100001244 3300005336 Bacteria 18369
34 Ga0070680_100003749 3300005336 Bacteria 11356
35 Ga0070680_100049016 3300005336 Bacteria 3442
36 Ga0070680_100060500 3300005336 Bacteria 3099
37 Ga0070680_100180305 3300005336 Bacteria 1779
38 Ga0070680_100324197 3300005336 Bacteria 1308
39 Ga0070682_100007750 3300005337 Bacteria 6048
40 Ga0070682_100009581 3300005337 Bacteria 5482
41 Ga0070682_100112270 3300005337 Bacteria 1818
42 Ga0068868_100016115 3300005338 Bacteria 5544
43 Ga0068868_100027677 3300005338 Bacteria 4326
44 Ga0068868_100091331 3300005338 Bacteria 2453
45 Ga0068868_100217795 3300005338 Unclassified 1597
46 Ga0070660_100005663 3300005339 Bacteria 8657
47 Ga0070660_100024672 3300005339 Bacteria 4462
48 Ga0070660_100063385 3300005339 Bacteria 2874
49 Ga0070660_100099164 3300005339 Unclassified 2306
50 Ga0070660_100364028 3300005339 Bacteria 1192
51 Ga0070689_100019798 3300005340 Bacteria 4980
52 Ga0070689_100022050 3300005340 Unclassified 4751
53 Ga0070689_100022958 3300005340 Bacteria 4665
54 Ga0070689_100186257 3300005340 Bacteria 1688
55 Ga0070689_100435414 3300005340 Archaea 1113
56 Ga0070661_100009031 3300005344 Bacteria 6896
57 Ga0070661_100036924 3300005344 Bacteria 3553
58 Ga0070661_100063263 3300005344 Bacteria 2717
59 Ga0070661_100089410 3300005344 Bacteria 2280
60 Ga0070661_100170907 3300005344 Bacteria 1650
61 Ga0070661_100385935 3300005344 Bacteria 1105
62 Ga0070692_10009258 3300005345 Bacteria 4434
63 Ga0070668_100027039 3300005347 Bacteria 4354
64 Ga0070668_100069974 3300005347 Bacteria 2731
65 Ga0070668_100136694 3300005347 Bacteria 1972
66 Ga0070669_100007550 3300005353 Bacteria 7785
67 Ga0070669_100015366 3300005353 Bacteria 5456
68 Ga0070669_100027829 3300005353 Bacteria 4069
69 Ga0070669_100080222 3300005353 Bacteria 2428
70 Ga0070669_100173876 3300005353 Archaea 1681
71 Ga0070675_100009393 3300005354 Bacteria 7609
72 Ga0070675_100012392 3300005354 Bacteria 6680
73 Ga0070675_100016529 3300005354 Bacteria 5858
74 Ga0070675_100018239 3300005354 Bacteria 5587
75 Ga0070675_100184288 3300005354 Bacteria 1806
76 Ga0070675_100392948 3300005354 Bacteria 1236
77 Ga0070671_100028772 3300005355 Bacteria 4579
78 Ga0070671_100213269 3300005355 Bacteria 1638
79 Ga0070671_100550364 3300005355 Bacteria 995
80 Ga0070674_100175684 3300005356 Bacteria 1636
81 Ga0070674_100357769 3300005356 Bacteria 1181
82 Ga0070673_100051632 3300005364 Unclassified 3222
83 Ga0070673_100061740 3300005364 Bacteria 2974
84 Ga0070673_100111127 3300005364 Bacteria 2273
85 Ga0070673_100122527 3300005364 Bacteria 2171
86 Ga0070673_100145115 3300005364 Bacteria 2006
87 Ga0070688_100001537 3300005365 Bacteria 11528
88 Ga0070688_100009503 3300005365 Bacteria 5322
89 Ga0070688_100010649 3300005365 Bacteria 5079
90 Ga0070659_100001454 3300005366 Bacteria 17048
91 Ga0070659_100012539 3300005366 Bacteria 6284
92 Ga0070659_100033173 3300005366 Bacteria 4009
93 Ga0070659_100036736 3300005366 Bacteria 3819
94 Ga0070659_100040587 3300005366 Bacteria 3637
95 Ga0070659_100107140 3300005366 Bacteria 2253
96 Ga0070659_100230986 3300005366 Unclassified 1529
97 Ga0070659_100409800 3300005366 Bacteria 1145
98 Ga0070659_100586271 3300005366 Bacteria 957
99 Ga0070667_100028480 3300005367 Bacteria 4651
100 Ga0070667_100093976 3300005367 Bacteria 2583
101 Ga0070667_100099382 3300005367 Bacteria 2512
102 Ga0070667_100438164 3300005367 Bacteria 1193
103 Ga0070709_10021041 3300005434 Bacteria 3797
104 Ga0070714_100011300 3300005435 Bacteria 7079
105 Ga0070714_100015069 3300005435 Bacteria 6216
106 Ga0070714_100017300 3300005435 Bacteria 5838
107 Ga0070714_100044427 3300005435 Bacteria 3761
108 Ga0070714_100238713 3300005435 Bacteria 1677
109 Ga0070713_100000365 3300005436 Bacteria 29146
110 Ga0070713_100256741 3300005436 Bacteria 1596
111 Ga0070710_10099028 3300005437 Bacteria 1733
112 Ga0070701_10089021 3300005438 Unclassified 1687
113 Ga0070711_100557867 3300005439 Bacteria 951
114 Ga0070700_100016931 3300005441 Bacteria 4159
115 Ga0070700_100067597 3300005441 Bacteria 2270
116 Ga0070700_100146962 3300005441 Bacteria 1608
117 Ga0070694_100105519 3300005444 Bacteria 2000
118 Ga0070694_100379230 3300005444 Bacteria 1102
119 Ga0070708_100001280 3300005445 Bacteria 19354
120 Ga0070708_100035012 3300005445 Bacteria 4372
121 Ga0070708_100230137 3300005445 Bacteria 1739
122 Ga0070708_100318766 3300005445 Bacteria 1464
123 Ga0070663_100270542 3300005455 Bacteria 1351
124 Ga0070678_100223537 3300005456 Unclassified 1566
125 Ga0070662_100024722 3300005457 Bacteria 4142
126 Ga0070662_100029632 3300005457 Bacteria 3821
127 Ga0070662_100032801 3300005457 Unclassified 3652
128 Ga0070662_100057326 3300005457 Bacteria 2831
129 Ga0070662_100089613 3300005457 Bacteria 2307
130 Ga0070662_100181168 3300005457 Bacteria 1661
131 Ga0070681_10006167 3300005458 Bacteria 11644
132 Ga0070681_10008118 3300005458 Bacteria 10272
133 Ga0070681_10010172 3300005458 Bacteria 9277
134 Ga0070681_10017212 3300005458 Bacteria 7226
135 Ga0070681_10021204 3300005458 Bacteria 6511
136 Ga0070681_10025562 3300005458 Bacteria 5940
137 Ga0070681_10106603 3300005458 Bacteria 2744
138 Ga0070681_10214922 3300005458 Bacteria 1839
139 Ga0068867_100073955 3300005459 Bacteria 2553
140 Ga0068867_100099120 3300005459 Unclassified 2223
141 Ga0070685_10031647 3300005466 Bacteria 2958
142 Ga0070706_100045609 3300005467 Bacteria 4048
143 Ga0070706_100048674 3300005467 Bacteria 3912
144 Ga0070706_100087818 3300005467 Bacteria 2883
145 Ga0070706_100295712 3300005467 Bacteria 1511
146 Ga0070707_100003353 3300005468 Bacteria 15128
147 Ga0070707_100409007 3300005468 Bacteria 1317
148 Ga0070707_100457888 3300005468 Bacteria 1236
149 Ga0070698_100004800 3300005471 Bacteria 14837
150 Ga0070698_100022229 3300005471 Bacteria 6637
151 Ga0070698_100046339 3300005471 Bacteria 4445
152 Ga0070698_100162634 3300005471 Bacteria 2176
153 Ga0070698_100522790 3300005471 Bacteria 1125
154 Ga0070699_100320395 3300005518 Bacteria 1393
155 Ga0070699_100570016 3300005518 Bacteria 1031
156 Ga0070679_100000561 3300005530 Bacteria 31548
157 Ga0070679_100000766 3300005530 Bacteria 27854
158 Ga0070679_100001382 3300005530 Bacteria 21375
159 Ga0070679_100007998 3300005530 Bacteria 9929
160 Ga0070679_100017798 3300005530 Bacteria 6882
161 Ga0070679_100055146 3300005530 Bacteria 3958
162 Ga0070679_100083777 3300005530 Bacteria 3177
163 Ga0070679_100099903 3300005530 Bacteria 2889
164 Ga0070679_100116018 3300005530 Bacteria 2663
165 Ga0070684_100001329 3300005535 Bacteria 17690
166 Ga0070684_100004209 3300005535 Bacteria 10905
167 Ga0070684_100024189 3300005535 Bacteria 5092
168 Ga0070684_100026468 3300005535 Bacteria 4888
169 Ga0070684_100035887 3300005535 Bacteria 4245
170 Ga0070684_100045546 3300005535 Bacteria 3798
171 Ga0070684_100078768 3300005535 Bacteria 2912
172 Ga0070684_100244685 3300005535 Bacteria 1639
173 Ga0070697_100096401 3300005536 Unclassified 2454
174 Ga0070697_100219760 3300005536 Bacteria 1619
175 Ga0070697_100274645 3300005536 Bacteria 1445
176 Ga0068853_100012696 3300005539 Bacteria 6858
177 Ga0068853_100085134 3300005539 Bacteria 2771
178 Ga0068853_100117441 3300005539 Bacteria 2369
179 Ga0068853_100120805 3300005539 Bacteria 2337
180 Ga0068853_100123375 3300005539 Unclassified 2313
181 Ga0068853_100132198 3300005539 Bacteria 2235
182 Ga0068853_100432844 3300005539 Bacteria 1235
183 Ga0070672_100009658 3300005543 Bacteria 6661
184 Ga0070672_100027785 3300005543 Bacteria 4224
185 Ga0070672_100052989 3300005543 Bacteria 3170
186 Ga0070672_100126228 3300005543 Bacteria 2099
187 Ga0070686_100014137 3300005544 Bacteria 4592
188 Ga0070686_100058775 3300005544 Bacteria 2475
189 Ga0070695_100002722 3300005545 Bacteria 10245
190 Ga0070695_100149815 3300005545 Bacteria 1627
191 Ga0070695_100452909 3300005545 Bacteria 984
192 Ga0070696_100225911 3300005546 Bacteria 1407
193 Ga0070693_100002489 3300005547 Bacteria 8486
194 Ga0070693_100014008 3300005547 Bacteria 4096
195 Ga0070693_100090956 3300005547 Bacteria 1839
196 Ga0070665_100102995 3300005548 Bacteria 2858
197 Ga0068855_100004528 3300005563 Bacteria 16978
198 Ga0068855_100011874 3300005563 Bacteria 10532
199 Ga0068855_100037146 3300005563 Bacteria 5794
200 Ga0068855_100068448 3300005563 Bacteria 4133
201 Ga0068855_100279087 3300005563 Bacteria 1856
202 Ga0068855_100430593 3300005563 Bacteria 1442
203 Ga0070664_100000860 3300005564 Bacteria 23476
204 Ga0070664_100004580 3300005564 Bacteria 11097
205 Ga0070664_100010187 3300005564 Bacteria 7625
206 Ga0070664_100012821 3300005564 Bacteria 6818
207 Ga0070664_100026462 3300005564 Bacteria 4811
208 Ga0070664_100027651 3300005564 Bacteria 4714
209 Ga0070664_100268172 3300005564 Bacteria 1537
210 Ga0070664_100268268 3300005564 Bacteria 1537
211 Ga0070664_100347279 3300005564 Bacteria 1349
212 Ga0070664_100598327 3300005564 Bacteria 1022
213 Ga0068857_100010829 3300005577 Bacteria 7940
214 Ga0068857_100018844 3300005577 Bacteria 6057
215 Ga0068857_100026666 3300005577 Bacteria 5093
216 Ga0068857_100075783 3300005577 Bacteria 2999
217 Ga0068857_100150116 3300005577 Bacteria 2111
218 Ga0068857_100206016 3300005577 Bacteria 1794
219 Ga0068857_100259674 3300005577 Bacteria 1594
220 Ga0068854_100012048 3300005578 Bacteria 5653
221 Ga0068854_100068584 3300005578 Bacteria 2586
222 Ga0068854_100381076 3300005578 Bacteria 1162
223 Ga0068856_100002006 3300005614 Bacteria 21232
224 Ga0068856_100006622 3300005614 Bacteria 11350
225 Ga0068856_100201225 3300005614 Bacteria 2006
226 Ga0068856_100234428 3300005614 Bacteria 1851
227 Ga0068856_100286213 3300005614 Bacteria 1665
228 Ga0070702_100004801 3300005615 Bacteria 6212
229 Ga0068852_100002537 3300005616 Bacteria 12578
230 Ga0068852_100007657 3300005616 Bacteria 7897
231 Ga0068852_100100512 3300005616 Bacteria 2609
232 Ga0068852_100169453 3300005616 Bacteria 2045
233 Ga0068852_100309101 3300005616 Bacteria 1532
234 Ga0068852_100524536 3300005616 Bacteria 1182
235 Ga0068859_100005085 3300005617 Bacteria 13363
236 Ga0068859_100009111 3300005617 Bacteria 10023
237 Ga0068859_100070423 3300005617 Unclassified 3532
238 Ga0068859_100482142 3300005617 Bacteria 1336
239 Ga0068859_100857555 3300005617 Bacteria 994
240 Ga0068864_100009378 3300005618 Bacteria 8075
241 Ga0068864_100121256 3300005618 Bacteria 2338
242 Ga0068864_100130034 3300005618 Bacteria 2261
243 Ga0068864_100212983 3300005618 Bacteria 1780
244 Ga0068864_100383695 3300005618 Bacteria 1332
245 Ga0068866_10013390 3300005718 Bacteria 3598
246 Ga0068866_10077650 3300005718 Bacteria 1774
247 Ga0068861_100008830 3300005719 Bacteria 6943
248 Ga0068861_100316211 3300005719 Bacteria 1358
249 Ga0068851_10018436 3300005834 Bacteria 3361
250 Ga0068870_10037539 3300005840 Bacteria 2498
251 Ga0068863_100014481 3300005841 Bacteria 7594
252 Ga0068863_100061954 3300005841 Bacteria 3537
253 Ga0068863_100181598 3300005841 Bacteria 2020
254 Ga0068858_100038324 3300005842 Bacteria 4446
255 Ga0068860_100043729 3300005843 Bacteria 4271
256 Ga0068860_100441606 3300005843 Bacteria 1292
257 Ga0068860_100503585 3300005843 Bacteria 1209
258 Ga0068860_100603889 3300005843 Bacteria 1103
259 Ga0068862_100000563 3300005844 Bacteria 38630
260 Ga0068862_100010344 3300005844 Bacteria 7700
261 Ga0068862_100079931 3300005844 Bacteria 2835
262 Ga0068862_100261253 3300005844 Archaea 1581
263 Ga0081455_10045084 3300005937 Unclassified 3839
264 Ga0081539_10000863 3300005985 Bacteria 58055
265 Ga0070717_10173908 3300006028 Bacteria 1874
266 Ga0070716_100016497 3300006173 Unclassified 3814
267 Ga0070712_100012391 3300006175 Bacteria 5419
268 Ga0070712_100403054 3300006175 Bacteria 1130
269 Ga0068871_100018822 3300006358 Bacteria 5260
270 Ga0068871_100181768 3300006358 Unclassified 1808
271 Ga0075428_100050677 3300006844 Bacteria 4553
272 Ga0075428_100162640 3300006844 Bacteria 2422
273 Ga0075428_100493611 3300006844 Bacteria 1310
274 Ga0075430_100022610 3300006846 Bacteria 5350
275 Ga0075430_100042968 3300006846 Bacteria 3821
276 Ga0075431_100109024 3300006847 Bacteria 2858
277 Ga0075431_100166447 3300006847 Unclassified 2266
278 Ga0075431_100323341 3300006847 Bacteria 1555
279 Ga0075433_10013022 3300006852 Bacteria 6744
280 Ga0075433_10021986 3300006852 Bacteria 5352
281 Ga0075433_10080963 3300006852 Bacteria 2863
282 Ga0075434_100011577 3300006871 Bacteria 8328
283 Ga0075434_100036251 3300006871 Bacteria 4879
284 Ga0075434_100354915 3300006871 Bacteria 1487
285 Ga0075429_100027896 3300006880 Bacteria 4901
286 Ga0075429_100411302 3300006880 Bacteria 1185
287 Ga0068865_100005916 3300006881 Bacteria 7443
288 Ga0068865_100007700 3300006881 Bacteria 6635
289 Ga0068865_100073954 3300006881 Bacteria 2425
290 Ga0075436_100002529 3300006914 Bacteria 12588
291 Ga0075436_100161142 3300006914 Bacteria 1581
292 Ga0097620_100005085 3300006931 Bacteria 13363
293 Ga0097620_100009110 3300006931 Bacteria 10023
294 Ga0097620_100070423 3300006931 Unclassified 3532
295 Ga0097620_100482159 3300006931 Bacteria 1336
296 Ga0097620_100624765 3300006931 Bacteria 1170
297 Ga0097620_100857287 3300006931 Bacteria 994
298 Ga0075435_100426367 3300007076 Bacteria 1143
299 Ga0105240_10269954 3300009093 Bacteria 1959
300 Ga0105240_10558865 3300009093 Bacteria 1265
301 Ga0105240_10867156 3300009093 Unclassified 973
302 Ga0111539_10041489 3300009094 Bacteria 5533
303 Ga0111539_10243393 3300009094 Unclassified 2094
304 Ga0105245_10004657 3300009098 Bacteria 12123
305 Ga0105245_10011517 3300009098 Bacteria 7702
306 Ga0105245_10014364 3300009098 Bacteria 6900
307 Ga0105245_10063247 3300009098 Bacteria 3341
308 Ga0105245_10084865 3300009098 Bacteria 2902
309 Ga0105245_10184631 3300009098 Bacteria 1994
310 Ga0105245_10487078 3300009098 Bacteria 1247
311 Ga0114129_10031366 3300009147 Bacteria 7514
312 Ga0114129_10054909 3300009147 Bacteria 5583
313 Ga0114129_10673389 3300009147 Unclassified 1333
314 Ga0105242_10075551 3300009176 Bacteria 2806
315 Ga0105242_10259586 3300009176 Bacteria 1569
316 Ga0105242_10293264 3300009176 Bacteria 1482
317 Ga0105242_10316557 3300009176 Bacteria 1430
318 Ga0105248_10003619 3300009177 Bacteria 17144
319 Ga0105248_10048557 3300009177 Unclassified 4761
320 Ga0105248_10102599 3300009177 Bacteria 3224
321 Ga0105248_10328054 3300009177 Bacteria 1724
322 Ga0105248_10384719 3300009177 Bacteria 1580
323 Ga0105237_10397301 3300009545 Bacteria 1383
324 Ga0105237_10657192 3300009545 Bacteria 1055
325 Ga0105238_10075862 3300009551 Bacteria 3354
326 Ga0105238_10673886 3300009551 Bacteria 1045
327 Ga0105249_10000133 3300009553 Bacteria 98005
328 Ga0105249_10000662 3300009553 Bacteria 31249
329 Ga0105249_10006990 3300009553 Bacteria 9846
330 Ga0105249_10014031 3300009553 Bacteria 7082
331 Ga0105239_10027056 3300010375 Bacteria 6314
332 Ga0105239_10922874 3300010375 Bacteria 1002
333 Ga0157373_10054372 3300013100 Bacteria 2845
334 Ga0157373_10182144 3300013100 Bacteria 1479
335 Ga0157373_10200311 3300013100 Bacteria 1407
336 Ga0157373_10233851 3300013100 Bacteria 1298
337 Ga0157373_10267285 3300013100 Bacteria 1210
338 Ga0157371_10043989 3300013102 Bacteria 3180
339 Ga0157371_10058264 3300013102 Bacteria 2740
340 Ga0157371_10092228 3300013102 Bacteria 2146
341 Ga0157370_10001370 3300013104 Bacteria 30160
342 Ga0157369_10011816 3300013105 Bacteria 9916
343 Ga0157369_10033560 3300013105 Bacteria 5640
344 Ga0157374_10019221 3300013296 Bacteria 6045
345 Ga0157374_10498771 3300013296 Bacteria 1222
346 Ga0157378_10003245 3300013297 Bacteria 14461
347 Ga0157378_10028482 3300013297 Unclassified 4929
348 Ga0157378_10063233 3300013297 Bacteria 3307
349 Ga0157378_10622950 3300013297 Unclassified 1092
350 Ga0163162_10724224 3300013306 Bacteria 1115
351 Ga0157372_10003051 3300013307 Bacteria 18053
352 Ga0157372_10011934 3300013307 Bacteria 9257
353 Ga0157372_10012090 3300013307 Bacteria 9195
354 Ga0157372_10016300 3300013307 Bacteria 7975
355 Ga0157372_10019093 3300013307 Bacteria 7380
356 Ga0157372_10029337 3300013307 Bacteria 6005
357 Ga0157372_10062637 3300013307 Bacteria 4168
358 Ga0157372_10082724 3300013307 Bacteria 3635
359 Ga0157372_10095768 3300013307 Bacteria 3382
360 Ga0157372_10112199 3300013307 Bacteria 3124
361 Ga0157372_10143808 3300013307 Bacteria 2750
362 Ga0157372_10245858 3300013307 Bacteria 2076
363 Ga0157372_10347459 3300013307 Bacteria 1728
364 Ga0157372_10817752 3300013307 Bacteria 1082
365 Ga0157375_10021958 3300013308 Bacteria 5867
366 Ga0157375_10025465 3300013308 Bacteria 5497
367 Ga0157375_10029803 3300013308 Bacteria 5136
368 Ga0157375_10312158 3300013308 Bacteria 1737
369 Ga0157375_10337270 3300013308 Unclassified 1673
370 Ga0157375_10398817 3300013308 Archaea 1542
371 Ga0157375_10479542 3300013308 Bacteria 1409
372 Ga0163163_10063230 3300014325 Bacteria 3669
373 Ga0157380_10001269 3300014326 Bacteria 16396
374 Ga0157380_10001654 3300014326 Bacteria 14690
375 Ga0157380_10246960 3300014326 Bacteria 1613
376 Ga0182008_10003363 3300014497 Bacteria 9710
377 Ga0157377_10003074 3300014745 Bacteria 7489
378 Ga0157377_10035936 3300014745 Bacteria 2722
379 Ga0157379_10034091 3300014968 Bacteria 4537
380 Ga0157376_10262549 3300014969 Bacteria 1619
381 Ga0157376_10296011 3300014969 Bacteria 1530
382 Ga0163161_10009918 3300017792 Bacteria 6597
383 Ga0163161_10299921 3300017792 Bacteria 1265
384 Ga0207697_10015277 3300025315 Bacteria 3174
385 Ga0207656_10033268 3300025321 Bacteria 2146
386 Ga0207647_10127997 3300025904 Bacteria 1493
387 Ga0207699_10005290 3300025906 Bacteria 6181
388 Ga0207699_10086770 3300025906 Bacteria 1955
389 Ga0207645_10001969 3300025907 Bacteria 16509
390 Ga0207645_10027733 3300025907 Bacteria 3656
391 Ga0207645_10037948 3300025907 Bacteria 3091
392 Ga0207645_10144377 3300025907 Bacteria 1551
393 Ga0207643_10004022 3300025908 Bacteria 7910
394 Ga0207705_10010734 3300025909 Bacteria 6649
395 Ga0207705_10026656 3300025909 Bacteria 4119
396 Ga0207705_10035784 3300025909 Bacteria 3552
397 Ga0207684_10066418 3300025910 Bacteria 3063
398 Ga0207684_10097800 3300025910 Bacteria 2506
399 Ga0207684_10137104 3300025910 Bacteria 2102
400 Ga0207707_10008918 3300025912 Bacteria 8710
401 Ga0207707_10030432 3300025912 Bacteria 4722
402 Ga0207707_10034898 3300025912 Bacteria 4400
403 Ga0207707_10067644 3300025912 Bacteria 3112
404 Ga0207707_10099175 3300025912 Bacteria 2546
405 Ga0207707_10405734 3300025912 Bacteria 1169
406 Ga0207695_10008459 3300025913 Bacteria 12887
407 Ga0207693_10016388 3300025915 Bacteria 5924
408 Ga0207693_10155951 3300025915 Bacteria 1796
409 Ga0207663_10031102 3300025916 Bacteria 3156
410 Ga0207663_10380229 3300025916 Bacteria 1075
411 Ga0207660_10003293 3300025917 Bacteria 10568
412 Ga0207660_10019589 3300025917 Bacteria 4525
413 Ga0207660_10035324 3300025917 Bacteria 3470
414 Ga0207660_10056219 3300025917 Bacteria 2815
415 Ga0207660_10110628 3300025917 Bacteria 2067
416 Ga0207660_10130826 3300025917 Bacteria 1910
417 Ga0207660_10197185 3300025917 Bacteria 1571
418 Ga0207662_10001250 3300025918 Bacteria 12218
419 Ga0207662_10004467 3300025918 Bacteria 7361
420 Ga0207662_10016177 3300025918 Bacteria 4207
421 Ga0207662_10103827 3300025918 Bacteria 1764
422 Ga0207657_10009076 3300025919 Bacteria 10038
423 Ga0207657_10015405 3300025919 Bacteria 7406
424 Ga0207657_10017219 3300025919 Bacteria 6941
425 Ga0207657_10021494 3300025919 Bacteria 6070
426 Ga0207657_10055660 3300025919 Bacteria 3416
427 Ga0207657_10132544 3300025919 Bacteria 2041
428 Ga0207649_10001109 3300025920 Bacteria 16344
429 Ga0207649_10038962 3300025920 Bacteria 2880
430 Ga0207649_10071880 3300025920 Bacteria 2211
431 Ga0207649_10085024 3300025920 Bacteria 2058
432 Ga0207649_10094281 3300025920 Bacteria 1966
433 Ga0207649_10095636 3300025920 Bacteria 1955
434 Ga0207649_10439802 3300025920 Bacteria 982
435 Ga0207652_10001386 3300025921 Bacteria 21574
436 Ga0207652_10018422 3300025921 Bacteria 5726
437 Ga0207652_10044571 3300025921 Bacteria 3779
438 Ga0207652_10055864 3300025921 Bacteria 3397
439 Ga0207652_10062406 3300025921 Bacteria 3220
440 Ga0207652_10205640 3300025921 Bacteria 1772
441 Ga0207652_10288621 3300025921 Bacteria 1480
442 Ga0207652_10521460 3300025921 Bacteria 1069
443 Ga0207646_10157800 3300025922 Bacteria 2047
444 Ga0207681_10009046 3300025923 Bacteria 6085
445 Ga0207681_10016233 3300025923 Bacteria 4654
446 Ga0207681_10146017 3300025923 Bacteria 1767
447 Ga0207650_10104830 3300025925 Bacteria 2182
448 Ga0207650_10187751 3300025925 Bacteria 1650
449 Ga0207650_10200437 3300025925 Bacteria 1598
450 Ga0207659_10065257 3300025926 Bacteria 2637
451 Ga0207659_10076234 3300025926 Bacteria 2464
452 Ga0207659_10141392 3300025926 Bacteria 1869
453 Ga0207659_10307582 3300025926 Bacteria 1304
454 Ga0207687_10002121 3300025927 Bacteria 13548
455 Ga0207687_10164501 3300025927 Bacteria 1706
456 Ga0207700_10000601 3300025928 Bacteria 21049
457 Ga0207700_10206385 3300025928 Bacteria 1659
458 Ga0207664_10029613 3300025929 Bacteria 4172
459 Ga0207664_10119128 3300025929 Bacteria 2207
460 Ga0207664_10161456 3300025929 Bacteria 1911
461 Ga0207644_10132554 3300025931 Bacteria 1910
462 Ga0207644_10210981 3300025931 Bacteria 1535
463 Ga0207644_10275253 3300025931 Bacteria 1350
464 Ga0207690_10004961 3300025932 Bacteria 7855
465 Ga0207690_10019589 3300025932 Bacteria 4170
466 Ga0207690_10038071 3300025932 Bacteria 3128
467 Ga0207690_10094915 3300025932 Bacteria 2117
468 Ga0207690_10112615 3300025932 Bacteria 1962
469 Ga0207690_10174467 3300025932 Bacteria 1613
470 Ga0207690_10311594 3300025932 Bacteria 1235
471 Ga0207690_10333200 3300025932 Bacteria 1196
472 Ga0207706_10000155 3300025933 Bacteria 75598
473 Ga0207706_10004784 3300025933 Bacteria 12681
474 Ga0207706_10133728 3300025933 Bacteria 2181
475 Ga0207706_10151732 3300025933 Bacteria 2038
476 Ga0207706_10216163 3300025933 Bacteria 1679
477 Ga0207706_10274577 3300025933 Bacteria 1471
478 Ga0207709_10606614 3300025935 Bacteria 867
479 Ga0207670_10102017 3300025936 Bacteria 2051
480 Ga0207670_10217638 3300025936 Bacteria 1460
481 Ga0207670_10311554 3300025936 Bacteria 1236
482 Ga0207669_10289862 3300025937 Bacteria 1239
483 Ga0207669_10440717 3300025937 Bacteria 1030
484 Ga0207669_10475324 3300025937 Unclassified 995
485 Ga0207704_10001434 3300025938 Bacteria 10659
486 Ga0207704_10021516 3300025938 Bacteria 3437
487 Ga0207704_10104951 3300025938 Bacteria 1894
488 Ga0207665_10027872 3300025939 Unclassified 3731
489 Ga0207691_10001667 3300025940 Bacteria 21972
490 Ga0207691_10004908 3300025940 Bacteria 12921
491 Ga0207691_10017234 3300025940 Bacteria 6853
492 Ga0207691_10141697 3300025940 Bacteria 2118
493 Ga0207691_10179693 3300025940 Bacteria 1849
494 Ga0207691_10228740 3300025940 Bacteria 1611
495 Ga0207711_10070370 3300025941 Bacteria 3034
496 Ga0207711_10078165 3300025941 Bacteria 2885
497 Ga0207689_10003635 3300025942 Bacteria 14085
498 Ga0207689_10004716 3300025942 Bacteria 12302
499 Ga0207689_10019328 3300025942 Bacteria 5742
500 Ga0207661_10001218 3300025944 Bacteria 17203
501 Ga0207661_10014531 3300025944 Bacteria 5774
502 Ga0207661_10031192 3300025944 Bacteria 4114
503 Ga0207661_10032826 3300025944 Bacteria 4025
504 Ga0207661_10043609 3300025944 Bacteria 3541
505 Ga0207661_10054436 3300025944 Bacteria 3205
506 Ga0207661_10098327 3300025944 Bacteria 2452
507 Ga0207661_10347377 3300025944 Bacteria 1338
508 Ga0207661_10554034 3300025944 Bacteria 1053
509 Ga0207679_10005446 3300025945 Bacteria 7974
510 Ga0207679_10009006 3300025945 Bacteria 6379
511 Ga0207679_10010456 3300025945 Bacteria 5976
512 Ga0207679_10037658 3300025945 Bacteria 3440
513 Ga0207679_10049855 3300025945 Bacteria 3056
514 Ga0207679_10078379 3300025945 Bacteria 2517
515 Ga0207679_10143864 3300025945 Bacteria 1931
516 Ga0207679_10178527 3300025945 Bacteria 1754
517 Ga0207679_10345022 3300025945 Bacteria 1296
518 Ga0207667_10031794 3300025949 Bacteria 5694
519 Ga0207667_10050498 3300025949 Bacteria 4388
520 Ga0207667_10106895 3300025949 Bacteria 2886
521 Ga0207667_10165870 3300025949 Bacteria 2271
522 Ga0207667_10342264 3300025949 Bacteria 1526
523 Ga0207651_10020380 3300025960 Unclassified 4001
524 Ga0207651_10178641 3300025960 Bacteria 1681
525 Ga0207651_10192445 3300025960 Bacteria 1628
526 Ga0207651_10461323 3300025960 Bacteria 1092
527 Ga0207712_10000098 3300025961 Bacteria 99232
528 Ga0207712_10004164 3300025961 Bacteria 9134
529 Ga0207712_10289201 3300025961 Archaea 1340
530 Ga0207668_10004732 3300025972 Bacteria 8009
531 Ga0207668_10009725 3300025972 Bacteria 5774
532 Ga0207668_10016901 3300025972 Bacteria 4564
533 Ga0207668_10394610 3300025972 Bacteria 1168
534 Ga0207640_10197548 3300025981 Bacteria 1521
535 Ga0207640_10297421 3300025981 Bacteria 1275
536 Ga0207658_10109821 3300025986 Bacteria 2178
537 Ga0207658_10371220 3300025986 Bacteria 1251
538 Ga0207677_10015316 3300026023 Bacteria 4505
539 Ga0207677_10030149 3300026023 Bacteria 3458
540 Ga0207677_10092855 3300026023 Bacteria 2198
541 Ga0207677_10247272 3300026023 Bacteria 1446
542 Ga0207677_10291336 3300026023 Bacteria 1344
543 Ga0207677_10398496 3300026023 Unclassified 1167
544 Ga0207677_10789330 3300026023 Bacteria 849
545 Ga0207639_10035933 3300026041 Unclassified 3669
546 Ga0207639_10099077 3300026041 Bacteria 2351
547 Ga0207639_10115640 3300026041 Bacteria 2194
548 Ga0207639_10256146 3300026041 Bacteria 1528
549 Ga0207639_10393737 3300026041 Bacteria 1247
550 Ga0207678_10045522 3300026067 Bacteria 3794
551 Ga0207678_10158251 3300026067 Unclassified 1934
552 Ga0207708_10041165 3300026075 Bacteria 3522
553 Ga0207708_10052406 3300026075 Bacteria 3108
554 Ga0207708_10173331 3300026075 Bacteria 1710
555 Ga0207708_10215811 3300026075 Bacteria 1535
556 Ga0207702_10163089 3300026078 Bacteria 2037
557 Ga0207702_10250243 3300026078 Bacteria 1664
558 Ga0207702_10484498 3300026078 Unclassified 1204
559 Ga0207702_10485550 3300026078 Bacteria 1203
560 Ga0207641_10026068 3300026088 Bacteria 4823
561 Ga0207641_10164714 3300026088 Bacteria 2018
562 Ga0207641_10289223 3300026088 Bacteria 1544
563 Ga0207641_10450490 3300026088 Bacteria 1244
564 Ga0207648_10071518 3300026089 Bacteria 3023
565 Ga0207648_10085368 3300026089 Bacteria 2754
566 Ga0207648_10126948 3300026089 Unclassified 2244
567 Ga0207648_10161996 3300026089 Bacteria 1975
568 Ga0207676_10008796 3300026095 Bacteria 7185
569 Ga0207676_10101298 3300026095 Bacteria 2388
570 Ga0207676_10141851 3300026095 Bacteria 2058
571 Ga0207676_10264243 3300026095 Bacteria 1555
572 Ga0207676_10672870 3300026095 Bacteria 1000
573 Ga0207674_10000809 3300026116 Bacteria 40695
574 Ga0207674_10011805 3300026116 Bacteria 9800
575 Ga0207674_10012102 3300026116 Bacteria 9663
576 Ga0207674_10014047 3300026116 Bacteria 8848
577 Ga0207674_10025219 3300026116 Bacteria 6344
578 Ga0207674_10075171 3300026116 Bacteria 3389
579 Ga0207674_10158807 3300026116 Bacteria 2216
580 Ga0207674_10248007 3300026116 Bacteria 1727
581 Ga0207675_100001026 3300026118 Bacteria 27652
582 Ga0207675_100614318 3300026118 Unclassified 1091
583 Ga0207683_10011699 3300026121 Bacteria 7490
584 Ga0207683_10206987 3300026121 Unclassified 1784
585 Ga0207683_10471804 3300026121 Bacteria 1158
586 Ga0207698_10001638 3300026142 Bacteria 13045
587 Ga0207698_10009621 3300026142 Bacteria 6172
588 Ga0207698_10056428 3300026142 Bacteria 3033
589 Ga0207698_10064264 3300026142 Bacteria 2876
590 Ga0207698_10564126 3300026142 Bacteria 1118
591 Ga0209968_1012529 3300027526 Bacteria 1322
592 Ga0209966_1004311 3300027695 Bacteria 2410
593 Ga0209966_1014994 3300027695 Bacteria 1452
594 Ga0209998_10001617 3300027717 Bacteria 5407
595 Ga0207428_10225256 3300027907 Bacteria 1404
596 Ga0268266_10447477 3300028379 Unclassified 1228
597 Ga0268266_10617035 3300028379 Bacteria 1042
598 Ga0268265_10012827 3300028380 Bacteria 5690
599 Ga0268265_10205298 3300028380 Bacteria 1712
600 Ga0268264_10062516 3300028381 Bacteria 3127
601 Ga0268264_10149331 3300028381 Bacteria 2094
602 Ga0307408_100001643 3300031548 Bacteria 16496
603 Ga0307408_100024719 3300031548 Bacteria 4106
604 Ga0307408_100039158 3300031548 Bacteria 3349
605 Ga0307408_100316432 3300031548 Bacteria 1313
606 Ga0307405_10004644 3300031731 Bacteria 6523
607 Ga0307405_10006260 3300031731 Bacteria 5838
608 Ga0307405_10025306 3300031731 Bacteria 3405
609 Ga0307405_10070280 3300031731 Bacteria 2248
610 Ga0307405_10113302 3300031731 Bacteria 1841
611 Ga0307405_10160166 3300031731 Bacteria 1593
612 Ga0307405_10303753 3300031731 Bacteria 1212
613 Ga0307413_10000556 3300031824 Bacteria 12494
614 Ga0307413_10010831 3300031824 Bacteria 4447
615 Ga0307413_10072658 3300031824 Bacteria 2172
616 Ga0307413_10126761 3300031824 Bacteria 1740
617 Ga0307413_10182362 3300031824 Bacteria 1498
618 Ga0307413_10197813 3300031824 Bacteria 1449
619 Ga0307413_10360367 3300031824 Bacteria 1125
620 Ga0307410_10000571 3300031852 Bacteria 15118
621 Ga0307410_10005071 3300031852 Bacteria 6919
622 Ga0307410_10009294 3300031852 Bacteria 5506
623 Ga0307410_10010551 3300031852 Bacteria 5241
624 Ga0307410_10051706 3300031852 Bacteria 2771
625 Ga0307410_10219508 3300031852 Bacteria 1462
626 Ga0307410_10642183 3300031852 Bacteria 889
627 Ga0307406_10021896 3300031901 Bacteria 3787
628 Ga0307406_10156400 3300031901 Bacteria 1633
629 Ga0307406_10519824 3300031901 Unclassified 968
630 Ga0307407_10010946 3300031903 Bacteria 4298
631 Ga0307407_10013395 3300031903 Bacteria 3979
632 Ga0307407_10070841 3300031903 Bacteria 2074
633 Ga0307407_10116379 3300031903 Bacteria 1687
634 Ga0307412_10006982 3300031911 Bacteria 6410
635 Ga0307412_10020284 3300031911 Bacteria 4043
636 Ga0307412_10048962 3300031911 Bacteria 2782
637 Ga0307412_10367213 3300031911 Bacteria 1161
638 Ga0307409_100000742 3300031995 Bacteria 14668
639 Ga0307409_100102704 3300031995 Bacteria 2376
640 Ga0307409_100473519 3300031995 Bacteria 1213
641 Ga0307409_100565157 3300031995 Bacteria 1119
642 Ga0307416_100000597 3300032002 Bacteria 18576
643 Ga0307416_100004398 3300032002 Bacteria 8487
644 Ga0307416_100175278 3300032002 Bacteria 2002
645 Ga0307416_100788686 3300032002 Unclassified 1045
646 Ga0307414_10446066 3300032004 Bacteria 1134
647 Ga0307411_10012126 3300032005 Bacteria 4685
648 Ga0307411_10095864 3300032005 Unclassified 2084
649 Ga0307411_10183321 3300032005 Bacteria 1591
650 Ga0307411_10260307 3300032005 Bacteria 1369
651 Ga0307415_100001116 3300032126 Bacteria 12535
652 Ga0307415_100011489 3300032126 Bacteria 5071
653 Ga0307415_100057054 3300032126 Bacteria 2681
654 Ga0307415_100067281 3300032126 Bacteria 2503
655 Ga0307415_100291326 3300032126 Bacteria 1348
656 Ga0307415_100331717 3300032126 Bacteria 1273
657 Ga0373928_0052188 3300035084 Bacteria 969
658 Ga0373934_0084410 3300035086 Bacteria 1277
659 Ga0373944_0072028 3300035089 Bacteria 1127
660 Ga0373949_0060323 3300035090 Bacteria 975
661 Ga0373923_0017975 3300035111 Bacteria 2713
662 Ga0373941_0012012 3300035115 Bacteria 2253
663 Ga0373953_0015172 3300035117 Bacteria 2786
664 Ga0373954_0093726 3300035118 Bacteria 1444
665 Ga0373956_0009886 3300035119 Bacteria 3888
666 Ga0373960_0019094 3300035121 Bacteria 1797
667 Ga0373943_0058608 3300035170 Bacteria 1917
668 Ga0373943_0108835 3300035170 Bacteria 1459
669 Ga0373946_0020597 3300035171 Bacteria 2550
670 Ga0373955_0009965 3300035172 Bacteria 4472
671 Ga0373924_0023842 3300035410 Bacteria 2406
672 Ga0373931_0017705 3300035691 Bacteria 3529
673 Ga0373927_0041389 3300035695 Bacteria 2988
674 Ga0373927_0209157 3300035695 Bacteria 1281
675 Ga0373927_0410270 3300035695 Bacteria 894
676 Ga0373933_0085145 3300035724 Bacteria 1943
677 Ga0373933_0102693 3300035724 Bacteria 1775
678 Ga0373947_0044272 3300035725 Bacteria 2659
679 Ga0373947_0095592 3300035725 Bacteria 1860
680 Ga0373947_0166068 3300035725 Bacteria 1430
681 Ga0373937_0000434 3300036401 Bacteria 38905
682 Ga0373937_0072457 3300036401 Bacteria 3177
683 Ga0373937_0188320 3300036401 Bacteria 1938
684 Ga0373937_0198116 3300036401 Bacteria 1888
685 Ga0373925_0058566 3300037068 Bacteria 2888
686 Ga0373925_0470947 3300037068 Bacteria 1030
687 Ga0395900_0212667 3300037418 Bacteria 1952
688 Ga0395900_1005492 3300037418 Bacteria 754
689 Ga0395905_0053174 3300037471 Bacteria 3791
690 Ga0395905_0090000 3300037471 Bacteria 2877
691 Ga0395901_0002263 3300038443 Bacteria 19641
692 Ga0439461_0107891 3300041410 Bacteria 684
693 Ga0451853_0011849 3300041512 Unclassified 1393
694 Ga0451577_0009304 3300042876 Bacteria 9472
695 Ga0451577_0046959 3300042876 Bacteria 3861
696 Ga0451577_0523213 3300042876 Bacteria 1077
697 Ga0466961_0163082 3300044693 Bacteria 1389
698 Ga0453684_0001936 3300044712 Bacteria 53406
699 Ga0453684_0045718 3300044712 Bacteria 5834
700 Ga0453684_0088669 3300044712 Bacteria 3829
701 Ga0453684_0719357 3300044712 Bacteria 1083
702 Ga0451576_0055476 3300045051 Bacteria 4145
703 Ga0451576_0264280 3300045051 Bacteria 1799
704 Ga0451576_0361169 3300045051 Bacteria 1521
705 Ga0451576_0593671 3300045051 Bacteria 1164
706 Ga0466958_0035550 3300045836 Bacteria 2977
707 Ga0466967_0018726 3300045976 Bacteria 5545
708 Ga0466967_0021161 3300045976 Bacteria 5275
709 Ga0466967_0626804 3300045976 Bacteria 1062
710 Ga0466967_0704125 3300045976 Bacteria 1000
711 Ga0466967_0871034 3300045976 Bacteria 895
712 Ga0495592_0029889 3300046454 Bacteria 4122
713 Ga0495592_0032311 3300046454 Bacteria 3950
714 Ga0495603_0132323 3300046455 Bacteria 1452
715 Ga0495590_0108454 3300046457 Bacteria 990
716 Ga0495629_0041492 3300046459 Bacteria 3238
717 Ga0495629_0046291 3300046459 Bacteria 3051
718 Ga0495629_0070901 3300046459 Bacteria 2432
719 Ga0495629_0125520 3300046459 Bacteria 1788
720 Ga0495638_0235176 3300046460 Bacteria 1017
721 Ga0495651_0022003 3300046462 Bacteria 4958
722 Ga0495651_0028369 3300046462 Bacteria 4362
723 Ga0495653_0037181 3300046463 Bacteria 3828
724 Ga0495653_0065656 3300046463 Bacteria 2731
725 Ga0495653_0290466 3300046463 Bacteria 1069
726 Ga0495580_0011454 3300046472 Bacteria 6862
727 Ga0495582_0045115 3300046473 Bacteria 2427
728 Ga0495639_0024788 3300046475 Bacteria 2642
729 Ga0495639_0111599 3300046475 Bacteria 1298
730 Ga0495662_0008895 3300046476 Bacteria 4932
731 Ga0495662_0242861 3300046476 Bacteria 887
732 Ga0495664_0048826 3300046477 Bacteria 2513
733 Ga0495664_0131477 3300046477 Bacteria 1516
734 Ga0495585_0231626 3300046492 Bacteria 928
735 Ga0495594_0019475 3300046499 Bacteria 3606
736 Ga0495594_0022665 3300046499 Bacteria 3359
737 Ga0495608_0023579 3300046511 Bacteria 4217
738 Ga0495608_0052709 3300046511 Bacteria 2692
739 Ga0495618_0103935 3300046514 Bacteria 1819
740 Ga0495628_0033661 3300046516 Bacteria 4128
741 Ga0495628_0376221 3300046516 Bacteria 1041
742 Ga0495630_0025171 3300046517 Bacteria 4399
743 Ga0495630_0029605 3300046517 Bacteria 4070
744 Ga0495630_0045291 3300046517 Bacteria 3287
745 Ga0495630_0490955 3300046517 Bacteria 941
746 Ga0495642_0077175 3300046528 Bacteria 1399
747 Ga0495652_0011861 3300046529 Bacteria 7877
748 Ga0495652_0016881 3300046529 Bacteria 6525
749 Ga0495652_0069678 3300046529 Bacteria 2943
750 Ga0495652_0121508 3300046529 Bacteria 2082
751 Ga0495665_0012889 3300046531 Bacteria 4525
752 Ga0495665_0098749 3300046531 Bacteria 1533
753 Ga0495640_0049604 3300046533 Bacteria 2893
754 Ga0495586_0086442 3300046535 Bacteria 1728
755 Ga0495586_0167998 3300046535 Bacteria 1239
756 Ga0495587_0002235 3300046536 Bacteria 12943
757 Ga0495587_0016015 3300046536 Bacteria 4667
758 Ga0495587_0020160 3300046536 Bacteria 4119
759 Ga0495645_0001706 3300046543 Bacteria 14937
760 Ga0495645_0027826 3300046543 Bacteria 4107
761 Ga0495645_0130828 3300046543 Bacteria 1759
762 Ga0495645_0137005 3300046543 Bacteria 1711
763 Ga0495667_0005980 3300046559 Bacteria 8229
764 Ga0495667_0020018 3300046559 Bacteria 4513
765 Ga0495667_0093517 3300046559 Bacteria 1947
766 Ga0495635_0065030 3300046663 Bacteria 2503
767 Ga0495657_0009875 3300046675 Bacteria 7202
768 Ga0495657_0222038 3300046675 Bacteria 1145
769 Ga0495599_0040019 3300046678 Bacteria 2944
770 Ga0495599_0201670 3300046678 Bacteria 1222
771 Ga0495623_0015647 3300046679 Bacteria 4904
772 Ga0495623_0063873 3300046679 Bacteria 2304
773 Ga0495623_0330637 3300046679 Bacteria 834
774 Ga0495646_0232861 3300046680 Bacteria 992
775 Ga0495658_0039829 3300046683 Bacteria 2609
776 Ga0495658_0107965 3300046683 Bacteria 1670
777 Ga0495613_0030001 3300046689 Bacteria 4040
778 Ga0495613_0108427 3300046689 Bacteria 2003
779 Ga0495613_0352047 3300046689 Bacteria 1011
780 Ga0495581_0025434 3300047315 Bacteria 3432
781 Ga0495581_0142844 3300047315 Bacteria 1397
782 Ga0495604_0031898 3300047317 Bacteria 4177
783 Ga0495674_0166705 3300047319 Bacteria 1840
784 Ga0495674_0177583 3300047319 Bacteria 1774
785 Ga0495674_0351746 3300047319 Bacteria 1196
786 Ga0495672_0008872 3300047320 Bacteria 7355
787 Ga0495680_0180652 3300047322 Bacteria 1523
788 Ga0495675_0018416 3300047444 Bacteria 4432
789 Ga0495675_0073863 3300047444 Bacteria 2150
790 Ga0495675_0086248 3300047444 Bacteria 1973
791 Ga0495675_0138231 3300047444 Bacteria 1511
792 Ga0495675_0139658 3300047444 Bacteria 1502
793 Ga0495684_0041185 3300047471 Bacteria 3540
794 Ga0495684_0095262 3300047471 Bacteria 2253
795 Ga0495684_0140430 3300047471 Bacteria 1811
796 Ga0495593_0011248 3300047673 Bacteria 5143
797 Ga0495593_0057235 3300047673 Bacteria 2048
798 Ga0495593_0088332 3300047673 Bacteria 1598
799 Ga0495602_0018181 3300048088 Bacteria 7030
800 Ga0495602_0097718 3300048088 Bacteria 2418
801 Ga0495602_0282689 3300048088 Bacteria 1221
802 Ga0495614_0200537 3300048089 Bacteria 903
803 Ga0496107_0117540 3300048910 Bacteria 1958
804 Ga0496108_0146693 3300048911 Bacteria 2035
805 Ga0496108_0167071 3300048911 Bacteria 1903
806 Ga0496109_0117872 3300048912 Bacteria 2471
807 Ga0496110_0203692 3300048913 Bacteria 1798
808 Ga0496112_0004132 3300048915 Bacteria 12214
809 Ga0496112_0018340 3300048915 Bacteria 6588
810 Ga0496112_0052810 3300048915 Bacteria 3990
811 Ga0496112_0297428 3300048915 Unclassified 1560
812 Ga0496113_0034747 3300048916 Bacteria 3681
813 Ga0496113_0045942 3300048916 Bacteria 3241
814 Ga0496113_0252654 3300048916 Bacteria 1408
815 Ga0501034_0237442 3300049571 Bacteria 1770
816 Ga0501036_0099470 3300049572 Bacteria 2460
817 Ga0501040_0018505 3300049576 Bacteria 4626
818 Ga0501043_0016800 3300049579 Bacteria 5735
819 Ga0501046_0211930 3300049580 Bacteria 1438
820 Ga0501047_0142512 3300049581 Bacteria 2274
821 Ga0501047_0185438 3300049581 Bacteria 1946
822 Ga0501067_0183514 3300049583 Bacteria 1165
823 Ga0501070_0002484 3300049586 Bacteria 16167
824 Ga0501072_0052305 3300049588 Bacteria 3216
825 Ga0501250_002065 3300049680 Unclassified 1771
826 Ga0501234_004862 3300049707 Unclassified 2109
827 Ga0501245_001055 3300049708 Bacteria 3546
828 nmdc:mga05p37_162947_c1 3300050507 Bacteria 2722
829 nmdc:mga05p37_38065_c1 3300050507 Bacteria 5899
830 nmdc:mga05p37_526143_c1 3300050507 Bacteria 1351
831 nmdc:mga09592_24822_c1 3300050508 Bacteria 4956
832 nmdc:mga09592_34401_c1 3300050508 Bacteria 4235
833 nmdc:mga0qj67_34785_c1 3300050509 Bacteria 3937
834 nmdc:mga0qj67_3989_c1 3300050509 Bacteria 10685
835 nmdc:mga0qj67_41292_c1 3300050509 Bacteria 3628
836 nmdc:mga0qj67_6857_c1 3300050509 Bacteria 8375
837 nmdc:mga06r32_327609_c1 3300050510 Bacteria 1517
838 nmdc:mga08y16_38613_c1 3300050511 Bacteria 5012
839 nmdc:mga08y16_445666_c1 3300050511 Bacteria 1321
840 nmdc:mga0n895_353217_c1 3300050512 Bacteria 1489
841 nmdc:mga0n895_35558_c1 3300050512 Bacteria 4804
842 nmdc:mga0rr50_620623_c1 3300050513 Bacteria 922
843 nmdc:mga08x19_56318_c1 3300050514 Bacteria 2537
844 nmdc:mga0a205_29080_c1 3300050515 Bacteria 5287
845 Ga0495612_0007310 3300053078 Bacteria 4516
846 Ga0495612_0027590 3300053078 Bacteria 2284
847 Ga0495619_0013401 3300053085 Bacteria 5166
848 Ga0495619_0239112 3300053085 Bacteria 1258
849 2644104460 2643221618 Bacteria 7717186
850 2644150092 2643221626 Bacteria 8069654
851 2644307848 2643221655 Bacteria 7722067
852 2644333571 2643221659 Bacteria 7890716
853 2644544603 2643221698 Bacteria 7756764
854 2644614003 2643221712 Bacteria 7729434
855 Ga0070658_10463844
856 MBSR1b_contig_10693841
857 MBSR1b_contig_11866738
858 MBSR1b_contig_1198787
859 JGI25406J46586_10049612
860 Ga0065715_10192997
861 Ga0065715_10295900
862 Ga0070658_10003398
863 Ga0070658_10005732
864 Ga0070658_10010035
865 Ga0070658_10015915
866 Ga0070658_10248439
867 Ga0070676_10018096
868 Ga0070676_10024158
869 Ga0070676_10112118
870 Ga0070683_100002801
871 Ga0070683_100007767
872 Ga0070683_100080952
873 Ga0070683_100112162
874 Ga0070683_100392244
875 Ga0070690_100061561
876 Ga0070690_100108243
877 Ga0070670_100000989
878 Ga0070670_100063923
879 Ga0070670_100089463
880 Ga0070670_100229470
881 Ga0070670_100298614
882 Ga0068869_100001309
883 Ga0068869_100006175
884 Ga0068869_100032195
885 Ga0070666_10066798
886 Ga0070680_100000691
887 Ga0070680_100001244
888 Ga0070680_100003749
889 Ga0070680_100049016
890 Ga0070680_100060500
891 Ga0070680_100180305
892 Ga0070680_100324197
893 Ga0070682_100007750
894 Ga0070682_100009581
895 Ga0070682_100112270
896 Ga0068868_100016115
897 Ga0068868_100027677
898 Ga0068868_100091331
899 Ga0068868_100217795
900 Ga0070660_100005663
901 Ga0070660_100024672
902 Ga0070660_100063385
903 Ga0070660_100099164
904 Ga0070660_100364028
905 Ga0070689_100019798
906 Ga0070689_100022050
907 Ga0070689_100022958
908 Ga0070689_100186257
909 Ga0070689_100435414
910 Ga0070661_100009031
911 Ga0070661_100036924
912 Ga0070661_100063263
913 Ga0070661_100089410
914 Ga0070661_100170907
915 Ga0070661_100385935
916 Ga0070692_10009258
917 Ga0070668_100027039
918 Ga0070668_100069974
919 Ga0070668_100136694
920 Ga0070669_100007550
921 Ga0070669_100015366
922 Ga0070669_100027829
923 Ga0070669_100080222
924 Ga0070669_100173876
925 Ga0070675_100009393
926 Ga0070675_100012392
927 Ga0070675_100016529
928 Ga0070675_100018239
929 Ga0070675_100184288
930 Ga0070675_100392948
931 Ga0070671_100028772
932 Ga0070671_100213269
933 Ga0070671_100550364
934 Ga0070674_100175684
935 Ga0070674_100357769
936 Ga0070673_100051632
937 Ga0070673_100061740
938 Ga0070673_100111127
939 Ga0070673_100122527
940 Ga0070673_100145115
941 Ga0070688_100001537
942 Ga0070688_100009503
943 Ga0070688_100010649
944 Ga0070659_100001454
945 Ga0070659_100012539
946 Ga0070659_100033173
947 Ga0070659_100036736
948 Ga0070659_100040587
949 Ga0070659_100107140
950 Ga0070659_100230986
951 Ga0070659_100409800
952 Ga0070659_100586271
953 Ga0070667_100028480
954 Ga0070667_100093976
955 Ga0070667_100099382
956 Ga0070667_100438164
957 Ga0070709_10021041
958 Ga0070714_100011300
959 Ga0070714_100015069
960 Ga0070714_100017300
961 Ga0070714_100044427
962 Ga0070714_100238713
963 Ga0070713_100000365
964 Ga0070713_100256741
965 Ga0070710_10099028
966 Ga0070701_10089021
967 Ga0070711_100557867
968 Ga0070700_100016931
969 Ga0070700_100067597
970 Ga0070700_100146962
971 Ga0070694_100105519
972 Ga0070694_100379230
973 Ga0070708_100001280
974 Ga0070708_100035012
975 Ga0070708_100230137
976 Ga0070708_100318766
977 Ga0070663_100270542
978 Ga0070678_100223537
979 Ga0070662_100024722
980 Ga0070662_100029632
981 Ga0070662_100032801
982 Ga0070662_100057326
983 Ga0070662_100089613
984 Ga0070662_100181168
985 Ga0070681_10006167
986 Ga0070681_10008118
987 Ga0070681_10010172
988 Ga0070681_10017212
989 Ga0070681_10021204
990 Ga0070681_10025562
991 Ga0070681_10106603
992 Ga0070681_10214922
993 Ga0068867_100073955
994 Ga0068867_100099120
995 Ga0070685_10031647
996 Ga0070706_100045609
997 Ga0070706_100048674
998 Ga0070706_100087818
999 Ga0070706_100295712
1000 Ga0070707_100003353
1001 Ga0070707_100409007
1002 Ga0070707_100457888
1003 Ga0070698_100004800
1004 Ga0070698_100022229
1005 Ga0070698_100046339
1006 Ga0070698_100162634
1007 Ga0070698_100522790
1008 Ga0070699_100320395
1009 Ga0070699_100570016
1010 Ga0070679_100000561
1011 Ga0070679_100000766
1012 Ga0070679_100001382
1013 Ga0070679_100007998
1014 Ga0070679_100017798
1015 Ga0070679_100055146
1016 Ga0070679_100083777
1017 Ga0070679_100099903
1018 Ga0070679_100116018
1019 Ga0070684_100001329
1020 Ga0070684_100004209
1021 Ga0070684_100024189
1022 Ga0070684_100026468
1023 Ga0070684_100035887
1024 Ga0070684_100045546
1025 Ga0070684_100078768
1026 Ga0070684_100244685
1027 Ga0070697_100096401
1028 Ga0070697_100219760
1029 Ga0070697_100274645
1030 Ga0068853_100012696
1031 Ga0068853_100085134
1032 Ga0068853_100117441
1033 Ga0068853_100120805
1034 Ga0068853_100123375
1035 Ga0068853_100132198
1036 Ga0068853_100432844
1037 Ga0070672_100009658
1038 Ga0070672_100027785
1039 Ga0070672_100052989
1040 Ga0070672_100126228
1041 Ga0070686_100014137
1042 Ga0070686_100058775
1043 Ga0070695_100002722
1044 Ga0070695_100149815
1045 Ga0070695_100452909
1046 Ga0070696_100225911
1047 Ga0070693_100002489
1048 Ga0070693_100014008
1049 Ga0070693_100090956
1050 Ga0070665_100102995
1051 Ga0068855_100004528
1052 Ga0068855_100011874
1053 Ga0068855_100037146
1054 Ga0068855_100068448
1055 Ga0068855_100279087
1056 Ga0068855_100430593
1057 Ga0070664_100000860
1058 Ga0070664_100004580
1059 Ga0070664_100010187
1060 Ga0070664_100012821
1061 Ga0070664_100026462
1062 Ga0070664_100027651
1063 Ga0070664_100268172
1064 Ga0070664_100268268
1065 Ga0070664_100347279
1066 Ga0070664_100598327
1067 Ga0068857_100010829
1068 Ga0068857_100018844
1069 Ga0068857_100026666
1070 Ga0068857_100075783
1071 Ga0068857_100150116
1072 Ga0068857_100206016
1073 Ga0068857_100259674
1074 Ga0068854_100012048
1075 Ga0068854_100068584
1076 Ga0068854_100381076
1077 Ga0068856_100002006
1078 Ga0068856_100006622
1079 Ga0068856_100201225
1080 Ga0068856_100234428
1081 Ga0068856_100286213
1082 Ga0070702_100004801
1083 Ga0068852_100002537
1084 Ga0068852_100007657
1085 Ga0068852_100100512
1086 Ga0068852_100169453
1087 Ga0068852_100309101
1088 Ga0068852_100524536
1089 Ga0068859_100005085
1090 Ga0068859_100009111
1091 Ga0068859_100070423
1092 Ga0068859_100482142
1093 Ga0068859_100857555
1094 Ga0068864_100009378
1095 Ga0068864_100121256
1096 Ga0068864_100130034
1097 Ga0068864_100212983
1098 Ga0068864_100383695
1099 Ga0068866_10013390
1100 Ga0068866_10077650
1101 Ga0068861_100008830
1102 Ga0068861_100316211
1103 Ga0068851_10018436
1104 Ga0068870_10037539
1105 Ga0068863_100014481
1106 Ga0068863_100061954
1107 Ga0068863_100181598
1108 Ga0068858_100038324
1109 Ga0068860_100043729
1110 Ga0068860_100441606
1111 Ga0068860_100503585
1112 Ga0068860_100603889
1113 Ga0068862_100000563
1114 Ga0068862_100010344
1115 Ga0068862_100079931
1116 Ga0068862_100261253
1117 Ga0081455_10045084
1118 Ga0081539_10000863
1119 Ga0070717_10173908
1120 Ga0070716_100016497
1121 Ga0070712_100012391
1122 Ga0070712_100403054
1123 Ga0068871_100018822
1124 Ga0068871_100181768
1125 Ga0075428_100050677
1126 Ga0075428_100162640
1127 Ga0075428_100493611
1128 Ga0075430_100022610
1129 Ga0075430_100042968
1130 Ga0075431_100109024
1131 Ga0075431_100166447
1132 Ga0075431_100323341
1133 Ga0075433_10013022
1134 Ga0075433_10021986
1135 Ga0075433_10080963
1136 Ga0075434_100011577
1137 Ga0075434_100036251
1138 Ga0075434_100354915
1139 Ga0075429_100027896
1140 Ga0075429_100411302
1141 Ga0068865_100005916
1142 Ga0068865_100007700
1143 Ga0068865_100073954
1144 Ga0075436_100002529
1145 Ga0075436_100161142
1146 Ga0097620_100005085
1147 Ga0097620_100009110
1148 Ga0097620_100070423
1149 Ga0097620_100482159
1150 Ga0097620_100624765
1151 Ga0097620_100857287
1152 Ga0075435_100426367
1153 Ga0105240_10269954
1154 Ga0105240_10558865
1155 Ga0105240_10867156
1156 Ga0111539_10041489
1157 Ga0111539_10243393
1158 Ga0105245_10004657
1159 Ga0105245_10011517
1160 Ga0105245_10014364
1161 Ga0105245_10063247
1162 Ga0105245_10084865
1163 Ga0105245_10184631
1164 Ga0105245_10487078
1165 Ga0114129_10031366
1166 Ga0114129_10054909
1167 Ga0114129_10673389
1168 Ga0105242_10075551
1169 Ga0105242_10259586
1170 Ga0105242_10293264
1171 Ga0105242_10316557
1172 Ga0105248_10003619
1173 Ga0105248_10048557
1174 Ga0105248_10102599
1175 Ga0105248_10328054
1176 Ga0105248_10384719
1177 Ga0105237_10397301
1178 Ga0105237_10657192
1179 Ga0105238_10075862
1180 Ga0105238_10673886
1181 Ga0105249_10000133
1182 Ga0105249_10000662
1183 Ga0105249_10006990
1184 Ga0105249_10014031
1185 Ga0105239_10027056
1186 Ga0105239_10922874
1187 Ga0157373_10054372
1188 Ga0157373_10182144
1189 Ga0157373_10200311
1190 Ga0157373_10233851
1191 Ga0157373_10267285
1192 Ga0157371_10043989
1193 Ga0157371_10058264
1194 Ga0157371_10092228
1195 Ga0157370_10001370
1196 Ga0157369_10011816
1197 Ga0157369_10033560
1198 Ga0157374_10019221
1199 Ga0157374_10498771
1200 Ga0157378_10003245
1201 Ga0157378_10028482
1202 Ga0157378_10063233
1203 Ga0157378_10622950
1204 Ga0163162_10724224
1205 Ga0157372_10003051
1206 Ga0157372_10011934
1207 Ga0157372_10012090
1208 Ga0157372_10016300
1209 Ga0157372_10019093
1210 Ga0157372_10029337
1211 Ga0157372_10062637
1212 Ga0157372_10082724
1213 Ga0157372_10095768
1214 Ga0157372_10112199
1215 Ga0157372_10143808
1216 Ga0157372_10245858
1217 Ga0157372_10347459
1218 Ga0157372_10817752
1219 Ga0157375_10021958
1220 Ga0157375_10025465
1221 Ga0157375_10029803
1222 Ga0157375_10312158
1223 Ga0157375_10337270
1224 Ga0157375_10398817
1225 Ga0157375_10479542
1226 Ga0163163_10063230
1227 Ga0157380_10001269
1228 Ga0157380_10001654
1229 Ga0157380_10246960
1230 Ga0182008_10003363
1231 Ga0157377_10003074
1232 Ga0157377_10035936
1233 Ga0157379_10034091
1234 Ga0157376_10262549
1235 Ga0157376_10296011
1236 Ga0163161_10009918
1237 Ga0163161_10299921
1238 Ga0207697_10015277
1239 Ga0207656_10033268
1240 Ga0207647_10127997
1241 Ga0207699_10005290
1242 Ga0207699_10086770
1243 Ga0207645_10001969
1244 Ga0207645_10027733
1245 Ga0207645_10037948
1246 Ga0207645_10144377
1247 Ga0207643_10004022
1248 Ga0207705_10010734
1249 Ga0207705_10026656
1250 Ga0207705_10035784
1251 Ga0207684_10066418
1252 Ga0207684_10097800
1253 Ga0207684_10137104
1254 Ga0207707_10008918
1255 Ga0207707_10030432
1256 Ga0207707_10034898
1257 Ga0207707_10067644
1258 Ga0207707_10099175
1259 Ga0207707_10405734
1260 Ga0207695_10008459
1261 Ga0207693_10016388
1262 Ga0207693_10155951
1263 Ga0207663_10031102
1264 Ga0207663_10380229
1265 Ga0207660_10003293
1266 Ga0207660_10019589
1267 Ga0207660_10035324
1268 Ga0207660_10056219
1269 Ga0207660_10110628
1270 Ga0207660_10130826
1271 Ga0207660_10197185
1272 Ga0207662_10001250
1273 Ga0207662_10004467
1274 Ga0207662_10016177
1275 Ga0207662_10103827
1276 Ga0207657_10009076
1277 Ga0207657_10015405
1278 Ga0207657_10017219
1279 Ga0207657_10021494
1280 Ga0207657_10055660
1281 Ga0207657_10132544
1282 Ga0207649_10001109
1283 Ga0207649_10038962
1284 Ga0207649_10071880
1285 Ga0207649_10085024
1286 Ga0207649_10094281
1287 Ga0207649_10095636
1288 Ga0207649_10439802
1289 Ga0207652_10001386
1290 Ga0207652_10018422
1291 Ga0207652_10044571
1292 Ga0207652_10055864
1293 Ga0207652_10062406
1294 Ga0207652_10205640
1295 Ga0207652_10288621
1296 Ga0207652_10521460
1297 Ga0207646_10157800
1298 Ga0207681_10009046
1299 Ga0207681_10016233
1300 Ga0207681_10146017
1301 Ga0207650_10104830
1302 Ga0207650_10187751
1303 Ga0207650_10200437
1304 Ga0207659_10065257
1305 Ga0207659_10076234
1306 Ga0207659_10141392
1307 Ga0207659_10307582
1308 Ga0207687_10002121
1309 Ga0207687_10164501
1310 Ga0207700_10000601
1311 Ga0207700_10206385
1312 Ga0207664_10029613
1313 Ga0207664_10119128
1314 Ga0207664_10161456
1315 Ga0207644_10132554
1316 Ga0207644_10210981
1317 Ga0207644_10275253
1318 Ga0207690_10004961
1319 Ga0207690_10019589
1320 Ga0207690_10038071
1321 Ga0207690_10094915
1322 Ga0207690_10112615
1323 Ga0207690_10174467
1324 Ga0207690_10311594
1325 Ga0207690_10333200
1326 Ga0207706_10000155
1327 Ga0207706_10004784
1328 Ga0207706_10133728
1329 Ga0207706_10151732
1330 Ga0207706_10216163
1331 Ga0207706_10274577
1332 Ga0207709_10606614
1333 Ga0207670_10102017
1334 Ga0207670_10217638
1335 Ga0207670_10311554
1336 Ga0207669_10289862
1337 Ga0207669_10440717
1338 Ga0207669_10475324
1339 Ga0207704_10001434
1340 Ga0207704_10021516
1341 Ga0207704_10104951
1342 Ga0207665_10027872
1343 Ga0207691_10001667
1344 Ga0207691_10004908
1345 Ga0207691_10017234
1346 Ga0207691_10141697
1347 Ga0207691_10179693
1348 Ga0207691_10228740
1349 Ga0207711_10070370
1350 Ga0207711_10078165
1351 Ga0207689_10003635
1352 Ga0207689_10004716
1353 Ga0207689_10019328
1354 Ga0207661_10001218
1355 Ga0207661_10014531
1356 Ga0207661_10031192
1357 Ga0207661_10032826
1358 Ga0207661_10043609
1359 Ga0207661_10054436
1360 Ga0207661_10098327
1361 Ga0207661_10347377
1362 Ga0207661_10554034
1363 Ga0207679_10005446
1364 Ga0207679_10009006
1365 Ga0207679_10010456
1366 Ga0207679_10037658
1367 Ga0207679_10049855
1368 Ga0207679_10078379
1369 Ga0207679_10143864
1370 Ga0207679_10178527
1371 Ga0207679_10345022
1372 Ga0207667_10031794
1373 Ga0207667_10050498
1374 Ga0207667_10106895
1375 Ga0207667_10165870
1376 Ga0207667_10342264
1377 Ga0207651_10020380
1378 Ga0207651_10178641
1379 Ga0207651_10192445
1380 Ga0207651_10461323
1381 Ga0207712_10000098
1382 Ga0207712_10004164
1383 Ga0207712_10289201
1384 Ga0207668_10004732
1385 Ga0207668_10009725
1386 Ga0207668_10016901
1387 Ga0207668_10394610
1388 Ga0207640_10197548
1389 Ga0207640_10297421
1390 Ga0207658_10109821
1391 Ga0207658_10371220
1392 Ga0207677_10015316
1393 Ga0207677_10030149
1394 Ga0207677_10092855
1395 Ga0207677_10247272
1396 Ga0207677_10291336
1397 Ga0207677_10398496
1398 Ga0207677_10789330
1399 Ga0207639_10035933
1400 Ga0207639_10099077
1401 Ga0207639_10115640
1402 Ga0207639_10256146
1403 Ga0207639_10393737
1404 Ga0207678_10045522
1405 Ga0207678_10158251
1406 Ga0207708_10041165
1407 Ga0207708_10052406
1408 Ga0207708_10173331
1409 Ga0207708_10215811
1410 Ga0207702_10163089
1411 Ga0207702_10250243
1412 Ga0207702_10484498
1413 Ga0207702_10485550
1414 Ga0207641_10026068
1415 Ga0207641_10164714
1416 Ga0207641_10289223
1417 Ga0207641_10450490
1418 Ga0207648_10071518
1419 Ga0207648_10085368
1420 Ga0207648_10126948
1421 Ga0207648_10161996
1422 Ga0207676_10008796
1423 Ga0207676_10101298
1424 Ga0207676_10141851
1425 Ga0207676_10264243
1426 Ga0207676_10672870
1427 Ga0207674_10000809
1428 Ga0207674_10011805
1429 Ga0207674_10012102
1430 Ga0207674_10014047
1431 Ga0207674_10025219
1432 Ga0207674_10075171
1433 Ga0207674_10158807
1434 Ga0207674_10248007
1435 Ga0207675_100001026
1436 Ga0207675_100614318
1437 Ga0207683_10011699
1438 Ga0207683_10206987
1439 Ga0207683_10471804
1440 Ga0207698_10001638
1441 Ga0207698_10009621
1442 Ga0207698_10056428
1443 Ga0207698_10064264
1444 Ga0207698_10564126
1445 Ga0209968_1012529
1446 Ga0209966_1004311
1447 Ga0209966_1014994
1448 Ga0209998_10001617
1449 Ga0207428_10225256
1450 Ga0268266_10447477
1451 Ga0268266_10617035
1452 Ga0268265_10012827
1453 Ga0268265_10205298
1454 Ga0268264_10062516
1455 Ga0268264_10149331
1456 Ga0307408_100001643
1457 Ga0307408_100024719
1458 Ga0307408_100039158
1459 Ga0307408_100316432
1460 Ga0307405_10004644
1461 Ga0307405_10006260
1462 Ga0307405_10025306
1463 Ga0307405_10070280
1464 Ga0307405_10113302
1465 Ga0307405_10160166
1466 Ga0307405_10303753
1467 Ga0307413_10000556
1468 Ga0307413_10010831
1469 Ga0307413_10072658
1470 Ga0307413_10126761
1471 Ga0307413_10182362
1472 Ga0307413_10197813
1473 Ga0307413_10360367
1474 Ga0307410_10000571
1475 Ga0307410_10005071
1476 Ga0307410_10009294
1477 Ga0307410_10010551
1478 Ga0307410_10051706
1479 Ga0307410_10219508
1480 Ga0307410_10642183
1481 Ga0307406_10021896
1482 Ga0307406_10156400
1483 Ga0307406_10519824
1484 Ga0307407_10010946
1485 Ga0307407_10013395
1486 Ga0307407_10070841
1487 Ga0307407_10116379
1488 Ga0307412_10006982
1489 Ga0307412_10020284
1490 Ga0307412_10048962
1491 Ga0307412_10367213
1492 Ga0307409_100000742
1493 Ga0307409_100102704
1494 Ga0307409_100473519
1495 Ga0307409_100565157
1496 Ga0307416_100000597
1497 Ga0307416_100004398
1498 Ga0307416_100175278
1499 Ga0307416_100788686
1500 Ga0307414_10446066
1501 Ga0307411_10012126
1502 Ga0307411_10095864
1503 Ga0307411_10183321
1504 Ga0307411_10260307
1505 Ga0307415_100001116
1506 Ga0307415_100011489
1507 Ga0307415_100057054
1508 Ga0307415_100067281
1509 Ga0307415_100291326
1510 Ga0307415_100331717
1511 Ga0373928_0052188
1512 Ga0373934_0084410
1513 Ga0373944_0072028
1514 Ga0373949_0060323
1515 Ga0373923_0017975
1516 Ga0373941_0012012
1517 Ga0373953_0015172
1518 Ga0373954_0093726
1519 Ga0373956_0009886
1520 Ga0373960_0019094
1521 Ga0373943_0058608
1522 Ga0373943_0108835
1523 Ga0373946_0020597
1524 Ga0373955_0009965
1525 Ga0373924_0023842
1526 Ga0373931_0017705
1527 Ga0373927_0041389
1528 Ga0373927_0209157
1529 Ga0373927_0410270
1530 Ga0373933_0085145
1531 Ga0373933_0102693
1532 Ga0373947_0044272
1533 Ga0373947_0095592
1534 Ga0373947_0166068
1535 Ga0373937_0000434
1536 Ga0373937_0072457
1537 Ga0373937_0188320
1538 Ga0373937_0198116
1539 Ga0373925_0058566
1540 Ga0373925_0470947
1541 Ga0395900_0212667
1542 Ga0395900_1005492
1543 Ga0395905_0053174
1544 Ga0395905_0090000
1545 Ga0395901_0002263
1546 Ga0439461_0107891
1547 Ga0451853_0011849
1548 Ga0451577_0009304
1549 Ga0451577_0046959
1550 Ga0451577_0523213
1551 Ga0466961_0163082
1552 Ga0453684_0001936
1553 Ga0453684_0045718
1554 Ga0453684_0088669
1555 Ga0453684_0719357
1556 Ga0451576_0055476
1557 Ga0451576_0264280
1558 Ga0451576_0361169
1559 Ga0451576_0593671
1560 Ga0466958_0035550
1561 Ga0466967_0018726
1562 Ga0466967_0021161
1563 Ga0466967_0626804
1564 Ga0466967_0704125
1565 Ga0466967_0871034
1566 Ga0495592_0029889
1567 Ga0495592_0032311
1568 Ga0495603_0132323
1569 Ga0495590_0108454
1570 Ga0495629_0041492
1571 Ga0495629_0046291
1572 Ga0495629_0070901
1573 Ga0495629_0125520
1574 Ga0495638_0235176
1575 Ga0495651_0022003
1576 Ga0495651_0028369
1577 Ga0495653_0037181
1578 Ga0495653_0065656
1579 Ga0495653_0290466
1580 Ga0495580_0011454
1581 Ga0495582_0045115
1582 Ga0495639_0024788
1583 Ga0495639_0111599
1584 Ga0495662_0008895
1585 Ga0495662_0242861
1586 Ga0495664_0048826
1587 Ga0495664_0131477
1588 Ga0495585_0231626
1589 Ga0495594_0019475
1590 Ga0495594_0022665
1591 Ga0495608_0023579
1592 Ga0495608_0052709
1593 Ga0495618_0103935
1594 Ga0495628_0033661
1595 Ga0495628_0376221
1596 Ga0495630_0025171
1597 Ga0495630_0029605
1598 Ga0495630_0045291
1599 Ga0495630_0490955
1600 Ga0495642_0077175
1601 Ga0495652_0011861
1602 Ga0495652_0016881
1603 Ga0495652_0069678
1604 Ga0495652_0121508
1605 Ga0495665_0012889
1606 Ga0495665_0098749
1607 Ga0495640_0049604
1608 Ga0495586_0086442
1609 Ga0495586_0167998
1610 Ga0495587_0002235
1611 Ga0495587_0016015
1612 Ga0495587_0020160
1613 Ga0495645_0001706
1614 Ga0495645_0027826
1615 Ga0495645_0130828
1616 Ga0495645_0137005
1617 Ga0495667_0005980
1618 Ga0495667_0020018
1619 Ga0495667_0093517
1620 Ga0495635_0065030
1621 Ga0495657_0009875
1622 Ga0495657_0222038
1623 Ga0495599_0040019
1624 Ga0495599_0201670
1625 Ga0495623_0015647
1626 Ga0495623_0063873
1627 Ga0495623_0330637
1628 Ga0495646_0232861
1629 Ga0495658_0039829
1630 Ga0495658_0107965
1631 Ga0495613_0030001
1632 Ga0495613_0108427
1633 Ga0495613_0352047
1634 Ga0495581_0025434
1635 Ga0495581_0142844
1636 Ga0495604_0031898
1637 Ga0495674_0166705
1638 Ga0495674_0177583
1639 Ga0495674_0351746
1640 Ga0495672_0008872
1641 Ga0495680_0180652
1642 Ga0495675_0018416
1643 Ga0495675_0073863
1644 Ga0495675_0086248
1645 Ga0495675_0138231
1646 Ga0495675_0139658
1647 Ga0495684_0041185
1648 Ga0495684_0095262
1649 Ga0495684_0140430
1650 Ga0495593_0011248
1651 Ga0495593_0057235
1652 Ga0495593_0088332
1653 Ga0495602_0018181
1654 Ga0495602_0097718
1655 Ga0495602_0282689
1656 Ga0495614_0200537
1657 Ga0496107_0117540
1658 Ga0496108_0146693
1659 Ga0496108_0167071
1660 Ga0496109_0117872
1661 Ga0496110_0203692
1662 Ga0496112_0004132
1663 Ga0496112_0018340
1664 Ga0496112_0052810
1665 Ga0496112_0297428
1666 Ga0496113_0034747
1667 Ga0496113_0045942
1668 Ga0496113_0252654
1669 Ga0501034_0237442
1670 Ga0501036_0099470
1671 Ga0501040_0018505
1672 Ga0501043_0016800
1673 Ga0501046_0211930
1674 Ga0501047_0142512
1675 Ga0501047_0185438
1676 Ga0501067_0183514
1677 Ga0501070_0002484
1678 Ga0501072_0052305
1679 Ga0501250_002065
1680 Ga0501234_004862
1681 Ga0501245_001055
1682 nmdc:mga05p37_162947_c1
1683 nmdc:mga05p37_38065_c1
1684 nmdc:mga05p37_526143_c1
1685 nmdc:mga09592_24822_c1
1686 nmdc:mga09592_34401_c1
1687 nmdc:mga0qj67_34785_c1
1688 nmdc:mga0qj67_3989_c1
1689 nmdc:mga0qj67_41292_c1
1690 nmdc:mga0qj67_6857_c1
1691 nmdc:mga06r32_327609_c1
1692 nmdc:mga08y16_38613_c1
1693 nmdc:mga08y16_445666_c1
1694 nmdc:mga0n895_353217_c1
1695 nmdc:mga0n895_35558_c1
1696 nmdc:mga0rr50_620623_c1
1697 nmdc:mga08x19_56318_c1
1698 nmdc:mga0a205_29080_c1
1699 Ga0495612_0007310
1700 Ga0495612_0027590
1701 Ga0495619_0013401
1702 Ga0495619_0239112
1703 2644104460
1704 2644150092
1705 2644307848
1706 2644333571
1707 2644544603
1708 2644614003

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

19

168

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b57-assembly1.cif.gz_C inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.9226 1 256
2nq2-assembly1.cif.gz_D an inward-facing conformation of a putative metal-chelate type abc transporter. 0.921 2 257
2nq2-assembly1.cif.gz_C an inward-facing conformation of a putative metal-chelate type abc transporter. 0.9196 2 258
7lb8-assembly1.cif.gz_C structure of a ferrichrome importer fhucdb from e. coli 0.9158 1 256
5b57-assembly1.cif.gz_D inward-facing conformation of abc heme importer bhuuv from burkholderia cenocepacia 0.9126 1 256
ID Description Score Start End Superfamily
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9656 1 248 3.40.50.300
af_Q58283_1_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9638 1 237 3.40.50.300
af_Q57554_4_248_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9541 1 248 3.40.50.300
af_P07821_3_262_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9528 2 252 3.40.50.300
af_P23878_8_259_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9445 3 254 3.40.50.300
ID Description Score Start End GO Terms
AF-E7QWZ5-F1-model_v4 ABC transporter related protein (Iron complex transport system ATP-binding protein) 0.9614 2 260 GO:0005524
GO:0016887
AF-A0A4R4Y2S0-F1-model_v4 ABC transporter ATP-binding protein 0.9614 2 255 GO:0005524
GO:0016887
AF-A0A3B9HTQ7-F1-model_v4 ABC transporter ATP-binding protein 0.9554 2 255 GO:0005524
GO:0016887
AF-A0A3C1DAE2-F1-model_v4 ABC transporter domain-containing protein 0.9531 3 259 GO:0005524
GO:0006826
GO:0016887
AF-A0A2N2YX47-F1-model_v4 ABC transporter ATP-binding protein 0.9516 2 257 GO:0005524
GO:0016887

Map