F483427

General Info

Members Datasets Scaffolds Average Seq Length
850 234 1700 142

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0383916|Ga0395899_0383916_213_644
Length 143
Sequence MTIAAVLRSKGSAVETIAAEATLFDAVRRLGEKRIGALPVVEGSRIAGIISERDIIYCLKDHGPEVLEWPVERVMSSPAITVDPDTDVLAALALITQRRIRHLPVVVGGVDIIGIVSIGDLVKYRMERIEAEAEAMRAYIQSA

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
13 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
14 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
17 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
18 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
19 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
32 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
33 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
34 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
35 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
36 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
37 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
156 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
165 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
178 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
179 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
182 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
189 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
197 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
198 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
215 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
216 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
217 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
218 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
221 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
224 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
225 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049757 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_B_2_control Metagenome Rhizosphere
228 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
229 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
230 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
231 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.71
Nodule 0
Rhizoplane 3.53
Rhizosphere 94.94
Stem 0
Stem Tuber 0
Unclassified 2.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0383916 3300037312 Bacteria 933
2 SwRhRL2b_contig_1053888 2162886007 Bacteria 906
3 JGI24736J21556_1000766 3300001904 Bacteria 5881
4 JGI24736J21556_1000967 3300001904 Bacteria 5302
5 JGI24741J21665_1009990 3300001915 Bacteria 1719
6 JGI24752J21851_1000180 3300001976 Bacteria 8678
7 JGI24752J21851_1000688 3300001976 Bacteria 4513
8 JGI24747J21853_1028030 3300001978 Bacteria 635
9 JGI24740J21852_10005691 3300001979 Bacteria 5245
10 JGI24740J21852_10011031 3300001979 Bacteria 3456
11 JGI24740J21852_10026937 3300001979 Bacteria 1919
12 JGI24740J21852_10030133 3300001979 Bacteria 1771
13 JGI24740J21852_10031099 3300001979 Bacteria 1727
14 JGI24740J21852_10032233 3300001979 Bacteria 1678
15 JGI24739J22299_10005321 3300001989 Bacteria 4902
16 JGI24739J22299_10010999 3300001989 Bacteria 3347
17 JGI24739J22299_10024646 3300001989 Bacteria 2120
18 JGI24739J22299_10029277 3300001989 Bacteria 1916
19 JGI24739J22299_10051158 3300001989 Bacteria 1333
20 JGI24737J22298_10003721 3300001990 Bacteria 5369
21 JGI24737J22298_10018720 3300001990 Bacteria 2220
22 JGI24737J22298_10037355 3300001990 Bacteria 1497
23 JGI24737J22298_10039339 3300001990 Bacteria 1454
24 JGI24737J22298_10056146 3300001990 Bacteria 1189
25 JGI24743J22301_10008782 3300001991 Bacteria 1779
26 JGI24735J21928_10007673 3300002067 Bacteria 3512
27 JGI24735J21928_10061385 3300002067 Bacteria 1079
28 JGI24735J21928_10062283 3300002067 Bacteria 1071
29 JGI24735J21928_10082846 3300002067 Bacteria 919
30 JGI24735J21928_10199783 3300002067 Bacteria 580
31 JGI24750J21931_1000362 3300002070 Bacteria 7759
32 JGI24748J21848_1000041 3300002074 Bacteria 64764
33 JGI24738J21930_10001561 3300002075 Bacteria 6322
34 JGI24738J21930_10022579 3300002075 Bacteria 1300
35 JGI24749J21850_1014218 3300002076 Unclassified 1116
36 JGI24034J26672_10000020 3300002239 Bacteria 122643
37 JGI24742J22300_10001855 3300002244 Bacteria 3364
38 JGI24742J22300_10023950 3300002244 Bacteria 1051
39 JGI24751J29686_10041994 3300002459 Unclassified 946
40 JGI25405J52794_10001005 3300003911 Bacteria 4468
41 Ga0065704_10081840 3300005289 Bacteria 3694
42 Ga0065704_10341346 3300005289 Unclassified 823
43 Ga0065707_10108971 3300005295 Bacteria 2486
44 Ga0065707_10179145 3300005295 Bacteria 1430
45 Ga0070658_10005537 3300005327 Bacteria 10250
46 Ga0070658_10047667 3300005327 Bacteria 3467
47 Ga0070658_10103513 3300005327 Bacteria 2354
48 Ga0070658_10127682 3300005327 Bacteria 2117
49 Ga0070658_10210333 3300005327 Bacteria 1643
50 Ga0070658_10218593 3300005327 Bacteria 1611
51 Ga0070658_10493284 3300005327 Bacteria 1057
52 Ga0070658_10634745 3300005327 Bacteria 926
53 Ga0070658_10645289 3300005327 Bacteria 918
54 Ga0070658_10690802 3300005327 Bacteria 886
55 Ga0070676_10020470 3300005328 Bacteria 3694
56 Ga0070676_10293535 3300005328 Bacteria 1099
57 Ga0070683_100113561 3300005329 Bacteria 2557
58 Ga0070683_100155887 3300005329 Bacteria 2165
59 Ga0070683_100372451 3300005329 Bacteria 1360
60 Ga0070683_100779055 3300005329 Bacteria 916
61 Ga0070683_101922806 3300005329 Bacteria 569
62 Ga0070690_100000108 3300005330 Bacteria 43016
63 Ga0070670_100000030 3300005331 Bacteria 164211
64 Ga0070670_100014280 3300005331 Bacteria 6814
65 Ga0070670_100144959 3300005331 Bacteria 2054
66 Ga0070670_100341518 3300005331 Bacteria 1314
67 Ga0068869_100264673 3300005334 Bacteria 1377
68 Ga0070666_10000027 3300005335 Bacteria 151010
69 Ga0070666_10007627 3300005335 Bacteria 6677
70 Ga0070680_100002984 3300005336 Bacteria 12571
71 Ga0070680_100035300 3300005336 Bacteria 4036
72 Ga0070680_100222738 3300005336 Bacteria 1592
73 Ga0070682_100391623 3300005337 Bacteria 1048
74 Ga0070682_100489413 3300005337 Bacteria 951
75 Ga0070682_101072473 3300005337 Bacteria 673
76 Ga0068868_100220303 3300005338 Bacteria 1588
77 Ga0070660_100016384 3300005339 Bacteria 5378
78 Ga0070660_100027254 3300005339 Bacteria 4262
79 Ga0070660_100134918 3300005339 Bacteria 1977
80 Ga0070660_100155933 3300005339 Bacteria 1838
81 Ga0070660_100226255 3300005339 Bacteria 1521
82 Ga0070660_100350600 3300005339 Bacteria 1215
83 Ga0070660_101519012 3300005339 Bacteria 569
84 Ga0070689_100040692 3300005340 Bacteria 3564
85 Ga0070687_100716546 3300005343 Unclassified 700
86 Ga0070661_100015189 3300005344 Bacteria 5433
87 Ga0070661_100033242 3300005344 Bacteria 3735
88 Ga0070661_100048478 3300005344 Bacteria 3109
89 Ga0070661_100050485 3300005344 Bacteria 3043
90 Ga0070661_100083490 3300005344 Bacteria 2359
91 Ga0070661_100131468 3300005344 Bacteria 1880
92 Ga0070661_100215353 3300005344 Bacteria 1471
93 Ga0070661_100394895 3300005344 Bacteria 1093
94 Ga0070661_101125231 3300005344 Unclassified 655
95 Ga0070692_10020606 3300005345 Bacteria 3198
96 Ga0070692_10181390 3300005345 Bacteria 1220
97 Ga0070692_10392655 3300005345 Bacteria 874
98 Ga0070668_100002391 3300005347 Bacteria 13795
99 Ga0070668_100184078 3300005347 Bacteria 1708
100 Ga0070668_100345867 3300005347 Bacteria 1257
101 Ga0070669_100003214 3300005353 Bacteria 11738
102 Ga0070669_100261348 3300005353 Bacteria 1381
103 Ga0070669_100947681 3300005353 Bacteria 737
104 Ga0070675_100517400 3300005354 Bacteria 1076
105 Ga0070671_100002224 3300005355 Bacteria 14971
106 Ga0070671_100029943 3300005355 Bacteria 4491
107 Ga0070671_100030841 3300005355 Bacteria 4425
108 Ga0070671_100088322 3300005355 Bacteria 2594
109 Ga0070671_101800203 3300005355 Bacteria 544
110 Ga0070674_100013450 3300005356 Bacteria 5061
111 Ga0070673_100215585 3300005364 Bacteria 1659
112 Ga0070673_100300738 3300005364 Bacteria 1412
113 Ga0070673_100474330 3300005364 Bacteria 1128
114 Ga0070673_100728690 3300005364 Bacteria 912
115 Ga0070673_100742221 3300005364 Bacteria 903
116 Ga0070688_100016346 3300005365 Bacteria 4242
117 Ga0070659_100015441 3300005366 Bacteria 5720
118 Ga0070659_100022330 3300005366 Bacteria 4830
119 Ga0070659_100186814 3300005366 Bacteria 1702
120 Ga0070659_100322035 3300005366 Bacteria 1292
121 Ga0070659_100446950 3300005366 Bacteria 1096
122 Ga0070659_100656721 3300005366 Bacteria 904
123 Ga0070667_100000710 3300005367 Bacteria 32106
124 Ga0070667_100006043 3300005367 Bacteria 10059
125 Ga0070667_100081428 3300005367 Bacteria 2770
126 Ga0070667_100133022 3300005367 Bacteria 2172
127 Ga0070667_100175252 3300005367 Bacteria 1895
128 Ga0070667_100313904 3300005367 Bacteria 1413
129 Ga0070714_100054716 3300005435 Bacteria 3409
130 Ga0070714_100198808 3300005435 Bacteria 1833
131 Ga0070663_100014097 3300005455 Bacteria 5122
132 Ga0070663_100035197 3300005455 Bacteria 3473
133 Ga0070663_100240507 3300005455 Bacteria 1428
134 Ga0070663_100604360 3300005455 Bacteria 923
135 Ga0070662_100007194 3300005457 Bacteria 7209
136 Ga0070662_100030334 3300005457 Bacteria 3782
137 Ga0070662_100053810 3300005457 Bacteria 2915
138 Ga0070662_100056906 3300005457 Bacteria 2839
139 Ga0070662_100138150 3300005457 Bacteria 1886
140 Ga0070662_100164536 3300005457 Bacteria 1737
141 Ga0070662_100344634 3300005457 Bacteria 1219
142 Ga0070662_100385319 3300005457 Bacteria 1154
143 Ga0070681_10496886 3300005458 Bacteria 1133
144 Ga0070681_11092383 3300005458 Bacteria 718
145 Ga0068867_100036073 3300005459 Bacteria 3587
146 Ga0068867_100160879 3300005459 Bacteria 1770
147 Ga0070685_10000040 3300005466 Bacteria 77295
148 Ga0070685_10872405 3300005466 Bacteria 668
149 Ga0070679_100031201 3300005530 Bacteria 5264
150 Ga0070679_100059216 3300005530 Bacteria 3817
151 Ga0070679_100601514 3300005530 Bacteria 1043
152 Ga0070679_100615282 3300005530 Bacteria 1029
153 Ga0070679_100700706 3300005530 Bacteria 955
154 Ga0070679_100906915 3300005530 Bacteria 825
155 Ga0070679_101282650 3300005530 Bacteria 678
156 Ga0070684_100051638 3300005535 Bacteria 3572
157 Ga0070684_100336960 3300005535 Bacteria 1386
158 Ga0070684_100565611 3300005535 Bacteria 1056
159 Ga0070684_101136888 3300005535 Bacteria 734
160 Ga0068853_100020145 3300005539 Bacteria 5544
161 Ga0068853_100046398 3300005539 Bacteria 3725
162 Ga0068853_100046922 3300005539 Bacteria 3706
163 Ga0068853_100206221 3300005539 Bacteria 1790
164 Ga0068853_100310620 3300005539 Bacteria 1459
165 Ga0068853_100420570 3300005539 Bacteria 1253
166 Ga0068853_100470822 3300005539 Bacteria 1183
167 Ga0070672_100047320 3300005543 Bacteria 3337
168 Ga0070672_100131302 3300005543 Bacteria 2059
169 Ga0070686_100000010 3300005544 Bacteria 192116
170 Ga0070665_100000331 3300005548 Bacteria 72744
171 Ga0070665_100012313 3300005548 Bacteria 8621
172 Ga0070665_100600622 3300005548 Bacteria 1113
173 Ga0070665_100894537 3300005548 Bacteria 901
174 Ga0068855_100043141 3300005563 Bacteria 5344
175 Ga0068855_100102226 3300005563 Bacteria 3299
176 Ga0068855_100107857 3300005563 Bacteria 3199
177 Ga0068855_100212567 3300005563 Bacteria 2172
178 Ga0068855_100213842 3300005563 Bacteria 2165
179 Ga0068855_100246880 3300005563 Bacteria 1992
180 Ga0068855_100327137 3300005563 Bacteria 1693
181 Ga0068855_100395507 3300005563 Bacteria 1515
182 Ga0068855_100396789 3300005563 Bacteria 1512
183 Ga0068855_100509745 3300005563 Bacteria 1306
184 Ga0068855_100590010 3300005563 Bacteria 1199
185 Ga0070664_100061938 3300005564 Bacteria 3189
186 Ga0070664_100091041 3300005564 Bacteria 2640
187 Ga0070664_100319506 3300005564 Bacteria 1406
188 Ga0070664_100356566 3300005564 Bacteria 1331
189 Ga0070664_101448277 3300005564 Bacteria 650
190 Ga0068857_100080653 3300005577 Bacteria 2906
191 Ga0068857_100106850 3300005577 Bacteria 2513
192 Ga0068857_100109980 3300005577 Bacteria 2476
193 Ga0068857_100333901 3300005577 Bacteria 1401
194 Ga0068857_100339532 3300005577 Bacteria 1389
195 Ga0068857_100564260 3300005577 Bacteria 1073
196 Ga0068857_100570409 3300005577 Bacteria 1067
197 Ga0068857_100737832 3300005577 Bacteria 937
198 Ga0068857_101661230 3300005577 Bacteria 624
199 Ga0068854_100005144 3300005578 Bacteria 8248
200 Ga0068854_100068834 3300005578 Bacteria 2582
201 Ga0068854_100111458 3300005578 Bacteria 2064
202 Ga0068854_100240116 3300005578 Bacteria 1442
203 Ga0068854_100406657 3300005578 Bacteria 1127
204 Ga0068854_100487956 3300005578 Bacteria 1035
205 Ga0068856_100048137 3300005614 Bacteria 4200
206 Ga0068856_100070362 3300005614 Bacteria 3461
207 Ga0068856_100122409 3300005614 Bacteria 2603
208 Ga0068856_100153488 3300005614 Bacteria 2312
209 Ga0068856_100190045 3300005614 Bacteria 2067
210 Ga0068856_100193764 3300005614 Bacteria 2046
211 Ga0068856_100250186 3300005614 Bacteria 1787
212 Ga0068856_100655192 3300005614 Bacteria 1071
213 Ga0068856_100707891 3300005614 Bacteria 1027
214 Ga0068852_100015748 3300005616 Bacteria 5878
215 Ga0068852_100016728 3300005616 Bacteria 5730
216 Ga0068852_100018511 3300005616 Bacteria 5489
217 Ga0068852_100037211 3300005616 Bacteria 4078
218 Ga0068852_100051503 3300005616 Bacteria 3533
219 Ga0068852_100073726 3300005616 Bacteria 3004
220 Ga0068852_100074916 3300005616 Bacteria 2983
221 Ga0068852_100115408 3300005616 Bacteria 2448
222 Ga0068852_100167959 3300005616 Bacteria 2054
223 Ga0068852_100352994 3300005616 Bacteria 1436
224 Ga0068852_100367032 3300005616 Bacteria 1409
225 Ga0068852_100432109 3300005616 Bacteria 1300
226 Ga0068852_100862175 3300005616 Bacteria 921
227 Ga0068852_100986996 3300005616 Bacteria 861
228 Ga0068859_100025698 3300005617 Bacteria 5906
229 Ga0068859_100068836 3300005617 Bacteria 3574
230 Ga0068859_100515707 3300005617 Bacteria 1290
231 Ga0068859_101189459 3300005617 Bacteria 839
232 Ga0068859_101695449 3300005617 Unclassified 698
233 Ga0068859_102175781 3300005617 Bacteria 612
234 Ga0068864_100000041 3300005618 Bacteria 165878
235 Ga0068864_100024246 3300005618 Bacteria 5102
236 Ga0068864_100078848 3300005618 Bacteria 2883
237 Ga0068864_100348049 3300005618 Bacteria 1397
238 Ga0068866_10790108 3300005718 Bacteria 659
239 Ga0068861_100004537 3300005719 Bacteria 9323
240 Ga0068851_10024597 3300005834 Bacteria 2949
241 Ga0068851_10037292 3300005834 Bacteria 2436
242 Ga0068851_10042284 3300005834 Bacteria 2293
243 Ga0068851_10056483 3300005834 Bacteria 2002
244 Ga0068863_100000035 3300005841 Bacteria 165877
245 Ga0068863_100000148 3300005841 Bacteria 73607
246 Ga0068863_100148860 3300005841 Bacteria 2239
247 Ga0068863_100271510 3300005841 Bacteria 1641
248 Ga0068858_100000543 3300005842 Bacteria 39235
249 Ga0068858_100489194 3300005842 Bacteria 1188
250 Ga0068860_100000080 3300005843 Bacteria 170152
251 Ga0068860_100157707 3300005843 Bacteria 2187
252 Ga0068862_100000042 3300005844 Bacteria 165084
253 Ga0068862_100000272 3300005844 Bacteria 57786
254 Ga0068862_100045961 3300005844 Bacteria 3726
255 Ga0068862_100052930 3300005844 Bacteria 3474
256 Ga0081455_10002194 3300005937 Bacteria 23270
257 Ga0075366_10235505 3300006195 Bacteria 1116
258 Ga0097621_100042116 3300006237 Bacteria 3677
259 Ga0068865_100030035 3300006881 Bacteria 3611
260 Ga0097620_100025698 3300006931 Bacteria 5906
261 Ga0097620_100068832 3300006931 Bacteria 3574
262 Ga0097620_100515684 3300006931 Bacteria 1290
263 Ga0097620_101189403 3300006931 Bacteria 839
264 Ga0097620_101695264 3300006931 Unclassified 698
265 Ga0097620_102175918 3300006931 Bacteria 612
266 Ga0105251_10000180 3300009011 Bacteria 63702
267 Ga0105240_10020333 3300009093 Bacteria 8859
268 Ga0105240_10059762 3300009093 Bacteria 4755
269 Ga0105240_10126401 3300009093 Bacteria 3072
270 Ga0105240_10214951 3300009093 Bacteria 2244
271 Ga0105240_12259811 3300009093 Bacteria 564
272 Ga0105245_11457666 3300009098 Bacteria 735
273 Ga0105247_10230660 3300009101 Bacteria 1257
274 Ga0105241_10015078 3300009174 Bacteria 5661
275 Ga0105241_10034476 3300009174 Bacteria 3803
276 Ga0105248_10000045 3300009177 Bacteria 165909
277 Ga0105248_10019485 3300009177 Bacteria 7507
278 Ga0105248_10086921 3300009177 Bacteria 3518
279 Ga0105248_10169325 3300009177 Bacteria 2462
280 Ga0105248_10323825 3300009177 Bacteria 1736
281 Ga0105248_10595813 3300009177 Bacteria 1247
282 Ga0105237_10104195 3300009545 Bacteria 2828
283 Ga0105237_10278099 3300009545 Bacteria 1676
284 Ga0105237_10540188 3300009545 Bacteria 1172
285 Ga0105238_10101612 3300009551 Bacteria 2857
286 Ga0105238_10120423 3300009551 Bacteria 2604
287 Ga0105238_10249499 3300009551 Bacteria 1753
288 Ga0105238_10500699 3300009551 Bacteria 1216
289 Ga0105249_10000055 3300009553 Bacteria 161674
290 Ga0105249_10000064 3300009553 Bacteria 151646
291 Ga0105249_11032743 3300009553 Unclassified 891
292 Ga0105239_10092130 3300010375 Bacteria 3345
293 Ga0105239_10142427 3300010375 Bacteria 2672
294 Ga0105239_10227365 3300010375 Bacteria 2093
295 Ga0105239_10253868 3300010375 Bacteria 1975
296 Ga0157373_10017786 3300013100 Bacteria 5175
297 Ga0157373_10099855 3300013100 Bacteria 2043
298 Ga0157373_10133342 3300013100 Bacteria 1746
299 Ga0157373_10216885 3300013100 Bacteria 1349
300 Ga0157373_10433518 3300013100 Bacteria 944
301 Ga0157371_10042550 3300013102 Bacteria 3237
302 Ga0157371_10066765 3300013102 Bacteria 2547
303 Ga0157371_10099665 3300013102 Bacteria 2060
304 Ga0157371_10143069 3300013102 Bacteria 1704
305 Ga0157371_10146921 3300013102 Bacteria 1680
306 Ga0157371_10199609 3300013102 Bacteria 1434
307 Ga0157371_10262895 3300013102 Bacteria 1244
308 Ga0157371_10318868 3300013102 Bacteria 1128
309 Ga0157371_10468807 3300013102 Bacteria 927
310 Ga0157371_10648861 3300013102 Bacteria 788
311 Ga0157371_10743056 3300013102 Bacteria 736
312 Ga0157370_10017082 3300013104 Bacteria 7330
313 Ga0157370_10138077 3300013104 Bacteria 2271
314 Ga0157370_10155191 3300013104 Bacteria 2130
315 Ga0157370_10179400 3300013104 Bacteria 1968
316 Ga0157370_10233925 3300013104 Unclassified 1700
317 Ga0157370_10238722 3300013104 Bacteria 1682
318 Ga0157370_10464055 3300013104 Bacteria 1164
319 Ga0157370_10504551 3300013104 Bacteria 1111
320 Ga0157370_10995311 3300013104 Bacteria 759
321 Ga0157370_10996503 3300013104 Bacteria 759
322 Ga0157369_10000385 3300013105 Bacteria 58590
323 Ga0157369_10008149 3300013105 Bacteria 12019
324 Ga0157369_10034567 3300013105 Bacteria 5546
325 Ga0157369_10042343 3300013105 Bacteria 4968
326 Ga0157369_10079244 3300013105 Bacteria 3518
327 Ga0157369_10089410 3300013105 Bacteria 3288
328 Ga0157369_10118133 3300013105 Bacteria 2815
329 Ga0157369_10261825 3300013105 Bacteria 1803
330 Ga0157369_10875687 3300013105 Bacteria 921
331 Ga0157369_10926097 3300013105 Bacteria 893
332 Ga0157369_10947725 3300013105 Bacteria 882
333 Ga0157374_10029530 3300013296 Bacteria 4967
334 Ga0157374_10398516 3300013296 Bacteria 1373
335 Ga0163162_10181859 3300013306 Bacteria 2228
336 Ga0163162_10208860 3300013306 Bacteria 2082
337 Ga0163162_10251460 3300013306 Bacteria 1899
338 Ga0163162_11400476 3300013306 Bacteria 795
339 Ga0157372_10042719 3300013307 Bacteria 5016
340 Ga0157372_10045610 3300013307 Bacteria 4864
341 Ga0157372_10130022 3300013307 Bacteria 2896
342 Ga0157372_10214949 3300013307 Bacteria 2228
343 Ga0157372_10857206 3300013307 Bacteria 1054
344 Ga0157372_11020401 3300013307 Unclassified 958
345 Ga0157375_10485219 3300013308 Bacteria 1401
346 Ga0163163_10013547 3300014325 Bacteria 7470
347 Ga0157380_10001938 3300014326 Bacteria 13760
348 Ga0182008_10481143 3300014497 Unclassified 680
349 Ga0157379_10004695 3300014968 Bacteria 11728
350 Ga0157379_10012402 3300014968 Bacteria 7445
351 Ga0157379_10419739 3300014968 Bacteria 1232
352 Ga0163161_10000187 3300017792 Bacteria 56930
353 Ga0207672_1001152 3300025223 Unclassified 2306
354 Ga0207697_10014787 3300025315 Bacteria 3232
355 Ga0207697_10165812 3300025315 Bacteria 965
356 Ga0207656_10006461 3300025321 Bacteria 4217
357 Ga0207656_10049465 3300025321 Bacteria 1813
358 Ga0207656_10070266 3300025321 Bacteria 1554
359 Ga0207656_10124184 3300025321 Bacteria 1204
360 Ga0207713_1000939 3300025735 Bacteria 26164
361 Ga0207642_10489201 3300025899 Bacteria 752
362 Ga0207710_10254749 3300025900 Bacteria 878
363 Ga0207688_10037118 3300025901 Bacteria 2702
364 Ga0207680_10000009 3300025903 Bacteria 464571
365 Ga0207680_10049833 3300025903 Bacteria 2495
366 Ga0207647_10002309 3300025904 Bacteria 14532
367 Ga0207647_10005863 3300025904 Bacteria 8954
368 Ga0207647_10021558 3300025904 Bacteria 4300
369 Ga0207647_10166493 3300025904 Bacteria 1285
370 Ga0207647_10226227 3300025904 Bacteria 1077
371 Ga0207645_10022379 3300025907 Bacteria 4113
372 Ga0207645_10294683 3300025907 Bacteria 1079
373 Ga0207705_10000059 3300025909 Bacteria 155683
374 Ga0207705_10017290 3300025909 Bacteria 5163
375 Ga0207705_10022736 3300025909 Bacteria 4471
376 Ga0207705_10030331 3300025909 Bacteria 3858
377 Ga0207705_10124461 3300025909 Bacteria 1915
378 Ga0207705_10137069 3300025909 Bacteria 1825
379 Ga0207705_10155706 3300025909 Bacteria 1714
380 Ga0207705_10208481 3300025909 Bacteria 1482
381 Ga0207705_10255959 3300025909 Unclassified 1336
382 Ga0207705_10284944 3300025909 Bacteria 1265
383 Ga0207705_10330453 3300025909 Bacteria 1172
384 Ga0207705_10342391 3300025909 Bacteria 1151
385 Ga0207654_10000165 3300025911 Bacteria 42120
386 Ga0207654_10772273 3300025911 Bacteria 693
387 Ga0207707_10082130 3300025912 Bacteria 2813
388 Ga0207707_10082591 3300025912 Bacteria 2805
389 Ga0207707_11262203 3300025912 Unclassified 595
390 Ga0207695_10012549 3300025913 Bacteria 10155
391 Ga0207695_10014941 3300025913 Bacteria 9163
392 Ga0207695_10133225 3300025913 Bacteria 2441
393 Ga0207695_10281745 3300025913 Bacteria 1556
394 Ga0207671_10003622 3300025914 Bacteria 15263
395 Ga0207671_10083675 3300025914 Bacteria 2396
396 Ga0207660_10002096 3300025917 Bacteria 13228
397 Ga0207660_10038411 3300025917 Bacteria 3342
398 Ga0207660_10092290 3300025917 Bacteria 2247
399 Ga0207660_10718218 3300025917 Bacteria 815
400 Ga0207657_10001961 3300025919 Bacteria 22201
401 Ga0207657_10003763 3300025919 Bacteria 16122
402 Ga0207657_10020869 3300025919 Bacteria 6182
403 Ga0207657_10029758 3300025919 Bacteria 4965
404 Ga0207657_10061618 3300025919 Bacteria 3215
405 Ga0207657_10114260 3300025919 Bacteria 2227
406 Ga0207657_10135629 3300025919 Bacteria 2014
407 Ga0207657_10158343 3300025919 Bacteria 1840
408 Ga0207657_10169585 3300025919 Bacteria 1769
409 Ga0207657_10257701 3300025919 Bacteria 1389
410 Ga0207657_10261760 3300025919 Bacteria 1376
411 Ga0207649_10000432 3300025920 Bacteria 30378
412 Ga0207649_10049581 3300025920 Bacteria 2594
413 Ga0207649_10059595 3300025920 Bacteria 2396
414 Ga0207649_10087224 3300025920 Bacteria 2035
415 Ga0207649_10097562 3300025920 Bacteria 1938
416 Ga0207649_10106977 3300025920 Bacteria 1862
417 Ga0207649_10150276 3300025920 Bacteria 1603
418 Ga0207649_10228944 3300025920 Bacteria 1328
419 Ga0207649_10556781 3300025920 Unclassified 878
420 Ga0207649_10839799 3300025920 Bacteria 718
421 Ga0207652_10171126 3300025921 Bacteria 1949
422 Ga0207652_10246404 3300025921 Bacteria 1611
423 Ga0207652_10592492 3300025921 Bacteria 994
424 Ga0207652_10602708 3300025921 Bacteria 985
425 Ga0207681_10001879 3300025923 Bacteria 13436
426 Ga0207694_10004249 3300025924 Bacteria 11223
427 Ga0207694_10079050 3300025924 Bacteria 2579
428 Ga0207694_10123956 3300025924 Bacteria 2065
429 Ga0207694_10163622 3300025924 Bacteria 1798
430 Ga0207650_10000238 3300025925 Bacteria 61061
431 Ga0207650_10071266 3300025925 Bacteria 2614
432 Ga0207650_10099065 3300025925 Bacteria 2240
433 Ga0207650_10150989 3300025925 Bacteria 1833
434 Ga0207650_10222872 3300025925 Bacteria 1518
435 Ga0207659_10751933 3300025926 Bacteria 836
436 Ga0207664_10066176 3300025929 Bacteria 2896
437 Ga0207664_10256449 3300025929 Bacteria 1528
438 Ga0207664_10368584 3300025929 Bacteria 1273
439 Ga0207644_10003828 3300025931 Bacteria 9746
440 Ga0207644_10022716 3300025931 Bacteria 4287
441 Ga0207644_10068389 3300025931 Bacteria 2591
442 Ga0207644_10367962 3300025931 Bacteria 1170
443 Ga0207690_10088321 3300025932 Bacteria 2183
444 Ga0207690_10091424 3300025932 Bacteria 2151
445 Ga0207690_10355481 3300025932 Bacteria 1159
446 Ga0207690_10552206 3300025932 Bacteria 936
447 Ga0207690_11802039 3300025932 Bacteria 511
448 Ga0207706_10011808 3300025933 Bacteria 7955
449 Ga0207706_10012837 3300025933 Bacteria 7626
450 Ga0207706_10018110 3300025933 Bacteria 6337
451 Ga0207706_10019697 3300025933 Bacteria 6070
452 Ga0207706_10036457 3300025933 Bacteria 4368
453 Ga0207706_10061107 3300025933 Bacteria 3318
454 Ga0207706_10607170 3300025933 Bacteria 939
455 Ga0207670_10229595 3300025936 Bacteria 1425
456 Ga0207669_10013413 3300025937 Bacteria 4068
457 Ga0207691_10049825 3300025940 Bacteria 3837
458 Ga0207691_10090124 3300025940 Bacteria 2749
459 Ga0207711_10000027 3300025941 Bacteria 236548
460 Ga0207711_10013041 3300025941 Bacteria 6903
461 Ga0207711_10051430 3300025941 Bacteria 3528
462 Ga0207711_10169513 3300025941 Bacteria 1980
463 Ga0207711_10194054 3300025941 Bacteria 1852
464 Ga0207689_10025616 3300025942 Bacteria 4942
465 Ga0207661_10108969 3300025944 Bacteria 2339
466 Ga0207679_10029152 3300025945 Bacteria 3840
467 Ga0207679_10239290 3300025945 Bacteria 1537
468 Ga0207679_10255330 3300025945 Bacteria 1492
469 Ga0207679_11117706 3300025945 Bacteria 723
470 Ga0207679_11225638 3300025945 Bacteria 689
471 Ga0207667_10021840 3300025949 Bacteria 7083
472 Ga0207667_10036542 3300025949 Bacteria 5263
473 Ga0207667_10055914 3300025949 Bacteria 4147
474 Ga0207667_10109859 3300025949 Bacteria 2844
475 Ga0207667_10148313 3300025949 Bacteria 2414
476 Ga0207667_10157438 3300025949 Bacteria 2337
477 Ga0207667_10211563 3300025949 Bacteria 1987
478 Ga0207667_10274779 3300025949 Bacteria 1722
479 Ga0207651_10258008 3300025960 Bacteria 1429
480 Ga0207651_10855157 3300025960 Bacteria 808
481 Ga0207712_10000044 3300025961 Bacteria 171240
482 Ga0207712_10000262 3300025961 Bacteria 51101
483 Ga0207712_10951243 3300025961 Unclassified 761
484 Ga0207668_10007392 3300025972 Bacteria 6530
485 Ga0207668_10361017 3300025972 Bacteria 1217
486 Ga0207640_10000423 3300025981 Bacteria 26221
487 Ga0207640_10030085 3300025981 Bacteria 3341
488 Ga0207640_10031572 3300025981 Bacteria 3274
489 Ga0207640_10037344 3300025981 Bacteria 3055
490 Ga0207640_10057785 3300025981 Bacteria 2553
491 Ga0207640_10082370 3300025981 Bacteria 2203
492 Ga0207640_10106319 3300025981 Bacteria 1979
493 Ga0207640_10301635 3300025981 Bacteria 1267
494 Ga0207658_10000362 3300025986 Bacteria 44869
495 Ga0207658_10019836 3300025986 Bacteria 4652
496 Ga0207658_10041559 3300025986 Bacteria 3330
497 Ga0207658_10104964 3300025986 Bacteria 2221
498 Ga0207658_10212681 3300025986 Bacteria 1621
499 Ga0207658_10341245 3300025986 Bacteria 1302
500 Ga0207658_10374347 3300025986 Bacteria 1246
501 Ga0207658_11090396 3300025986 Bacteria 729
502 Ga0207677_11618030 3300026023 Bacteria 600
503 Ga0207639_10022823 3300026041 Bacteria 4512
504 Ga0207639_10024690 3300026041 Bacteria 4353
505 Ga0207639_10031332 3300026041 Bacteria 3908
506 Ga0207639_10051804 3300026041 Bacteria 3124
507 Ga0207639_10356686 3300026041 Bacteria 1307
508 Ga0207639_10423427 3300026041 Bacteria 1204
509 Ga0207639_10445763 3300026041 Bacteria 1174
510 Ga0207639_10462501 3300026041 Bacteria 1154
511 Ga0207639_11762313 3300026041 Bacteria 580
512 Ga0207678_10000471 3300026067 Bacteria 36436
513 Ga0207678_10000487 3300026067 Bacteria 35968
514 Ga0207678_10016987 3300026067 Bacteria 6388
515 Ga0207678_10032677 3300026067 Bacteria 4535
516 Ga0207678_10069528 3300026067 Bacteria 3019
517 Ga0207678_10125984 3300026067 Bacteria 2185
518 Ga0207678_10140056 3300026067 Bacteria 2064
519 Ga0207678_10224675 3300026067 Bacteria 1607
520 Ga0207678_10236380 3300026067 Bacteria 1565
521 Ga0207678_10332333 3300026067 Bacteria 1308
522 Ga0207678_10713279 3300026067 Bacteria 883
523 Ga0207702_10003397 3300026078 Bacteria 14579
524 Ga0207702_10006604 3300026078 Bacteria 9974
525 Ga0207702_10017071 3300026078 Bacteria 6004
526 Ga0207702_10040341 3300026078 Bacteria 3914
527 Ga0207702_10102585 3300026078 Bacteria 2528
528 Ga0207702_10181952 3300026078 Bacteria 1936
529 Ga0207702_10216458 3300026078 Bacteria 1783
530 Ga0207702_10260251 3300026078 Bacteria 1633
531 Ga0207702_10435135 3300026078 Bacteria 1270
532 Ga0207702_10546035 3300026078 Bacteria 1133
533 Ga0207702_10823914 3300026078 Bacteria 918
534 Ga0207641_10000041 3300026088 Bacteria 191595
535 Ga0207641_10000488 3300026088 Bacteria 44701
536 Ga0207641_10205826 3300026088 Bacteria 1817
537 Ga0207648_10014768 3300026089 Bacteria 7204
538 Ga0207676_10000039 3300026095 Bacteria 171142
539 Ga0207676_10001800 3300026095 Bacteria 15706
540 Ga0207676_10291780 3300026095 Bacteria 1485
541 Ga0207676_10677322 3300026095 Bacteria 997
542 Ga0207674_10002967 3300026116 Bacteria 21070
543 Ga0207674_10023732 3300026116 Bacteria 6564
544 Ga0207674_10042490 3300026116 Bacteria 4695
545 Ga0207674_10044575 3300026116 Bacteria 4568
546 Ga0207674_10046337 3300026116 Bacteria 4464
547 Ga0207674_10278489 3300026116 Bacteria 1620
548 Ga0207674_10390021 3300026116 Bacteria 1346
549 Ga0207674_10572458 3300026116 Bacteria 1091
550 Ga0207675_100002506 3300026118 Bacteria 18172
551 Ga0207675_100204837 3300026118 Bacteria 1896
552 Ga0207683_10063059 3300026121 Bacteria 3265
553 Ga0207683_11013209 3300026121 Bacteria 771
554 Ga0207698_10012912 3300026142 Bacteria 5489
555 Ga0207698_10014170 3300026142 Bacteria 5289
556 Ga0207698_10020321 3300026142 Bacteria 4568
557 Ga0207698_10020958 3300026142 Bacteria 4512
558 Ga0207698_10064515 3300026142 Bacteria 2871
559 Ga0207698_10138493 3300026142 Bacteria 2092
560 Ga0207698_10138996 3300026142 Bacteria 2089
561 Ga0207698_10151371 3300026142 Bacteria 2014
562 Ga0207698_10152715 3300026142 Bacteria 2007
563 Ga0207698_10289434 3300026142 Bacteria 1519
564 Ga0207698_10592129 3300026142 Bacteria 1092
565 Ga0207698_10616298 3300026142 Bacteria 1071
566 Ga0268266_10000069 3300028379 Bacteria 239714
567 Ga0268266_10007113 3300028379 Bacteria 10153
568 Ga0268266_10414804 3300028379 Bacteria 1275
569 Ga0268265_10000061 3300028380 Bacteria 148625
570 Ga0268265_10000100 3300028380 Bacteria 108659
571 Ga0268265_10011102 3300028380 Bacteria 6086
572 Ga0268265_10154314 3300028380 Bacteria 1941
573 Ga0268264_10000131 3300028381 Bacteria 181459
574 Ga0307408_100135783 3300031548 Bacteria 1924
575 Ga0307408_100474405 3300031548 Bacteria 1090
576 Ga0307408_101211675 3300031548 Bacteria 704
577 Ga0307405_10016550 3300031731 Bacteria 4023
578 Ga0307405_10213494 3300031731 Bacteria 1410
579 Ga0307413_10086838 3300031824 Bacteria 2024
580 Ga0307413_10161264 3300031824 Bacteria 1575
581 Ga0307413_10166666 3300031824 Bacteria 1554
582 Ga0307413_10590856 3300031824 Bacteria 907
583 Ga0307410_10013352 3300031852 Bacteria 4789
584 Ga0307410_10229124 3300031852 Bacteria 1433
585 Ga0307410_10526296 3300031852 Bacteria 976
586 Ga0307410_11063940 3300031852 Bacteria 700
587 Ga0307406_10211993 3300031901 Bacteria 1433
588 Ga0307406_10245637 3300031901 Bacteria 1345
589 Ga0307406_10456883 3300031901 Bacteria 1026
590 Ga0307407_10058205 3300031903 Bacteria 2245
591 Ga0307407_10170297 3300031903 Bacteria 1433
592 Ga0307407_10321402 3300031903 Bacteria 1086
593 Ga0307412_10101628 3300031911 Bacteria 2034
594 Ga0307412_10227661 3300031911 Bacteria 1433
595 Ga0307412_10227666 3300031911 Bacteria 1433
596 Ga0307412_10355327 3300031911 Bacteria 1178
597 Ga0307409_100055692 3300031995 Bacteria 3055
598 Ga0307409_100087305 3300031995 Bacteria 2541
599 Ga0307409_100248143 3300031995 Bacteria 1625
600 Ga0307409_100447078 3300031995 Bacteria 1246
601 Ga0307416_100119501 3300032002 Bacteria 2344
602 Ga0307416_100322168 3300032002 Bacteria 1548
603 Ga0307414_10126810 3300032004 Bacteria 1973
604 Ga0307414_10153733 3300032004 Bacteria 1818
605 Ga0307414_10546338 3300032004 Bacteria 1032
606 Ga0307414_11338702 3300032004 Bacteria 665
607 Ga0307411_10234151 3300032005 Bacteria 1433
608 Ga0307411_10234152 3300032005 Bacteria 1433
609 Ga0307411_10394478 3300032005 Bacteria 1142
610 Ga0307411_10791932 3300032005 Bacteria 834
611 Ga0307415_100018055 3300032126 Bacteria 4248
612 Ga0307415_100070163 3300032126 Bacteria 2459
613 Ga0307415_100166245 3300032126 Bacteria 1715
614 Ga0373923_0087831 3300035111 Bacteria 1357
615 Ga0373954_0009995 3300035118 Bacteria 4180
616 Ga0373955_0012508 3300035172 Bacteria 4079
617 Ga0373935_1185545 3300035692 Archaea 569
618 Ga0373933_0135393 3300035724 Bacteria 1552
619 Ga0373937_0005592 3300036401 Bacteria 10784
620 Ga0395899_0031826 3300037312 Bacteria 3963
621 Ga0395899_0047409 3300037312 Bacteria 3199
622 Ga0395899_0062688 3300037312 Bacteria 2737
623 Ga0395899_0078203 3300037312 Bacteria 2411
624 Ga0395899_0167469 3300037312 Bacteria 1549
625 Ga0395899_0186946 3300037312 Bacteria 1451
626 Ga0395899_0232137 3300037312 Bacteria 1273
627 Ga0395899_0239425 3300037312 Bacteria 1249
628 Ga0395899_0265107 3300037312 Bacteria 1173
629 Ga0395899_0266507 3300037312 Bacteria 1169
630 Ga0395899_0332854 3300037312 Bacteria 1020
631 Ga0395899_0392088 3300037312 Bacteria 920
632 Ga0395899_0439176 3300037312 Bacteria 857
633 Ga0395900_0013241 3300037418 Bacteria 8429
634 Ga0395900_0029049 3300037418 Bacteria 5671
635 Ga0395900_0030220 3300037418 Bacteria 5562
636 Ga0395900_0072500 3300037418 Bacteria 3540
637 Ga0395900_0080169 3300037418 Bacteria 3354
638 Ga0395900_0089800 3300037418 Bacteria 3158
639 Ga0395900_0114819 3300037418 Bacteria 2763
640 Ga0395900_0205322 3300037418 Bacteria 1991
641 Ga0395900_0224468 3300037418 Bacteria 1892
642 Ga0395900_0270096 3300037418 Bacteria 1695
643 Ga0395900_0420799 3300037418 Bacteria 1297
644 Ga0395900_0507575 3300037418 Bacteria 1155
645 Ga0395900_0552262 3300037418 Bacteria 1096
646 Ga0395900_0560206 3300037418 Bacteria 1086
647 Ga0395900_0871056 3300037418 Bacteria 825
648 Ga0395900_1063892 3300037418 Bacteria 727
649 Ga0395900_1068906 3300037418 Bacteria 725
650 Ga0395900_1174575 3300037418 Bacteria 683
651 Ga0395900_1179828 3300037418 Bacteria 681
652 Ga0395900_1206261 3300037418 Unclassified 672
653 Ga0395900_1384523 3300037418 Bacteria 616
654 Ga0395900_1601663 3300037418 Bacteria 563
655 Ga0395898_0011127 3300037466 Bacteria 9368
656 Ga0395898_0012808 3300037466 Bacteria 8658
657 Ga0395898_0030111 3300037466 Bacteria 5433
658 Ga0395898_0034005 3300037466 Bacteria 5084
659 Ga0395898_0087127 3300037466 Bacteria 3008
660 Ga0395898_0087987 3300037466 Bacteria 2991
661 Ga0395898_0240839 3300037466 Bacteria 1725
662 Ga0395898_0311417 3300037466 Bacteria 1502
663 Ga0395898_0415018 3300037466 Bacteria 1283
664 Ga0395898_0425909 3300037466 Bacteria 1264
665 Ga0395898_0478769 3300037466 Bacteria 1184
666 Ga0395898_0500473 3300037466 Bacteria 1156
667 Ga0395898_0768826 3300037466 Bacteria 904
668 Ga0395898_0991980 3300037466 Bacteria 776
669 Ga0395905_0004481 3300037471 Bacteria 14487
670 Ga0395905_0008397 3300037471 Bacteria 10183
671 Ga0395905_0015331 3300037471 Bacteria 7285
672 Ga0395905_0027014 3300037471 Bacteria 5412
673 Ga0395905_0037236 3300037471 Bacteria 4569
674 Ga0395905_0057816 3300037471 Bacteria 3627
675 Ga0395905_0129321 3300037471 Bacteria 2375
676 Ga0395905_0156489 3300037471 Bacteria 2143
677 Ga0395905_0283341 3300037471 Bacteria 1543
678 Ga0395905_0293088 3300037471 Bacteria 1514
679 Ga0395905_0333895 3300037471 Bacteria 1406
680 Ga0395905_0341511 3300037471 Bacteria 1388
681 Ga0395905_0504194 3300037471 Bacteria 1110
682 Ga0395905_0506900 3300037471 Bacteria 1107
683 Ga0395905_0596321 3300037471 Bacteria 1007
684 Ga0395905_0627529 3300037471 Bacteria 977
685 Ga0395905_1042681 3300037471 Bacteria 721
686 Ga0395905_1164340 3300037471 Bacteria 674
687 Ga0395905_1349495 3300037471 Unclassified 617
688 Ga0395905_1442416 3300037471 Bacteria 592
689 Ga0395905_1672839 3300037471 Bacteria 541
690 Ga0395901_0007654 3300038443 Bacteria 10899
691 Ga0395901_0028062 3300038443 Bacteria 5789
692 Ga0395901_0038644 3300038443 Bacteria 4936
693 Ga0395901_0058710 3300038443 Bacteria 4002
694 Ga0395901_0072469 3300038443 Bacteria 3591
695 Ga0395901_0153424 3300038443 Bacteria 2419
696 Ga0395901_0193555 3300038443 Bacteria 2132
697 Ga0395901_0252414 3300038443 Bacteria 1837
698 Ga0395901_0280143 3300038443 Bacteria 1732
699 Ga0395901_0332113 3300038443 Bacteria 1571
700 Ga0395901_0358683 3300038443 Bacteria 1503
701 Ga0395901_0499274 3300038443 Bacteria 1239
702 Ga0395901_0507680 3300038443 Bacteria 1227
703 Ga0395901_0561055 3300038443 Bacteria 1156
704 Ga0395901_0569403 3300038443 Bacteria 1146
705 Ga0395901_0590911 3300038443 Bacteria 1120
706 Ga0395901_0657263 3300038443 Bacteria 1051
707 Ga0395901_0730153 3300038443 Bacteria 985
708 Ga0395901_0798812 3300038443 Bacteria 933
709 Ga0395901_0898992 3300038443 Bacteria 867
710 Ga0395901_1143331 3300038443 Bacteria 747
711 Ga0395901_1521617 3300038443 Bacteria 624
712 Ga0395901_1672181 3300038443 Bacteria 588
713 Ga0451802_0572938 3300041460 Bacteria 532
714 Ga0439433_0045471 3300041999 Bacteria 1028
715 Ga0439448_0016029 3300042005 Bacteria 2277
716 Ga0439449_0111056 3300042007 Bacteria 1015
717 Ga0439458_0000422 3300042157 Bacteria 10657
718 Ga0439458_0001147 3300042157 Bacteria 6734
719 Ga0466969_0088654 3300044656 Bacteria 1468
720 Ga0466969_0143916 3300044656 Bacteria 1101
721 Ga0466969_0296944 3300044656 Bacteria 731
722 Ga0466972_0052878 3300044658 Bacteria 1956
723 Ga0466965_0146108 3300044683 Bacteria 1234
724 Ga0466965_0235540 3300044683 Bacteria 979
725 Ga0466965_0349455 3300044683 Bacteria 810
726 Ga0466966_0000052 3300044684 Bacteria 88472
727 Ga0466966_0058989 3300044684 Bacteria 2424
728 Ga0466966_0123352 3300044684 Bacteria 1590
729 Ga0466966_0136231 3300044684 Bacteria 1501
730 Ga0466966_0138624 3300044684 Bacteria 1487
731 Ga0466966_0317106 3300044684 Bacteria 937
732 Ga0466961_0092565 3300044693 Bacteria 1908
733 Ga0466961_0200464 3300044693 Bacteria 1234
734 Ga0466961_0242972 3300044693 Bacteria 1106
735 Ga0466961_0492624 3300044693 Bacteria 740
736 Ga0466961_0526259 3300044693 Bacteria 713
737 Ga0466963_0021704 3300044694 Bacteria 4054
738 Ga0466963_0058453 3300044694 Bacteria 2571
739 Ga0466963_0083764 3300044694 Bacteria 2163
740 Ga0466963_0141941 3300044694 Bacteria 1664
741 Ga0466963_0162950 3300044694 Bacteria 1552
742 Ga0466963_0285273 3300044694 Bacteria 1160
743 Ga0466963_0306714 3300044694 Bacteria 1117
744 Ga0466963_0547140 3300044694 Bacteria 817
745 Ga0466964_0004154 3300044706 Bacteria 5325
746 Ga0466964_0012830 3300044706 Bacteria 3174
747 Ga0466964_0280054 3300044706 Unclassified 833
748 Ga0466964_0574439 3300044706 Bacteria 615
749 Ga0466971_0028364 3300044719 Bacteria 2504
750 Ga0466971_0097314 3300044719 Bacteria 1350
751 Ga0466971_0107990 3300044719 Bacteria 1282
752 Ga0466971_0269206 3300044719 Bacteria 814
753 Ga0466971_0379606 3300044719 Bacteria 687
754 Ga0466968_0074177 3300044735 Bacteria 1485
755 Ga0466968_0467646 3300044735 Bacteria 625
756 Ga0466970_0065496 3300044765 Bacteria 1949
757 Ga0466970_0111615 3300044765 Bacteria 1493
758 Ga0466970_0186696 3300044765 Bacteria 1151
759 Ga0466957_0253716 3300044842 Bacteria 1170
760 Ga0466957_0345543 3300044842 Bacteria 1008
761 Ga0466957_0378768 3300044842 Bacteria 964
762 Ga0466957_0398063 3300044842 Bacteria 941
763 Ga0466957_0860815 3300044842 Bacteria 646
764 Ga0466959_0029469 3300045049 Bacteria 4066
765 Ga0466959_0201943 3300045049 Bacteria 1383
766 Ga0466959_0233860 3300045049 Bacteria 1271
767 Ga0466959_0455032 3300045049 Bacteria 867
768 Ga0466959_0578946 3300045049 Bacteria 756
769 Ga0466959_0607351 3300045049 Bacteria 736
770 Ga0466958_0000482 3300045836 Bacteria 16679
771 Ga0466958_0117034 3300045836 Bacteria 1666
772 Ga0466958_0235632 3300045836 Bacteria 1169
773 Ga0466958_0294077 3300045836 Bacteria 1042
774 Ga0466958_0467231 3300045836 Bacteria 817
775 Ga0466958_0655471 3300045836 Bacteria 683
776 Ga0466967_0020578 3300045976 Bacteria 5338
777 Ga0466967_0057654 3300045976 Bacteria 3429
778 Ga0466967_0094209 3300045976 Bacteria 2726
779 Ga0466967_0120132 3300045976 Bacteria 2427
780 Ga0466967_0230319 3300045976 Bacteria 1764
781 Ga0466967_0231962 3300045976 Bacteria 1758
782 Ga0466967_0248549 3300045976 Bacteria 1698
783 Ga0466967_0286781 3300045976 Bacteria 1581
784 Ga0466967_0288781 3300045976 Bacteria 1575
785 Ga0466967_0324034 3300045976 Bacteria 1486
786 Ga0466967_1272519 3300045976 Bacteria 733
787 Ga0466967_1955190 3300045976 Bacteria 583
788 Ga0495663_0035689 3300046525 Bacteria 1494
789 Ga0495654_0002580 3300046530 Bacteria 11581
790 Ga0495668_0013222 3300046616 Bacteria 4878
791 Ga0495668_0017035 3300046616 Bacteria 4219
792 Ga0495623_0007986 3300046679 Bacteria 6873
793 Ga0495685_137817 3300047447 Bacteria 796
794 Ga0495681_0404952 3300047470 Unclassified 509
795 Ga0496101_0193715 3300048904 Bacteria 1569
796 Ga0496101_0244888 3300048904 Bacteria 1396
797 Ga0496101_1246825 3300048904 Bacteria 582
798 Ga0496102_0007991 3300048905 Bacteria 9039
799 Ga0496102_0237167 3300048905 Bacteria 1720
800 Ga0496102_0295809 3300048905 Bacteria 1526
801 Ga0496103_0000362 3300048906 Bacteria 40991
802 Ga0496103_0014910 3300048906 Bacteria 4620
803 Ga0496104_1099589 3300048907 Unclassified 698
804 Ga0496105_0051845 3300048908 Bacteria 3388
805 Ga0496107_0162547 3300048910 Bacteria 1655
806 Ga0496107_0511167 3300048910 Bacteria 891
807 Ga0496108_0000944 3300048911 Bacteria 22620
808 Ga0496108_0022066 3300048911 Bacteria 5234
809 Ga0496108_0046987 3300048911 Bacteria 3608
810 Ga0496108_0456951 3300048911 Bacteria 1116
811 Ga0496109_0114695 3300048912 Bacteria 2506
812 Ga0496109_0139158 3300048912 Bacteria 2269
813 Ga0496109_0140016 3300048912 Bacteria 2262
814 Ga0496110_0003482 3300048913 Bacteria 12073
815 Ga0496110_0912928 3300048913 Bacteria 784
816 Ga0496110_0960575 3300048913 Bacteria 761
817 Ga0496111_0182604 3300048914 Bacteria 1559
818 Ga0496111_0287806 3300048914 Bacteria 1219
819 Ga0496112_0059780 3300048915 Bacteria 3755
820 Ga0496112_0149572 3300048915 Bacteria 2302
821 Ga0496112_0273753 3300048915 Bacteria 1636
822 Ga0496113_0021971 3300048916 Bacteria 4506
823 Ga0496113_0142822 3300048916 Bacteria 1884
824 Ga0496116_0064291 3300048919 Bacteria 2359
825 Ga0496117_0065699 3300048920 Bacteria 2464
826 Ga0496118_0006582 3300048921 Bacteria 12689
827 Ga0496118_0070176 3300048921 Bacteria 2531
828 Ga0496120_0192240 3300048923 Unclassified 994
829 Ga0496121_0160724 3300048924 Bacteria 1643
830 Ga0496124_0399383 3300048927 Bacteria 955
831 Ga0495678_123647 3300049459 Bacteria 866
832 Ga0501227_092154 3300049665 Bacteria 801
833 Ga0501235_011598 3300049669 Bacteria 1933
834 Ga0501221_081608 3300049704 Bacteria 779
835 Ga0501225_0145440 3300049705 Bacteria 719
836 Ga0501234_032474 3300049707 Bacteria 845
837 Ga0501081_1249765 3300049743 Bacteria 563
838 Ga0501232_008215 3300049757 Bacteria 1122
839 Ga0501270_021670 3300049767 Bacteria 985
840 Ga0501212_013771 3300049851 Bacteria 1190
841 Ga0500592_055036 3300053116 Bacteria 648
842 Ga0500568_0119204 3300053139 Bacteria 984
843 Ga0500604_0006651 3300053151 Bacteria 3056
844 Ga0500604_0007069 3300053151 Bacteria 2971
845 Ga0500627_0000449 3300053158 Bacteria 11165
846 Ga0466962_0012025 3300061719 Bacteria 4163
847 Ga0466962_0023563 3300061719 Bacteria 2958
848 Ga0466962_0026015 3300061719 Bacteria 2809
849 Ga0466962_0112685 3300061719 Bacteria 1310
850 Ga0466962_0169626 3300061719 Bacteria 1062
851 Ga0395899_0383916
852 SwRhRL2b_contig_1053888
853 JGI24736J21556_1000766
854 JGI24736J21556_1000967
855 JGI24741J21665_1009990
856 JGI24752J21851_1000180
857 JGI24752J21851_1000688
858 JGI24747J21853_1028030
859 JGI24740J21852_10005691
860 JGI24740J21852_10011031
861 JGI24740J21852_10026937
862 JGI24740J21852_10030133
863 JGI24740J21852_10031099
864 JGI24740J21852_10032233
865 JGI24739J22299_10005321
866 JGI24739J22299_10010999
867 JGI24739J22299_10024646
868 JGI24739J22299_10029277
869 JGI24739J22299_10051158
870 JGI24737J22298_10003721
871 JGI24737J22298_10018720
872 JGI24737J22298_10037355
873 JGI24737J22298_10039339
874 JGI24737J22298_10056146
875 JGI24743J22301_10008782
876 JGI24735J21928_10007673
877 JGI24735J21928_10061385
878 JGI24735J21928_10062283
879 JGI24735J21928_10082846
880 JGI24735J21928_10199783
881 JGI24750J21931_1000362
882 JGI24748J21848_1000041
883 JGI24738J21930_10001561
884 JGI24738J21930_10022579
885 JGI24749J21850_1014218
886 JGI24034J26672_10000020
887 JGI24742J22300_10001855
888 JGI24742J22300_10023950
889 JGI24751J29686_10041994
890 JGI25405J52794_10001005
891 Ga0065704_10081840
892 Ga0065704_10341346
893 Ga0065707_10108971
894 Ga0065707_10179145
895 Ga0070658_10005537
896 Ga0070658_10047667
897 Ga0070658_10103513
898 Ga0070658_10127682
899 Ga0070658_10210333
900 Ga0070658_10218593
901 Ga0070658_10493284
902 Ga0070658_10634745
903 Ga0070658_10645289
904 Ga0070658_10690802
905 Ga0070676_10020470
906 Ga0070676_10293535
907 Ga0070683_100113561
908 Ga0070683_100155887
909 Ga0070683_100372451
910 Ga0070683_100779055
911 Ga0070683_101922806
912 Ga0070690_100000108
913 Ga0070670_100000030
914 Ga0070670_100014280
915 Ga0070670_100144959
916 Ga0070670_100341518
917 Ga0068869_100264673
918 Ga0070666_10000027
919 Ga0070666_10007627
920 Ga0070680_100002984
921 Ga0070680_100035300
922 Ga0070680_100222738
923 Ga0070682_100391623
924 Ga0070682_100489413
925 Ga0070682_101072473
926 Ga0068868_100220303
927 Ga0070660_100016384
928 Ga0070660_100027254
929 Ga0070660_100134918
930 Ga0070660_100155933
931 Ga0070660_100226255
932 Ga0070660_100350600
933 Ga0070660_101519012
934 Ga0070689_100040692
935 Ga0070687_100716546
936 Ga0070661_100015189
937 Ga0070661_100033242
938 Ga0070661_100048478
939 Ga0070661_100050485
940 Ga0070661_100083490
941 Ga0070661_100131468
942 Ga0070661_100215353
943 Ga0070661_100394895
944 Ga0070661_101125231
945 Ga0070692_10020606
946 Ga0070692_10181390
947 Ga0070692_10392655
948 Ga0070668_100002391
949 Ga0070668_100184078
950 Ga0070668_100345867
951 Ga0070669_100003214
952 Ga0070669_100261348
953 Ga0070669_100947681
954 Ga0070675_100517400
955 Ga0070671_100002224
956 Ga0070671_100029943
957 Ga0070671_100030841
958 Ga0070671_100088322
959 Ga0070671_101800203
960 Ga0070674_100013450
961 Ga0070673_100215585
962 Ga0070673_100300738
963 Ga0070673_100474330
964 Ga0070673_100728690
965 Ga0070673_100742221
966 Ga0070688_100016346
967 Ga0070659_100015441
968 Ga0070659_100022330
969 Ga0070659_100186814
970 Ga0070659_100322035
971 Ga0070659_100446950
972 Ga0070659_100656721
973 Ga0070667_100000710
974 Ga0070667_100006043
975 Ga0070667_100081428
976 Ga0070667_100133022
977 Ga0070667_100175252
978 Ga0070667_100313904
979 Ga0070714_100054716
980 Ga0070714_100198808
981 Ga0070663_100014097
982 Ga0070663_100035197
983 Ga0070663_100240507
984 Ga0070663_100604360
985 Ga0070662_100007194
986 Ga0070662_100030334
987 Ga0070662_100053810
988 Ga0070662_100056906
989 Ga0070662_100138150
990 Ga0070662_100164536
991 Ga0070662_100344634
992 Ga0070662_100385319
993 Ga0070681_10496886
994 Ga0070681_11092383
995 Ga0068867_100036073
996 Ga0068867_100160879
997 Ga0070685_10000040
998 Ga0070685_10872405
999 Ga0070679_100031201
1000 Ga0070679_100059216
1001 Ga0070679_100601514
1002 Ga0070679_100615282
1003 Ga0070679_100700706
1004 Ga0070679_100906915
1005 Ga0070679_101282650
1006 Ga0070684_100051638
1007 Ga0070684_100336960
1008 Ga0070684_100565611
1009 Ga0070684_101136888
1010 Ga0068853_100020145
1011 Ga0068853_100046398
1012 Ga0068853_100046922
1013 Ga0068853_100206221
1014 Ga0068853_100310620
1015 Ga0068853_100420570
1016 Ga0068853_100470822
1017 Ga0070672_100047320
1018 Ga0070672_100131302
1019 Ga0070686_100000010
1020 Ga0070665_100000331
1021 Ga0070665_100012313
1022 Ga0070665_100600622
1023 Ga0070665_100894537
1024 Ga0068855_100043141
1025 Ga0068855_100102226
1026 Ga0068855_100107857
1027 Ga0068855_100212567
1028 Ga0068855_100213842
1029 Ga0068855_100246880
1030 Ga0068855_100327137
1031 Ga0068855_100395507
1032 Ga0068855_100396789
1033 Ga0068855_100509745
1034 Ga0068855_100590010
1035 Ga0070664_100061938
1036 Ga0070664_100091041
1037 Ga0070664_100319506
1038 Ga0070664_100356566
1039 Ga0070664_101448277
1040 Ga0068857_100080653
1041 Ga0068857_100106850
1042 Ga0068857_100109980
1043 Ga0068857_100333901
1044 Ga0068857_100339532
1045 Ga0068857_100564260
1046 Ga0068857_100570409
1047 Ga0068857_100737832
1048 Ga0068857_101661230
1049 Ga0068854_100005144
1050 Ga0068854_100068834
1051 Ga0068854_100111458
1052 Ga0068854_100240116
1053 Ga0068854_100406657
1054 Ga0068854_100487956
1055 Ga0068856_100048137
1056 Ga0068856_100070362
1057 Ga0068856_100122409
1058 Ga0068856_100153488
1059 Ga0068856_100190045
1060 Ga0068856_100193764
1061 Ga0068856_100250186
1062 Ga0068856_100655192
1063 Ga0068856_100707891
1064 Ga0068852_100015748
1065 Ga0068852_100016728
1066 Ga0068852_100018511
1067 Ga0068852_100037211
1068 Ga0068852_100051503
1069 Ga0068852_100073726
1070 Ga0068852_100074916
1071 Ga0068852_100115408
1072 Ga0068852_100167959
1073 Ga0068852_100352994
1074 Ga0068852_100367032
1075 Ga0068852_100432109
1076 Ga0068852_100862175
1077 Ga0068852_100986996
1078 Ga0068859_100025698
1079 Ga0068859_100068836
1080 Ga0068859_100515707
1081 Ga0068859_101189459
1082 Ga0068859_101695449
1083 Ga0068859_102175781
1084 Ga0068864_100000041
1085 Ga0068864_100024246
1086 Ga0068864_100078848
1087 Ga0068864_100348049
1088 Ga0068866_10790108
1089 Ga0068861_100004537
1090 Ga0068851_10024597
1091 Ga0068851_10037292
1092 Ga0068851_10042284
1093 Ga0068851_10056483
1094 Ga0068863_100000035
1095 Ga0068863_100000148
1096 Ga0068863_100148860
1097 Ga0068863_100271510
1098 Ga0068858_100000543
1099 Ga0068858_100489194
1100 Ga0068860_100000080
1101 Ga0068860_100157707
1102 Ga0068862_100000042
1103 Ga0068862_100000272
1104 Ga0068862_100045961
1105 Ga0068862_100052930
1106 Ga0081455_10002194
1107 Ga0075366_10235505
1108 Ga0097621_100042116
1109 Ga0068865_100030035
1110 Ga0097620_100025698
1111 Ga0097620_100068832
1112 Ga0097620_100515684
1113 Ga0097620_101189403
1114 Ga0097620_101695264
1115 Ga0097620_102175918
1116 Ga0105251_10000180
1117 Ga0105240_10020333
1118 Ga0105240_10059762
1119 Ga0105240_10126401
1120 Ga0105240_10214951
1121 Ga0105240_12259811
1122 Ga0105245_11457666
1123 Ga0105247_10230660
1124 Ga0105241_10015078
1125 Ga0105241_10034476
1126 Ga0105248_10000045
1127 Ga0105248_10019485
1128 Ga0105248_10086921
1129 Ga0105248_10169325
1130 Ga0105248_10323825
1131 Ga0105248_10595813
1132 Ga0105237_10104195
1133 Ga0105237_10278099
1134 Ga0105237_10540188
1135 Ga0105238_10101612
1136 Ga0105238_10120423
1137 Ga0105238_10249499
1138 Ga0105238_10500699
1139 Ga0105249_10000055
1140 Ga0105249_10000064
1141 Ga0105249_11032743
1142 Ga0105239_10092130
1143 Ga0105239_10142427
1144 Ga0105239_10227365
1145 Ga0105239_10253868
1146 Ga0157373_10017786
1147 Ga0157373_10099855
1148 Ga0157373_10133342
1149 Ga0157373_10216885
1150 Ga0157373_10433518
1151 Ga0157371_10042550
1152 Ga0157371_10066765
1153 Ga0157371_10099665
1154 Ga0157371_10143069
1155 Ga0157371_10146921
1156 Ga0157371_10199609
1157 Ga0157371_10262895
1158 Ga0157371_10318868
1159 Ga0157371_10468807
1160 Ga0157371_10648861
1161 Ga0157371_10743056
1162 Ga0157370_10017082
1163 Ga0157370_10138077
1164 Ga0157370_10155191
1165 Ga0157370_10179400
1166 Ga0157370_10233925
1167 Ga0157370_10238722
1168 Ga0157370_10464055
1169 Ga0157370_10504551
1170 Ga0157370_10995311
1171 Ga0157370_10996503
1172 Ga0157369_10000385
1173 Ga0157369_10008149
1174 Ga0157369_10034567
1175 Ga0157369_10042343
1176 Ga0157369_10079244
1177 Ga0157369_10089410
1178 Ga0157369_10118133
1179 Ga0157369_10261825
1180 Ga0157369_10875687
1181 Ga0157369_10926097
1182 Ga0157369_10947725
1183 Ga0157374_10029530
1184 Ga0157374_10398516
1185 Ga0163162_10181859
1186 Ga0163162_10208860
1187 Ga0163162_10251460
1188 Ga0163162_11400476
1189 Ga0157372_10042719
1190 Ga0157372_10045610
1191 Ga0157372_10130022
1192 Ga0157372_10214949
1193 Ga0157372_10857206
1194 Ga0157372_11020401
1195 Ga0157375_10485219
1196 Ga0163163_10013547
1197 Ga0157380_10001938
1198 Ga0182008_10481143
1199 Ga0157379_10004695
1200 Ga0157379_10012402
1201 Ga0157379_10419739
1202 Ga0163161_10000187
1203 Ga0207672_1001152
1204 Ga0207697_10014787
1205 Ga0207697_10165812
1206 Ga0207656_10006461
1207 Ga0207656_10049465
1208 Ga0207656_10070266
1209 Ga0207656_10124184
1210 Ga0207713_1000939
1211 Ga0207642_10489201
1212 Ga0207710_10254749
1213 Ga0207688_10037118
1214 Ga0207680_10000009
1215 Ga0207680_10049833
1216 Ga0207647_10002309
1217 Ga0207647_10005863
1218 Ga0207647_10021558
1219 Ga0207647_10166493
1220 Ga0207647_10226227
1221 Ga0207645_10022379
1222 Ga0207645_10294683
1223 Ga0207705_10000059
1224 Ga0207705_10017290
1225 Ga0207705_10022736
1226 Ga0207705_10030331
1227 Ga0207705_10124461
1228 Ga0207705_10137069
1229 Ga0207705_10155706
1230 Ga0207705_10208481
1231 Ga0207705_10255959
1232 Ga0207705_10284944
1233 Ga0207705_10330453
1234 Ga0207705_10342391
1235 Ga0207654_10000165
1236 Ga0207654_10772273
1237 Ga0207707_10082130
1238 Ga0207707_10082591
1239 Ga0207707_11262203
1240 Ga0207695_10012549
1241 Ga0207695_10014941
1242 Ga0207695_10133225
1243 Ga0207695_10281745
1244 Ga0207671_10003622
1245 Ga0207671_10083675
1246 Ga0207660_10002096
1247 Ga0207660_10038411
1248 Ga0207660_10092290
1249 Ga0207660_10718218
1250 Ga0207657_10001961
1251 Ga0207657_10003763
1252 Ga0207657_10020869
1253 Ga0207657_10029758
1254 Ga0207657_10061618
1255 Ga0207657_10114260
1256 Ga0207657_10135629
1257 Ga0207657_10158343
1258 Ga0207657_10169585
1259 Ga0207657_10257701
1260 Ga0207657_10261760
1261 Ga0207649_10000432
1262 Ga0207649_10049581
1263 Ga0207649_10059595
1264 Ga0207649_10087224
1265 Ga0207649_10097562
1266 Ga0207649_10106977
1267 Ga0207649_10150276
1268 Ga0207649_10228944
1269 Ga0207649_10556781
1270 Ga0207649_10839799
1271 Ga0207652_10171126
1272 Ga0207652_10246404
1273 Ga0207652_10592492
1274 Ga0207652_10602708
1275 Ga0207681_10001879
1276 Ga0207694_10004249
1277 Ga0207694_10079050
1278 Ga0207694_10123956
1279 Ga0207694_10163622
1280 Ga0207650_10000238
1281 Ga0207650_10071266
1282 Ga0207650_10099065
1283 Ga0207650_10150989
1284 Ga0207650_10222872
1285 Ga0207659_10751933
1286 Ga0207664_10066176
1287 Ga0207664_10256449
1288 Ga0207664_10368584
1289 Ga0207644_10003828
1290 Ga0207644_10022716
1291 Ga0207644_10068389
1292 Ga0207644_10367962
1293 Ga0207690_10088321
1294 Ga0207690_10091424
1295 Ga0207690_10355481
1296 Ga0207690_10552206
1297 Ga0207690_11802039
1298 Ga0207706_10011808
1299 Ga0207706_10012837
1300 Ga0207706_10018110
1301 Ga0207706_10019697
1302 Ga0207706_10036457
1303 Ga0207706_10061107
1304 Ga0207706_10607170
1305 Ga0207670_10229595
1306 Ga0207669_10013413
1307 Ga0207691_10049825
1308 Ga0207691_10090124
1309 Ga0207711_10000027
1310 Ga0207711_10013041
1311 Ga0207711_10051430
1312 Ga0207711_10169513
1313 Ga0207711_10194054
1314 Ga0207689_10025616
1315 Ga0207661_10108969
1316 Ga0207679_10029152
1317 Ga0207679_10239290
1318 Ga0207679_10255330
1319 Ga0207679_11117706
1320 Ga0207679_11225638
1321 Ga0207667_10021840
1322 Ga0207667_10036542
1323 Ga0207667_10055914
1324 Ga0207667_10109859
1325 Ga0207667_10148313
1326 Ga0207667_10157438
1327 Ga0207667_10211563
1328 Ga0207667_10274779
1329 Ga0207651_10258008
1330 Ga0207651_10855157
1331 Ga0207712_10000044
1332 Ga0207712_10000262
1333 Ga0207712_10951243
1334 Ga0207668_10007392
1335 Ga0207668_10361017
1336 Ga0207640_10000423
1337 Ga0207640_10030085
1338 Ga0207640_10031572
1339 Ga0207640_10037344
1340 Ga0207640_10057785
1341 Ga0207640_10082370
1342 Ga0207640_10106319
1343 Ga0207640_10301635
1344 Ga0207658_10000362
1345 Ga0207658_10019836
1346 Ga0207658_10041559
1347 Ga0207658_10104964
1348 Ga0207658_10212681
1349 Ga0207658_10341245
1350 Ga0207658_10374347
1351 Ga0207658_11090396
1352 Ga0207677_11618030
1353 Ga0207639_10022823
1354 Ga0207639_10024690
1355 Ga0207639_10031332
1356 Ga0207639_10051804
1357 Ga0207639_10356686
1358 Ga0207639_10423427
1359 Ga0207639_10445763
1360 Ga0207639_10462501
1361 Ga0207639_11762313
1362 Ga0207678_10000471
1363 Ga0207678_10000487
1364 Ga0207678_10016987
1365 Ga0207678_10032677
1366 Ga0207678_10069528
1367 Ga0207678_10125984
1368 Ga0207678_10140056
1369 Ga0207678_10224675
1370 Ga0207678_10236380
1371 Ga0207678_10332333
1372 Ga0207678_10713279
1373 Ga0207702_10003397
1374 Ga0207702_10006604
1375 Ga0207702_10017071
1376 Ga0207702_10040341
1377 Ga0207702_10102585
1378 Ga0207702_10181952
1379 Ga0207702_10216458
1380 Ga0207702_10260251
1381 Ga0207702_10435135
1382 Ga0207702_10546035
1383 Ga0207702_10823914
1384 Ga0207641_10000041
1385 Ga0207641_10000488
1386 Ga0207641_10205826
1387 Ga0207648_10014768
1388 Ga0207676_10000039
1389 Ga0207676_10001800
1390 Ga0207676_10291780
1391 Ga0207676_10677322
1392 Ga0207674_10002967
1393 Ga0207674_10023732
1394 Ga0207674_10042490
1395 Ga0207674_10044575
1396 Ga0207674_10046337
1397 Ga0207674_10278489
1398 Ga0207674_10390021
1399 Ga0207674_10572458
1400 Ga0207675_100002506
1401 Ga0207675_100204837
1402 Ga0207683_10063059
1403 Ga0207683_11013209
1404 Ga0207698_10012912
1405 Ga0207698_10014170
1406 Ga0207698_10020321
1407 Ga0207698_10020958
1408 Ga0207698_10064515
1409 Ga0207698_10138493
1410 Ga0207698_10138996
1411 Ga0207698_10151371
1412 Ga0207698_10152715
1413 Ga0207698_10289434
1414 Ga0207698_10592129
1415 Ga0207698_10616298
1416 Ga0268266_10000069
1417 Ga0268266_10007113
1418 Ga0268266_10414804
1419 Ga0268265_10000061
1420 Ga0268265_10000100
1421 Ga0268265_10011102
1422 Ga0268265_10154314
1423 Ga0268264_10000131
1424 Ga0307408_100135783
1425 Ga0307408_100474405
1426 Ga0307408_101211675
1427 Ga0307405_10016550
1428 Ga0307405_10213494
1429 Ga0307413_10086838
1430 Ga0307413_10161264
1431 Ga0307413_10166666
1432 Ga0307413_10590856
1433 Ga0307410_10013352
1434 Ga0307410_10229124
1435 Ga0307410_10526296
1436 Ga0307410_11063940
1437 Ga0307406_10211993
1438 Ga0307406_10245637
1439 Ga0307406_10456883
1440 Ga0307407_10058205
1441 Ga0307407_10170297
1442 Ga0307407_10321402
1443 Ga0307412_10101628
1444 Ga0307412_10227661
1445 Ga0307412_10227666
1446 Ga0307412_10355327
1447 Ga0307409_100055692
1448 Ga0307409_100087305
1449 Ga0307409_100248143
1450 Ga0307409_100447078
1451 Ga0307416_100119501
1452 Ga0307416_100322168
1453 Ga0307414_10126810
1454 Ga0307414_10153733
1455 Ga0307414_10546338
1456 Ga0307414_11338702
1457 Ga0307411_10234151
1458 Ga0307411_10234152
1459 Ga0307411_10394478
1460 Ga0307411_10791932
1461 Ga0307415_100018055
1462 Ga0307415_100070163
1463 Ga0307415_100166245
1464 Ga0373923_0087831
1465 Ga0373954_0009995
1466 Ga0373955_0012508
1467 Ga0373935_1185545
1468 Ga0373933_0135393
1469 Ga0373937_0005592
1470 Ga0395899_0031826
1471 Ga0395899_0047409
1472 Ga0395899_0062688
1473 Ga0395899_0078203
1474 Ga0395899_0167469
1475 Ga0395899_0186946
1476 Ga0395899_0232137
1477 Ga0395899_0239425
1478 Ga0395899_0265107
1479 Ga0395899_0266507
1480 Ga0395899_0332854
1481 Ga0395899_0392088
1482 Ga0395899_0439176
1483 Ga0395900_0013241
1484 Ga0395900_0029049
1485 Ga0395900_0030220
1486 Ga0395900_0072500
1487 Ga0395900_0080169
1488 Ga0395900_0089800
1489 Ga0395900_0114819
1490 Ga0395900_0205322
1491 Ga0395900_0224468
1492 Ga0395900_0270096
1493 Ga0395900_0420799
1494 Ga0395900_0507575
1495 Ga0395900_0552262
1496 Ga0395900_0560206
1497 Ga0395900_0871056
1498 Ga0395900_1063892
1499 Ga0395900_1068906
1500 Ga0395900_1174575
1501 Ga0395900_1179828
1502 Ga0395900_1206261
1503 Ga0395900_1384523
1504 Ga0395900_1601663
1505 Ga0395898_0011127
1506 Ga0395898_0012808
1507 Ga0395898_0030111
1508 Ga0395898_0034005
1509 Ga0395898_0087127
1510 Ga0395898_0087987
1511 Ga0395898_0240839
1512 Ga0395898_0311417
1513 Ga0395898_0415018
1514 Ga0395898_0425909
1515 Ga0395898_0478769
1516 Ga0395898_0500473
1517 Ga0395898_0768826
1518 Ga0395898_0991980
1519 Ga0395905_0004481
1520 Ga0395905_0008397
1521 Ga0395905_0015331
1522 Ga0395905_0027014
1523 Ga0395905_0037236
1524 Ga0395905_0057816
1525 Ga0395905_0129321
1526 Ga0395905_0156489
1527 Ga0395905_0283341
1528 Ga0395905_0293088
1529 Ga0395905_0333895
1530 Ga0395905_0341511
1531 Ga0395905_0504194
1532 Ga0395905_0506900
1533 Ga0395905_0596321
1534 Ga0395905_0627529
1535 Ga0395905_1042681
1536 Ga0395905_1164340
1537 Ga0395905_1349495
1538 Ga0395905_1442416
1539 Ga0395905_1672839
1540 Ga0395901_0007654
1541 Ga0395901_0028062
1542 Ga0395901_0038644
1543 Ga0395901_0058710
1544 Ga0395901_0072469
1545 Ga0395901_0153424
1546 Ga0395901_0193555
1547 Ga0395901_0252414
1548 Ga0395901_0280143
1549 Ga0395901_0332113
1550 Ga0395901_0358683
1551 Ga0395901_0499274
1552 Ga0395901_0507680
1553 Ga0395901_0561055
1554 Ga0395901_0569403
1555 Ga0395901_0590911
1556 Ga0395901_0657263
1557 Ga0395901_0730153
1558 Ga0395901_0798812
1559 Ga0395901_0898992
1560 Ga0395901_1143331
1561 Ga0395901_1521617
1562 Ga0395901_1672181
1563 Ga0451802_0572938
1564 Ga0439433_0045471
1565 Ga0439448_0016029
1566 Ga0439449_0111056
1567 Ga0439458_0000422
1568 Ga0439458_0001147
1569 Ga0466969_0088654
1570 Ga0466969_0143916
1571 Ga0466969_0296944
1572 Ga0466972_0052878
1573 Ga0466965_0146108
1574 Ga0466965_0235540
1575 Ga0466965_0349455
1576 Ga0466966_0000052
1577 Ga0466966_0058989
1578 Ga0466966_0123352
1579 Ga0466966_0136231
1580 Ga0466966_0138624
1581 Ga0466966_0317106
1582 Ga0466961_0092565
1583 Ga0466961_0200464
1584 Ga0466961_0242972
1585 Ga0466961_0492624
1586 Ga0466961_0526259
1587 Ga0466963_0021704
1588 Ga0466963_0058453
1589 Ga0466963_0083764
1590 Ga0466963_0141941
1591 Ga0466963_0162950
1592 Ga0466963_0285273
1593 Ga0466963_0306714
1594 Ga0466963_0547140
1595 Ga0466964_0004154
1596 Ga0466964_0012830
1597 Ga0466964_0280054
1598 Ga0466964_0574439
1599 Ga0466971_0028364
1600 Ga0466971_0097314
1601 Ga0466971_0107990
1602 Ga0466971_0269206
1603 Ga0466971_0379606
1604 Ga0466968_0074177
1605 Ga0466968_0467646
1606 Ga0466970_0065496
1607 Ga0466970_0111615
1608 Ga0466970_0186696
1609 Ga0466957_0253716
1610 Ga0466957_0345543
1611 Ga0466957_0378768
1612 Ga0466957_0398063
1613 Ga0466957_0860815
1614 Ga0466959_0029469
1615 Ga0466959_0201943
1616 Ga0466959_0233860
1617 Ga0466959_0455032
1618 Ga0466959_0578946
1619 Ga0466959_0607351
1620 Ga0466958_0000482
1621 Ga0466958_0117034
1622 Ga0466958_0235632
1623 Ga0466958_0294077
1624 Ga0466958_0467231
1625 Ga0466958_0655471
1626 Ga0466967_0020578
1627 Ga0466967_0057654
1628 Ga0466967_0094209
1629 Ga0466967_0120132
1630 Ga0466967_0230319
1631 Ga0466967_0231962
1632 Ga0466967_0248549
1633 Ga0466967_0286781
1634 Ga0466967_0288781
1635 Ga0466967_0324034
1636 Ga0466967_1272519
1637 Ga0466967_1955190
1638 Ga0495663_0035689
1639 Ga0495654_0002580
1640 Ga0495668_0013222
1641 Ga0495668_0017035
1642 Ga0495623_0007986
1643 Ga0495685_137817
1644 Ga0495681_0404952
1645 Ga0496101_0193715
1646 Ga0496101_0244888
1647 Ga0496101_1246825
1648 Ga0496102_0007991
1649 Ga0496102_0237167
1650 Ga0496102_0295809
1651 Ga0496103_0000362
1652 Ga0496103_0014910
1653 Ga0496104_1099589
1654 Ga0496105_0051845
1655 Ga0496107_0162547
1656 Ga0496107_0511167
1657 Ga0496108_0000944
1658 Ga0496108_0022066
1659 Ga0496108_0046987
1660 Ga0496108_0456951
1661 Ga0496109_0114695
1662 Ga0496109_0139158
1663 Ga0496109_0140016
1664 Ga0496110_0003482
1665 Ga0496110_0912928
1666 Ga0496110_0960575
1667 Ga0496111_0182604
1668 Ga0496111_0287806
1669 Ga0496112_0059780
1670 Ga0496112_0149572
1671 Ga0496112_0273753
1672 Ga0496113_0021971
1673 Ga0496113_0142822
1674 Ga0496116_0064291
1675 Ga0496117_0065699
1676 Ga0496118_0006582
1677 Ga0496118_0070176
1678 Ga0496120_0192240
1679 Ga0496121_0160724
1680 Ga0496124_0399383
1681 Ga0495678_123647
1682 Ga0501227_092154
1683 Ga0501235_011598
1684 Ga0501221_081608
1685 Ga0501225_0145440
1686 Ga0501234_032474
1687 Ga0501081_1249765
1688 Ga0501232_008215
1689 Ga0501270_021670
1690 Ga0501212_013771
1691 Ga0500592_055036
1692 Ga0500568_0119204
1693 Ga0500604_0006651
1694 Ga0500604_0007069
1695 Ga0500627_0000449
1696 Ga0466962_0012025
1697 Ga0466962_0023563
1698 Ga0466962_0026015
1699 Ga0466962_0112685
1700 Ga0466962_0169626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

71

127

0.92

PF00571

CBS

CBS domain

11

61

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kpd-assembly2.cif.gz_C crystal structure of the cbs domain pair of protein mj0100 in complex with 5 -methylthioadenosine and s-adenosyl-l-methionine. 0.9341 1 123
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9285 1 124
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9267 1 125
3fhm-assembly2.cif.gz_C crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.9255 2 124
2o16-assembly1.cif.gz_A crystal structure of a putative acetoin utilization protein (acub) from vibrio cholerae 0.92 1 132
ID Description Score Start End Superfamily
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9431 1 140 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9303 1 140 3.10.580.10
af_I1KTW9_5_335_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.928 81 124 3.20.20.70
3kpbA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9273 1 123 3.10.580.10
af_Q75K17_104_256_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9202 2 140 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A496PUT9-F1-model_v4 Inosine-5-monophosphate dehydrogenase 0.9733 1 141
AF-A0A429GIL6-F1-model_v4 CBS domain-containing protein 0.9691 1 129
AF-A0A5Q4FTQ3-F1-model_v4 CBS domain-containing protein 0.9669 2 141
AF-A0A1Y6F5Z0-F1-model_v4 CBS domain-containing protein 0.9662 1 116
AF-A0A4Q8MLJ9-F1-model_v4 deleted 0.9661 1 139

Map