F483381

General Info

Members Datasets Scaffolds Average Seq Length
848 377 785 207

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2856287931|2856292120
Length 221
Sequence NTLNEQLEDSQMFTGIVAAVGRIESIKPLGGEADAGVRLRVNAGGLGLDDVQLGDSIAIQGACMTVIDKSATTFDVDVSRESLNRTVGLADTGEVNLEKALRAHDRLGGHIVSGHVDGLGTVTRFAPVGESHELRILAPVEIGRYLAYKGSVTVNGVSLTVNSVDDRADGCEFSINLIPHTVEVTTLKHLAAGTKVNLEIDLIARYVERMLSAGVSAKPSA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
18 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
19 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
20 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
21 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
22 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
23 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
24 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
25 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
26 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
27 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
28 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
29 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
30 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
31 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
32 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
33 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
34 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
35 2818991450 Burkholderia sp. 604 Isolate Unclassified
36 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
37 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
38 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
39 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
40 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
41 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
42 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
43 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
44 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
45 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
46 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
47 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
48 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
49 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
50 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
51 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
52 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
53 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
54 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
55 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
56 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
57 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
58 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
59 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
60 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
61 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
62 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
63 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
64 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
65 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
66 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
67 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
76 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
77 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
82 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
85 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
86 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
89 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
94 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
95 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
96 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
97 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
98 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
99 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
102 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
103 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
104 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
105 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
106 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
107 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
108 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
111 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
112 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
113 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
117 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
118 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
119 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
120 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
121 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
122 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
123 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
131 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
132 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
133 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
137 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
143 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
149 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
150 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
152 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
153 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
156 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
157 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
159 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
160 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
163 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
189 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
194 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
197 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
198 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
199 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
207 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
208 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
212 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
213 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
214 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
215 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
216 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
217 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
218 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
219 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
220 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
226 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
227 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
233 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
236 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
237 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
238 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
239 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
240 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
241 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
242 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
243 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
244 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
245 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
246 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
247 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
248 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
249 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
250 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
251 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
257 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
258 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
259 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
260 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
261 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
262 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
263 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
271 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
272 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
273 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
274 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
275 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
276 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
277 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
278 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
279 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
280 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
281 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
282 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
283 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
288 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
295 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
296 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
297 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
298 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
299 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
300 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
301 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
302 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
306 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
316 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
317 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
318 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
319 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
320 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
321 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
322 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
323 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
324 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
327 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
328 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
329 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
330 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
331 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
332 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
344 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
345 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
346 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
347 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
348 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
349 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
350 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
351 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
355 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
356 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
357 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
358 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
359 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
360 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
361 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
362 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
363 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
366 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
369 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
372 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
373 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
374 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
375 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
376 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
377 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.63
Metatranscriptomes 0.94
Isolates 7.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.67
Nodule 2.36
Rhizoplane 5.31
Rhizosphere 69.58
Stem 0
Stem Tuber 0
Unclassified 11.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000077 3300001915 Bacteria 24237
2 JGI24740J21852_10002191 3300001979 Bacteria 8934
3 JGI24740J21852_10022509 3300001979 Bacteria 2168
4 JGI24739J22299_10003301 3300001989 Bacteria 6147
5 JGI24739J22299_10003931 3300001989 Bacteria 5685
6 JGI24739J22299_10036622 3300001989 Bacteria 1656
7 JGI24737J22298_10043513 3300001990 Bacteria 1374
8 JGI24735J21928_10000214 3300002067 Bacteria 20243
9 JGI24735J21928_10001188 3300002067 Bacteria 9269
10 JGI24735J21928_10001236 3300002067 Bacteria 9074
11 JGI24735J21928_10020013 3300002067 Bacteria 2053
12 JGI24738J21930_10004301 3300002075 Bacteria 3504
13 JGI25156J39149_1000606 3300002705 Bacteria 19907
14 JGI25156J39149_1000877 3300002705 Bacteria 14944
15 JGI25156J39149_1002479 3300002705 Bacteria 6584
16 JGI25154J39366_1001139 3300002738 Bacteria 10304
17 JGI25151J46595_10000587 3300003187 Bacteria 32303
18 JGI25151J46595_10033312 3300003187 Bacteria 1986
19 JGI25165J46597_1001699 3300003214 Bacteria 9902
20 rootH1_10006911 3300003316 Bacteria 5673
21 rootH2_10063962 3300003320 Bacteria 1153
22 rootL2_10111393 3300003322 Bacteria 2464
23 JGI25160J50197_1000140 3300003354 Bacteria 65061
24 Ga0006560J51390_1031649 3300003565 Bacteria 1466
25 Ga0055538_1000478 3300003751 Bacteria 14689
26 Ga0055538_1007262 3300003751 Bacteria 1010
27 Ga0055538_1007661 3300003751 Bacteria 958
28 Ga0055539_1000038 3300003752 Bacteria 205053
29 Ga0055533_1000425 3300003756 Bacteria 16228
30 Ga0055533_1002261 3300003756 Bacteria 4486
31 Ga0055533_1007826 3300003756 Bacteria 1411
32 Ga0055532_1000002 3300003758 Bacteria 576000
33 Ga0055532_1000012 3300003758 Bacteria 382698
34 Ga0055525_1000320 3300003759 Bacteria 38132
35 Ga0055527_1000011 3300003760 Bacteria 354560
36 Ga0055527_1001572 3300003760 Bacteria 4621
37 Ga0055527_1001635 3300003760 Bacteria 4468
38 Ga0055527_1002110 3300003760 Bacteria 3550
39 Ga0055535_1000009 3300003761 Bacteria 382698
40 Ga0055535_1003337 3300003761 Bacteria 4621
41 Ga0055535_1003461 3300003761 Bacteria 4468
42 Ga0055542_1000015 3300003762 Bacteria 382698
43 Ga0055542_1003186 3300003762 Bacteria 4621
44 Ga0055542_1004987 3300003762 Bacteria 3085
45 Ga0055542_1005528 3300003762 Bacteria 2837
46 Ga0055529_1000011 3300003763 Bacteria 382698
47 Ga0055529_1000113 3300003763 Bacteria 118574
48 Ga0055529_1001414 3300003763 Bacteria 7595
49 Ga0055529_1002664 3300003763 Bacteria 3300
50 Ga0055528_1000521 3300003790 Bacteria 30018
51 Ga0055541_1000396 3300003841 Bacteria 13178
52 Ga0065165_1000952 3300005262 Bacteria 36509
53 Ga0070658_10011441 3300005327 Bacteria 7117
54 Ga0070658_10016321 3300005327 Bacteria 5943
55 Ga0070676_10255487 3300005328 Bacteria 1171
56 Ga0070660_100000008 3300005339 Bacteria 155650
57 Ga0070661_100000051 3300005344 Bacteria 89625
58 Ga0070661_100402972 3300005344 Bacteria 1082
59 Ga0070668_100150582 3300005347 Bacteria 1881
60 Ga0070671_100334466 3300005355 Bacteria 1291
61 Ga0070671_100658049 3300005355 Bacteria 907
62 Ga0070659_100000014 3300005366 Bacteria 178272
63 Ga0070667_100119691 3300005367 Bacteria 2290
64 Ga0070663_100000012 3300005455 Bacteria 144773
65 Ga0070663_100000594 3300005455 Bacteria 19241
66 Ga0070663_100043807 3300005455 Bacteria 3151
67 Ga0070663_100214195 3300005455 Bacteria 1510
68 Ga0068853_100871863 3300005539 Bacteria 864
69 Ga0068855_100023843 3300005563 Bacteria 7330
70 Ga0068855_100674665 3300005563 Bacteria 1108
71 Ga0070664_100000045 3300005564 Bacteria 74810
72 Ga0068857_100062520 3300005577 Bacteria 3309
73 Ga0068854_100000127 3300005578 Bacteria 52256
74 Ga0068854_100153720 3300005578 Bacteria 1776
75 Ga0068856_100000035 3300005614 Bacteria 124192
76 Ga0068852_100038560 3300005616 Bacteria 4017
77 Ga0068852_100080267 3300005616 Bacteria 2892
78 Ga0068858_100722235 3300005842 Bacteria 970
79 Ga0075368_10011344 3300006042 Bacteria 3241
80 Ga0075363_100029390 3300006048 Bacteria 2837
81 Ga0075362_10164475 3300006177 Bacteria 1069
82 Ga0075367_10297078 3300006178 Bacteria 1016
83 Ga0075369_10025709 3300006186 Bacteria 2450
84 Ga0075366_10072863 3300006195 Bacteria 2047
85 Ga0075370_10164128 3300006353 Bacteria 1304
86 Ga0075428_100005735 3300006844 Bacteria 13801
87 Ga0075430_100420683 3300006846 Bacteria 1103
88 Ga0075431_100460356 3300006847 Bacteria 1266
89 Ga0099826_10000016 3300006948 Bacteria 210934
90 Ga0105251_10000128 3300009011 Bacteria 75973
91 Ga0105251_10000317 3300009011 Bacteria 48358
92 Ga0105244_10197133 3300009036 Bacteria 950
93 Ga0105250_10007640 3300009092 Bacteria 4635
94 Ga0105250_10121747 3300009092 Bacteria 1073
95 Ga0105240_10005293 3300009093 Bacteria 19263
96 Ga0105240_10116230 3300009093 Bacteria 3228
97 Ga0105240_10193905 3300009093 Bacteria 2387
98 Ga0105240_10241969 3300009093 Bacteria 2091
99 Ga0105240_10334943 3300009093 Bacteria 1720
100 Ga0105240_10426502 3300009093 Bacteria 1489
101 Ga0105240_10612381 3300009093 Bacteria 1198
102 Ga0105247_10353745 3300009101 Bacteria 1034
103 Ga0105241_10054083 3300009174 Bacteria 3072
104 Ga0105241_10430046 3300009174 Bacteria 1164
105 Ga0105242_10138741 3300009176 Bacteria 2107
106 Ga0105248_10001566 3300009177 Bacteria 25445
107 Ga0105237_10004182 3300009545 Bacteria 16811
108 Ga0105237_10020630 3300009545 Bacteria 6789
109 Ga0105238_10010764 3300009551 Bacteria 9189
110 Ga0105238_10095245 3300009551 Bacteria 2964
111 Ga0105238_10161765 3300009551 Bacteria 2214
112 Ga0105147_100942 3300009982 Bacteria 2334
113 Ga0105239_10002627 3300010375 Bacteria 22716
114 Ga0105239_10087940 3300010375 Bacteria 3425
115 Ga0105239_10791683 3300010375 Bacteria 1086
116 Ga0105246_10358882 3300011119 Bacteria 1197
117 Ga0157373_10007322 3300013100 Bacteria 8220
118 Ga0157373_10082901 3300013100 Bacteria 2260
119 Ga0157371_10000122 3300013102 Bacteria 118586
120 Ga0157371_10023565 3300013102 Bacteria 4501
121 Ga0157370_10000025 3300013104 Bacteria 158865
122 Ga0157370_10001394 3300013104 Bacteria 29968
123 Ga0157370_10001629 3300013104 Bacteria 27715
124 Ga0157370_10013544 3300013104 Bacteria 8394
125 Ga0157370_10714252 3300013104 Bacteria 914
126 Ga0157369_10000496 3300013105 Bacteria 52084
127 Ga0157369_10006956 3300013105 Bacteria 13048
128 Ga0157369_10009945 3300013105 Bacteria 10866
129 Ga0157369_10023222 3300013105 Bacteria 6910
130 Ga0157369_10062813 3300013105 Bacteria 4001
131 Ga0157369_10077781 3300013105 Bacteria 3556
132 Ga0157369_10992493 3300013105 Bacteria 860
133 Ga0157369_10992494 3300013105 Bacteria 860
134 Ga0157374_10000039 3300013296 Bacteria 164906
135 Ga0163162_10013214 3300013306 Bacteria 8064
136 Ga0163162_10817546 3300013306 Bacteria 1048
137 Ga0157372_10006313 3300013307 Bacteria 12607
138 Ga0157372_10008949 3300013307 Bacteria 10639
139 Ga0157372_10156360 3300013307 Bacteria 2634
140 Ga0157375_10083096 3300013308 Bacteria 3246
141 Ga0182008_10042765 3300014497 Bacteria 2257
142 Ga0182006_1000567 3300015261 Bacteria 27489
143 Ga0182006_1033972 3300015261 Bacteria 2043
144 Ga0182006_1083679 3300015261 Bacteria 1160
145 Ga0182006_1090477 3300015261 Bacteria 1102
146 Ga0182007_10000485 3300015262 Bacteria 23896
147 Ga0182007_10038563 3300015262 Bacteria 1601
148 Ga0183361_10009 3300016635 Bacteria 205218
149 Ga0206356_10619711 3300020070 Bacteria 5773
150 Ga0206351_10697103 3300020077 Bacteria 8736
151 Ga0206350_11308312 3300020080 Bacteria 3245
152 Ga0154015_1248418 3300020610 Bacteria 36809
153 Ga0224712_10000050 3300022467 Bacteria 18507
154 Ga0209435_100889 3300025206 Bacteria 4569
155 Ga0209784_100003 3300025224 Bacteria 1379451
156 Ga0209784_102261 3300025224 Bacteria 2027
157 Ga0209566_100002 3300025225 Bacteria 2614868
158 Ga0209566_100200 3300025225 Bacteria 61991
159 Ga0209566_101550 3300025225 Bacteria 6230
160 Ga0209674_100008 3300025226 Bacteria 1076909
161 Ga0209674_100013 3300025226 Bacteria 813140
162 Ga0209674_100188 3300025226 Bacteria 67031
163 Ga0209674_100199 3300025226 Bacteria 62593
164 Ga0209674_100237 3300025226 Bacteria 47803
165 Ga0209672_100010 3300025228 Bacteria 873151
166 Ga0209672_100051 3300025228 Bacteria 234414
167 Ga0209672_100083 3300025228 Bacteria 135473
168 Ga0209672_100202 3300025228 Bacteria 47228
169 Ga0209672_100298 3300025228 Bacteria 34360
170 Ga0209147_100002 3300025229 Bacteria 2158988
171 Ga0209147_100006 3300025229 Bacteria 873276
172 Ga0209147_100120 3300025229 Bacteria 142306
173 Ga0209147_100237 3300025229 Bacteria 54193
174 Ga0209147_100244 3300025229 Bacteria 53002
175 Ga0209563_100004 3300025230 Bacteria 1814108
176 Ga0209563_100026 3300025230 Bacteria 559453
177 Ga0209563_102249 3300025230 Bacteria 4460
178 Ga0209563_102800 3300025230 Bacteria 3814
179 Ga0209563_104242 3300025230 Bacteria 2775
180 Ga0207427_101961 3300025231 Bacteria 6299
181 Ga0209258_100002 3300025242 Bacteria 2158988
182 Ga0209258_100010 3300025242 Bacteria 873276
183 Ga0209258_100351 3300025242 Bacteria 65874
184 Ga0209258_100405 3300025242 Bacteria 53002
185 Ga0209646_1000058 3300025246 Bacteria 259999
186 Ga0209026_1011709 3300025250 Bacteria 1561
187 Ga0209677_100013 3300025253 Bacteria 548200
188 Ga0209677_110452 3300025253 Bacteria 1541
189 Ga0209148_1000018 3300025254 Bacteria 756247
190 Ga0209148_1000027 3300025254 Bacteria 616374
191 Ga0209148_1000043 3300025254 Bacteria 461531
192 Ga0209148_1004949 3300025254 Bacteria 3146
193 Ga0209759_1000251 3300025256 Bacteria 79885
194 Ga0209759_1000261 3300025256 Bacteria 76336
195 Ga0209759_1002520 3300025256 Bacteria 7969
196 Ga0209759_1003150 3300025256 Bacteria 6729
197 Ga0209759_1003642 3300025256 Bacteria 6065
198 Ga0209759_1027372 3300025256 Bacteria 1178
199 Ga0209233_1000093 3300025261 Bacteria 306016
200 Ga0209455_1000015 3300025272 Bacteria 756128
201 Ga0209455_1000021 3300025272 Bacteria 699993
202 Ga0209455_1000247 3300025272 Bacteria 66221
203 Ga0209455_1004841 3300025272 Bacteria 4298
204 Ga0209673_1000070 3300025273 Bacteria 241592
205 Ga0209130_1020712 3300025284 Bacteria 1499
206 Ga0209025_1000504 3300025294 Bacteria 75030
207 Ga0209025_1045818 3300025294 Bacteria 1807
208 Ga0209564_1004518 3300025295 Bacteria 8465
209 Ga0207426_1000326 3300025302 Bacteria 91021
210 Ga0207426_1008314 3300025302 Bacteria 4212
211 Ga0207696_1022696 3300025711 Bacteria 1989
212 Ga0207713_1000135 3300025735 Bacteria 112173
213 Ga0207713_1003069 3300025735 Bacteria 11609
214 Ga0207680_10031563 3300025903 Bacteria 3002
215 Ga0207647_10000335 3300025904 Bacteria 38391
216 Ga0207647_10001635 3300025904 Bacteria 17224
217 Ga0207647_10003889 3300025904 Bacteria 11154
218 Ga0207647_10006078 3300025904 Bacteria 8797
219 Ga0207647_10013424 3300025904 Bacteria 5677
220 Ga0207695_10003990 3300025913 Bacteria 20362
221 Ga0207695_10023118 3300025913 Bacteria 7035
222 Ga0207695_10283342 3300025913 Bacteria 1551
223 Ga0207695_10433322 3300025913 Bacteria 1198
224 Ga0207671_10025975 3300025914 Bacteria 4393
225 Ga0207671_10109446 3300025914 Bacteria 2101
226 Ga0207671_10515084 3300025914 Bacteria 954
227 Ga0207657_10000018 3300025919 Bacteria 172140
228 Ga0207649_10000252 3300025920 Bacteria 43144
229 Ga0207694_10032418 3300025924 Bacteria 3999
230 Ga0207694_10162066 3300025924 Bacteria 1807
231 Ga0207644_10508790 3300025931 Bacteria 994
232 Ga0207644_10871195 3300025931 Bacteria 754
233 Ga0207690_10000006 3300025932 Bacteria 433880
234 Ga0207711_10023040 3300025941 Bacteria 5213
235 Ga0207711_10089564 3300025941 Bacteria 2703
236 Ga0207679_10000001 3300025945 Bacteria 777444
237 Ga0207679_10678554 3300025945 Bacteria 934
238 Ga0207667_10000920 3300025949 Bacteria 37531
239 Ga0207667_10032194 3300025949 Bacteria 5653
240 Ga0207667_10138735 3300025949 Bacteria 2503
241 Ga0207667_11335328 3300025949 Bacteria 692
242 Ga0207668_10357813 3300025972 Bacteria 1222
243 Ga0207640_10000119 3300025981 Bacteria 59745
244 Ga0207658_10315606 3300025986 Bacteria 1351
245 Ga0207703_10116919 3300026035 Bacteria 2284
246 Ga0207639_10803347 3300026041 Bacteria 877
247 Ga0207678_10000004 3300026067 Bacteria 196743
248 Ga0207678_10002092 3300026067 Bacteria 18081
249 Ga0207678_10055809 3300026067 Bacteria 3402
250 Ga0207678_10075959 3300026067 Bacteria 2877
251 Ga0207678_10081052 3300026067 Bacteria 2778
252 Ga0207702_10000029 3300026078 Bacteria 181652
253 Ga0207674_10282044 3300026116 Bacteria 1609
254 Ga0207698_10041928 3300026142 Bacteria 3415
255 Ga0207698_10066979 3300026142 Bacteria 2830
256 Ga0209371_1000181 3300027312 Bacteria 93199
257 Ga0209371_1007364 3300027312 Bacteria 3848
258 Ga0209813_10015470 3300027866 Bacteria 2068
259 Ga0265338_10000173 3300028800 Bacteria 119505
260 Ga0265338_10000346 3300028800 Bacteria 84499
261 Ga0268256_1000151 3300030500 Bacteria 93199
262 Ga0268256_1027975 3300030500 Bacteria 1397
263 Ga0265332_10103214 3300031238 Bacteria 1202
264 Ga0307408_100006267 3300031548 Bacteria 7896
265 Ga0307412_10000016 3300031911 Bacteria 312878
266 Ga0307412_10009877 3300031911 Bacteria 5486
267 Ga0307409_100097960 3300031995 Bacteria 2424
268 Ga0307416_100035015 3300032002 Bacteria 3829
269 Ga0307411_10181136 3300032005 Bacteria 1599
270 Ga0395899_0000324 3300037312 Bacteria 60511
271 Ga0395899_0190040 3300037312 Bacteria 1437
272 Ga0395900_0000430 3300037418 Bacteria 60385
273 Ga0395900_0000813 3300037418 Bacteria 41294
274 Ga0395900_0002540 3300037418 Bacteria 19975
275 Ga0395900_0024846 3300037418 Bacteria 6132
276 Ga0395900_0178391 3300037418 Bacteria 2160
277 Ga0395900_0460178 3300037418 Bacteria 1227
278 Ga0395898_0000072 3300037466 Bacteria 249505
279 Ga0395898_0002375 3300037466 Bacteria 22364
280 Ga0395898_0569126 3300037466 Bacteria 1075
281 Ga0395905_0000059 3300037471 Bacteria 198101
282 Ga0395905_0049339 3300037471 Bacteria 3944
283 Ga0395901_0000003 3300038443 Bacteria 701538
284 Ga0395901_0000415 3300038443 Bacteria 50246
285 Ga0395901_0000432 3300038443 Bacteria 49091
286 Ga0395901_0046019 3300038443 Bacteria 4530
287 Ga0395901_0117723 3300038443 Bacteria 2791
288 Ga0395901_0593447 3300038443 Bacteria 1118
289 Ga0436361_0260074 3300039447 Bacteria 972
290 Ga0436361_0539295 3300039447 Bacteria 3814
291 Ga0436362_1154311 3300039453 Bacteria 1092
292 Ga0439436_0015620 3300041404 Bacteria 2282
293 Ga0451793_0789053 3300041452 Bacteria 954
294 Ga0451849_0987617 3300041505 Bacteria 1405
295 Ga0439448_0002221 3300042005 Bacteria 5246
296 Ga0439435_0135598 3300042436 Bacteria 781
297 Ga0466986_0130492 3300044650 Bacteria 1713
298 Ga0466986_0226976 3300044650 Bacteria 1209
299 Ga0466969_0009479 3300044656 Bacteria 5162
300 Ga0466969_0083913 3300044656 Bacteria 1516
301 Ga0466969_0127075 3300044656 Bacteria 1184
302 Ga0466972_0017322 3300044658 Bacteria 3606
303 Ga0466972_0021216 3300044658 Bacteria 3241
304 Ga0466972_0041084 3300044658 Bacteria 2252
305 Ga0466972_0146269 3300044658 Bacteria 1112
306 Ga0466973_0010102 3300044659 Bacteria 8701
307 Ga0466982_0155021 3300044672 Bacteria 1399
308 Ga0453683_0116493 3300044673 Bacteria 1681
309 Ga0466965_0035176 3300044683 Bacteria 2453
310 Ga0466965_0051669 3300044683 Bacteria 2039
311 Ga0466965_0145629 3300044683 Bacteria 1236
312 Ga0466966_0000008 3300044684 Bacteria 155597
313 Ga0466966_0001215 3300044684 Bacteria 16541
314 Ga0466966_0006621 3300044684 Bacteria 7669
315 Ga0466966_0033415 3300044684 Bacteria 3331
316 Ga0466966_0070385 3300044684 Bacteria 2193
317 Ga0466966_0161245 3300044684 Bacteria 1365
318 Ga0466966_0183980 3300044684 Bacteria 1267
319 Ga0466966_0313707 3300044684 Bacteria 942
320 Ga0466961_0000028 3300044693 Bacteria 86793
321 Ga0466961_0000333 3300044693 Bacteria 30975
322 Ga0466961_0066046 3300044693 Bacteria 2298
323 Ga0466961_0090476 3300044693 Bacteria 1932
324 Ga0466961_0128366 3300044693 Bacteria 1589
325 Ga0466961_0188637 3300044693 Bacteria 1278
326 Ga0466963_0069590 3300044694 Bacteria 2365
327 Ga0466963_0243541 3300044694 Bacteria 1261
328 Ga0466963_0361584 3300044694 Bacteria 1022
329 Ga0466964_0001177 3300044706 Bacteria 8836
330 Ga0466964_0032188 3300044706 Bacteria 2083
331 Ga0466964_0056448 3300044706 Bacteria 1623
332 Ga0466971_0025267 3300044719 Bacteria 2652
333 Ga0466971_0083054 3300044719 Bacteria 1462
334 Ga0466971_0085858 3300044719 Bacteria 1438
335 Ga0466971_0195293 3300044719 Bacteria 954
336 Ga0466968_0028517 3300044735 Bacteria 2302
337 Ga0466970_0000663 3300044765 Bacteria 16899
338 Ga0466970_0033488 3300044765 Bacteria 2716
339 Ga0466970_0034974 3300044765 Bacteria 2661
340 Ga0466957_0059160 3300044842 Bacteria 2348
341 Ga0466957_0068940 3300044842 Bacteria 2184
342 Ga0466957_0097879 3300044842 Bacteria 1845
343 Ga0466957_0141858 3300044842 Bacteria 1548
344 Ga0466957_0222065 3300044842 Bacteria 1248
345 Ga0466957_0253637 3300044842 Bacteria 1170
346 Ga0466957_0449712 3300044842 Bacteria 888
347 Ga0466960_0114616 3300044901 Bacteria 1404
348 Ga0466960_0185031 3300044901 Bacteria 1131
349 Ga0466959_0001381 3300045049 Bacteria 14827
350 Ga0466959_0088074 3300045049 Bacteria 2232
351 Ga0466959_0113338 3300045049 Bacteria 1933
352 Ga0466959_0182094 3300045049 Bacteria 1469
353 Ga0466958_0002250 3300045836 Bacteria 9612
354 Ga0466958_0007472 3300045836 Bacteria 6014
355 Ga0466958_0074660 3300045836 Bacteria 2078
356 Ga0466958_0084481 3300045836 Bacteria 1958
357 Ga0466958_0198904 3300045836 Bacteria 1275
358 Ga0466958_0261659 3300045836 Bacteria 1107
359 Ga0466958_0459690 3300045836 Bacteria 824
360 Ga0466967_0010109 3300045976 Bacteria 7053
361 Ga0466967_0034766 3300045976 Bacteria 4282
362 Ga0466967_0409109 3300045976 Bacteria 1321
363 Ga0495592_0007994 3300046454 Bacteria 7935
364 Ga0495592_0086802 3300046454 Bacteria 2252
365 Ga0495603_0000640 3300046455 Bacteria 19703
366 Ga0495603_0002349 3300046455 Bacteria 11107
367 Ga0495603_0002700 3300046455 Bacteria 10464
368 Ga0495590_0001269 3300046457 Bacteria 10978
369 Ga0495590_0003356 3300046457 Bacteria 6548
370 Ga0495590_0028898 3300046457 Bacteria 1944
371 Ga0495591_003008 3300046458 Bacteria 8972
372 Ga0495629_0000703 3300046459 Bacteria 27102
373 Ga0495629_0001980 3300046459 Bacteria 15968
374 Ga0495629_0003466 3300046459 Bacteria 11928
375 Ga0495629_0004573 3300046459 Bacteria 10352
376 Ga0495629_0021661 3300046459 Bacteria 4586
377 Ga0495629_0030253 3300046459 Bacteria 3840
378 Ga0495629_0087508 3300046459 Bacteria 2174
379 Ga0495638_0007235 3300046460 Bacteria 7981
380 Ga0495638_0025053 3300046460 Bacteria 3882
381 Ga0495641_0051713 3300046461 Bacteria 1874
382 Ga0495651_0421509 3300046462 Bacteria 867
383 Ga0495653_0002719 3300046463 Bacteria 14086
384 Ga0495653_0018625 3300046463 Bacteria 5636
385 Ga0495653_0045422 3300046463 Bacteria 3405
386 Ga0495653_0079438 3300046463 Bacteria 2429
387 Ga0495653_0147647 3300046463 Bacteria 1646
388 Ga0495650_0003069 3300046471 Bacteria 12553
389 Ga0495650_0004407 3300046471 Bacteria 9674
390 Ga0495650_0013555 3300046471 Bacteria 4302
391 Ga0495650_0013967 3300046471 Bacteria 4213
392 Ga0495580_0000113 3300046472 Bacteria 55036
393 Ga0495580_0003286 3300046472 Bacteria 13819
394 Ga0495580_0004870 3300046472 Bacteria 11227
395 Ga0495580_0005056 3300046472 Bacteria 10993
396 Ga0495580_0006067 3300046472 Bacteria 9891
397 Ga0495580_0007782 3300046472 Bacteria 8586
398 Ga0495580_0016400 3300046472 Bacteria 5558
399 Ga0495580_0056883 3300046472 Bacteria 2753
400 Ga0495580_0060211 3300046472 Bacteria 2668
401 Ga0495582_0002231 3300046473 Bacteria 10851
402 Ga0495582_0009614 3300046473 Bacteria 5325
403 Ga0495582_0045673 3300046473 Bacteria 2412
404 Ga0495582_0073253 3300046473 Bacteria 1896
405 Ga0495605_0002865 3300046474 Bacteria 10481
406 Ga0495605_0009738 3300046474 Bacteria 5399
407 Ga0495605_0251811 3300046474 Bacteria 755
408 Ga0495662_0078790 3300046476 Bacteria 1601
409 Ga0495662_0115623 3300046476 Bacteria 1315
410 Ga0495662_0156474 3300046476 Bacteria 1122
411 Ga0495664_0000227 3300046477 Bacteria 26841
412 Ga0495664_0007232 3300046477 Bacteria 6157
413 Ga0495664_0008101 3300046477 Bacteria 5853
414 Ga0495664_0320594 3300046477 Bacteria 934
415 Ga0495584_0120939 3300046491 Bacteria 1326
416 Ga0495585_0069244 3300046492 Bacteria 1926
417 Ga0495594_0092350 3300046499 Bacteria 1697
418 Ga0495596_0002909 3300046500 Bacteria 8909
419 Ga0495596_0040430 3300046500 Bacteria 1841
420 Ga0495607_0000329 3300046501 Bacteria 49139
421 Ga0495607_0265533 3300046501 Bacteria 820
422 Ga0495583_0002659 3300046506 Bacteria 14880
423 Ga0495583_0003678 3300046506 Bacteria 11422
424 Ga0495583_0121861 3300046506 Bacteria 1097
425 Ga0495606_0010165 3300046507 Bacteria 7850
426 Ga0495606_0011009 3300046507 Bacteria 7428
427 Ga0495606_0014220 3300046507 Bacteria 6227
428 Ga0495606_0033064 3300046507 Bacteria 3573
429 Ga0495606_0101924 3300046507 Bacteria 1746
430 Ga0495606_0190929 3300046507 Bacteria 1174
431 Ga0495606_0362728 3300046507 Bacteria 765
432 Ga0495606_0387203 3300046507 Bacteria 732
433 Ga0495608_0005576 3300046511 Bacteria 8991
434 Ga0495608_0006513 3300046511 Bacteria 8280
435 Ga0495610_0012526 3300046512 Bacteria 5097
436 Ga0495616_0007997 3300046513 Bacteria 6300
437 Ga0495618_0001295 3300046514 Bacteria 16869
438 Ga0495618_0005466 3300046514 Bacteria 7739
439 Ga0495618_0016164 3300046514 Bacteria 4561
440 Ga0495618_0252322 3300046514 Bacteria 1106
441 Ga0495620_0005370 3300046515 Bacteria 7160
442 Ga0495628_0001823 3300046516 Bacteria 19336
443 Ga0495628_0008473 3300046516 Bacteria 8816
444 Ga0495628_0022031 3300046516 Bacteria 5237
445 Ga0495628_0029990 3300046516 Bacteria 4405
446 Ga0495628_0037075 3300046516 Bacteria 3909
447 Ga0495628_0053141 3300046516 Bacteria 3198
448 Ga0495628_0199103 3300046516 Bacteria 1510
449 Ga0495630_0006483 3300046517 Bacteria 8330
450 Ga0495630_0017668 3300046517 Bacteria 5228
451 Ga0495630_0048420 3300046517 Bacteria 3180
452 Ga0495630_0107760 3300046517 Bacteria 2110
453 Ga0495630_0180384 3300046517 Bacteria 1610
454 Ga0495643_0005747 3300046522 Bacteria 8302
455 Ga0495643_0095481 3300046522 Bacteria 1529
456 Ga0495648_0004394 3300046524 Bacteria 12056
457 Ga0495648_0183000 3300046524 Bacteria 1063
458 Ga0495648_0262257 3300046524 Bacteria 828
459 Ga0495648_0351021 3300046524 Bacteria 673
460 Ga0495666_0002186 3300046526 Bacteria 9739
461 Ga0495666_0011191 3300046526 Bacteria 4477
462 Ga0495666_0048521 3300046526 Bacteria 2045
463 Ga0495666_0078709 3300046526 Bacteria 1561
464 Ga0495666_0085757 3300046526 Bacteria 1487
465 Ga0495642_0027173 3300046528 Bacteria 2276
466 Ga0495642_0033729 3300046528 Bacteria 2059
467 Ga0495642_0082814 3300046528 Bacteria 1353
468 Ga0495652_0002048 3300046529 Bacteria 21360
469 Ga0495652_0016759 3300046529 Bacteria 6549
470 Ga0495652_0050315 3300046529 Bacteria 3562
471 Ga0495652_0501538 3300046529 Bacteria 841
472 Ga0495665_0001052 3300046531 Bacteria 14651
473 Ga0495665_0002464 3300046531 Bacteria 9999
474 Ga0495665_0006263 3300046531 Bacteria 6419
475 Ga0495665_0013800 3300046531 Bacteria 4363
476 Ga0495665_0030811 3300046531 Bacteria 2870
477 Ga0495665_0075139 3300046531 Bacteria 1779
478 Ga0495640_0005874 3300046533 Bacteria 9737
479 Ga0495640_0018210 3300046533 Bacteria 5216
480 Ga0495640_0131840 3300046533 Bacteria 1617
481 Ga0495586_0000326 3300046535 Bacteria 30088
482 Ga0495586_0022555 3300046535 Bacteria 3360
483 Ga0495586_0109977 3300046535 Bacteria 1533
484 Ga0495586_0151858 3300046535 Bacteria 1303
485 Ga0495587_0004978 3300046536 Bacteria 8699
486 Ga0495587_0005348 3300046536 Bacteria 8396
487 Ga0495597_0016769 3300046542 Bacteria 3456
488 Ga0495597_0028514 3300046542 Bacteria 2555
489 Ga0495597_0045089 3300046542 Bacteria 1958
490 Ga0495597_0067005 3300046542 Bacteria 1554
491 Ga0495645_0001415 3300046543 Bacteria 16156
492 Ga0495645_0001575 3300046543 Bacteria 15467
493 Ga0495645_0031032 3300046543 Bacteria 3892
494 Ga0495622_0000039 3300046557 Bacteria 119003
495 Ga0495622_0003219 3300046557 Bacteria 7737
496 Ga0495667_0202633 3300046559 Bacteria 1270
497 Ga0495656_0359194 3300046615 Bacteria 756
498 Ga0495634_0002058 3300046642 Bacteria 17023
499 Ga0495634_0011548 3300046642 Bacteria 6427
500 Ga0495611_0067539 3300046648 Bacteria 1631
501 Ga0495611_0249442 3300046648 Bacteria 823
502 Ga0495625_0539305 3300046660 Bacteria 708
503 Ga0495635_0007124 3300046663 Bacteria 7818
504 Ga0495635_0007337 3300046663 Bacteria 7695
505 Ga0495635_0040306 3300046663 Bacteria 3227
506 Ga0495635_0149385 3300046663 Bacteria 1590
507 Ga0495661_0001394 3300046665 Bacteria 20278
508 Ga0495661_0003998 3300046665 Bacteria 10751
509 Ga0495661_0088194 3300046665 Bacteria 1771
510 Ga0495657_0025556 3300046675 Bacteria 4192
511 Ga0495599_0096775 3300046678 Bacteria 1840
512 Ga0495599_0096981 3300046678 Bacteria 1838
513 Ga0495599_0133636 3300046678 Bacteria 1540
514 Ga0495623_0001079 3300046679 Bacteria 18453
515 Ga0495623_0006469 3300046679 Bacteria 7625
516 Ga0495623_0014837 3300046679 Bacteria 5038
517 Ga0495623_0027720 3300046679 Bacteria 3646
518 Ga0495623_0045999 3300046679 Bacteria 2770
519 Ga0495646_0000155 3300046680 Bacteria 34843
520 Ga0495646_0012470 3300046680 Bacteria 5405
521 Ga0495646_0013646 3300046680 Bacteria 5165
522 Ga0495646_0024648 3300046680 Bacteria 3787
523 Ga0495646_0025570 3300046680 Bacteria 3713
524 Ga0495646_0111933 3300046680 Bacteria 1553
525 Ga0495646_0199776 3300046680 Bacteria 1089
526 Ga0495669_0047580 3300046684 Bacteria 1916
527 Ga0495669_0172346 3300046684 Bacteria 1030
528 Ga0495669_0255589 3300046684 Bacteria 841
529 Ga0495613_0001007 3300046689 Bacteria 21445
530 Ga0495613_0003373 3300046689 Bacteria 11936
531 Ga0495613_0081112 3300046689 Bacteria 2357
532 Ga0495613_0136456 3300046689 Bacteria 1755
533 Ga0495624_0000620 3300046690 Bacteria 27718
534 Ga0495624_0007322 3300046690 Bacteria 7748
535 Ga0495624_0008336 3300046690 Bacteria 7240
536 Ga0495624_0126289 3300046690 Bacteria 1569
537 Ga0495624_0157002 3300046690 Bacteria 1390
538 Ga0495624_0182741 3300046690 Bacteria 1277
539 Ga0495624_0384904 3300046690 Bacteria 842
540 Ga0495670_0042905 3300046691 Bacteria 2257
541 Ga0495671_0027324 3300046692 Bacteria 2948
542 Ga0495671_0082017 3300046692 Bacteria 1580
543 Ga0495671_0138357 3300046692 Bacteria 1187
544 Ga0495671_0183391 3300046692 Bacteria 1016
545 Ga0495649_0011930 3300046694 Bacteria 5078
546 Ga0495649_0012033 3300046694 Bacteria 5051
547 Ga0495649_0029333 3300046694 Bacteria 3044
548 Ga0495649_0079258 3300046694 Bacteria 1757
549 Ga0495649_0092850 3300046694 Bacteria 1607
550 Ga0495649_0140296 3300046694 Bacteria 1272
551 Ga0495649_0250098 3300046694 Bacteria 911
552 Ga0495589_0016179 3300046794 Bacteria 3833
553 Ga0495589_0071950 3300046794 Bacteria 1689
554 Ga0495589_0113756 3300046794 Bacteria 1305
555 Ga0495600_0005649 3300046809 Bacteria 7557
556 Ga0495600_0103766 3300046809 Bacteria 1853
557 Ga0495600_0166342 3300046809 Bacteria 1424
558 Ga0495660_0111347 3300046810 Bacteria 1396
559 Ga0495581_0001216 3300047315 Bacteria 14188
560 Ga0495581_0010651 3300047315 Bacteria 5316
561 Ga0495581_0021619 3300047315 Bacteria 3727
562 Ga0495604_0001412 3300047317 Bacteria 19688
563 Ga0495604_0005483 3300047317 Bacteria 10059
564 Ga0495604_0008594 3300047317 Bacteria 8068
565 Ga0495604_0075942 3300047317 Bacteria 2528
566 Ga0495604_0106118 3300047317 Bacteria 2055
567 Ga0495604_0129650 3300047317 Bacteria 1814
568 Ga0495604_0395761 3300047317 Bacteria 910
569 Ga0495636_0092780 3300047318 Bacteria 1312
570 Ga0495674_0006005 3300047319 Bacteria 11659
571 Ga0495674_0012219 3300047319 Bacteria 8091
572 Ga0495674_0018817 3300047319 Bacteria 6424
573 Ga0495674_0033988 3300047319 Bacteria 4613
574 Ga0495674_0059693 3300047319 Bacteria 3330
575 Ga0495674_0063280 3300047319 Bacteria 3218
576 Ga0495674_0272809 3300047319 Bacteria 1387
577 Ga0495674_0318450 3300047319 Bacteria 1267
578 Ga0495672_0004259 3300047320 Bacteria 11809
579 Ga0495672_0060950 3300047320 Bacteria 2176
580 Ga0495672_0138486 3300047320 Bacteria 1273
581 Ga0495676_0001508 3300047321 Bacteria 20148
582 Ga0495676_0063384 3300047321 Bacteria 2881
583 Ga0495676_0070196 3300047321 Bacteria 2699
584 Ga0495676_0127677 3300047321 Bacteria 1840
585 Ga0495676_0503208 3300047321 Bacteria 795
586 Ga0495676_0542856 3300047321 Bacteria 760
587 Ga0495680_0002596 3300047322 Bacteria 18380
588 Ga0495680_0021794 3300047322 Bacteria 5355
589 Ga0495680_0042257 3300047322 Bacteria 3619
590 Ga0495683_0004163 3300047323 Bacteria 8281
591 Ga0495683_0007420 3300047323 Bacteria 5934
592 Ga0495683_0008065 3300047323 Bacteria 5652
593 Ga0495683_0016687 3300047323 Bacteria 3810
594 Ga0495683_0065545 3300047323 Bacteria 1791
595 Ga0495683_0069715 3300047323 Bacteria 1727
596 Ga0495683_0072431 3300047323 Bacteria 1690
597 Ga0495683_0252860 3300047323 Bacteria 773
598 Ga0495687_000131 3300047443 Bacteria 114820
599 Ga0495687_006746 3300047443 Bacteria 6947
600 Ga0495687_030617 3300047443 Bacteria 2476
601 Ga0495687_042898 3300047443 Bacteria 1973
602 Ga0495687_098112 3300047443 Bacteria 1106
603 Ga0495687_105674 3300047443 Bacteria 1046
604 Ga0495675_0013165 3300047444 Bacteria 5219
605 Ga0495675_0054171 3300047444 Bacteria 2546
606 Ga0495675_0132991 3300047444 Bacteria 1545
607 Ga0495675_0141917 3300047444 Bacteria 1488
608 Ga0495679_000037 3300047446 Bacteria 158099
609 Ga0495679_000454 3300047446 Bacteria 30216
610 Ga0495679_013496 3300047446 Bacteria 3064
611 Ga0495679_072484 3300047446 Bacteria 990
612 Ga0495673_0008666 3300047469 Bacteria 5689
613 Ga0495673_0051163 3300047469 Bacteria 1810
614 Ga0495681_0115402 3300047470 Bacteria 1158
615 Ga0495681_0116659 3300047470 Bacteria 1150
616 Ga0495684_0016894 3300047471 Bacteria 5622
617 Ga0495684_0102550 3300047471 Bacteria 2163
618 Ga0495686_0000002 3300047472 Bacteria 1050777
619 Ga0495686_0075694 3300047472 Bacteria 2063
620 Ga0495593_0000287 3300047673 Bacteria 27425
621 Ga0495593_0003687 3300047673 Bacteria 9146
622 Ga0495593_0006363 3300047673 Bacteria 6925
623 Ga0495593_0006758 3300047673 Bacteria 6713
624 Ga0495593_0015750 3300047673 Bacteria 4274
625 Ga0495593_0056679 3300047673 Bacteria 2059
626 Ga0495602_0001875 3300048088 Bacteria 21030
627 Ga0495602_0013819 3300048088 Bacteria 8230
628 Ga0495602_0038201 3300048088 Bacteria 4443
629 Ga0495602_0119069 3300048088 Bacteria 2128
630 Ga0495602_0127352 3300048088 Bacteria 2037
631 Ga0495602_0205667 3300048088 Bacteria 1498
632 Ga0495614_0029822 3300048089 Bacteria 2347
633 Ga0495626_0031109 3300048091 Bacteria 2570
634 Ga0495626_0033737 3300048091 Bacteria 2451
635 Ga0495626_0051799 3300048091 Bacteria 1893
636 Ga0495626_0142706 3300048091 Bacteria 1015
637 Ga0496100_0012964 3300048903 Bacteria 4795
638 Ga0496100_0040842 3300048903 Bacteria 2954
639 Ga0496100_0059266 3300048903 Bacteria 2515
640 Ga0496100_0461752 3300048903 Bacteria 974
641 Ga0496100_0547842 3300048903 Bacteria 895
642 Ga0496101_0001117 3300048904 Bacteria 15982
643 Ga0496101_0020925 3300048904 Bacteria 4488
644 Ga0496101_0023151 3300048904 Bacteria 4287
645 Ga0496101_0145326 3300048904 Bacteria 1810
646 Ga0496102_0001133 3300048905 Bacteria 24404
647 Ga0496102_0003455 3300048905 Bacteria 13392
648 Ga0496102_0032234 3300048905 Bacteria 4708
649 Ga0496102_0225888 3300048905 Bacteria 1765
650 Ga0496102_0330758 3300048905 Bacteria 1435
651 Ga0496103_0000681 3300048906 Bacteria 25410
652 Ga0496103_0001656 3300048906 Bacteria 14589
653 Ga0496103_0009166 3300048906 Bacteria 5860
654 Ga0496103_0277787 3300048906 Bacteria 1077
655 Ga0496104_0046962 3300048907 Bacteria 4069
656 Ga0496104_0138693 3300048907 Bacteria 2337
657 Ga0496104_0150415 3300048907 Bacteria 2235
658 Ga0496104_0250304 3300048907 Bacteria 1684
659 Ga0496104_0307593 3300048907 Bacteria 1498
660 Ga0496105_0012438 3300048908 Bacteria 6738
661 Ga0496105_0070070 3300048908 Bacteria 2898
662 Ga0496105_0097817 3300048908 Bacteria 2424
663 Ga0496105_0277076 3300048908 Bacteria 1353
664 Ga0496105_0306142 3300048908 Bacteria 1276
665 Ga0496105_0812286 3300048908 Bacteria 710
666 Ga0496106_0000352 3300048909 Bacteria 32632
667 Ga0496106_0062508 3300048909 Bacteria 2827
668 Ga0496106_0112030 3300048909 Bacteria 2125
669 Ga0496107_0176788 3300048910 Bacteria 1585
670 Ga0496107_0205259 3300048910 Bacteria 1465
671 Ga0496109_0039119 3300048912 Bacteria 4292
672 Ga0496111_0083690 3300048914 Bacteria 2331
673 Ga0496112_0044271 3300048915 Bacteria 4361
674 Ga0496113_0024725 3300048916 Bacteria 4274
675 Ga0496113_0061511 3300048916 Bacteria 2833
676 Ga0496113_0585851 3300048916 Bacteria 893
677 Ga0496114_0000251 3300048917 Bacteria 38822
678 Ga0496115_0231109 3300048918 Bacteria 1525
679 Ga0496115_0598644 3300048918 Bacteria 877
680 Ga0496116_0003169 3300048919 Bacteria 16478
681 Ga0496116_0032563 3300048919 Bacteria 3713
682 Ga0496116_0043245 3300048919 Bacteria 3071
683 Ga0496117_0002039 3300048920 Bacteria 26745
684 Ga0496117_0003850 3300048920 Bacteria 17076
685 Ga0496117_0004840 3300048920 Bacteria 14551
686 Ga0496117_0012414 3300048920 Bacteria 7511
687 Ga0496117_0033221 3300048920 Bacteria 3904
688 Ga0496117_0071399 3300048920 Bacteria 2326
689 Ga0496117_0129744 3300048920 Bacteria 1530
690 Ga0496117_0153008 3300048920 Bacteria 1362
691 Ga0496118_0001852 3300048921 Bacteria 30306
692 Ga0496118_0004425 3300048921 Bacteria 16675
693 Ga0496118_0005290 3300048921 Bacteria 14729
694 Ga0496118_0017045 3300048921 Bacteria 6633
695 Ga0496118_0032131 3300048921 Bacteria 4333
696 Ga0496118_0078040 3300048921 Bacteria 2345
697 Ga0496118_0107205 3300048921 Bacteria 1866
698 Ga0496118_0128514 3300048921 Bacteria 1633
699 Ga0496118_0162368 3300048921 Bacteria 1379
700 Ga0496119_0219759 3300048922 Bacteria 973
701 Ga0496121_0000777 3300048924 Bacteria 58484
702 Ga0496121_0001964 3300048924 Bacteria 32753
703 Ga0496121_0003879 3300048924 Bacteria 20788
704 Ga0496121_0015159 3300048924 Bacteria 8106
705 Ga0496121_0023640 3300048924 Bacteria 5909
706 Ga0496121_0064896 3300048924 Bacteria 2974
707 Ga0496121_0231989 3300048924 Bacteria 1292
708 Ga0496121_0235738 3300048924 Bacteria 1279
709 Ga0496122_0005672 3300048925 Bacteria 14730
710 Ga0496122_0121198 3300048925 Bacteria 1686
711 Ga0496122_0258596 3300048925 Bacteria 968
712 Ga0496123_0006619 3300048926 Bacteria 11187
713 Ga0496123_0068677 3300048926 Bacteria 2230
714 Ga0496124_0022049 3300048927 Bacteria 5849
715 Ga0496124_0256413 3300048927 Bacteria 1290
716 Ga0496125_0067667 3300048928 Bacteria 2813
717 Ga0496125_0106491 3300048928 Bacteria 2046
718 Ga0496125_0176319 3300048928 Bacteria 1430
719 Ga0496125_0267817 3300048928 Bacteria 1067
720 Ga0496126_0000225 3300048929 Bacteria 122842
721 Ga0496126_0000393 3300048929 Bacteria 89680
722 Ga0496126_0001627 3300048929 Bacteria 33959
723 Ga0496126_0026239 3300048929 Bacteria 5589
724 Ga0496126_0064283 3300048929 Bacteria 3288
725 Ga0495678_007858 3300049459 Bacteria 5479
726 Ga0495678_068131 3300049459 Bacteria 1313
727 Ga0495678_069675 3300049459 Bacteria 1293
728 Ga0495678_077843 3300049459 Bacteria 1198
729 Ga0495678_097210 3300049459 Bacteria 1026
730 Ga0495682_0002273 3300049460 Bacteria 9209
731 Ga0495682_0058996 3300049460 Bacteria 1387
732 Ga0501033_0014132 3300049570 Bacteria 6069
733 Ga0501034_0000169 3300049571 Bacteria 122591
734 Ga0501034_0010755 3300049571 Bacteria 9504
735 Ga0501036_0170589 3300049572 Bacteria 1833
736 Ga0501036_0388670 3300049572 Bacteria 1164
737 Ga0501038_0034357 3300049574 Bacteria 4459
738 Ga0501038_0084030 3300049574 Bacteria 2679
739 Ga0501038_0708860 3300049574 Bacteria 753
740 Ga0501039_0074326 3300049575 Bacteria 2641
741 Ga0501039_0188225 3300049575 Bacteria 1623
742 Ga0501040_0002570 3300049576 Bacteria 11708
743 Ga0501041_0031618 3300049577 Bacteria 3199
744 Ga0501042_0006853 3300049578 Bacteria 7435
745 Ga0501043_0100751 3300049579 Bacteria 2271
746 Ga0501043_0246380 3300049579 Bacteria 1377
747 Ga0501048_0057873 3300049582 Bacteria 2748
748 Ga0501071_0147257 3300049587 Bacteria 1755
749 Ga0501071_0244675 3300049587 Bacteria 1353
750 Ga0501072_0031243 3300049588 Bacteria 4167
751 Ga0501072_0245779 3300049588 Bacteria 1425
752 Ga0501075_0010927 3300049591 Bacteria 6402
753 Ga0501075_0056249 3300049591 Bacteria 2961
754 Ga0501076_0002338 3300049592 Bacteria 12975
755 Ga0501076_0138268 3300049592 Bacteria 1978
756 Ga0501077_0086335 3300049593 Bacteria 1989
757 Ga0501079_0008736 3300049741 Bacteria 7678
758 Ga0501079_0209033 3300049741 Bacteria 1524
759 Ga0501080_0070289 3300049742 Bacteria 3255
760 Ga0501081_0464793 3300049743 Bacteria 941
761 Ga0501035_0017204 3300049822 Bacteria 6664
762 Ga0501044_0005999 3300049823 Bacteria 13420
763 Ga0501045_0007731 3300049824 Bacteria 7476
764 Ga0501045_0040355 3300049824 Bacteria 3397
765 nmdc:mga03683_147336_c1 3300050489 Bacteria 1061
766 nmdc:mga03n38_11740_c1 3300050490 Bacteria 3274
767 nmdc:mga00v17_205841_c1 3300050491 Bacteria 1273
768 nmdc:mga0k408_356828_c1 3300050493 Bacteria 871
769 nmdc:mga06z11_55437_c1 3300050494 Bacteria 2047
770 nmdc:mga04h51_32683_c1 3300050495 Bacteria 1652
771 Ga0500593_136208 3300053117 Bacteria 973
772 Ga0500594_0004303 3300053118 Bacteria 3140
773 Ga0500568_0136773 3300053139 Bacteria 909
774 Ga0500634_0212550 3300053161 Bacteria 838
775 Ga0500637_0252631 3300053178 Bacteria 983
776 Ga0501084_0058674 3300054114 Bacteria 3220
777 Ga0501084_0340310 3300054114 Bacteria 1267
778 Ga0587088_000147 3300059508 Bacteria 4461
779 Ga0587072_000202 3300059643 Bacteria 5343
780 Ga0501082_0004701 3300060353 Bacteria 11907
781 Ga0501082_0247007 3300060353 Bacteria 1553
782 Ga0466962_0025961 3300061719 Bacteria 2812
783 Ga0466962_0063975 3300061719 Bacteria 1756
784 Ga0466962_0260495 3300061719 Bacteria 853
785 Ga0530510_0002418 3300061734 Bacteria 12862

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041452 Ga0451793_0789053 Ga0451793_0789053_128_721 177
2 3300041505 Ga0451849_0987617 Ga0451849_0987617_518_1111 177
3 iso_pu_bacteria 2858688981 2858698913 178
4 3300046692 Ga0495671_0082017 Ga0495671_0082017_89_667 192
5 3300025735 Ga0207713_1000135 Ga0207713_100013592 193
6 3300049571 Ga0501034_0010755 Ga0501034_0010755_3411_4007 194
7 3300053117 Ga0500593_136208 Ga0500593_136208_179_775 194
8 3300006844 Ga0075428_100005735 Ga0075428_10000573514 196
9 3300006846 Ga0075430_100420683 Ga0075430_1004206832 196
10 3300006847 Ga0075431_100460356 Ga0075431_1004603562 196
11 3300025206 Ga0209435_100889 Ga0209435_1008893 196
12 3300037471 Ga0395905_0049339 Ga0395905_0049339_536_1150 196
13 3300045976 Ga0466967_0034766 Ga0466967_0034766_947_1561 196
14 3300046678 Ga0495599_0096981 Ga0495599_0096981_1228_1818 196
15 3300046679 Ga0495623_0045999 Ga0495623_0045999_16_606 196
16 3300039453 Ga0436362_1154311 Ga0436362_1154311_417_1073 197
17 3300044673 Ga0453683_0116493 Ga0453683_0116493_691_1299 197
18 3300049572 Ga0501036_0170589 Ga0501036_0170589_344_937 197
19 3300049572 Ga0501036_0388670 Ga0501036_0388670_260_853 197
20 3300049574 Ga0501038_0034357 Ga0501038_0034357_1990_2583 197
21 3300049574 Ga0501038_0708860 Ga0501038_0708860_118_711 197
22 3300049575 Ga0501039_0074326 Ga0501039_0074326_785_1378 197
23 3300049575 Ga0501039_0188225 Ga0501039_0188225_443_1036 197
24 3300049576 Ga0501040_0002570 Ga0501040_0002570_9083_9676 197
25 3300049577 Ga0501041_0031618 Ga0501041_0031618_587_1180 197
26 3300049578 Ga0501042_0006853 Ga0501042_0006853_1275_1868 197
27 3300049579 Ga0501043_0246380 Ga0501043_0246380_109_702 197
28 3300049582 Ga0501048_0057873 Ga0501048_0057873_2144_2737 197
29 3300049587 Ga0501071_0147257 Ga0501071_0147257_142_735 197
30 3300049587 Ga0501071_0244675 Ga0501071_0244675_454_1047 197
31 3300049588 Ga0501072_0031243 Ga0501072_0031243_1702_2295 197
32 3300049588 Ga0501072_0245779 Ga0501072_0245779_772_1365 197
33 3300049591 Ga0501075_0010927 Ga0501075_0010927_160_753 197
34 3300049591 Ga0501075_0056249 Ga0501075_0056249_64_657 197
35 3300049592 Ga0501076_0002338 Ga0501076_0002338_10721_11314 197
36 3300049592 Ga0501076_0138268 Ga0501076_0138268_1350_1943 197
37 3300049593 Ga0501077_0086335 Ga0501077_0086335_657_1250 197
38 3300049741 Ga0501079_0008736 Ga0501079_0008736_529_1122 197
39 3300049741 Ga0501079_0209033 Ga0501079_0209033_840_1433 197
40 3300049742 Ga0501080_0070289 Ga0501080_0070289_247_840 197
41 3300049743 Ga0501081_0464793 Ga0501081_0464793_64_657 197
42 3300049824 Ga0501045_0007731 Ga0501045_0007731_5654_6247 197
43 3300049824 Ga0501045_0040355 Ga0501045_0040355_1827_2420 197
44 3300054114 Ga0501084_0058674 Ga0501084_0058674_1004_1597 197
45 3300054114 Ga0501084_0340310 Ga0501084_0340310_258_851 197
46 3300060353 Ga0501082_0004701 Ga0501082_0004701_1515_2108 197
47 3300060353 Ga0501082_0247007 Ga0501082_0247007_758_1351 197
48 3300061734 Ga0530510_0002418 Ga0530510_0002418_6252_6845 197
49 3300005842 Ga0068858_100722235 Ga0068858_1007222352 198
50 3300044693 Ga0466961_0090476 Ga0466961_0090476_1205_1834 198
51 3300044706 Ga0466964_0056448 Ga0466964_0056448_107_736 198
52 3300045836 Ga0466958_0074660 Ga0466958_0074660_1096_1725 198
53 3300039447 Ga0436361_0539295 Ga0436361_0539295_2253_2888 199
54 3300042436 Ga0439435_0135598 Ga0439435_0135598_160_759 199
55 3300044684 Ga0466966_0313707 Ga0466966_0313707_68_697 199
56 3300044842 Ga0466957_0068940 Ga0466957_0068940_1479_2114 200
57 iso_pu_bacteria 2508501125 2509130091 200
58 iso_pu_bacteria 2513237151 2513962328 200
59 iso_pu_bacteria 2513237166 2514051742 200
60 iso_pu_bacteria 2526164713 2527077660 200
61 iso_pu_bacteria 2562617112 2563059437 200
62 iso_pu_bacteria 2711768613 2713479620 200
63 iso_pu_bacteria 2744054900 2746088336 200
64 iso_pu_bacteria 2744054901 2746096769 200
65 iso_pu_bacteria 2751185846 2753567790 200
66 iso_pu_bacteria 2791355137 2792834350 200
67 iso_pu_bacteria 2857576091 2857580614 200
68 iso_pu_bacteria 2900634093 2900637647 200
69 iso_pu_bacteria 2904483920 2904487579 200
70 iso_pu_bacteria 2904615490 2904616150 200
71 iso_pu_bacteria 2919527303 2919528883 200
72 iso_pu_bacteria 2921643360 2921651425 200
73 iso_pu_bacteria 2928503688 2928505880 200
74 iso_pu_bacteria 2945934425 2945937838 200
75 iso_pu_bacteria 2990703756 2990705444 200
76 iso_pu_bacteria 641736151 642424465 200
77 iso_pu_bacteria 642555112 642592384 200
78 iso_pu_bacteria 642555113 642622672 200
79 iso_pu_bacteria 8055266321 8055267126 200
80 iso_pu_bacteria 8055301274 8055301557 200
81 3300047444 Ga0495675_0141917 Ga0495675_0141917_295_900 201
82 3300053161 Ga0500634_0212550 Ga0500634_0212550_161_775 201
83 iso_pu_bacteria 2600255067 2600810980 201
84 3300006042 Ga0075368_10011344 Ga0075368_100113443 202
85 3300006048 Ga0075363_100029390 Ga0075363_1000293902 202
86 3300006177 Ga0075362_10164475 Ga0075362_101644752 202
87 3300006178 Ga0075367_10297078 Ga0075367_102970782 202
88 3300006186 Ga0075369_10025709 Ga0075369_100257092 202
89 3300006195 Ga0075366_10072863 Ga0075366_100728632 202
90 3300006353 Ga0075370_10164128 Ga0075370_101641281 202
91 3300027866 Ga0209813_10015470 Ga0209813_100154703 202
92 3300045049 Ga0466959_0088074 Ga0466959_0088074_1582_2217 202
93 3300048928 Ga0496125_0176319 Ga0496125_0176319_668_1303 202
94 3300050489 nmdc:mga03683_147336_c1 nmdc:mga03683_147336_c1_139_747 202
95 3300050490 nmdc:mga03n38_11740_c1 nmdc:mga03n38_11740_c1_833_1441 202
96 3300050491 nmdc:mga00v17_205841_c1 nmdc:mga00v17_205841_c1_315_923 202
97 3300050494 nmdc:mga06z11_55437_c1 nmdc:mga06z11_55437_c1_1024_1632 202
98 3300050495 nmdc:mga04h51_32683_c1 nmdc:mga04h51_32683_c1_629_1237 202
99 3300053178 Ga0500637_0252631 Ga0500637_0252631_257_865 202
100 iso_pu_bacteria 2808606384 2808972109 202
101 iso_pu_bacteria 2808606390 2809006973 202
102 iso_pu_bacteria 2808606391 2809014111 202
103 3300001990 JGI24737J22298_10043513 JGI24737J22298_100435131 203
104 3300002067 JGI24735J21928_10001188 JGI24735J21928_100011884 203
105 3300002067 JGI24735J21928_10020013 JGI24735J21928_100200131 203
106 3300005355 Ga0070671_100334466 Ga0070671_1003344662 203
107 3300005455 Ga0070663_100214195 Ga0070663_1002141952 203
108 3300009011 Ga0105251_10000317 Ga0105251_1000031724 203
109 3300009092 Ga0105250_10121747 Ga0105250_101217472 203
110 3300009093 Ga0105240_10193905 Ga0105240_101939052 203
111 3300009093 Ga0105240_10334943 Ga0105240_103349431 203
112 3300009101 Ga0105247_10353745 Ga0105247_103537452 203
113 3300009174 Ga0105241_10430046 Ga0105241_104300462 203
114 3300011119 Ga0105246_10358882 Ga0105246_103588822 203
115 3300013105 Ga0157369_10077781 Ga0157369_100777813 203
116 3300025302 Ga0207426_1008314 Ga0207426_10083142 203
117 3300025735 Ga0207713_1003069 Ga0207713_10030694 203
118 3300025904 Ga0207647_10006078 Ga0207647_100060782 203
119 3300025914 Ga0207671_10515084 Ga0207671_105150842 203
120 3300025931 Ga0207644_10871195 Ga0207644_108711951 203
121 3300026067 Ga0207678_10081052 Ga0207678_100810522 203
122 3300041404 Ga0439436_0015620 Ga0439436_0015620_232_858 203
123 3300044683 Ga0466965_0145629 Ga0466965_0145629_28_642 203
124 3300044684 Ga0466966_0070385 Ga0466966_0070385_870_1484 203
125 3300044765 Ga0466970_0033488 Ga0466970_0033488_636_1250 203
126 3300044842 Ga0466957_0222065 Ga0466957_0222065_369_983 203
127 3300045049 Ga0466959_0182094 Ga0466959_0182094_117_731 203
128 3300045836 Ga0466958_0198904 Ga0466958_0198904_651_1265 203
129 3300046457 Ga0495590_0001269 Ga0495590_0001269_9499_10113 203
130 3300046459 Ga0495629_0004573 Ga0495629_0004573_5952_6566 203
131 3300046459 Ga0495629_0087508 Ga0495629_0087508_572_1186 203
132 3300046463 Ga0495653_0018625 Ga0495653_0018625_867_1481 203
133 3300046463 Ga0495653_0147647 Ga0495653_0147647_601_1215 203
134 3300046477 Ga0495664_0007232 Ga0495664_0007232_2202_2816 203
135 3300046507 Ga0495606_0033064 Ga0495606_0033064_2103_2717 203
136 3300046507 Ga0495606_0101924 Ga0495606_0101924_385_999 203
137 3300046507 Ga0495606_0387203 Ga0495606_0387203_95_709 203
138 3300046516 Ga0495628_0008473 Ga0495628_0008473_4506_5120 203
139 3300046517 Ga0495630_0017668 Ga0495630_0017668_509_1123 203
140 3300046526 Ga0495666_0048521 Ga0495666_0048521_239_853 203
141 3300046529 Ga0495652_0016759 Ga0495652_0016759_2744_3358 203
142 3300046531 Ga0495665_0002464 Ga0495665_0002464_3270_3884 203
143 3300046542 Ga0495597_0016769 Ga0495597_0016769_1270_1884 203
144 3300046543 Ga0495645_0031032 Ga0495645_0031032_266_880 203
145 3300046663 Ga0495635_0149385 Ga0495635_0149385_67_681 203
146 3300046679 Ga0495623_0014837 Ga0495623_0014837_2233_2847 203
147 3300046680 Ga0495646_0012470 Ga0495646_0012470_3109_3723 203
148 3300046684 Ga0495669_0172346 Ga0495669_0172346_201_815 203
149 3300046690 Ga0495624_0008336 Ga0495624_0008336_3678_4292 203
150 3300046690 Ga0495624_0157002 Ga0495624_0157002_581_1195 203
151 3300046694 Ga0495649_0079258 Ga0495649_0079258_592_1206 203
152 3300046694 Ga0495649_0092850 Ga0495649_0092850_687_1301 203
153 3300047317 Ga0495604_0129650 Ga0495604_0129650_654_1268 203
154 3300047319 Ga0495674_0033988 Ga0495674_0033988_1258_1872 203
155 3300047323 Ga0495683_0004163 Ga0495683_0004163_6589_7203 203
156 3300047323 Ga0495683_0252860 Ga0495683_0252860_109_723 203
157 3300047443 Ga0495687_000131 Ga0495687_000131_103521_104135 203
158 3300047443 Ga0495687_105674 Ga0495687_105674_195_809 203
159 3300047673 Ga0495593_0006758 Ga0495593_0006758_1629_2243 203
160 3300047673 Ga0495593_0056679 Ga0495593_0056679_1143_1757 203
161 3300048088 Ga0495602_0038201 Ga0495602_0038201_3109_3723 203
162 3300048088 Ga0495602_0127352 Ga0495602_0127352_310_924 203
163 3300048091 Ga0495626_0142706 Ga0495626_0142706_15_629 203
164 3300048903 Ga0496100_0461752 Ga0496100_0461752_226_840 203
165 3300048904 Ga0496101_0020925 Ga0496101_0020925_228_842 203
166 3300048905 Ga0496102_0003455 Ga0496102_0003455_4542_5156 203
167 3300048906 Ga0496103_0000681 Ga0496103_0000681_18290_18904 203
168 3300048907 Ga0496104_0138693 Ga0496104_0138693_741_1355 203
169 3300048908 Ga0496105_0012438 Ga0496105_0012438_198_812 203
170 3300048908 Ga0496105_0097817 Ga0496105_0097817_909_1523 203
171 3300048909 Ga0496106_0112030 Ga0496106_0112030_691_1305 203
172 3300048912 Ga0496109_0039119 Ga0496109_0039119_711_1325 203
173 3300048914 Ga0496111_0083690 Ga0496111_0083690_865_1479 203
174 3300048915 Ga0496112_0044271 Ga0496112_0044271_2933_3547 203
175 3300048916 Ga0496113_0024725 Ga0496113_0024725_2993_3607 203
176 3300048916 Ga0496113_0585851 Ga0496113_0585851_55_669 203
177 3300048918 Ga0496115_0231109 Ga0496115_0231109_794_1408 203
178 3300048920 Ga0496117_0153008 Ga0496117_0153008_461_1075 203
179 3300048921 Ga0496118_0017045 Ga0496118_0017045_5769_6383 203
180 3300048921 Ga0496118_0162368 Ga0496118_0162368_28_642 203
181 3300048924 Ga0496121_0003879 Ga0496121_0003879_10642_11256 203
182 3300048924 Ga0496121_0231989 Ga0496121_0231989_584_1198 203
183 3300048925 Ga0496122_0005672 Ga0496122_0005672_10670_11284 203
184 3300048926 Ga0496123_0006619 Ga0496123_0006619_10543_11157 203
185 3300048927 Ga0496124_0022049 Ga0496124_0022049_4478_5092 203
186 3300048928 Ga0496125_0106491 Ga0496125_0106491_1205_1819 203
187 3300048929 Ga0496126_0064283 Ga0496126_0064283_1734_2348 203
188 3300049459 Ga0495678_069675 Ga0495678_069675_404_1018 203
189 3300050493 nmdc:mga0k408_356828_c1 nmdc:mga0k408_356828_c1_216_827 203
190 3300053118 Ga0500594_0004303 Ga0500594_0004303_300_911 203
191 3300053139 Ga0500568_0136773 Ga0500568_0136773_84_695 203
192 iso_pu_bacteria 8003400568 8003403709 203
193 3300001979 JGI24740J21852_10022509 JGI24740J21852_100225093 204
194 3300001989 JGI24739J22299_10003931 JGI24739J22299_100039315 204
195 3300001989 JGI24739J22299_10036622 JGI24739J22299_100366222 204
196 3300002705 JGI25156J39149_1000606 JGI25156J39149_100060625 204
197 3300002705 JGI25156J39149_1000877 JGI25156J39149_10008778 204
198 3300002705 JGI25156J39149_1002479 JGI25156J39149_10024793 204
199 3300003214 JGI25165J46597_1001699 JGI25165J46597_10016996 204
200 3300003322 rootL2_10111393 rootL2_101113932 204
201 3300003354 JGI25160J50197_1000140 JGI25160J50197_100014035 204
202 3300003756 Ga0055533_1000425 Ga0055533_100042517 204
203 3300003756 Ga0055533_1002261 Ga0055533_10022614 204
204 3300003758 Ga0055532_1000012 Ga0055532_1000012248 204
205 3300003760 Ga0055527_1000011 Ga0055527_100001194 204
206 3300003761 Ga0055535_1000009 Ga0055535_1000009248 204
207 3300003762 Ga0055542_1000015 Ga0055542_1000015248 204
208 3300003763 Ga0055529_1000011 Ga0055529_1000011248 204
209 3300005262 Ga0065165_1000952 Ga0065165_10009525 204
210 3300009093 Ga0105240_10426502 Ga0105240_104265021 204
211 3300009551 Ga0105238_10095245 Ga0105238_100952453 204
212 3300013105 Ga0157369_10023222 Ga0157369_100232225 204
213 3300016635 Ga0183361_10009 Ga0183361_1000961 204
214 3300025226 Ga0209674_100013 Ga0209674_100013403 204
215 3300025226 Ga0209674_100188 Ga0209674_10018825 204
216 3300025226 Ga0209674_100199 Ga0209674_10019944 204
217 3300025228 Ga0209672_100010 Ga0209672_100010455 204
218 3300025229 Ga0209147_100006 Ga0209147_100006455 204
219 3300025230 Ga0209563_102249 Ga0209563_1022494 204
220 3300025231 Ga0207427_101961 Ga0207427_1019613 204
221 3300025242 Ga0209258_100010 Ga0209258_100010455 204
222 3300025254 Ga0209148_1000018 Ga0209148_1000018455 204
223 3300025256 Ga0209759_1000251 Ga0209759_100025132 204
224 3300025256 Ga0209759_1000261 Ga0209759_100026149 204
225 3300025256 Ga0209759_1002520 Ga0209759_10025204 204
226 3300025261 Ga0209233_1000093 Ga0209233_100009326 204
227 3300025272 Ga0209455_1000015 Ga0209455_1000015455 204
228 3300025284 Ga0209130_1020712 Ga0209130_10207122 204
229 3300025295 Ga0209564_1004518 Ga0209564_10045186 204
230 3300025302 Ga0207426_1000326 Ga0207426_100032659 204
231 3300025904 Ga0207647_10013424 Ga0207647_100134243 204
232 3300025924 Ga0207694_10162066 Ga0207694_101620662 204
233 3300026035 Ga0207703_10116919 Ga0207703_101169192 204
234 3300027312 Ga0209371_1007364 Ga0209371_10073645 204
235 3300030500 Ga0268256_1027975 Ga0268256_10279752 204
236 3300031911 Ga0307412_10000016 Ga0307412_1000001699 204
237 3300037471 Ga0395905_0000059 Ga0395905_0000059_166143_166757 204
238 3300044684 Ga0466966_0183980 Ga0466966_0183980_427_1041 204
239 3300044842 Ga0466957_0449712 Ga0466957_0449712_222_836 204
240 3300046454 Ga0495592_0007994 Ga0495592_0007994_3691_4305 204
241 3300046454 Ga0495592_0086802 Ga0495592_0086802_808_1422 204
242 3300046455 Ga0495603_0000640 Ga0495603_0000640_4559_5173 204
243 3300046455 Ga0495603_0002349 Ga0495603_0002349_5493_6107 204
244 3300046457 Ga0495590_0003356 Ga0495590_0003356_2547_3161 204
245 3300046457 Ga0495590_0028898 Ga0495590_0028898_654_1268 204
246 3300046458 Ga0495591_003008 Ga0495591_003008_1213_1827 204
247 3300046459 Ga0495629_0000703 Ga0495629_0000703_19578_20192 204
248 3300046459 Ga0495629_0001980 Ga0495629_0001980_3375_3989 204
249 3300046459 Ga0495629_0003466 Ga0495629_0003466_9052_9666 204
250 3300046459 Ga0495629_0021661 Ga0495629_0021661_3605_4219 204
251 3300046459 Ga0495629_0030253 Ga0495629_0030253_1750_2364 204
252 3300046460 Ga0495638_0025053 Ga0495638_0025053_1612_2226 204
253 3300046461 Ga0495641_0051713 Ga0495641_0051713_938_1552 204
254 3300046462 Ga0495651_0421509 Ga0495651_0421509_192_806 204
255 3300046463 Ga0495653_0002719 Ga0495653_0002719_6893_7507 204
256 3300046463 Ga0495653_0045422 Ga0495653_0045422_2614_3228 204
257 3300046463 Ga0495653_0079438 Ga0495653_0079438_104_718 204
258 3300046471 Ga0495650_0013967 Ga0495650_0013967_2097_2711 204
259 3300046472 Ga0495580_0000113 Ga0495580_0000113_16951_17565 204
260 3300046472 Ga0495580_0003286 Ga0495580_0003286_10585_11199 204
261 3300046472 Ga0495580_0005056 Ga0495580_0005056_4886_5500 204
262 3300046472 Ga0495580_0006067 Ga0495580_0006067_9070_9684 204
263 3300046472 Ga0495580_0007782 Ga0495580_0007782_6908_7522 204
264 3300046472 Ga0495580_0016400 Ga0495580_0016400_57_671 204
265 3300046472 Ga0495580_0060211 Ga0495580_0060211_1955_2569 204
266 3300046473 Ga0495582_0002231 Ga0495582_0002231_6790_7404 204
267 3300046473 Ga0495582_0009614 Ga0495582_0009614_3370_3984 204
268 3300046473 Ga0495582_0045673 Ga0495582_0045673_927_1541 204
269 3300046474 Ga0495605_0002865 Ga0495605_0002865_3731_4345 204
270 3300046474 Ga0495605_0251811 Ga0495605_0251811_94_708 204
271 3300046476 Ga0495662_0078790 Ga0495662_0078790_547_1161 204
272 3300046476 Ga0495662_0115623 Ga0495662_0115623_389_1003 204
273 3300046476 Ga0495662_0156474 Ga0495662_0156474_468_1082 204
274 3300046477 Ga0495664_0000227 Ga0495664_0000227_9299_9913 204
275 3300046477 Ga0495664_0008101 Ga0495664_0008101_2142_2756 204
276 3300046491 Ga0495584_0120939 Ga0495584_0120939_576_1190 204
277 3300046499 Ga0495594_0092350 Ga0495594_0092350_492_1115 204
278 3300046500 Ga0495596_0002909 Ga0495596_0002909_792_1406 204
279 3300046500 Ga0495596_0040430 Ga0495596_0040430_504_1118 204
280 3300046501 Ga0495607_0000329 Ga0495607_0000329_1760_2410 204
281 3300046506 Ga0495583_0002659 Ga0495583_0002659_11595_12209 204
282 3300046506 Ga0495583_0003678 Ga0495583_0003678_6083_6697 204
283 3300046507 Ga0495606_0010165 Ga0495606_0010165_5627_6241 204
284 3300046511 Ga0495608_0005576 Ga0495608_0005576_7560_8174 204
285 3300046511 Ga0495608_0006513 Ga0495608_0006513_3983_4597 204
286 3300046513 Ga0495616_0007997 Ga0495616_0007997_813_1427 204
287 3300046514 Ga0495618_0001295 Ga0495618_0001295_2149_2763 204
288 3300046514 Ga0495618_0005466 Ga0495618_0005466_6954_7568 204
289 3300046514 Ga0495618_0016164 Ga0495618_0016164_2227_2841 204
290 3300046514 Ga0495618_0252322 Ga0495618_0252322_52_666 204
291 3300046515 Ga0495620_0005370 Ga0495620_0005370_2116_2730 204
292 3300046516 Ga0495628_0001823 Ga0495628_0001823_15898_16512 204
293 3300046516 Ga0495628_0029990 Ga0495628_0029990_2646_3260 204
294 3300046516 Ga0495628_0037075 Ga0495628_0037075_1948_2562 204
295 3300046516 Ga0495628_0053141 Ga0495628_0053141_82_696 204
296 3300046517 Ga0495630_0006483 Ga0495630_0006483_3962_4576 204
297 3300046517 Ga0495630_0048420 Ga0495630_0048420_2135_2749 204
298 3300046517 Ga0495630_0107760 Ga0495630_0107760_1262_1876 204
299 3300046524 Ga0495648_0004394 Ga0495648_0004394_4909_5523 204
300 3300046524 Ga0495648_0183000 Ga0495648_0183000_210_824 204
301 3300046524 Ga0495648_0351021 Ga0495648_0351021_12_626 204
302 3300046526 Ga0495666_0002186 Ga0495666_0002186_1995_2609 204
303 3300046526 Ga0495666_0011191 Ga0495666_0011191_1688_2302 204
304 3300046526 Ga0495666_0078709 Ga0495666_0078709_63_677 204
305 3300046529 Ga0495652_0002048 Ga0495652_0002048_16188_16802 204
306 3300046529 Ga0495652_0050315 Ga0495652_0050315_2027_2641 204
307 3300046529 Ga0495652_0501538 Ga0495652_0501538_146_760 204
308 3300046531 Ga0495665_0001052 Ga0495665_0001052_4687_5301 204
309 3300046531 Ga0495665_0006263 Ga0495665_0006263_3858_4472 204
310 3300046531 Ga0495665_0013800 Ga0495665_0013800_2275_2889 204
311 3300046531 Ga0495665_0075139 Ga0495665_0075139_468_1082 204
312 3300046533 Ga0495640_0005874 Ga0495640_0005874_6546_7160 204
313 3300046533 Ga0495640_0018210 Ga0495640_0018210_4043_4657 204
314 3300046533 Ga0495640_0131840 Ga0495640_0131840_399_1013 204
315 3300046535 Ga0495586_0000326 Ga0495586_0000326_14944_15558 204
316 3300046535 Ga0495586_0109977 Ga0495586_0109977_43_657 204
317 3300046535 Ga0495586_0151858 Ga0495586_0151858_652_1266 204
318 3300046536 Ga0495587_0004978 Ga0495587_0004978_6746_7360 204
319 3300046536 Ga0495587_0005348 Ga0495587_0005348_6244_6858 204
320 3300046542 Ga0495597_0045089 Ga0495597_0045089_151_765 204
321 3300046542 Ga0495597_0067005 Ga0495597_0067005_354_968 204
322 3300046543 Ga0495645_0001575 Ga0495645_0001575_6801_7415 204
323 3300046557 Ga0495622_0000039 Ga0495622_0000039_39936_40550 204
324 3300046557 Ga0495622_0003219 Ga0495622_0003219_4759_5373 204
325 3300046559 Ga0495667_0202633 Ga0495667_0202633_181_795 204
326 3300046642 Ga0495634_0002058 Ga0495634_0002058_7792_8406 204
327 3300046642 Ga0495634_0011548 Ga0495634_0011548_993_1607 204
328 3300046648 Ga0495611_0067539 Ga0495611_0067539_313_927 204
329 3300046648 Ga0495611_0249442 Ga0495611_0249442_148_762 204
330 3300046660 Ga0495625_0539305 Ga0495625_0539305_19_633 204
331 3300046663 Ga0495635_0007124 Ga0495635_0007124_7135_7749 204
332 3300046663 Ga0495635_0007337 Ga0495635_0007337_6703_7317 204
333 3300046663 Ga0495635_0040306 Ga0495635_0040306_1948_2562 204
334 3300046665 Ga0495661_0001394 Ga0495661_0001394_12888_13502 204
335 3300046665 Ga0495661_0088194 Ga0495661_0088194_368_982 204
336 3300046675 Ga0495657_0025556 Ga0495657_0025556_2652_3266 204
337 3300046678 Ga0495599_0096775 Ga0495599_0096775_595_1209 204
338 3300046678 Ga0495599_0133636 Ga0495599_0133636_791_1405 204
339 3300046679 Ga0495623_0001079 Ga0495623_0001079_6674_7288 204
340 3300046679 Ga0495623_0006469 Ga0495623_0006469_3433_4047 204
341 3300046679 Ga0495623_0027720 Ga0495623_0027720_1028_1642 204
342 3300046680 Ga0495646_0000155 Ga0495646_0000155_16382_16996 204
343 3300046680 Ga0495646_0013646 Ga0495646_0013646_3197_3811 204
344 3300046680 Ga0495646_0024648 Ga0495646_0024648_2806_3420 204
345 3300046680 Ga0495646_0025570 Ga0495646_0025570_1170_1784 204
346 3300046680 Ga0495646_0199776 Ga0495646_0199776_109_723 204
347 3300046689 Ga0495613_0001007 Ga0495613_0001007_1252_1866 204
348 3300046689 Ga0495613_0003373 Ga0495613_0003373_4627_5241 204
349 3300046689 Ga0495613_0081112 Ga0495613_0081112_547_1161 204
350 3300046690 Ga0495624_0000620 Ga0495624_0000620_22797_23411 204
351 3300046690 Ga0495624_0007322 Ga0495624_0007322_5158_5772 204
352 3300046690 Ga0495624_0126289 Ga0495624_0126289_252_866 204
353 3300046690 Ga0495624_0384904 Ga0495624_0384904_57_671 204
354 3300046692 Ga0495671_0027324 Ga0495671_0027324_143_757 204
355 3300046692 Ga0495671_0183391 Ga0495671_0183391_386_1000 204
356 3300046694 Ga0495649_0011930 Ga0495649_0011930_4002_4616 204
357 3300046694 Ga0495649_0012033 Ga0495649_0012033_1667_2281 204
358 3300046694 Ga0495649_0029333 Ga0495649_0029333_817_1431 204
359 3300046794 Ga0495589_0071950 Ga0495589_0071950_655_1269 204
360 3300046809 Ga0495600_0005649 Ga0495600_0005649_6204_6818 204
361 3300046809 Ga0495600_0166342 Ga0495600_0166342_741_1355 204
362 3300046810 Ga0495660_0111347 Ga0495660_0111347_25_639 204
363 3300047315 Ga0495581_0001216 Ga0495581_0001216_4096_4710 204
364 3300047315 Ga0495581_0010651 Ga0495581_0010651_3069_3683 204
365 3300047317 Ga0495604_0001412 Ga0495604_0001412_12341_12955 204
366 3300047317 Ga0495604_0008594 Ga0495604_0008594_6767_7381 204
367 3300047317 Ga0495604_0075942 Ga0495604_0075942_560_1174 204
368 3300047317 Ga0495604_0106118 Ga0495604_0106118_172_786 204
369 3300047317 Ga0495604_0395761 Ga0495604_0395761_57_671 204
370 3300047319 Ga0495674_0006005 Ga0495674_0006005_1567_2181 204
371 3300047319 Ga0495674_0012219 Ga0495674_0012219_1292_1906 204
372 3300047319 Ga0495674_0018817 Ga0495674_0018817_4334_4948 204
373 3300047319 Ga0495674_0059693 Ga0495674_0059693_1328_1942 204
374 3300047319 Ga0495674_0063280 Ga0495674_0063280_832_1446 204
375 3300047320 Ga0495672_0060950 Ga0495672_0060950_1125_1739 204
376 3300047320 Ga0495672_0138486 Ga0495672_0138486_211_825 204
377 3300047321 Ga0495676_0001508 Ga0495676_0001508_913_1527 204
378 3300047321 Ga0495676_0063384 Ga0495676_0063384_938_1552 204
379 3300047321 Ga0495676_0070196 Ga0495676_0070196_774_1388 204
380 3300047321 Ga0495676_0127677 Ga0495676_0127677_667_1281 204
381 3300047321 Ga0495676_0503208 Ga0495676_0503208_166_780 204
382 3300047322 Ga0495680_0002596 Ga0495680_0002596_5384_5998 204
383 3300047322 Ga0495680_0021794 Ga0495680_0021794_1948_2562 204
384 3300047322 Ga0495680_0042257 Ga0495680_0042257_1843_2457 204
385 3300047323 Ga0495683_0007420 Ga0495683_0007420_1691_2305 204
386 3300047323 Ga0495683_0016687 Ga0495683_0016687_2141_2755 204
387 3300047323 Ga0495683_0065545 Ga0495683_0065545_904_1518 204
388 3300047323 Ga0495683_0069715 Ga0495683_0069715_778_1392 204
389 3300047443 Ga0495687_006746 Ga0495687_006746_1995_2609 204
390 3300047443 Ga0495687_030617 Ga0495687_030617_824_1438 204
391 3300047443 Ga0495687_098112 Ga0495687_098112_416_1030 204
392 3300047444 Ga0495675_0013165 Ga0495675_0013165_4217_4831 204
393 3300047444 Ga0495675_0132991 Ga0495675_0132991_84_698 204
394 3300047446 Ga0495679_000037 Ga0495679_000037_86926_87540 204
395 3300047446 Ga0495679_000454 Ga0495679_000454_15072_15686 204
396 3300047446 Ga0495679_013496 Ga0495679_013496_2211_2825 204
397 3300047469 Ga0495673_0008666 Ga0495673_0008666_4329_4943 204
398 3300047469 Ga0495673_0051163 Ga0495673_0051163_827_1441 204
399 3300047470 Ga0495681_0116659 Ga0495681_0116659_209_823 204
400 3300047471 Ga0495684_0016894 Ga0495684_0016894_3666_4280 204
401 3300047471 Ga0495684_0102550 Ga0495684_0102550_1066_1680 204
402 3300047472 Ga0495686_0075694 Ga0495686_0075694_904_1518 204
403 3300047673 Ga0495593_0000287 Ga0495593_0000287_25272_25886 204
404 3300047673 Ga0495593_0003687 Ga0495593_0003687_6788_7402 204
405 3300047673 Ga0495593_0006363 Ga0495593_0006363_691_1305 204
406 3300047673 Ga0495593_0015750 Ga0495593_0015750_800_1414 204
407 3300048088 Ga0495602_0001875 Ga0495602_0001875_15636_16250 204
408 3300048088 Ga0495602_0013819 Ga0495602_0013819_7259_7873 204
409 3300048088 Ga0495602_0119069 Ga0495602_0119069_1240_1854 204
410 3300048088 Ga0495602_0205667 Ga0495602_0205667_198_812 204
411 3300048089 Ga0495614_0029822 Ga0495614_0029822_1675_2289 204
412 3300048091 Ga0495626_0031109 Ga0495626_0031109_558_1172 204
413 3300048091 Ga0495626_0051799 Ga0495626_0051799_1124_1738 204
414 3300048903 Ga0496100_0012964 Ga0496100_0012964_2653_3267 204
415 3300048904 Ga0496101_0001117 Ga0496101_0001117_6253_6867 204
416 3300048904 Ga0496101_0145326 Ga0496101_0145326_209_823 204
417 3300048905 Ga0496102_0001133 Ga0496102_0001133_15952_16566 204
418 3300048905 Ga0496102_0032234 Ga0496102_0032234_3389_4003 204
419 3300048906 Ga0496103_0001656 Ga0496103_0001656_9116_9730 204
420 3300048906 Ga0496103_0009166 Ga0496103_0009166_3497_4111 204
421 3300048907 Ga0496104_0250304 Ga0496104_0250304_936_1550 204
422 3300048908 Ga0496105_0070070 Ga0496105_0070070_422_1036 204
423 3300048909 Ga0496106_0000352 Ga0496106_0000352_12695_13330 204
424 3300048909 Ga0496106_0062508 Ga0496106_0062508_1961_2575 204
425 3300048910 Ga0496107_0176788 Ga0496107_0176788_609_1223 204
426 3300048916 Ga0496113_0061511 Ga0496113_0061511_1192_1806 204
427 3300048918 Ga0496115_0598644 Ga0496115_0598644_193_807 204
428 3300048920 Ga0496117_0003850 Ga0496117_0003850_10365_10979 204
429 3300048920 Ga0496117_0004840 Ga0496117_0004840_8258_8872 204
430 3300048920 Ga0496117_0012414 Ga0496117_0012414_5792_6406 204
431 3300048920 Ga0496117_0033221 Ga0496117_0033221_524_1138 204
432 3300048921 Ga0496118_0004425 Ga0496118_0004425_9499_10113 204
433 3300048921 Ga0496118_0005290 Ga0496118_0005290_6230_6844 204
434 3300048921 Ga0496118_0078040 Ga0496118_0078040_424_1038 204
435 3300048924 Ga0496121_0001964 Ga0496121_0001964_12635_13270 204
436 3300048924 Ga0496121_0023640 Ga0496121_0023640_2515_3129 204
437 3300048925 Ga0496122_0121198 Ga0496122_0121198_456_1070 204
438 3300048925 Ga0496122_0258596 Ga0496122_0258596_276_890 204
439 3300048927 Ga0496124_0256413 Ga0496124_0256413_470_1084 204
440 3300048929 Ga0496126_0000225 Ga0496126_0000225_40120_40734 204
441 3300049459 Ga0495678_007858 Ga0495678_007858_2584_3198 204
442 3300049459 Ga0495678_077843 Ga0495678_077843_530_1144 204
443 3300049459 Ga0495678_097210 Ga0495678_097210_85_699 204
444 3300049460 Ga0495682_0002273 Ga0495682_0002273_4330_4944 204
445 3300049460 Ga0495682_0058996 Ga0495682_0058996_63_677 204
446 3300009177 Ga0105248_10001566 Ga0105248_1000156625 205
447 3300009982 Ga0105147_100942 Ga0105147_1009422 205
448 3300025941 Ga0207711_10023040 Ga0207711_100230402 205
449 3300037418 Ga0395900_0460178 Ga0395900_0460178_377_997 205
450 3300037466 Ga0395898_0002375 Ga0395898_0002375_9186_9806 205
451 3300046507 Ga0495606_0362728 Ga0495606_0362728_73_708 205
452 3300048905 Ga0496102_0225888 Ga0496102_0225888_44_661 205
453 3300048919 Ga0496116_0003169 Ga0496116_0003169_1534_2151 205
454 3300048919 Ga0496116_0043245 Ga0496116_0043245_1773_2408 205
455 3300048921 Ga0496118_0128514 Ga0496118_0128514_106_741 205
456 3300049570 Ga0501033_0014132 Ga0501033_0014132_3215_3844 205
457 3300049574 Ga0501038_0084030 Ga0501038_0084030_151_780 205
458 3300049579 Ga0501043_0100751 Ga0501043_0100751_1535_2164 205
459 3300049822 Ga0501035_0017204 Ga0501035_0017204_5180_5809 205
460 3300049823 Ga0501044_0005999 Ga0501044_0005999_2922_3551 205
461 iso_pu_bacteria 2510065045 2510252016 205
462 iso_pu_bacteria 2718217991 2719641119 205
463 iso_pu_bacteria 2818991450 2819621831 205
464 iso_pu_bacteria 2928108538 2928111033 205
465 iso_pu_bacteria 2928135762 2928137434 205
466 3300003187 JGI25151J46595_10033312 JGI25151J46595_100333122 206
467 3300009174 Ga0105241_10054083 Ga0105241_100540832 206
468 3300025294 Ga0209025_1000504 Ga0209025_100050449 206
469 3300044693 Ga0466961_0000333 Ga0466961_0000333_29378_29998 206
470 3300044901 Ga0466960_0185031 Ga0466960_0185031_286_939 206
471 3300045836 Ga0466958_0084481 Ga0466958_0084481_93_746 206
472 3300045976 Ga0466967_0409109 Ga0466967_0409109_253_873 206
473 3300046522 Ga0495643_0005747 Ga0495643_0005747_1644_2264 206
474 3300046526 Ga0495666_0085757 Ga0495666_0085757_270_929 206
475 3300046542 Ga0495597_0028514 Ga0495597_0028514_766_1386 206
476 3300046665 Ga0495661_0003998 Ga0495661_0003998_4235_4855 206
477 3300046690 Ga0495624_0182741 Ga0495624_0182741_244_870 206
478 3300047317 Ga0495604_0005483 Ga0495604_0005483_8764_9390 206
479 3300047318 Ga0495636_0092780 Ga0495636_0092780_514_1134 206
480 3300047443 Ga0495687_042898 Ga0495687_042898_956_1576 206
481 3300048908 Ga0496105_0812286 Ga0496105_0812286_28_648 206
482 3300048924 Ga0496121_0000777 Ga0496121_0000777_39275_39895 206
483 3300048929 Ga0496126_0001627 Ga0496126_0001627_601_1221 206
484 3300049571 Ga0501034_0000169 Ga0501034_0000169_57142_57780 206
485 iso_pu_bacteria 2834641062 2834641382 206
486 3300013306 Ga0163162_10817546 Ga0163162_108175462 207
487 3300038443 Ga0395901_0593447 Ga0395901_0593447_290_913 207
488 3300046516 Ga0495628_0022031 Ga0495628_0022031_784_1413 207
489 3300047319 Ga0495674_0272809 Ga0495674_0272809_741_1364 207
490 3300047472 Ga0495686_0000002 Ga0495686_0000002_294648_295277 207
491 iso_pu_bacteria 2512047030 2512345052 207
492 iso_pu_bacteria 2515154122 2515685060 207
493 iso_pu_bacteria 2515154123 2515692559 207
494 iso_pu_bacteria 2721755763 2723879291 207
495 iso_pu_bacteria 2738541296 2738819154 207
496 iso_pu_bacteria 2738541298 2738830690 207
497 iso_pu_bacteria 2738541306 2738872216 207
498 iso_pu_bacteria 2738543002 2739189783 207
499 iso_pu_bacteria 2738543008 2739218817 207
500 iso_pu_bacteria 2842324504 2842324925 207
501 iso_pu_bacteria 2842348783 2842349204 207
502 iso_pu_bacteria 2842454564 2842456978 207
503 iso_pu_bacteria 2885270888 2885277919 207
504 iso_pu_bacteria 2902682994 2902686908 207
505 3300025294 Ga0209025_1045818 Ga0209025_10458182 208
506 3300038443 Ga0395901_0117723 Ga0395901_0117723_1576_2202 208
507 3300047319 Ga0495674_0318450 Ga0495674_0318450_352_984 208
508 iso_pu_bacteria 2501025501 2501070688 208
509 iso_pu_bacteria 2501025504 2501408216 208
510 iso_pu_bacteria 2510917013 2511085827 208
511 iso_pu_bacteria 2510917014 2511095955 208
512 iso_pu_bacteria 2510917015 2511103308 208
513 iso_pu_bacteria 2513237082 2513554030 208
514 iso_pu_bacteria 2513237083 2513561494 208
515 iso_pu_bacteria 2515154189 2516020711 208
516 iso_pu_bacteria 2883087390 2883091004 208
517 iso_pu_bacteria 8003955200 8003957641 208
518 3300001989 JGI24739J22299_10003301 JGI24739J22299_100033012 209
519 3300002067 JGI24735J21928_10001236 JGI24735J21928_100012367 209
520 3300003316 rootH1_10006911 rootH1_100069112 209
521 3300003320 rootH2_10063962 rootH2_100639621 209
522 3300003760 Ga0055527_1001572 Ga0055527_10015723 209
523 3300003760 Ga0055527_1001635 Ga0055527_10016353 209
524 3300003760 Ga0055527_1002110 Ga0055527_10021103 209
525 3300003761 Ga0055535_1003337 Ga0055535_10033373 209
526 3300003761 Ga0055535_1003461 Ga0055535_10034613 209
527 3300003762 Ga0055542_1003186 Ga0055542_10031863 209
528 3300003762 Ga0055542_1004987 Ga0055542_10049873 209
529 3300003763 Ga0055529_1001414 Ga0055529_10014144 209
530 3300003763 Ga0055529_1002664 Ga0055529_10026643 209
531 3300003790 Ga0055528_1000521 Ga0055528_100052122 209
532 3300005327 Ga0070658_10011441 Ga0070658_100114417 209
533 3300005327 Ga0070658_10016321 Ga0070658_100163213 209
534 3300005339 Ga0070660_100000008 Ga0070660_100000008139 209
535 3300005344 Ga0070661_100402972 Ga0070661_1004029722 209
536 3300005366 Ga0070659_100000014 Ga0070659_100000014143 209
537 3300005455 Ga0070663_100000594 Ga0070663_10000059412 209
538 3300005455 Ga0070663_100043807 Ga0070663_1000438072 209
539 3300005539 Ga0068853_100871863 Ga0068853_1008718631 209
540 3300005563 Ga0068855_100023843 Ga0068855_1000238437 209
541 3300005578 Ga0068854_100153720 Ga0068854_1001537201 209
542 3300005616 Ga0068852_100038560 Ga0068852_1000385603 209
543 3300009011 Ga0105251_10000128 Ga0105251_1000012817 209
544 3300009092 Ga0105250_10007640 Ga0105250_100076404 209
545 3300009093 Ga0105240_10005293 Ga0105240_100052931 209
546 3300009093 Ga0105240_10241969 Ga0105240_102419692 209
547 3300009093 Ga0105240_10612381 Ga0105240_106123811 209
548 3300009545 Ga0105237_10004182 Ga0105237_1000418213 209
549 3300009545 Ga0105237_10020630 Ga0105237_100206307 209
550 3300009551 Ga0105238_10010764 Ga0105238_100107646 209
551 3300009551 Ga0105238_10161765 Ga0105238_101617651 209
552 3300010375 Ga0105239_10002627 Ga0105239_1000262723 209
553 3300010375 Ga0105239_10087940 Ga0105239_100879402 209
554 3300013100 Ga0157373_10007322 Ga0157373_100073222 209
555 3300013100 Ga0157373_10082901 Ga0157373_100829013 209
556 3300013102 Ga0157371_10023565 Ga0157371_100235656 209
557 3300013104 Ga0157370_10001394 Ga0157370_1000139423 209
558 3300013104 Ga0157370_10001629 Ga0157370_100016298 209
559 3300013104 Ga0157370_10013544 Ga0157370_100135445 209
560 3300013104 Ga0157370_10714252 Ga0157370_107142522 209
561 3300013105 Ga0157369_10000496 Ga0157369_1000049643 209
562 3300013105 Ga0157369_10006956 Ga0157369_100069565 209
563 3300013105 Ga0157369_10062813 Ga0157369_100628134 209
564 3300013105 Ga0157369_10992493 Ga0157369_109924931 209
565 3300013105 Ga0157369_10992494 Ga0157369_109924941 209
566 3300013307 Ga0157372_10008949 Ga0157372_100089493 209
567 3300013307 Ga0157372_10156360 Ga0157372_101563602 209
568 3300015261 Ga0182006_1033972 Ga0182006_10339723 209
569 3300015261 Ga0182006_1083679 Ga0182006_10836793 209
570 3300015261 Ga0182006_1090477 Ga0182006_10904772 209
571 3300015262 Ga0182007_10000485 Ga0182007_1000048524 209
572 3300015262 Ga0182007_10038563 Ga0182007_100385632 209
573 3300020070 Ga0206356_10619711 Ga0206356_106197111 209
574 3300022467 Ga0224712_10000050 Ga0224712_100000505 209
575 3300025228 Ga0209672_100051 Ga0209672_100051187 209
576 3300025228 Ga0209672_100083 Ga0209672_10008355 209
577 3300025228 Ga0209672_100298 Ga0209672_1002987 209
578 3300025229 Ga0209147_100120 Ga0209147_10012089 209
579 3300025229 Ga0209147_100237 Ga0209147_10023751 209
580 3300025229 Ga0209147_100244 Ga0209147_1002448 209
581 3300025242 Ga0209258_100351 Ga0209258_10035110 209
582 3300025242 Ga0209258_100405 Ga0209258_1004058 209
583 3300025254 Ga0209148_1000027 Ga0209148_1000027531 209
584 3300025256 Ga0209759_1003150 Ga0209759_10031506 209
585 3300025256 Ga0209759_1003642 Ga0209759_10036422 209
586 3300025272 Ga0209455_1000247 Ga0209455_100024710 209
587 3300025272 Ga0209455_1004841 Ga0209455_10048413 209
588 3300025273 Ga0209673_1000070 Ga0209673_1000070108 209
589 3300025711 Ga0207696_1022696 Ga0207696_10226962 209
590 3300025904 Ga0207647_10000335 Ga0207647_1000033524 209
591 3300025904 Ga0207647_10001635 Ga0207647_1000163515 209
592 3300025904 Ga0207647_10003889 Ga0207647_100038897 209
593 3300025913 Ga0207695_10003990 Ga0207695_100039908 209
594 3300025913 Ga0207695_10023118 Ga0207695_100231186 209
595 3300025913 Ga0207695_10283342 Ga0207695_102833422 209
596 3300025913 Ga0207695_10433322 Ga0207695_104333221 209
597 3300025914 Ga0207671_10025975 Ga0207671_100259756 209
598 3300025914 Ga0207671_10109446 Ga0207671_101094463 209
599 3300025919 Ga0207657_10000018 Ga0207657_1000001885 209
600 3300025924 Ga0207694_10032418 Ga0207694_100324185 209
601 3300025932 Ga0207690_10000006 Ga0207690_10000006137 209
602 3300025945 Ga0207679_10678554 Ga0207679_106785542 209
603 3300025949 Ga0207667_10032194 Ga0207667_100321945 209
604 3300025949 Ga0207667_10138735 Ga0207667_101387352 209
605 3300025949 Ga0207667_11335328 Ga0207667_113353281 209
606 3300026041 Ga0207639_10803347 Ga0207639_108033472 209
607 3300026067 Ga0207678_10002092 Ga0207678_100020929 209
608 3300026067 Ga0207678_10055809 Ga0207678_100558093 209
609 3300026116 Ga0207674_10282044 Ga0207674_102820442 209
610 3300026142 Ga0207698_10041928 Ga0207698_100419283 209
611 3300027312 Ga0209371_1000181 Ga0209371_100018174 209
612 3300028800 Ga0265338_10000346 Ga0265338_1000034644 209
613 3300030500 Ga0268256_1000151 Ga0268256_100015118 209
614 3300031238 Ga0265332_10103214 Ga0265332_101032141 209
615 3300037312 Ga0395899_0000324 Ga0395899_0000324_3685_4314 209
616 3300037418 Ga0395900_0000430 Ga0395900_0000430_56198_56827 209
617 3300037466 Ga0395898_0000072 Ga0395898_0000072_33242_33871 209
618 3300037466 Ga0395898_0569126 Ga0395898_0569126_227_856 209
619 3300038443 Ga0395901_0000432 Ga0395901_0000432_7828_8457 209
620 3300038443 Ga0395901_0046019 Ga0395901_0046019_590_1219 209
621 3300042005 Ga0439448_0002221 Ga0439448_0002221_3467_4096 209
622 3300044650 Ga0466986_0226976 Ga0466986_0226976_276_905 209
623 3300044656 Ga0466969_0009479 Ga0466969_0009479_917_1555 209
624 3300044656 Ga0466969_0127075 Ga0466969_0127075_334_963 209
625 3300044658 Ga0466972_0021216 Ga0466972_0021216_728_1357 209
626 3300044658 Ga0466972_0041084 Ga0466972_0041084_149_787 209
627 3300044658 Ga0466972_0146269 Ga0466972_0146269_41_670 209
628 3300044659 Ga0466973_0010102 Ga0466973_0010102_4221_4859 209
629 3300044672 Ga0466982_0155021 Ga0466982_0155021_606_1235 209
630 3300044683 Ga0466965_0035176 Ga0466965_0035176_1321_1959 209
631 3300044684 Ga0466966_0033415 Ga0466966_0033415_180_809 209
632 3300044684 Ga0466966_0161245 Ga0466966_0161245_317_946 209
633 3300044693 Ga0466961_0066046 Ga0466961_0066046_700_1332 209
634 3300044693 Ga0466961_0128366 Ga0466961_0128366_284_913 209
635 3300044693 Ga0466961_0188637 Ga0466961_0188637_170_799 209
636 3300044694 Ga0466963_0069590 Ga0466963_0069590_547_1185 209
637 3300044694 Ga0466963_0361584 Ga0466963_0361584_341_970 209
638 3300044706 Ga0466964_0032188 Ga0466964_0032188_1017_1655 209
639 3300044719 Ga0466971_0025267 Ga0466971_0025267_893_1531 209
640 3300044719 Ga0466971_0195293 Ga0466971_0195293_225_854 209
641 3300044735 Ga0466968_0028517 Ga0466968_0028517_1379_2017 209
642 3300044765 Ga0466970_0034974 Ga0466970_0034974_909_1547 209
643 3300044842 Ga0466957_0059160 Ga0466957_0059160_893_1531 209
644 3300044842 Ga0466957_0097879 Ga0466957_0097879_84_713 209
645 3300044842 Ga0466957_0141858 Ga0466957_0141858_568_1197 209
646 3300044901 Ga0466960_0114616 Ga0466960_0114616_152_781 209
647 3300045049 Ga0466959_0113338 Ga0466959_0113338_1249_1887 209
648 3300045836 Ga0466958_0007472 Ga0466958_0007472_173_811 209
649 3300045836 Ga0466958_0261659 Ga0466958_0261659_233_862 209
650 3300046471 Ga0495650_0004407 Ga0495650_0004407_648_1277 209
651 3300046472 Ga0495580_0004870 Ga0495580_0004870_8943_9572 209
652 3300046528 Ga0495642_0082814 Ga0495642_0082814_577_1206 209
653 3300046794 Ga0495589_0113756 Ga0495589_0113756_108_737 209
654 3300048903 Ga0496100_0547842 Ga0496100_0547842_192_821 209
655 3300048908 Ga0496105_0306142 Ga0496105_0306142_136_765 209
656 3300048919 Ga0496116_0032563 Ga0496116_0032563_2411_3040 209
657 3300048920 Ga0496117_0071399 Ga0496117_0071399_1422_2051 209
658 3300048920 Ga0496117_0129744 Ga0496117_0129744_667_1296 209
659 3300048921 Ga0496118_0032131 Ga0496118_0032131_3143_3772 209
660 3300048921 Ga0496118_0107205 Ga0496118_0107205_270_899 209
661 3300048922 Ga0496119_0219759 Ga0496119_0219759_234_863 209
662 3300048924 Ga0496121_0015159 Ga0496121_0015159_5736_6377 209
663 3300048924 Ga0496121_0064896 Ga0496121_0064896_22_651 209
664 3300048926 Ga0496123_0068677 Ga0496123_0068677_163_792 209
665 3300048928 Ga0496125_0267817 Ga0496125_0267817_324_953 209
666 3300061719 Ga0466962_0025961 Ga0466962_0025961_818_1456 209
667 3300061719 Ga0466962_0063975 Ga0466962_0063975_754_1383 209
668 3300002067 JGI24735J21928_10000214 JGI24735J21928_100002145 210
669 3300002075 JGI24738J21930_10004301 JGI24738J21930_100043013 210
670 3300003187 JGI25151J46595_10000587 JGI25151J46595_1000058710 210
671 3300005563 Ga0068855_100674665 Ga0068855_1006746651 210
672 3300006948 Ga0099826_10000016 Ga0099826_1000001652 210
673 3300010375 Ga0105239_10791683 Ga0105239_107916831 210
674 3300026067 Ga0207678_10075959 Ga0207678_100759593 210
675 3300044684 Ga0466966_0000008 Ga0466966_0000008_105655_106287 210
676 3300044684 Ga0466966_0001215 Ga0466966_0001215_15820_16452 210
677 3300044694 Ga0466963_0243541 Ga0466963_0243541_403_1035 210
678 3300044719 Ga0466971_0083054 Ga0466971_0083054_750_1382 210
679 3300045836 Ga0466958_0459690 Ga0466958_0459690_113_745 210
680 3300046507 Ga0495606_0014220 Ga0495606_0014220_5553_6185 210
681 3300046512 Ga0495610_0012526 Ga0495610_0012526_1030_1662 210
682 3300046522 Ga0495643_0095481 Ga0495643_0095481_842_1474 210
683 3300046528 Ga0495642_0027173 Ga0495642_0027173_947_1579 210
684 3300047323 Ga0495683_0008065 Ga0495683_0008065_4427_5059 210
685 3300048091 Ga0495626_0033737 Ga0495626_0033737_1161_1793 210
686 3300048907 Ga0496104_0307593 Ga0496104_0307593_41_673 210
687 3300061719 Ga0466962_0260495 Ga0466962_0260495_132_764 210
688 iso_pu_bacteria 2856287931 2856292120 210
689 iso_pu_bacteria 2857357740 2857361196 210
690 3300002738 JGI25154J39366_1001139 JGI25154J39366_10011398 211
691 3300003751 Ga0055538_1007262 Ga0055538_10072622 211
692 3300003756 Ga0055533_1007826 Ga0055533_10078262 211
693 3300003762 Ga0055542_1005528 Ga0055542_10055282 211
694 3300003841 Ga0055541_1000396 Ga0055541_100039610 211
695 3300013296 Ga0157374_10000039 Ga0157374_10000039140 211
696 3300014497 Ga0182008_10042765 Ga0182008_100427653 211
697 3300025224 Ga0209784_102261 Ga0209784_1022612 211
698 3300025225 Ga0209566_100200 Ga0209566_1002005 211
699 3300025226 Ga0209674_100237 Ga0209674_1002379 211
700 3300025230 Ga0209563_102800 Ga0209563_1028002 211
701 3300025246 Ga0209646_1000058 Ga0209646_100005811 211
702 3300025250 Ga0209026_1011709 Ga0209026_10117092 211
703 3300025253 Ga0209677_110452 Ga0209677_1104522 211
704 3300025254 Ga0209148_1000043 Ga0209148_1000043193 211
705 3300025949 Ga0207667_10000920 Ga0207667_1000092024 211
706 3300028800 Ga0265338_10000173 Ga0265338_1000017359 211
707 3300031548 Ga0307408_100006267 Ga0307408_1000062673 211
708 3300031911 Ga0307412_10009877 Ga0307412_100098775 211
709 3300031995 Ga0307409_100097960 Ga0307409_1000979603 211
710 3300032002 Ga0307416_100035015 Ga0307416_1000350152 211
711 3300032005 Ga0307411_10181136 Ga0307411_101811362 211
712 3300037312 Ga0395899_0190040 Ga0395899_0190040_414_1049 211
713 3300037418 Ga0395900_0000813 Ga0395900_0000813_12677_13312 211
714 3300037418 Ga0395900_0024846 Ga0395900_0024846_1404_2039 211
715 3300037418 Ga0395900_0178391 Ga0395900_0178391_568_1203 211
716 3300038443 Ga0395901_0000003 Ga0395901_0000003_171206_171841 211
717 3300038443 Ga0395901_0000415 Ga0395901_0000415_25257_25892 211
718 3300044656 Ga0466969_0083913 Ga0466969_0083913_662_1300 211
719 3300044658 Ga0466972_0017322 Ga0466972_0017322_1800_2435 211
720 3300044683 Ga0466965_0051669 Ga0466965_0051669_398_1033 211
721 3300044684 Ga0466966_0006621 Ga0466966_0006621_5839_6477 211
722 3300044693 Ga0466961_0000028 Ga0466961_0000028_44829_45464 211
723 3300044706 Ga0466964_0001177 Ga0466964_0001177_6339_6974 211
724 3300044719 Ga0466971_0085858 Ga0466971_0085858_634_1269 211
725 3300044765 Ga0466970_0000663 Ga0466970_0000663_1546_2181 211
726 3300044842 Ga0466957_0253637 Ga0466957_0253637_298_933 211
727 3300045049 Ga0466959_0001381 Ga0466959_0001381_13557_14192 211
728 3300045836 Ga0466958_0002250 Ga0466958_0002250_5395_6030 211
729 3300045976 Ga0466967_0010109 Ga0466967_0010109_4434_5069 211
730 3300046471 Ga0495650_0013555 Ga0495650_0013555_1623_2258 211
731 3300046477 Ga0495664_0320594 Ga0495664_0320594_131_766 211
732 3300046516 Ga0495628_0199103 Ga0495628_0199103_766_1401 211
733 3300046694 Ga0495649_0250098 Ga0495649_0250098_184_819 211
734 3300047320 Ga0495672_0004259 Ga0495672_0004259_10107_10751 211
735 3300048905 Ga0496102_0330758 Ga0496102_0330758_612_1247 211
736 3300048920 Ga0496117_0002039 Ga0496117_0002039_16704_17339 211
737 3300048921 Ga0496118_0001852 Ga0496118_0001852_27226_27861 211
738 3300048929 Ga0496126_0000393 Ga0496126_0000393_87234_87869 211
739 3300048929 Ga0496126_0026239 Ga0496126_0026239_1164_1802 211
740 3300039447 Ga0436361_0260074 Ga0436361_0260074_218_856 212
741 3300046455 Ga0495603_0002700 Ga0495603_0002700_2302_2940 212
742 3300046471 Ga0495650_0003069 Ga0495650_0003069_10171_10809 212
743 3300046472 Ga0495580_0056883 Ga0495580_0056883_1188_1826 212
744 3300046473 Ga0495582_0073253 Ga0495582_0073253_1012_1650 212
745 3300046501 Ga0495607_0265533 Ga0495607_0265533_25_663 212
746 3300046506 Ga0495583_0121861 Ga0495583_0121861_326_964 212
747 3300046507 Ga0495606_0011009 Ga0495606_0011009_6424_7062 212
748 3300046507 Ga0495606_0190929 Ga0495606_0190929_108_746 212
749 3300046517 Ga0495630_0180384 Ga0495630_0180384_182_820 212
750 3300046524 Ga0495648_0262257 Ga0495648_0262257_112_750 212
751 3300046528 Ga0495642_0033729 Ga0495642_0033729_938_1576 212
752 3300046531 Ga0495665_0030811 Ga0495665_0030811_642_1280 212
753 3300046535 Ga0495586_0022555 Ga0495586_0022555_955_1593 212
754 3300046543 Ga0495645_0001415 Ga0495645_0001415_14391_15029 212
755 3300046615 Ga0495656_0359194 Ga0495656_0359194_84_722 212
756 3300046680 Ga0495646_0111933 Ga0495646_0111933_849_1487 212
757 3300046684 Ga0495669_0047580 Ga0495669_0047580_533_1171 212
758 3300046689 Ga0495613_0136456 Ga0495613_0136456_239_877 212
759 3300046694 Ga0495649_0140296 Ga0495649_0140296_408_1046 212
760 3300046809 Ga0495600_0103766 Ga0495600_0103766_1108_1746 212
761 3300047315 Ga0495581_0021619 Ga0495581_0021619_825_1463 212
762 3300047321 Ga0495676_0542856 Ga0495676_0542856_14_652 212
763 3300047323 Ga0495683_0072431 Ga0495683_0072431_767_1405 212
764 3300047444 Ga0495675_0054171 Ga0495675_0054171_1778_2416 212
765 3300048903 Ga0496100_0040842 Ga0496100_0040842_1636_2274 212
766 3300048907 Ga0496104_0150415 Ga0496104_0150415_263_901 212
767 3300048908 Ga0496105_0277076 Ga0496105_0277076_192_830 212
768 3300048910 Ga0496107_0205259 Ga0496107_0205259_286_924 212
769 3300048917 Ga0496114_0000251 Ga0496114_0000251_10269_10907 212
770 iso_pu_bacteria 2501025502 2501076935 212
771 3300005328 Ga0070676_10255487 Ga0070676_102554872 213
772 3300005347 Ga0070668_100150582 Ga0070668_1001505822 213
773 3300005355 Ga0070671_100658049 Ga0070671_1006580491 213
774 3300005367 Ga0070667_100119691 Ga0070667_1001196911 213
775 3300009036 Ga0105244_10197133 Ga0105244_101971331 213
776 3300009176 Ga0105242_10138741 Ga0105242_101387412 213
777 3300013306 Ga0163162_10013214 Ga0163162_100132147 213
778 3300013308 Ga0157375_10083096 Ga0157375_100830962 213
779 3300025903 Ga0207680_10031563 Ga0207680_100315633 213
780 3300025931 Ga0207644_10508790 Ga0207644_105087901 213
781 3300025941 Ga0207711_10089564 Ga0207711_100895642 213
782 3300025972 Ga0207668_10357813 Ga0207668_103578131 213
783 3300025986 Ga0207658_10315606 Ga0207658_103156062 213
784 3300046460 Ga0495638_0007235 Ga0495638_0007235_7018_7659 213
785 3300046474 Ga0495605_0009738 Ga0495605_0009738_3886_4527 213
786 3300046492 Ga0495585_0069244 Ga0495585_0069244_412_1053 213
787 3300046684 Ga0495669_0255589 Ga0495669_0255589_17_658 213
788 3300046691 Ga0495670_0042905 Ga0495670_0042905_1494_2135 213
789 3300046692 Ga0495671_0138357 Ga0495671_0138357_507_1148 213
790 3300046794 Ga0495589_0016179 Ga0495589_0016179_1683_2324 213
791 3300047446 Ga0495679_072484 Ga0495679_072484_210_851 213
792 3300047470 Ga0495681_0115402 Ga0495681_0115402_312_953 213
793 3300048903 Ga0496100_0059266 Ga0496100_0059266_1590_2231 213
794 3300048904 Ga0496101_0023151 Ga0496101_0023151_1440_2081 213
795 3300048906 Ga0496103_0277787 Ga0496103_0277787_102_743 213
796 3300048907 Ga0496104_0046962 Ga0496104_0046962_2704_3345 213
797 3300048924 Ga0496121_0235738 Ga0496121_0235738_439_1080 213
798 3300049459 Ga0495678_068131 Ga0495678_068131_448_1089 213
799 3300001915 JGI24741J21665_1000077 JGI24741J21665_100007722 217
800 3300001979 JGI24740J21852_10002191 JGI24740J21852_100021912 217
801 3300003565 Ga0006560J51390_1031649 Ga0006560J51390_10316491 217
802 3300003751 Ga0055538_1000478 Ga0055538_10004781 217
803 3300003751 Ga0055538_1007661 Ga0055538_10076612 217
804 3300003752 Ga0055539_1000038 Ga0055539_1000038108 217
805 3300003758 Ga0055532_1000002 Ga0055532_1000002527 217
806 3300003759 Ga0055525_1000320 Ga0055525_100032041 217
807 3300003763 Ga0055529_1000113 Ga0055529_100011397 217
808 3300005344 Ga0070661_100000051 Ga0070661_10000005158 217
809 3300005455 Ga0070663_100000012 Ga0070663_10000001283 217
810 3300005564 Ga0070664_100000045 Ga0070664_10000004557 217
811 3300005577 Ga0068857_100062520 Ga0068857_1000625202 217
812 3300005578 Ga0068854_100000127 Ga0068854_1000001274 217
813 3300005614 Ga0068856_100000035 Ga0068856_100000035108 217
814 3300005616 Ga0068852_100080267 Ga0068852_1000802672 217
815 3300009093 Ga0105240_10116230 Ga0105240_101162302 217
816 3300013102 Ga0157371_10000122 Ga0157371_1000012234 217
817 3300013104 Ga0157370_10000025 Ga0157370_1000002585 217
818 3300013105 Ga0157369_10009945 Ga0157369_100099459 217
819 3300013307 Ga0157372_10006313 Ga0157372_1000631313 217
820 3300015261 Ga0182006_1000567 Ga0182006_100056723 217
821 3300020077 Ga0206351_10697103 Ga0206351_106971035 217
822 3300020080 Ga0206350_11308312 Ga0206350_113083124 217
823 3300020610 Ga0154015_1248418 Ga0154015_124841824 217
824 3300025224 Ga0209784_100003 Ga0209784_100003186 217
825 3300025225 Ga0209566_100002 Ga0209566_1000021230 217
826 3300025225 Ga0209566_101550 Ga0209566_1015502 217
827 3300025226 Ga0209674_100008 Ga0209674_100008960 217
828 3300025228 Ga0209672_100202 Ga0209672_10020225 217
829 3300025229 Ga0209147_100002 Ga0209147_1000022056 217
830 3300025230 Ga0209563_100004 Ga0209563_100004642 217
831 3300025230 Ga0209563_100026 Ga0209563_100026107 217
832 3300025230 Ga0209563_104242 Ga0209563_1042423 217
833 3300025242 Ga0209258_100002 Ga0209258_1000022056 217
834 3300025253 Ga0209677_100013 Ga0209677_100013265 217
835 3300025254 Ga0209148_1004949 Ga0209148_10049493 217
836 3300025256 Ga0209759_1027372 Ga0209759_10273722 217
837 3300025272 Ga0209455_1000021 Ga0209455_1000021643 217
838 3300025920 Ga0207649_10000252 Ga0207649_1000025226 217
839 3300025945 Ga0207679_10000001 Ga0207679_10000001651 217
840 3300025981 Ga0207640_10000119 Ga0207640_100001199 217
841 3300026067 Ga0207678_10000004 Ga0207678_10000004126 217
842 3300026078 Ga0207702_10000029 Ga0207702_10000029149 217
843 3300026142 Ga0207698_10066979 Ga0207698_100669793 217
844 3300037418 Ga0395900_0002540 Ga0395900_0002540_14085_14738 217
845 3300044650 Ga0466986_0130492 Ga0466986_0130492_299_952 217
846 3300048928 Ga0496125_0067667 Ga0496125_0067667_729_1382 217
847 3300059508 Ga0587088_000147 Ga0587088_000147_431_1084 217
848 3300059643 Ga0587072_000202 Ga0587072_000202_1329_1982 217

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00677

Lum_binding

Lumazine binding domain

113

201

0.95

PF00677

Lum_binding

Lumazine binding domain

14

100

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.9316 102 189
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.8992 1 201
1hze-assembly1.cif.gz_A solution structure of the n-terminal domain of riboflavin synthase from e. coli 0.8974 105 189
1pkv-assembly1.cif.gz_B the n-terminal domain of riboflavin synthase in complex with riboflavin 0.8911 102 189
4fxu-assembly1.cif.gz_A crystallographic structure of trimeric riboflavin synthase from brucella abortus 0.8903 1 201
ID Description Score Start End Superfamily
3a3bA02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9188 97 188 2.40.30.20
af_P9WK35_1_88_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9174 102 189 2.40.30.20
af_P0AFU8_1_89_2.40.30.20 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.916 102 189 2.40.30.20
3a3bB02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9086 99 189 2.40.30.20
4fxuC02 Mainly Beta;Beta Barrel;Elongation Factor Tu (Ef-tu); domain 3; 0.9039 104 198 2.40.30.20
ID Description Score Start End GO Terms
AF-A0A1F4CS80-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9598 1 191 GO:0004746
GO:0009231
AF-A0A2N2QZS8-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.958 1 149 GO:0004746
GO:0009231
AF-A0A2W5F3I4-F1-model_v4 deleted 0.9547 1 134
AF-A0A1F4CS80-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9546 1 191 GO:0004746
GO:0009231
AF-I3U9P5-F1-model_v4 Riboflavin synthase (EC 2.5.1.9) 0.9544 1 138 GO:0004746
GO:0009231

Feature Viewer

pLDDT pTM Quality
85.79 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map