F483365

General Info

Members Datasets Scaffolds Average Seq Length
848 673 337 193

Family's Representative Sequence

Representative Sequence 3300009765|Ga0123341_1000032|Ga0123341_100003224
Length 215
Sequence MPLDTFFALVLFAFTTSITPGPNNMMLFASGVNFGFRRTVPHMFGIGVGFFSLLHAVPVAYTVLKFAGGAYLVWIAWKIASSRSLSEGKSGVKPMSFFAAAAFQWVNPKAWVMAVTAMATYTNPQLYLVSVLIVGLAFAAVNIPSVSTWAGFGSALREWLSDPVRLKWFNISMAVLLVASLWPMLNRAIAGFVSISQRMPRTAAKAGKPQANQMR

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
6 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
17 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
18 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
19 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
20 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
21 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
22 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
23 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
24 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
25 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
26 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
27 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
28 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
29 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
30 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
31 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
32 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
33 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
34 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
35 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
36 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
37 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
38 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
39 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
40 2516143018 Ensifer sp. BR816 Isolate Nodule
41 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
42 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
43 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
44 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
45 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
46 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
47 2519899620 Rhizobium sp. Pop5 Isolate Nodule
48 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
49 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
50 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
51 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
52 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
53 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
54 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
55 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
56 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
57 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
58 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
59 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
60 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
61 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
62 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
63 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
64 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
65 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
66 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
67 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
68 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
69 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
70 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
71 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
72 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
73 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
74 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
75 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
76 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
77 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
78 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
79 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
80 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
81 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
82 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
83 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
84 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
85 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
86 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
87 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
88 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
89 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
90 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
91 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
92 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
93 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
94 2643221557 Ensifer sp. Root558 Isolate Unclassified
95 2643221607 Rhizobium sp. Root73 Isolate Unclassified
96 2643221610 Ensifer sp. Root74 Isolate Unclassified
97 2643221618 Ensifer sp. Root231 Isolate Unclassified
98 2643221626 Ensifer sp. Root31 Isolate Unclassified
99 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
100 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
101 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
102 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
103 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
104 2643221655 Ensifer sp. Root1252 Isolate Unclassified
105 2643221659 Ensifer sp. Root127 Isolate Unclassified
106 2643221668 Ensifer sp. Root423 Isolate Unclassified
107 2643221675 Ensifer sp. Root1298 Isolate Unclassified
108 2643221680 Ensifer sp. Root1312 Isolate Unclassified
109 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
110 2643221688 Rhizobium sp. Root482 Isolate Unclassified
111 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
112 2643221693 Rhizobium sp. Root491 Isolate Unclassified
113 2643221698 Ensifer sp. Root142 Isolate Unclassified
114 2643221712 Ensifer sp. Root258 Isolate Unclassified
115 2643221718 Rhizobium sp. Root268 Isolate Unclassified
116 2643221719 Rhizobium sp. Root274 Isolate Unclassified
117 2643221723 Ensifer sp. Root278 Isolate Unclassified
118 2643221726 Ensifer sp. Root954 Isolate Unclassified
119 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
120 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
121 2718217882 Rhizobium sp. N741 Isolate Nodule
122 2718217927 Rhizobium sp. N324 Isolate Nodule
123 2718218009 Rhizobium sp. N561 Isolate Nodule
124 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
125 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
126 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
127 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
128 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
129 2718218363 Rhizobium sp. N113 Isolate Nodule
130 2718218365 Rhizobium sp. N731 Isolate Nodule
131 2718218366 Rhizobium sp. N621 Isolate Nodule
132 2718218423 Rhizobium sp. N941 Isolate Nodule
133 2721755514 Rhizobium sp. N6212 Isolate Nodule
134 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
135 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
136 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
137 2721755809 Rhizobium sp. N541 Isolate Nodule
138 2721755810 Rhizobium sp. N871 Isolate Nodule
139 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
140 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
141 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
142 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
143 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
144 2728369365 Rhizobium sp. N1341 Isolate Nodule
145 2728369397 Rhizobium sp. N1314 Isolate Nodule
146 2738541293 Rhizobium sp. GV031 Isolate Unclassified
147 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
148 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
149 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
150 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
151 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
152 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
153 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
154 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
155 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
156 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
157 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
158 2791355256 Rhizobium sp. M10 Isolate Nodule
159 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
160 2791355260 Rhizobium sp. L9 Isolate Nodule
161 2791355261 Rhizobium sp. J15 Isolate Nodule
162 2791355262 Rhizobium sp. M1 Isolate Nodule
163 2791355263 Rhizobium chutanense C5 Isolate Nodule
164 2791355264 Rhizobium sp. S9 Isolate Nodule
165 2791355265 Rhizobium sp. H4 Isolate Nodule
166 2791355266 Rhizobium sp. L43 Isolate Nodule
167 2791355267 Rhizobium sp. L18 Isolate Nodule
168 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
169 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
170 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
171 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
172 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
173 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
174 2802429633 Rhizobium anhuiense J3 Isolate Nodule
175 2802429634 Rhizobium anhuiense S10 Isolate Nodule
176 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
177 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
178 2802429637 Rhizobium anhuiense C15 Isolate Nodule
179 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
180 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
181 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
182 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
183 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
184 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
185 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
186 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
187 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
188 2838048938 Rhizobium pisi 27/80 Isolate Nodule
189 2838061910 Rhizobium phaseoli L15 Isolate Nodule
190 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
191 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
192 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
193 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
194 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
195 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
196 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
197 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
198 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
199 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
200 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
201 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
202 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
203 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
204 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
205 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
206 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
207 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
208 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
209 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
210 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
211 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
212 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
213 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
214 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
215 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
216 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
217 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
218 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
219 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
220 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
221 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
222 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
223 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
224 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
225 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
226 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
227 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
228 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
229 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
230 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
231 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
232 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
233 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
234 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
235 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
236 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
237 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
238 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
239 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
240 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
241 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
242 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
243 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
244 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
245 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
246 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
247 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
248 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
249 2844163670 Ensifer sp. 1H6 Isolate Unclassified
250 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
251 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
252 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
253 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
254 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
255 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
256 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
257 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
258 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
259 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
260 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
261 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
262 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
263 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
264 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
265 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
266 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
267 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
268 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
269 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
270 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
271 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
272 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
273 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
274 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
275 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
276 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
277 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
278 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
279 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
280 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
281 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
282 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
283 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
284 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
285 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
286 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
287 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
288 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
289 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
290 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
291 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
292 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
293 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
294 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
295 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
296 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
297 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
298 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
299 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
300 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
301 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
302 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
303 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
304 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
305 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
306 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
307 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
308 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
309 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
310 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
311 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
312 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
313 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
314 2933599457 Rhizobium phaseoli M3 Isolate Nodule
315 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
316 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
317 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
318 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
319 2936381700 Rhizobium chutanense C16 Isolate Unclassified
320 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
321 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
322 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
323 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
324 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
325 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
326 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
327 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
328 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
329 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
330 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
331 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
332 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
333 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
334 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
335 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
336 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
337 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
338 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
339 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
340 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
341 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
342 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
343 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
344 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
345 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
346 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
347 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
348 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
349 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
350 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
351 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
352 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
353 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
354 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
355 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
356 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
357 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
358 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
359 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
360 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
361 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
362 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
363 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
364 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
365 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
366 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
367 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
368 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
369 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
370 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
371 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
372 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
373 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
374 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
375 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
376 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
377 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
378 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
379 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
380 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
381 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
382 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
383 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
384 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
385 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
386 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
387 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
388 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
389 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
390 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
391 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
392 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
393 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
394 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
395 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
396 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
397 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
398 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
399 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
400 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
401 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
402 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
403 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
404 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
405 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
406 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
407 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
408 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
409 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
410 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
411 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
412 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
413 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
414 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
415 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
416 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
417 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
418 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
419 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
420 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
421 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
422 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
423 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
424 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
425 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
426 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
427 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
428 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
429 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
430 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
431 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
432 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
433 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
434 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
435 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
436 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
437 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
438 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
439 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
440 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
441 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
442 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
443 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
444 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
445 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
446 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
447 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
448 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
449 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
450 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
451 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
452 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
453 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
454 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
455 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
456 2996887358 Rhizobium sp. R711 Isolate Nodule
457 2996893221 Rhizobium sp. R635 Isolate Nodule
458 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
459 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
460 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
461 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
462 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
463 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
464 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
465 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
466 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
467 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
468 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
469 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
470 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
471 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
472 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
473 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
474 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
475 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
476 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
477 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
478 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
479 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
480 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
481 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
482 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
483 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
484 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
485 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
486 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
487 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
488 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
489 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
490 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
491 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
492 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
493 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
494 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
495 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
496 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
497 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
498 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
499 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
500 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
501 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
502 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
503 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
504 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
505 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
506 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
507 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
508 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
509 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
510 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
511 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
512 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
513 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
514 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
515 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
516 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
517 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
518 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
519 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
520 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
521 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
522 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
523 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
524 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
525 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
526 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
527 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
528 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
529 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
530 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
531 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
532 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
533 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
534 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
535 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
536 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
537 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
538 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
539 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
540 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
541 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
542 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
543 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
544 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
545 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
546 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
547 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
548 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
549 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
550 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
551 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
552 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
553 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
554 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
555 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
556 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
557 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
558 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
559 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
560 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
561 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
562 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
563 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
564 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
565 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
566 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
567 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
568 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
569 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
570 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
571 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
572 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
573 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
574 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
575 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
576 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
577 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
578 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
579 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
580 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
581 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
582 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
583 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
584 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
585 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
586 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
587 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
588 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
589 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
590 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
591 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
592 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
593 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
594 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
595 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
596 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
597 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
598 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
599 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
600 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
601 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
602 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
603 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
604 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
605 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
606 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
607 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
608 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
609 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
610 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
611 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
612 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
613 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
614 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
615 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
616 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
617 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
618 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
619 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
620 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
621 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
622 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
623 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
624 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
625 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
626 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
627 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
628 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
629 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
630 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
631 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
632 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
633 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
634 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
635 8005258706 Rhizobium sp. R693 Isolate Nodule
636 8005275841 Rhizobium sp. N4311 Isolate Nodule
637 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
638 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
639 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
640 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
641 8005321885 Rhizobium sp. R72 Isolate Nodule
642 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
643 8005382845 Rhizobium sp. R634 Isolate Nodule
644 8005395548 Rhizobium sp. R339 Isolate Nodule
645 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
646 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
647 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
648 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
649 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
650 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
651 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
652 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
653 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
654 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
655 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
656 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
657 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
658 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
659 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
660 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
661 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
662 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
663 8018176218 Rhizobium sp. N122 Isolate Nodule
664 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
665 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
666 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
667 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
668 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
669 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
670 8056382006 Rhizobium croatiense 13T Isolate Nodule
671 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
672 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
673 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.5
Metatranscriptomes 0.24
Isolates 60.26

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 19.1
Nodule 45.17
Rhizoplane 1.42
Rhizosphere 16.04
Stem 0
Stem Tuber 0
Unclassified 17.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000336 3300002739 Bacteria 10357
2 JGI25152J39213_1000826 3300002773 Bacteria 15432
3 JGI25152J39213_1006182 3300002773 Bacteria 3323
4 JGI25152J39213_1006351 3300002773 Bacteria 3243
5 JGI25152J39213_1017437 3300002773 Bacteria 1356
6 JGI25150J39212_1000165 3300002774 Bacteria 37364
7 JGI25150J39212_1000307 3300002774 Bacteria 24463
8 JGI25150J39212_1006463 3300002774 Bacteria 2416
9 JGI25159J45721_1000040 3300002987 Bacteria 68143
10 JGI25159J45721_1000966 3300002987 Bacteria 12481
11 JGI25151J46595_10000329 3300003187 Bacteria 51364
12 JGI25151J46595_10005981 3300003187 Bacteria 6194
13 JGI25151J46595_10024415 3300003187 Bacteria 2474
14 JGI25151J46595_10034270 3300003187 Bacteria 1944
15 JGI25153J46596_10003631 3300003215 Bacteria 8560
16 JGI25153J46596_10009561 3300003215 Bacteria 4484
17 JGI25153J46596_10012453 3300003215 Bacteria 3669
18 JGI25153J46596_10014210 3300003215 Bacteria 3323
19 JGI25153J46596_10026848 3300003215 Bacteria 2029
20 JGI25153J46596_10043631 3300003215 Bacteria 1356
21 rootH2_10199801 3300003320 Bacteria 1227
22 rootL2_10127000 3300003322 Bacteria 2632
23 JGI25160J50197_1000001 3300003354 Bacteria 782301
24 JGI25160J50197_1000128 3300003354 Bacteria 68143
25 JGI25161J50226_1000001 3300003374 Bacteria 655036
26 JGI25161J50226_1000996 3300003374 Bacteria 9921
27 Ga0006562J51391_1036025 3300003578 Bacteria 1556
28 Ga0055526_1001311 3300003771 Bacteria 17836
29 Ga0055526_1001851 3300003771 Bacteria 14653
30 Ga0055526_1005523 3300003771 Bacteria 7236
31 Ga0055526_1007857 3300003771 Bacteria 5451
32 Ga0055524_1002368 3300003775 Bacteria 9799
33 Ga0055524_1004414 3300003775 Bacteria 6490
34 Ga0055524_1015223 3300003775 Bacteria 2814
35 Ga0055524_1053175 3300003775 Bacteria 899
36 Ga0055536_1002507 3300003781 Bacteria 10298
37 Ga0055536_1009417 3300003781 Bacteria 4039
38 Ga0055528_1001122 3300003790 Bacteria 17570
39 Ga0055528_1003598 3300003790 Bacteria 7716
40 Ga0055528_1004902 3300003790 Bacteria 6318
41 Ga0055528_1011411 3300003790 Bacteria 3531
42 Ga0055528_1013658 3300003790 Bacteria 3061
43 Ga0055528_1014492 3300003790 Bacteria 2914
44 Ga0055528_1026156 3300003790 Bacteria 1689
45 Ga0055530_10016163 3300003791 Bacteria 2396
46 Ga0055530_10018535 3300003791 Bacteria 2142
47 Ga0055540_1000283 3300003792 Bacteria 45546
48 Ga0055540_1006077 3300003792 Bacteria 4876
49 Ga0055540_1008899 3300003792 Bacteria 3547
50 Ga0055540_1021104 3300003792 Bacteria 1701
51 Ga0055531_10014920 3300003794 Bacteria 3465
52 Ga0055531_10019396 3300003794 Bacteria 2751
53 Ga0055543_1000003 3300004625 Bacteria 358656
54 Ga0055543_1000130 3300004625 Bacteria 62045
55 Ga0065165_1000013 3300005262 Bacteria 301887
56 Ga0065165_1000068 3300005262 Bacteria 170609
57 Ga0065165_1018622 3300005262 Bacteria 2506
58 Ga0070668_100484784 3300005347 Bacteria 1068
59 Ga0070669_100366031 3300005353 Bacteria 1173
60 Ga0070671_100043123 3300005355 Bacteria 3750
61 Ga0075365_10002254 3300006038 Bacteria 9345
62 Ga0075365_10146606 3300006038 Bacteria 1640
63 Ga0075363_100171077 3300006048 Bacteria 1233
64 Ga0075362_10199156 3300006177 Bacteria 974
65 Ga0075367_10111600 3300006178 Bacteria 1679
66 Ga0075369_10000132 3300006186 Bacteria 20799
67 Ga0075369_10055198 3300006186 Bacteria 1726
68 Ga0075370_10103814 3300006353 Bacteria 1647
69 Ga0105248_10041256 3300009177 Bacteria 5173
70 Ga0105248_10055062 3300009177 Bacteria 4461
71 Ga0123341_1000032 3300009765 Bacteria 62527
72 Ga0123342_1005565 3300009766 Bacteria 18132
73 Ga0123342_1021015 3300009766 Bacteria 4659
74 Ga0171463_1003 3300013249 Bacteria 695693
75 Ga0157375_10860375 3300013308 Bacteria 1053
76 Ga0183363_1104 3300015690 Bacteria 24110
77 Ga0214543_1000038 3300021327 Bacteria 182106
78 Ga0228710_1000009 3300022740 Bacteria 169770
79 Ga0209436_100478 3300025208 Bacteria 17685
80 Ga0207425_1000024 3300025245 Bacteria 328978
81 Ga0207425_1006299 3300025245 Bacteria 3259
82 Ga0207425_1006673 3300025245 Bacteria 3131
83 Ga0207425_1022530 3300025245 Bacteria 1326
84 Ga0207425_1029056 3300025245 Bacteria 1117
85 Ga0209129_1000146 3300025258 Bacteria 115180
86 Ga0209129_1000161 3300025258 Bacteria 102017
87 Ga0209129_1001999 3300025258 Bacteria 10596
88 Ga0209129_1002877 3300025258 Bacteria 7934
89 Ga0209129_1005114 3300025258 Bacteria 4803
90 Ga0209129_1022237 3300025258 Bacteria 1148
91 Ga0209129_1025995 3300025258 Bacteria 1015
92 Ga0209673_1000010 3300025273 Bacteria 596656
93 Ga0209673_1000384 3300025273 Bacteria 79540
94 Ga0209673_1000977 3300025273 Bacteria 35281
95 Ga0209673_1004894 3300025273 Bacteria 6978
96 Ga0209673_1005688 3300025273 Bacteria 6218
97 Ga0209673_1013499 3300025273 Bacteria 3218
98 Ga0209673_1091836 3300025273 Bacteria 670
99 Ga0209130_1000003 3300025284 Bacteria 677988
100 Ga0209130_1000034 3300025284 Bacteria 302439
101 Ga0209130_1027074 3300025284 Bacteria 1222
102 Ga0209676_1001813 3300025292 Bacteria 17850
103 Ga0209676_1002914 3300025292 Bacteria 11195
104 Ga0209676_1034652 3300025292 Bacteria 1490
105 Ga0209025_1000050 3300025294 Bacteria 331531
106 Ga0209025_1002141 3300025294 Bacteria 22141
107 Ga0209025_1005836 3300025294 Bacteria 9857
108 Ga0209025_1006154 3300025294 Bacteria 9440
109 Ga0209025_1071243 3300025294 Bacteria 1233
110 Ga0209025_1113848 3300025294 Bacteria 824
111 Ga0209564_1000013 3300025295 Bacteria 775755
112 Ga0209564_1000388 3300025295 Bacteria 79331
113 Ga0209564_1000512 3300025295 Bacteria 63708
114 Ga0209564_1005163 3300025295 Bacteria 7580
115 Ga0209758_1000083 3300025297 Bacteria 257283
116 Ga0209758_1000642 3300025297 Bacteria 53219
117 Ga0209758_1002951 3300025297 Bacteria 16327
118 Ga0209758_1003069 3300025297 Bacteria 15878
119 Ga0209758_1003364 3300025297 Bacteria 14653
120 Ga0209758_1009029 3300025297 Bacteria 6300
121 Ga0209758_1012299 3300025297 Bacteria 4804
122 Ga0209758_1046605 3300025297 Bacteria 1561
123 Ga0209758_1060767 3300025297 Bacteria 1249
124 Ga0209758_1099502 3300025297 Bacteria 830
125 Ga0209050_1002022 3300025298 Bacteria 18857
126 Ga0209256_1000442 3300025299 Bacteria 63395
127 Ga0209256_1001584 3300025299 Bacteria 22294
128 Ga0209256_1002304 3300025299 Bacteria 15989
129 Ga0209256_1003052 3300025299 Bacteria 12342
130 Ga0209256_1020294 3300025299 Bacteria 2079
131 Ga0209256_1021361 3300025299 Bacteria 1990
132 Ga0207426_1000006 3300025302 Bacteria 1025969
133 Ga0207426_1000011 3300025302 Bacteria 791203
134 Ga0207426_1002076 3300025302 Bacteria 13895
135 Ga0209051_1000308 3300025303 Bacteria 76477
136 Ga0209051_1002410 3300025303 Bacteria 13449
137 Ga0209051_1003936 3300025303 Bacteria 9464
138 Ga0209051_1007466 3300025303 Bacteria 5969
139 Ga0209051_1042307 3300025303 Bacteria 1611
140 Ga0209257_1000853 3300025304 Bacteria 43617
141 Ga0209257_1002648 3300025304 Bacteria 17217
142 Ga0209257_1003491 3300025304 Bacteria 13392
143 Ga0209257_1021628 3300025304 Bacteria 2328
144 Ga0207681_10147234 3300025923 Bacteria 1761
145 Ga0207711_10014356 3300025941 Bacteria 6578
146 Ga0207711_10015952 3300025941 Bacteria 6232
147 Ga0209974_10026978 3300027876 Bacteria 1900
148 Ga0268266_10381118 3300028379 Bacteria 1330
149 Ga0307515_10017597 3300028794 Bacteria 13001
150 Ga0307515_10025749 3300028794 Bacteria 10161
151 Ga0307515_10188841 3300028794 Bacteria 1979
152 Ga0307513_10093771 3300031456 Bacteria 3050
153 Ga0307408_100346790 3300031548 Bacteria 1259
154 Ga0307412_11023142 3300031911 Bacteria 731
155 Ga0307416_101434602 3300032002 Bacteria 796
156 Ga0307414_10082671 3300032004 Bacteria 2355
157 Ga0315913_1000006 3300033430 Bacteria 169893
158 Ga0395905_0000736 3300037471 Bacteria 43138
159 Ga0439436_0001576 3300041404 Bacteria 6644
160 Ga0439436_0012157 3300041404 Bacteria 2613
161 Ga0439439_0027963 3300041406 Bacteria 1426
162 Ga0439465_0001082 3300041413 Bacteria 8718
163 Ga0439465_0004189 3300041413 Bacteria 4692
164 Ga0439465_0218761 3300041413 Bacteria 698
165 Ga0451787_436462 3300041441 Bacteria 1242
166 Ga0451791_0821308 3300041451 Bacteria 2156
167 Ga0451833_0225210 3300041491 Bacteria 836
168 Ga0451837_0392092 3300041494 Bacteria 3031
169 Ga0451837_0569472 3300041494 Bacteria 1243
170 Ga0451839_0313923 3300041496 Bacteria 4452
171 Ga0451841_0936760 3300041498 Bacteria 1090
172 Ga0451846_55098 3300041502 Bacteria 766
173 Ga0451847_0237521 3300041503 Bacteria 1694
174 Ga0451847_0735982 3300041503 Bacteria 1749
175 Ga0451849_1213583 3300041505 Bacteria 856
176 Ga0451851_0161803 3300041507 Bacteria 5715
177 Ga0451843_0233737 3300041509 Bacteria 1014
178 Ga0451843_0998701 3300041509 Bacteria 2137
179 Ga0451855_0713139 3300041511 Bacteria 956
180 Ga0451853_0211463 3300041512 Bacteria 1657
181 Ga0451853_1152098 3300041512 Bacteria 5309
182 Ga0451853_1888721 3300041512 Bacteria 749
183 Ga0439431_0028971 3300041997 Bacteria 1366
184 Ga0450906_004190 3300042145 Bacteria 3040
185 Ga0450906_061604 3300042145 Bacteria 668
186 Ga0439434_0009578 3300042435 Bacteria 2850
187 Ga0466970_0069085 3300044765 Bacteria 1899
188 Ga0495617_013469 3300046452 Bacteria 2784
189 Ga0495638_0000195 3300046460 Bacteria 88030
190 Ga0495650_0047306 3300046471 Bacteria 1800
191 Ga0495605_0007566 3300046474 Bacteria 6160
192 Ga0495605_0018481 3300046474 Bacteria 3737
193 Ga0495585_0006794 3300046492 Bacteria 7061
194 Ga0495596_0021263 3300046500 Bacteria 2650
195 Ga0495607_0153511 3300046501 Bacteria 1176
196 Ga0495583_0101246 3300046506 Bacteria 1229
197 Ga0495606_0010451 3300046507 Bacteria 7701
198 Ga0495606_0236521 3300046507 Bacteria 1021
199 Ga0495610_0001253 3300046512 Bacteria 22804
200 Ga0495610_0011895 3300046512 Bacteria 5282
201 Ga0495620_0048655 3300046515 Bacteria 1818
202 Ga0495631_0001628 3300046518 Bacteria 13398
203 Ga0495631_0056441 3300046518 Bacteria 1710
204 Ga0495632_0080978 3300046519 Bacteria 1548
205 Ga0495643_0007771 3300046522 Bacteria 6862
206 Ga0495643_0015966 3300046522 Bacteria 4421
207 Ga0495643_0078291 3300046522 Bacteria 1726
208 Ga0495643_0099412 3300046522 Bacteria 1492
209 Ga0495648_0091124 3300046524 Bacteria 1706
210 Ga0495648_0196670 3300046524 Bacteria 1013
211 Ga0495663_0008753 3300046525 Bacteria 2807
212 Ga0495597_0011360 3300046542 Bacteria 4320
213 Ga0495633_0012064 3300046558 Bacteria 4615
214 Ga0495656_0219239 3300046615 Bacteria 951
215 Ga0495668_0013421 3300046616 Bacteria 4832
216 Ga0495611_0009701 3300046648 Bacteria 4069
217 Ga0495611_0058439 3300046648 Bacteria 1749
218 Ga0495625_0000621 3300046660 Bacteria 51568
219 Ga0495625_0003972 3300046660 Bacteria 14184
220 Ga0495625_0151117 3300046660 Bacteria 1561
221 Ga0495625_0251681 3300046660 Bacteria 1146
222 Ga0495670_0016423 3300046691 Bacteria 3638
223 Ga0495670_0095238 3300046691 Bacteria 1527
224 Ga0495671_0077923 3300046692 Bacteria 1625
225 Ga0495660_0021318 3300046810 Bacteria 3711
226 Ga0495660_0046709 3300046810 Bacteria 2373
227 Ga0495636_0077919 3300047318 Bacteria 1423
228 Ga0495672_0005251 3300047320 Bacteria 10318
229 Ga0495687_071448 3300047443 Bacteria 1390
230 Ga0495686_0003045 3300047472 Bacteria 14859
231 Ga0495686_0033251 3300047472 Bacteria 3331
232 Ga0495686_0046675 3300047472 Bacteria 2737
233 Ga0495626_0069954 3300048091 Bacteria 1580
234 Ga0495626_0242227 3300048091 Bacteria 726
235 Ga0496102_0033698 3300048905 Bacteria 4604
236 Ga0496106_0000578 3300048909 Bacteria 26182
237 Ga0496110_0011425 3300048913 Bacteria 7268
238 Ga0496113_0178332 3300048916 Bacteria 1684
239 Ga0496114_0986492 3300048917 Bacteria 725
240 Ga0496116_0007652 3300048919 Bacteria 9529
241 Ga0496116_0021014 3300048919 Bacteria 4936
242 Ga0496116_0098082 3300048919 Bacteria 1759
243 Ga0496116_0301076 3300048919 Bacteria 763
244 Ga0496117_0011077 3300048920 Bacteria 8114
245 Ga0496117_0076711 3300048920 Bacteria 2214
246 Ga0496117_0130386 3300048920 Bacteria 1525
247 Ga0496118_0007840 3300048921 Bacteria 11196
248 Ga0496118_0013080 3300048921 Bacteria 7889
249 Ga0496118_0027940 3300048921 Bacteria 4764
250 Ga0496119_0187637 3300048922 Bacteria 1080
251 Ga0496119_0293636 3300048922 Bacteria 804
252 Ga0496121_0009569 3300048924 Bacteria 11104
253 Ga0496121_0011992 3300048924 Bacteria 9529
254 Ga0496121_0029632 3300048924 Bacteria 5052
255 Ga0496121_0042223 3300048924 Bacteria 3971
256 Ga0496121_0061579 3300048924 Bacteria 3078
257 Ga0496121_0085895 3300048924 Bacteria 2474
258 Ga0496121_0086354 3300048924 Bacteria 2466
259 Ga0496121_0344383 3300048924 Bacteria 995
260 Ga0496122_0002690 3300048925 Bacteria 24724
261 Ga0496122_0013904 3300048925 Bacteria 7829
262 Ga0496122_0016080 3300048925 Bacteria 7110
263 Ga0496122_0035177 3300048925 Bacteria 4083
264 Ga0496122_0045332 3300048925 Bacteria 3419
265 Ga0496122_0459654 3300048925 Bacteria 629
266 Ga0496123_0000054 3300048926 Bacteria 234046
267 Ga0496123_0009709 3300048926 Bacteria 8623
268 Ga0496123_0019000 3300048926 Bacteria 5432
269 Ga0496123_0045692 3300048926 Bacteria 2980
270 Ga0496123_0062910 3300048926 Bacteria 2374
271 Ga0496124_0001702 3300048927 Bacteria 31109
272 Ga0496124_0006525 3300048927 Bacteria 12691
273 Ga0496124_0034478 3300048927 Bacteria 4441
274 Ga0496124_0038771 3300048927 Bacteria 4134
275 Ga0496124_0100509 3300048927 Bacteria 2344
276 Ga0496124_0131331 3300048927 Bacteria 1989
277 Ga0496125_0000273 3300048928 Bacteria 104663
278 Ga0496125_0012546 3300048928 Bacteria 8403
279 Ga0496125_0064881 3300048928 Bacteria 2898
280 Ga0496125_0085645 3300048928 Bacteria 2387
281 Ga0496125_0217125 3300048928 Bacteria 1236
282 Ga0496125_0396043 3300048928 Bacteria 809
283 Ga0496126_0000589 3300048929 Bacteria 68753
284 Ga0496126_0022038 3300048929 Bacteria 6208
285 Ga0496126_0044422 3300048929 Bacteria 4092
286 Ga0496126_0373740 3300048929 Bacteria 1162
287 Ga0496126_0518452 3300048929 Bacteria 950
288 Ga0495678_091705 3300049459 Bacteria 1069
289 Ga0495678_103658 3300049459 Bacteria 982
290 Ga0501032_0057958 3300049569 Bacteria 2601
291 Ga0501033_0150145 3300049570 Bacteria 1681
292 Ga0501034_0780151 3300049571 Bacteria 849
293 Ga0501036_0164362 3300049572 Bacteria 1871
294 Ga0501037_0123580 3300049573 Bacteria 1859
295 Ga0501039_0109357 3300049575 Bacteria 2161
296 Ga0501043_0191596 3300049579 Bacteria 1590
297 Ga0501073_0213904 3300049589 Bacteria 1332
298 Ga0501276_008926 3300049773 Bacteria 823
299 Ga0501035_0097802 3300049822 Bacteria 2577
300 Ga0501044_0056630 3300049823 Bacteria 4025
301 Ga0501044_0618799 3300049823 Bacteria 974
302 nmdc:mga00v17_99741_c1 3300050491 Bacteria 1832
303 nmdc:mga0yw44_10832_c1 3300050492 Bacteria 4674
304 nmdc:mga0yw44_213667_c1 3300050492 Bacteria 1276
305 nmdc:mga07m45_129080_c1 3300050496 Bacteria 1462
306 nmdc:mga07m45_170867_c1 3300050496 Bacteria 1263
307 nmdc:mga0sz30_10737_c2 3300050516 Bacteria 1325
308 nmdc:mga0sz30_286662_c1 3300050516 Bacteria 734
309 Ga0500610_0034789 3300053079 Bacteria 2580
310 Ga0495655_0021806 3300053083 Bacteria 1455
311 Ga0500578_0117842 3300053086 Bacteria 1670
312 Ga0500643_023448 3300053087 Bacteria 1971
313 Ga0500557_003926 3300053105 Bacteria 3039
314 Ga0500562_019999 3300053108 Bacteria 1737
315 Ga0500569_009973 3300053109 Bacteria 2222
316 Ga0500569_012112 3300053109 Bacteria 2078
317 Ga0500594_0002292 3300053118 Bacteria 4149
318 Ga0500608_029678 3300053122 Bacteria 2588
319 Ga0500658_0002369 3300053134 Bacteria 7302
320 Ga0500658_0132682 3300053134 Bacteria 1112
321 Ga0500659_0108663 3300053135 Bacteria 1429
322 Ga0500559_0005229 3300053136 Bacteria 5983
323 Ga0500568_0005767 3300053139 Bacteria 6338
324 Ga0500568_0008709 3300053139 Bacteria 4869
325 Ga0500568_0060281 3300053139 Bacteria 1470
326 Ga0500568_0068957 3300053139 Bacteria 1357
327 Ga0500604_0007759 3300053151 Bacteria 2844
328 Ga0500616_0000884 3300053153 Bacteria 33039
329 Ga0500616_0019444 3300053153 Bacteria 3828
330 Ga0500616_0091969 3300053153 Bacteria 1500
331 Ga0500616_0189017 3300053153 Bacteria 921
332 Ga0500622_0000697 3300053156 Bacteria 29561
333 Ga0500622_0000899 3300053156 Bacteria 25323
334 Ga0500622_0191860 3300053156 Bacteria 936
335 Ga0500627_0015706 3300053158 Bacteria 2935
336 Ga0500633_0031808 3300053160 Bacteria 1708
337 Ga0500599_004643 3300053736 Bacteria 1703

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048927 Ga0496124_0131331 Ga0496124_0131331_12_512 156
2 3300046525 Ga0495663_0008753 Ga0495663_0008753_2270_2791 163
3 3300048925 Ga0496122_0459654 Ga0496122_0459654_74_595 164
4 3300003790 Ga0055528_1003598 Ga0055528_10035988 167
5 iso_pu_bacteria 2964628898 2964632987 175
6 iso_pu_bacteria 2964719344 2964724635 175
7 3300003320 rootH2_10199801 rootH2_101998012 180
8 3300048922 Ga0496119_0187637 Ga0496119_0187637_220_813 180
9 iso_pu_bacteria 2508501122 2509111329 184
10 iso_pu_bacteria 2509276019 2509376393 184
11 iso_pu_bacteria 2509276021 2509392132 184
12 iso_pu_bacteria 2509276033 2509445778 184
13 iso_pu_bacteria 2509276033 2509446920 184
14 iso_pu_bacteria 2510065019 2510133878 184
15 iso_pu_bacteria 2510065057 2510304391 184
16 iso_pu_bacteria 2510461069 2510840077 184
17 iso_pu_bacteria 2510461076 2510895299 184
18 iso_pu_bacteria 2510917022 2511135317 184
19 iso_pu_bacteria 2510917026 2511173698 184
20 iso_pu_bacteria 2510917028 2511186984 184
21 iso_pu_bacteria 2510917030 2511196079 184
22 iso_pu_bacteria 2511231027 2511389781 184
23 iso_pu_bacteria 2511231052 2511502165 184
24 iso_pu_bacteria 2512047086 2512533544 184
25 iso_pu_bacteria 2512875026 2512970781 184
26 iso_pu_bacteria 2513237084 2513573647 184
27 iso_pu_bacteria 2513237085 2513576868 184
28 iso_pu_bacteria 2513237086 2513582441 184
29 iso_pu_bacteria 2513237088 2513596402 184
30 iso_pu_bacteria 2513237089 2513604176 184
31 iso_pu_bacteria 2513237091 2513617982 184
32 iso_pu_bacteria 2513237093 2513629475 184
33 iso_pu_bacteria 2513237103 2513708125 184
34 iso_pu_bacteria 2513237138 2513865526 184
35 iso_pu_bacteria 2513237140 2513885506 184
36 iso_pu_bacteria 2513237143 2513903282 184
37 iso_pu_bacteria 2513237144 2513909185 184
38 iso_pu_bacteria 2513237146 2513925452 184
39 iso_pu_bacteria 2513237156 2513985317 184
40 iso_pu_bacteria 2513237159 2513996873 184
41 iso_pu_bacteria 2513237160 2514006475 184
42 iso_pu_bacteria 2513237162 2514020082 184
43 iso_pu_bacteria 2515075009 2515112923 184
44 iso_pu_bacteria 2515154107 2515608945 184
45 iso_pu_bacteria 2515154113 2515636398 184
46 iso_pu_bacteria 2515154114 2515640886 184
47 iso_pu_bacteria 2515154116 2515655430 184
48 iso_pu_bacteria 2515154134 2515739407 184
49 iso_pu_bacteria 2516143018 2516204079 184
50 iso_pu_bacteria 2516653046 2516893545 184
51 iso_pu_bacteria 2516653077 2517036625 184
52 iso_pu_bacteria 2516653085 2517076987 184
53 iso_pu_bacteria 2517093000 2517095757 184
54 iso_pu_bacteria 2517287029 2517407322 184
55 iso_pu_bacteria 2517487022 2517570248 184
56 iso_pu_bacteria 2519899620 2520381427 184
57 iso_pu_bacteria 2524023207 2524448631 184
58 iso_pu_bacteria 2524023209 2524459517 184
59 iso_pu_bacteria 2529292951 2530646030 184
60 iso_pu_bacteria 2534681796 2535516796 184
61 iso_pu_bacteria 2551306084 2551674484 184
62 iso_pu_bacteria 2551306085 2551685847 184
63 iso_pu_bacteria 2551306086 2551695969 184
64 iso_pu_bacteria 2551306087 2551697269 184
65 iso_pu_bacteria 2551306089 2551715303 184
66 iso_pu_bacteria 2551306091 2551725120 184
67 iso_pu_bacteria 2551306092 2551733150 184
68 iso_pu_bacteria 2551306093 2551743322 184
69 iso_pu_bacteria 2558860100 2558867781 184
70 iso_pu_bacteria 2558860242 2559295277 184
71 iso_pu_bacteria 2582581283 2585166277 184
72 iso_pu_bacteria 2582581294 2585200535 184
73 iso_pu_bacteria 2582581298 2585222749 184
74 iso_pu_bacteria 2582581299 2585232766 184
75 iso_pu_bacteria 2582581304 2585255010 184
76 iso_pu_bacteria 2582581306 2585267512 184
77 iso_pu_bacteria 2582581307 2585271054 184
78 iso_pu_bacteria 2582581316 2585331551 184
79 iso_pu_bacteria 2582581865 2585386574 184
80 iso_pu_bacteria 2582581866 2585393187 184
81 iso_pu_bacteria 2582581867 2585402471 184
82 iso_pu_bacteria 2585427526 2585527367 184
83 iso_pu_bacteria 2585427527 2585535036 184
84 iso_pu_bacteria 2585427528 2585538109 184
85 iso_pu_bacteria 2585427529 2585545332 184
86 iso_pu_bacteria 2585427530 2585555884 184
87 iso_pu_bacteria 2585427531 2585558778 184
88 iso_pu_bacteria 2585427590 2585822841 184
89 iso_pu_bacteria 2585427593 2585836057 184
90 iso_pu_bacteria 2585427594 2585843097 184
91 iso_pu_bacteria 2585427608 2585898173 184
92 iso_pu_bacteria 2585427609 2585904252 184
93 iso_pu_bacteria 2585427633 2585996124 184
94 iso_pu_bacteria 2585427634 2586000741 184
95 iso_pu_bacteria 2585428125 2587980631 184
96 iso_pu_bacteria 2599185170 2599417369 184
97 iso_pu_bacteria 2599185210 2599601591 184
98 iso_pu_bacteria 2599185352 2600194301 184
99 iso_pu_bacteria 2615840624 2616293434 184
100 iso_pu_bacteria 2615840626 2616308884 184
101 iso_pu_bacteria 2615840698 2616556907 184
102 iso_pu_bacteria 2617270742 2617385956 184
103 iso_pu_bacteria 2643221557 2643803189 184
104 iso_pu_bacteria 2643221607 2644050590 184
105 iso_pu_bacteria 2643221610 2644063553 184
106 iso_pu_bacteria 2643221618 2644107372 184
107 iso_pu_bacteria 2643221626 2644150939 184
108 iso_pu_bacteria 2643221634 2644193431 184
109 iso_pu_bacteria 2643221636 2644205064 184
110 iso_pu_bacteria 2643221637 2644210093 184
111 iso_pu_bacteria 2643221643 2644238876 184
112 iso_pu_bacteria 2643221653 2644298598 184
113 iso_pu_bacteria 2643221655 2644308767 184
114 iso_pu_bacteria 2643221659 2644335584 184
115 iso_pu_bacteria 2643221668 2644374834 184
116 iso_pu_bacteria 2643221675 2644414316 184
117 iso_pu_bacteria 2643221680 2644447844 184
118 iso_pu_bacteria 2643221686 2644483508 184
119 iso_pu_bacteria 2643221688 2644491968 184
120 iso_pu_bacteria 2643221689 2644499715 184
121 iso_pu_bacteria 2643221693 2644522029 184
122 iso_pu_bacteria 2643221698 2644539990 184
123 iso_pu_bacteria 2643221712 2644614708 184
124 iso_pu_bacteria 2643221718 2644653645 184
125 iso_pu_bacteria 2643221719 2644656827 184
126 iso_pu_bacteria 2643221723 2644676173 184
127 iso_pu_bacteria 2643221726 2644690317 184
128 iso_pu_bacteria 2657244999 2657681493 184
129 iso_pu_bacteria 2667528174 2671111509 184
130 iso_pu_bacteria 2718217882 2719181736 184
131 iso_pu_bacteria 2718217927 2719386260 184
132 iso_pu_bacteria 2718218009 2719732400 184
133 iso_pu_bacteria 2718218199 2720492501 184
134 iso_pu_bacteria 2718218232 2720613937 184
135 iso_pu_bacteria 2718218233 2720620741 184
136 iso_pu_bacteria 2718218235 2720632064 184
137 iso_pu_bacteria 2718218269 2720775792 184
138 iso_pu_bacteria 2718218363 2721147827 184
139 iso_pu_bacteria 2718218365 2721159277 184
140 iso_pu_bacteria 2718218366 2721164663 184
141 iso_pu_bacteria 2718218423 2721400042 184
142 iso_pu_bacteria 2721755514 2722840833 184
143 iso_pu_bacteria 2721755556 2723027399 184
144 iso_pu_bacteria 2721755684 2723561018 184
145 iso_pu_bacteria 2721755685 2723567611 184
146 iso_pu_bacteria 2721755809 2724038855 184
147 iso_pu_bacteria 2721755810 2724045156 184
148 iso_pu_bacteria 2721755819 2724090399 184
149 iso_pu_bacteria 2721755822 2724104876 184
150 iso_pu_bacteria 2721755823 2724110681 184
151 iso_pu_bacteria 2724679232 2725952637 184
152 iso_pu_bacteria 2728369352 2730108335 184
153 iso_pu_bacteria 2728369365 2730164971 184
154 iso_pu_bacteria 2728369397 2730298909 184
155 iso_pu_bacteria 2738541293 2738800008 184
156 iso_pu_bacteria 2738541333 2739032767 184
157 iso_pu_bacteria 2751185821 2753461957 184
158 iso_pu_bacteria 2765235802 2765464697 184
159 iso_pu_bacteria 2765235942 2766065791 184
160 iso_pu_bacteria 2767802442 2770195370 184
161 iso_pu_bacteria 2775506902 2776270688 184
162 iso_pu_bacteria 2775506904 2776280489 184
163 iso_pu_bacteria 2775507266 2778175343 184
164 iso_pu_bacteria 2791355091 2792620847 184
165 iso_pu_bacteria 2791355092 2792626207 184
166 iso_pu_bacteria 2791355094 2792639145 184
167 iso_pu_bacteria 2791355256 2793294512 184
168 iso_pu_bacteria 2791355259 2793314613 184
169 iso_pu_bacteria 2791355260 2793320440 184
170 iso_pu_bacteria 2791355261 2793331712 184
171 iso_pu_bacteria 2791355262 2793336836 184
172 iso_pu_bacteria 2791355263 2793339127 184
173 iso_pu_bacteria 2791355264 2793348810 184
174 iso_pu_bacteria 2791355265 2793351907 184
175 iso_pu_bacteria 2791355266 2793363622 184
176 iso_pu_bacteria 2791355267 2793370252 184
177 iso_pu_bacteria 2802428858 2802719943 184
178 iso_pu_bacteria 2802428860 2802731874 184
179 iso_pu_bacteria 2802428861 2802739205 184
180 iso_pu_bacteria 2802428862 2802745815 184
181 iso_pu_bacteria 2802428863 2802752417 184
182 iso_pu_bacteria 2802429268 2804752685 184
183 iso_pu_bacteria 2802429633 2806043746 184
184 iso_pu_bacteria 2802429634 2806050322 184
185 iso_pu_bacteria 2802429635 2806057139 184
186 iso_pu_bacteria 2802429636 2806064521 184
187 iso_pu_bacteria 2802429637 2806071788 184
188 iso_pu_bacteria 2808606387 2808987989 184
189 iso_pu_bacteria 2818991272 2819241478 184
190 iso_pu_bacteria 2818991439 2819558994 184
191 iso_pu_bacteria 2818991448 2819609067 184
192 iso_pu_bacteria 2818991453 2819637700 184
193 iso_pu_bacteria 2838022645 2838028398 184
194 iso_pu_bacteria 2838029111 2838029888 184
195 iso_pu_bacteria 2838035591 2838038430 184
196 iso_pu_bacteria 2838042994 2838043891 184
197 iso_pu_bacteria 2838048938 2838051977 184
198 iso_pu_bacteria 2838061910 2838067405 184
199 iso_pu_bacteria 2838068647 2838070223 184
200 iso_pu_bacteria 2838661181 2838661661 184
201 iso_pu_bacteria 2838668709 2838670285 184
202 iso_pu_bacteria 2838680041 2838681688 184
203 iso_pu_bacteria 2838686498 2838687131 184
204 iso_pu_bacteria 2838694306 2838696260 184
205 iso_pu_bacteria 2838701080 2838702656 184
206 iso_pu_bacteria 2838707686 2838710501 184
207 iso_pu_bacteria 2838729681 2838729896 184
208 iso_pu_bacteria 2838742623 2838743089 184
209 iso_pu_bacteria 2839993093 2839996961 184
210 iso_pu_bacteria 2840764183 2840767485 184
211 iso_pu_bacteria 2841851746 2841852575 184
212 iso_pu_bacteria 2841859092 2841862054 184
213 iso_pu_bacteria 2841864319 2841869874 184
214 iso_pu_bacteria 2842077413 2842078675 184
215 iso_pu_bacteria 2842110456 2842114905 184
216 iso_pu_bacteria 2842118031 2842118816 184
217 iso_pu_bacteria 2842146304 2842148086 184
218 iso_pu_bacteria 2842156927 2842157965 184
219 iso_pu_bacteria 2842163707 2842167485 184
220 iso_pu_bacteria 2842180545 2842181584 184
221 iso_pu_bacteria 2842198810 2842204471 184
222 iso_pu_bacteria 2842205361 2842205555 184
223 iso_pu_bacteria 2842217011 2842217856 184
224 iso_pu_bacteria 2842229732 2842230365 184
225 iso_pu_bacteria 2842237096 2842239913 184
226 iso_pu_bacteria 2842243621 2842244267 184
227 iso_pu_bacteria 2842250916 2842253152 184
228 iso_pu_bacteria 2842257432 2842257647 184
229 iso_pu_bacteria 2842264693 2842266187 184
230 iso_pu_bacteria 2842271015 2842271331 184
231 iso_pu_bacteria 2842278818 2842279012 184
232 iso_pu_bacteria 2842291075 2842292337 184
233 iso_pu_bacteria 2842298080 2842301297 184
234 iso_pu_bacteria 2842304105 2842304960 184
235 iso_pu_bacteria 2842311132 2842314991 184
236 iso_pu_bacteria 2842341865 2842346380 184
237 iso_pu_bacteria 2842357229 2842357834 184
238 iso_pu_bacteria 2842363717 2842369041 184
239 iso_pu_bacteria 2842370503 2842372255 184
240 iso_pu_bacteria 2842377471 2842378734 184
241 iso_pu_bacteria 2842384541 2842385326 184
242 iso_pu_bacteria 2842395702 2842399958 184
243 iso_pu_bacteria 2842422224 2842423837 184
244 iso_pu_bacteria 2842428310 2842430650 184
245 iso_pu_bacteria 2842434925 2842437363 184
246 iso_pu_bacteria 2842441272 2842443733 184
247 iso_pu_bacteria 2842447887 2842453141 184
248 iso_pu_bacteria 2842462802 2842464793 184
249 iso_pu_bacteria 2842469257 2842471981 184
250 iso_pu_bacteria 2842475841 2842476827 184
251 iso_pu_bacteria 2842482326 2842484638 184
252 iso_pu_bacteria 2842489311 2842491902 184
253 iso_pu_bacteria 2842502639 2842503416 184
254 iso_pu_bacteria 2842509118 2842511207 184
255 iso_pu_bacteria 2842515876 2842518838 184
256 iso_pu_bacteria 2842521101 2842522888 184
257 iso_pu_bacteria 2842871566 2842871878 184
258 iso_pu_bacteria 2844163670 2844166654 184
259 iso_pu_bacteria 2844454524 2844458498 184
260 iso_pu_bacteria 2850079185 2850081362 184
261 iso_pu_bacteria 2852387548 2852390135 184
262 iso_pu_bacteria 2854896431 2854899207 184
263 iso_pu_bacteria 2854916844 2854918762 184
264 iso_pu_bacteria 2855825444 2855826265 184
265 iso_pu_bacteria 2855839649 2855841610 184
266 iso_pu_bacteria 2857516855 2857517514 184
267 iso_pu_bacteria 2858800743 2858801726 184
268 iso_pu_bacteria 2894652903 2894656061 184
269 iso_pu_bacteria 2899792073 2899796122 184
270 iso_pu_bacteria 2899803654 2899807347 184
271 iso_pu_bacteria 2899845264 2899850706 184
272 iso_pu_bacteria 2904578770 2904580690 184
273 iso_pu_bacteria 2915980308 2915981353 184
274 iso_pu_bacteria 2915986958 2915990418 184
275 iso_pu_bacteria 2915993759 2915998080 184
276 iso_pu_bacteria 2916000859 2916006855 184
277 iso_pu_bacteria 2916007675 2916013853 184
278 iso_pu_bacteria 2916014648 2916017585 184
279 iso_pu_bacteria 2916021584 2916025044 184
280 iso_pu_bacteria 2916028427 2916033207 184
281 iso_pu_bacteria 2916035215 2916040209 184
282 iso_pu_bacteria 2916041962 2916044048 184
283 iso_pu_bacteria 2916048683 2916054229 184
284 iso_pu_bacteria 2916055098 2916059656 184
285 iso_pu_bacteria 2916061851 2916064253 184
286 iso_pu_bacteria 2916068649 2916070328 184
287 iso_pu_bacteria 2916076590 2916079887 184
288 iso_pu_bacteria 2919100787 2919106635 184
289 iso_pu_bacteria 2919119836 2919121596 184
290 iso_pu_bacteria 2919171160 2919174776 184
291 iso_pu_bacteria 2919408235 2919409899 184
292 iso_pu_bacteria 2920760137 2920761619 184
293 iso_pu_bacteria 2920822456 2920825128 184
294 iso_pu_bacteria 2921201388 2921208469 184
295 iso_pu_bacteria 2921208531 2921214511 184
296 iso_pu_bacteria 2921237296 2921244123 184
297 iso_pu_bacteria 2921244191 2921248566 184
298 iso_pu_bacteria 2921250672 2921252000 184
299 iso_pu_bacteria 2921257292 2921261222 184
300 iso_pu_bacteria 2921263974 2921268639 184
301 iso_pu_bacteria 2921282425 2921285860 184
302 iso_pu_bacteria 2921289301 2921289453 184
303 iso_pu_bacteria 2923556063 2923558497 184
304 iso_pu_bacteria 2924144063 2924148438 184
305 iso_pu_bacteria 2924150972 2924158066 184
306 iso_pu_bacteria 2924158325 2924159200 184
307 iso_pu_bacteria 2924165586 2924171430 184
308 iso_pu_bacteria 2924172951 2924177921 184
309 iso_pu_bacteria 2924179722 2924183713 184
310 iso_pu_bacteria 2924186466 2924191965 184
311 iso_pu_bacteria 2924193448 2924197991 184
312 iso_pu_bacteria 2924200457 2924204753 184
313 iso_pu_bacteria 2924207177 2924211499 184
314 iso_pu_bacteria 2924214083 2924218738 184
315 iso_pu_bacteria 2924221636 2924225741 184
316 iso_pu_bacteria 2924228884 2924233062 184
317 iso_pu_bacteria 2926760298 2926762901 184
318 iso_pu_bacteria 2928521798 2928523809 184
319 iso_pu_bacteria 2929138655 2929140793 184
320 iso_pu_bacteria 2933011516 2933014988 184
321 iso_pu_bacteria 2933570622 2933570768 184
322 iso_pu_bacteria 2933586486 2933591277 184
323 iso_pu_bacteria 2933599457 2933601029 184
324 iso_pu_bacteria 2935894831 2935900734 184
325 iso_pu_bacteria 2935901341 2935902035 184
326 iso_pu_bacteria 2936367885 2936372120 184
327 iso_pu_bacteria 2936375103 2936381075 184
328 iso_pu_bacteria 2936381700 2936382970 184
329 iso_pu_bacteria 2936996657 2936999688 184
330 iso_pu_bacteria 2937002841 2937007351 184
331 iso_pu_bacteria 2937009748 2937012919 184
332 iso_pu_bacteria 2937016420 2937021655 184
333 iso_pu_bacteria 2937023124 2937026885 184
334 iso_pu_bacteria 2937029754 2937030199 184
335 iso_pu_bacteria 2937036028 2937042579 184
336 iso_pu_bacteria 2937042894 2937047717 184
337 iso_pu_bacteria 2937049772 2937053678 184
338 iso_pu_bacteria 2937056579 2937063402 184
339 iso_pu_bacteria 2937063883 2937070728 184
340 iso_pu_bacteria 2937071275 2937077149 184
341 iso_pu_bacteria 2937084907 2937085542 184
342 iso_pu_bacteria 2937091812 2937098198 184
343 iso_pu_bacteria 2937098957 2937102525 184
344 iso_pu_bacteria 2937106411 2937111235 184
345 iso_pu_bacteria 2937113482 2937117906 184
346 iso_pu_bacteria 2937119839 2937124044 184
347 iso_pu_bacteria 2937126314 2937130587 184
348 iso_pu_bacteria 2941499720 2941502223 184
349 iso_pu_bacteria 2954011201 2954016094 184
350 iso_pu_bacteria 2957375807 2957376472 184
351 iso_pu_bacteria 2957382221 2957386608 184
352 iso_pu_bacteria 2957388812 2957392910 184
353 iso_pu_bacteria 2957395598 2957395973 184
354 iso_pu_bacteria 2957402308 2957406707 184
355 iso_pu_bacteria 2957408893 2957410768 184
356 iso_pu_bacteria 2957415311 2957417597 184
357 iso_pu_bacteria 2957422303 2957423717 184
358 iso_pu_bacteria 2957430029 2957434303 184
359 iso_pu_bacteria 2957437181 2957437635 184
360 iso_pu_bacteria 2957443900 2957446340 184
361 iso_pu_bacteria 2957450854 2957454726 184
362 iso_pu_bacteria 2957457609 2957461980 184
363 iso_pu_bacteria 2957464669 2957468644 184
364 iso_pu_bacteria 2957471148 2957476466 184
365 iso_pu_bacteria 2957478035 2957482806 184
366 iso_pu_bacteria 2957484790 2957488700 184
367 iso_pu_bacteria 2957491536 2957496969 184
368 iso_pu_bacteria 2957498199 2957503232 184
369 iso_pu_bacteria 2957505466 2957507288 184
370 iso_pu_bacteria 2960584000 2960584526 184
371 iso_pu_bacteria 2960591022 2960591998 184
372 iso_pu_bacteria 2960597568 2960602492 184
373 iso_pu_bacteria 2960603979 2960606449 184
374 iso_pu_bacteria 2960610863 2960612395 184
375 iso_pu_bacteria 2960617483 2960621486 184
376 iso_pu_bacteria 2960624210 2960630831 184
377 iso_pu_bacteria 2960631154 2960631959 184
378 iso_pu_bacteria 2960645483 2960650009 184
379 iso_pu_bacteria 2960652885 2960654750 184
380 iso_pu_bacteria 2960660292 2960665247 184
381 iso_pu_bacteria 2960667422 2960671732 184
382 iso_pu_bacteria 2960674078 2960678347 184
383 iso_pu_bacteria 2960680706 2960681534 184
384 iso_pu_bacteria 2960687367 2960692527 184
385 iso_pu_bacteria 2960693952 2960698117 184
386 iso_pu_bacteria 2964607997 2964614505 184
387 iso_pu_bacteria 2964615318 2964621064 184
388 iso_pu_bacteria 2964621998 2964625726 184
389 iso_pu_bacteria 2964636051 2964640147 184
390 iso_pu_bacteria 2964643177 2964646837 184
391 iso_pu_bacteria 2964649959 2964655341 184
392 iso_pu_bacteria 2964656573 2964663220 184
393 iso_pu_bacteria 2964663802 2964668297 184
394 iso_pu_bacteria 2964670856 2964671771 184
395 iso_pu_bacteria 2964678106 2964681593 184
396 iso_pu_bacteria 2964685014 2964691343 184
397 iso_pu_bacteria 2964691889 2964698277 184
398 iso_pu_bacteria 2964698721 2964705097 184
399 iso_pu_bacteria 2964705432 2964709829 184
400 iso_pu_bacteria 2964712639 2964716525 184
401 iso_pu_bacteria 2967664464 2967665487 184
402 iso_pu_bacteria 2967671571 2967675909 184
403 iso_pu_bacteria 2967678726 2967684503 184
404 iso_pu_bacteria 2967686174 2967688881 184
405 iso_pu_bacteria 2967693043 2967697355 184
406 iso_pu_bacteria 2967699805 2967706623 184
407 iso_pu_bacteria 2967706974 2967711545 184
408 iso_pu_bacteria 2967714385 2967714795 184
409 iso_pu_bacteria 2967721400 2967725810 184
410 iso_pu_bacteria 2967728569 2967729084 184
411 iso_pu_bacteria 2967735183 2967738858 184
412 iso_pu_bacteria 2967742019 2967743527 184
413 iso_pu_bacteria 2967748971 2967753566 184
414 iso_pu_bacteria 2967755722 2967758957 184
415 iso_pu_bacteria 2967762386 2967768481 184
416 iso_pu_bacteria 2967769361 2967773849 184
417 iso_pu_bacteria 2967775926 2967778027 184
418 iso_pu_bacteria 2970019648 2970023492 184
419 iso_pu_bacteria 2970026789 2970030354 184
420 iso_pu_bacteria 2970033650 2970040212 184
421 iso_pu_bacteria 2970040964 2970045859 184
422 iso_pu_bacteria 2970047711 2970053967 184
423 iso_pu_bacteria 2970054988 2970059286 184
424 iso_pu_bacteria 2970061556 2970065657 184
425 iso_pu_bacteria 2970068827 2970075490 184
426 iso_pu_bacteria 2970076120 2970080194 184
427 iso_pu_bacteria 2970082768 2970087780 184
428 iso_pu_bacteria 2970088815 2970093221 184
429 iso_pu_bacteria 2970095765 2970100072 184
430 iso_pu_bacteria 2970102677 2970108076 184
431 iso_pu_bacteria 2970109326 2970113886 184
432 iso_pu_bacteria 2970116247 2970120490 184
433 iso_pu_bacteria 2970122695 2970127027 184
434 iso_pu_bacteria 2970129317 2970133203 184
435 iso_pu_bacteria 2970136068 2970140460 184
436 iso_pu_bacteria 2970143518 2970146190 184
437 iso_pu_bacteria 2970156795 2970161091 184
438 iso_pu_bacteria 2970164137 2970168476 184
439 iso_pu_bacteria 2970170962 2970171562 184
440 iso_pu_bacteria 2970177841 2970182894 184
441 iso_pu_bacteria 2970184632 2970188698 184
442 iso_pu_bacteria 2970191845 2970196364 184
443 iso_pu_bacteria 2977516862 2977522530 184
444 iso_pu_bacteria 2977523885 2977526250 184
445 iso_pu_bacteria 2977530762 2977534346 184
446 iso_pu_bacteria 2977537788 2977542019 184
447 iso_pu_bacteria 2977544691 2977547713 184
448 iso_pu_bacteria 2977551784 2977558354 184
449 iso_pu_bacteria 2977558990 2977562681 184
450 iso_pu_bacteria 2977565890 2977570270 184
451 iso_pu_bacteria 2977572785 2977577071 184
452 iso_pu_bacteria 2977579622 2977583578 184
453 iso_pu_bacteria 2978969890 2978974546 184
454 iso_pu_bacteria 2979089926 2979094607 184
455 iso_pu_bacteria 2979095461 2979100828 184
456 iso_pu_bacteria 2984509177 2984511589 184
457 iso_pu_bacteria 2984518228 2984522050 184
458 iso_pu_bacteria 2984537506 2984541348 184
459 iso_pu_bacteria 2984587000 2984589866 184
460 iso_pu_bacteria 2984601300 2984603625 184
461 iso_pu_bacteria 2989349275 2989349566 184
462 iso_pu_bacteria 2989776772 2989779131 184
463 iso_pu_bacteria 2996887358 2996889111 184
464 iso_pu_bacteria 2996893221 2996896433 184
465 iso_pu_bacteria 3002141150 3002144691 184
466 iso_pu_bacteria 3003930520 3003933940 184
467 iso_pu_bacteria 3005409236 3005414701 184
468 iso_pu_bacteria 3005416602 3005419554 184
469 iso_pu_bacteria 3005445848 3005448364 184
470 iso_pu_bacteria 3005452660 3005454561 184
471 iso_pu_bacteria 639633055 639649116 184
472 iso_pu_bacteria 643692032 643826212 184
473 iso_pu_bacteria 648276728 648740495 184
474 iso_pu_bacteria 650716007 650740486 184
475 iso_pu_bacteria 8003570095 8003571553 184
476 iso_pu_bacteria 8003992118 8003994085 184
477 iso_pu_bacteria 8003999396 8004001709 184
478 iso_pu_bacteria 8005246636 8005248695 184
479 iso_pu_bacteria 8005258706 8005260232 184
480 iso_pu_bacteria 8005275841 8005281051 184
481 iso_pu_bacteria 8005282627 8005283339 184
482 iso_pu_bacteria 8005301065 8005303045 184
483 iso_pu_bacteria 8005307578 8005312754 184
484 iso_pu_bacteria 8005314921 8005316845 184
485 iso_pu_bacteria 8005321885 8005323638 184
486 iso_pu_bacteria 8005376324 8005380849 184
487 iso_pu_bacteria 8005382845 8005385283 184
488 iso_pu_bacteria 8005395548 8005396200 184
489 iso_pu_bacteria 8005430974 8005435076 184
490 iso_pu_bacteria 8005460587 8005463600 184
491 iso_pu_bacteria 8005484373 8005485349 184
492 iso_pu_bacteria 8005497431 8005500814 184
493 iso_pu_bacteria 8005542996 8005545544 184
494 iso_pu_bacteria 8005556819 8005557093 184
495 iso_pu_bacteria 8005563573 8005567912 184
496 iso_pu_bacteria 8005570704 8005573542 184
497 iso_pu_bacteria 8005619151 8005622191 184
498 iso_pu_bacteria 8005626139 8005632333 184
499 iso_pu_bacteria 8005645114 8005649661 184
500 iso_pu_bacteria 8005658619 8005659112 184
501 iso_pu_bacteria 8005668836 8005672232 184
502 iso_pu_bacteria 8005682033 8005682974 184
503 iso_pu_bacteria 8005688590 8005692185 184
504 iso_pu_bacteria 8005695170 8005697321 184
505 iso_pu_bacteria 8018127388 8018134016 184
506 iso_pu_bacteria 8018163183 8018163869 184
507 iso_pu_bacteria 8018176218 8018181401 184
508 iso_pu_bacteria 8023680758 8023683247 184
509 iso_pu_bacteria 8024479707 8024482945 184
510 iso_pu_bacteria 8024486573 8024487949 184
511 iso_pu_bacteria 8046767195 8046771623 184
512 iso_pu_bacteria 8054558443 8054560763 184
513 iso_pu_bacteria 8056375014 8056378450 184
514 iso_pu_bacteria 8056382006 8056386647 184
515 iso_pu_bacteria 8056875544 8056877365 184
516 iso_pu_bacteria 8057575449 8057575817 184
517 iso_pu_bacteria 8057874678 8057877318 184
518 3300002987 JGI25159J45721_1000966 JGI25159J45721_10009663 186
519 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001726 186
520 3300003374 JGI25161J50226_1000001 JGI25161J50226_100000124 186
521 3300004625 Ga0055543_1000003 Ga0055543_100000340 186
522 3300005262 Ga0065165_1000068 Ga0065165_1000068128 186
523 3300009765 Ga0123341_1000032 Ga0123341_100003224 186
524 3300009766 Ga0123342_1021015 Ga0123342_10210152 186
525 3300025284 Ga0209130_1000003 Ga0209130_100000350 186
526 3300025302 Ga0207426_1000011 Ga0207426_1000011728 186
527 3300028794 Ga0307515_10188841 Ga0307515_101888413 186
528 3300044765 Ga0466970_0069085 Ga0466970_0069085_149_742 186
529 3300048924 Ga0496121_0042223 Ga0496121_0042223_2176_2769 186
530 3300002773 JGI25152J39213_1006182 JGI25152J39213_10061824 187
531 3300002773 JGI25152J39213_1006351 JGI25152J39213_10063512 187
532 3300003187 JGI25151J46595_10005981 JGI25151J46595_100059816 187
533 3300003187 JGI25151J46595_10034270 JGI25151J46595_100342702 187
534 3300003215 JGI25153J46596_10014210 JGI25153J46596_100142104 187
535 3300003771 Ga0055526_1007857 Ga0055526_10078572 187
536 3300003775 Ga0055524_1004414 Ga0055524_10044145 187
537 3300003790 Ga0055528_1001122 Ga0055528_10011225 187
538 3300003790 Ga0055528_1004902 Ga0055528_10049029 187
539 3300003790 Ga0055528_1011411 Ga0055528_10114112 187
540 3300003790 Ga0055528_1014492 Ga0055528_10144923 187
541 3300003790 Ga0055528_1026156 Ga0055528_10261562 187
542 3300003792 Ga0055540_1000283 Ga0055540_100028345 187
543 3300006048 Ga0075363_100171077 Ga0075363_1001710771 187
544 3300025245 Ga0207425_1006299 Ga0207425_10062994 187
545 3300025258 Ga0209129_1000161 Ga0209129_100016195 187
546 3300025258 Ga0209129_1005114 Ga0209129_10051142 187
547 3300025258 Ga0209129_1022237 Ga0209129_10222372 187
548 3300025273 Ga0209673_1000010 Ga0209673_1000010115 187
549 3300025273 Ga0209673_1000384 Ga0209673_100038485 187
550 3300025273 Ga0209673_1000977 Ga0209673_100097729 187
551 3300025273 Ga0209673_1005688 Ga0209673_10056885 187
552 3300025292 Ga0209676_1034652 Ga0209676_10346522 187
553 3300025294 Ga0209025_1005836 Ga0209025_10058365 187
554 3300025294 Ga0209025_1006154 Ga0209025_100615412 187
555 3300025295 Ga0209564_1000388 Ga0209564_100038885 187
556 3300025295 Ga0209564_1005163 Ga0209564_10051637 187
557 3300025297 Ga0209758_1003069 Ga0209758_100306920 187
558 3300025297 Ga0209758_1012299 Ga0209758_10122996 187
559 3300025297 Ga0209758_1060767 Ga0209758_10607673 187
560 3300025297 Ga0209758_1099502 Ga0209758_10995021 187
561 3300025299 Ga0209256_1002304 Ga0209256_100230418 187
562 3300025299 Ga0209256_1003052 Ga0209256_10030529 187
563 3300025299 Ga0209256_1020294 Ga0209256_10202942 187
564 3300025303 Ga0209051_1000308 Ga0209051_100030864 187
565 3300025303 Ga0209051_1042307 Ga0209051_10423072 187
566 3300025304 Ga0209257_1000853 Ga0209257_100085319 187
567 3300031911 Ga0307412_11023142 Ga0307412_110231421 187
568 3300041441 Ga0451787_436462 Ga0451787_436462_241_834 187
569 3300041451 Ga0451791_0821308 Ga0451791_0821308_1023_1616 187
570 3300041494 Ga0451837_0392092 Ga0451837_0392092_1560_2153 187
571 3300041502 Ga0451846_55098 Ga0451846_55098_32_625 187
572 3300041503 Ga0451847_0237521 Ga0451847_0237521_892_1485 187
573 3300041505 Ga0451849_1213583 Ga0451849_1213583_65_658 187
574 3300041509 Ga0451843_0233737 Ga0451843_0233737_82_675 187
575 3300041509 Ga0451843_0998701 Ga0451843_0998701_1317_1910 187
576 3300041512 Ga0451853_0211463 Ga0451853_0211463_881_1474 187
577 3300041512 Ga0451853_1888721 Ga0451853_1888721_48_641 187
578 3300046474 Ga0495605_0018481 Ga0495605_0018481_753_1346 187
579 3300046500 Ga0495596_0021263 Ga0495596_0021263_953_1546 187
580 3300046507 Ga0495606_0010451 Ga0495606_0010451_3099_3692 187
581 3300046515 Ga0495620_0048655 Ga0495620_0048655_331_924 187
582 3300046518 Ga0495631_0056441 Ga0495631_0056441_76_669 187
583 3300046519 Ga0495632_0080978 Ga0495632_0080978_338_931 187
584 3300046522 Ga0495643_0015966 Ga0495643_0015966_2657_3250 187
585 3300046524 Ga0495648_0091124 Ga0495648_0091124_567_1160 187
586 3300046542 Ga0495597_0011360 Ga0495597_0011360_1354_1947 187
587 3300046558 Ga0495633_0012064 Ga0495633_0012064_1802_2395 187
588 3300046615 Ga0495656_0219239 Ga0495656_0219239_86_679 187
589 3300046648 Ga0495611_0058439 Ga0495611_0058439_973_1566 187
590 3300046660 Ga0495625_0003972 Ga0495625_0003972_8565_9158 187
591 3300046660 Ga0495625_0251681 Ga0495625_0251681_145_738 187
592 3300046691 Ga0495670_0016423 Ga0495670_0016423_696_1289 187
593 3300046692 Ga0495671_0077923 Ga0495671_0077923_92_685 187
594 3300046810 Ga0495660_0046709 Ga0495660_0046709_1557_2150 187
595 3300047318 Ga0495636_0077919 Ga0495636_0077919_329_922 187
596 3300047443 Ga0495687_071448 Ga0495687_071448_709_1302 187
597 3300047472 Ga0495686_0033251 Ga0495686_0033251_310_903 187
598 3300048091 Ga0495626_0069954 Ga0495626_0069954_923_1516 187
599 3300048928 Ga0496125_0396043 Ga0496125_0396043_49_642 187
600 3300049459 Ga0495678_091705 Ga0495678_091705_225_818 187
601 3300050496 nmdc:mga07m45_129080_c1 nmdc:mga07m45_129080_c1_214_807 187
602 3300050516 nmdc:mga0sz30_10737_c2 nmdc:mga0sz30_10737_c2_229_822 187
603 3300053083 Ga0495655_0021806 Ga0495655_0021806_338_931 187
604 3300053086 Ga0500578_0117842 Ga0500578_0117842_273_866 187
605 3300053109 Ga0500569_012112 Ga0500569_012112_949_1542 187
606 3300053134 Ga0500658_0002369 Ga0500658_0002369_2090_2683 187
607 3300053135 Ga0500659_0108663 Ga0500659_0108663_816_1409 187
608 3300053139 Ga0500568_0008709 Ga0500568_0008709_2274_2867 187
609 3300053153 Ga0500616_0091969 Ga0500616_0091969_103_696 187
610 3300002739 JGI25158J39367_1000336 JGI25158J39367_10003364 188
611 3300002773 JGI25152J39213_1000826 JGI25152J39213_100082610 188
612 3300002773 JGI25152J39213_1017437 JGI25152J39213_10174373 188
613 3300002774 JGI25150J39212_1000165 JGI25150J39212_10001654 188
614 3300002774 JGI25150J39212_1000307 JGI25150J39212_100030718 188
615 3300002774 JGI25150J39212_1006463 JGI25150J39212_10064633 188
616 3300002987 JGI25159J45721_1000040 JGI25159J45721_100004038 188
617 3300003187 JGI25151J46595_10000329 JGI25151J46595_1000032918 188
618 3300003187 JGI25151J46595_10024415 JGI25151J46595_100244153 188
619 3300003215 JGI25153J46596_10003631 JGI25153J46596_100036314 188
620 3300003215 JGI25153J46596_10009561 JGI25153J46596_100095614 188
621 3300003215 JGI25153J46596_10012453 JGI25153J46596_100124533 188
622 3300003215 JGI25153J46596_10026848 JGI25153J46596_100268482 188
623 3300003215 JGI25153J46596_10043631 JGI25153J46596_100436313 188
624 3300003322 rootL2_10127000 rootL2_101270003 188
625 3300003354 JGI25160J50197_1000128 JGI25160J50197_100012843 188
626 3300003374 JGI25161J50226_1000996 JGI25161J50226_10009969 188
627 3300003578 Ga0006562J51391_1036025 Ga0006562J51391_10360251 188
628 3300003771 Ga0055526_1001311 Ga0055526_10013117 188
629 3300003771 Ga0055526_1001851 Ga0055526_100185114 188
630 3300003771 Ga0055526_1005523 Ga0055526_10055237 188
631 3300003775 Ga0055524_1002368 Ga0055524_10023683 188
632 3300003775 Ga0055524_1015223 Ga0055524_10152233 188
633 3300003775 Ga0055524_1053175 Ga0055524_10531751 188
634 3300003781 Ga0055536_1002507 Ga0055536_10025073 188
635 3300003781 Ga0055536_1009417 Ga0055536_10094172 188
636 3300003790 Ga0055528_1013658 Ga0055528_10136583 188
637 3300003791 Ga0055530_10016163 Ga0055530_100161632 188
638 3300003791 Ga0055530_10018535 Ga0055530_100185352 188
639 3300003792 Ga0055540_1006077 Ga0055540_10060773 188
640 3300003792 Ga0055540_1008899 Ga0055540_10088994 188
641 3300003792 Ga0055540_1021104 Ga0055540_10211042 188
642 3300003794 Ga0055531_10014920 Ga0055531_100149202 188
643 3300003794 Ga0055531_10019396 Ga0055531_100193963 188
644 3300004625 Ga0055543_1000130 Ga0055543_100013035 188
645 3300005262 Ga0065165_1000013 Ga0065165_1000013264 188
646 3300005262 Ga0065165_1018622 Ga0065165_10186223 188
647 3300005347 Ga0070668_100484784 Ga0070668_1004847842 188
648 3300005353 Ga0070669_100366031 Ga0070669_1003660312 188
649 3300005355 Ga0070671_100043123 Ga0070671_1000431233 188
650 3300006038 Ga0075365_10002254 Ga0075365_100022546 188
651 3300006038 Ga0075365_10146606 Ga0075365_101466062 188
652 3300006177 Ga0075362_10199156 Ga0075362_101991562 188
653 3300006178 Ga0075367_10111600 Ga0075367_101116002 188
654 3300006186 Ga0075369_10000132 Ga0075369_100001324 188
655 3300006186 Ga0075369_10055198 Ga0075369_100551982 188
656 3300006353 Ga0075370_10103814 Ga0075370_101038141 188
657 3300009177 Ga0105248_10041256 Ga0105248_100412562 188
658 3300009177 Ga0105248_10055062 Ga0105248_100550624 188
659 3300009766 Ga0123342_1005565 Ga0123342_10055658 188
660 3300013249 Ga0171463_1003 Ga0171463_1003248 188
661 3300013308 Ga0157375_10860375 Ga0157375_108603752 188
662 3300015690 Ga0183363_1104 Ga0183363_110425 188
663 3300021327 Ga0214543_1000038 Ga0214543_1000038146 188
664 3300022740 Ga0228710_1000009 Ga0228710_1000009123 188
665 3300025208 Ga0209436_100478 Ga0209436_1004783 188
666 3300025245 Ga0207425_1000024 Ga0207425_1000024287 188
667 3300025245 Ga0207425_1006673 Ga0207425_10066732 188
668 3300025245 Ga0207425_1022530 Ga0207425_10225302 188
669 3300025245 Ga0207425_1029056 Ga0207425_10290561 188
670 3300025258 Ga0209129_1000146 Ga0209129_100014683 188
671 3300025258 Ga0209129_1001999 Ga0209129_100199910 188
672 3300025258 Ga0209129_1002877 Ga0209129_100287712 188
673 3300025258 Ga0209129_1025995 Ga0209129_10259951 188
674 3300025273 Ga0209673_1004894 Ga0209673_100489411 188
675 3300025273 Ga0209673_1013499 Ga0209673_10134994 188
676 3300025273 Ga0209673_1091836 Ga0209673_10918361 188
677 3300025284 Ga0209130_1000034 Ga0209130_1000034255 188
678 3300025284 Ga0209130_1027074 Ga0209130_10270742 188
679 3300025292 Ga0209676_1001813 Ga0209676_100181311 188
680 3300025292 Ga0209676_1002914 Ga0209676_10029142 188
681 3300025294 Ga0209025_1000050 Ga0209025_100005040 188
682 3300025294 Ga0209025_1002141 Ga0209025_100214117 188
683 3300025294 Ga0209025_1071243 Ga0209025_10712431 188
684 3300025294 Ga0209025_1113848 Ga0209025_11138481 188
685 3300025295 Ga0209564_1000013 Ga0209564_1000013253 188
686 3300025295 Ga0209564_1000512 Ga0209564_100051240 188
687 3300025297 Ga0209758_1000083 Ga0209758_1000083217 188
688 3300025297 Ga0209758_1000642 Ga0209758_100064235 188
689 3300025297 Ga0209758_1002951 Ga0209758_10029519 188
690 3300025297 Ga0209758_1003364 Ga0209758_10033644 188
691 3300025297 Ga0209758_1009029 Ga0209758_10090294 188
692 3300025297 Ga0209758_1046605 Ga0209758_10466052 188
693 3300025298 Ga0209050_1002022 Ga0209050_100202210 188
694 3300025299 Ga0209256_1000442 Ga0209256_100044266 188
695 3300025299 Ga0209256_1001584 Ga0209256_10015843 188
696 3300025299 Ga0209256_1021361 Ga0209256_10213613 188
697 3300025302 Ga0207426_1000006 Ga0207426_1000006628 188
698 3300025302 Ga0207426_1002076 Ga0207426_10020766 188
699 3300025303 Ga0209051_1002410 Ga0209051_100241010 188
700 3300025303 Ga0209051_1003936 Ga0209051_10039362 188
701 3300025303 Ga0209051_1007466 Ga0209051_10074661 188
702 3300025304 Ga0209257_1002648 Ga0209257_10026488 188
703 3300025304 Ga0209257_1003491 Ga0209257_10034919 188
704 3300025304 Ga0209257_1021628 Ga0209257_10216282 188
705 3300025923 Ga0207681_10147234 Ga0207681_101472343 188
706 3300025941 Ga0207711_10014356 Ga0207711_100143563 188
707 3300025941 Ga0207711_10015952 Ga0207711_100159525 188
708 3300027876 Ga0209974_10026978 Ga0209974_100269783 188
709 3300028379 Ga0268266_10381118 Ga0268266_103811183 188
710 3300028794 Ga0307515_10017597 Ga0307515_100175975 188
711 3300028794 Ga0307515_10025749 Ga0307515_1002574913 188
712 3300031456 Ga0307513_10093771 Ga0307513_100937714 188
713 3300031548 Ga0307408_100346790 Ga0307408_1003467902 188
714 3300032002 Ga0307416_101434602 Ga0307416_1014346021 188
715 3300032004 Ga0307414_10082671 Ga0307414_100826712 188
716 3300033430 Ga0315913_1000006 Ga0315913_1000006123 188
717 3300037471 Ga0395905_0000736 Ga0395905_0000736_29767_30360 188
718 3300041404 Ga0439436_0001576 Ga0439436_0001576_3922_4515 188
719 3300041404 Ga0439436_0012157 Ga0439436_0012157_1811_2404 188
720 3300041406 Ga0439439_0027963 Ga0439439_0027963_672_1265 188
721 3300041413 Ga0439465_0001082 Ga0439465_0001082_6953_7546 188
722 3300041413 Ga0439465_0004189 Ga0439465_0004189_3109_3702 188
723 3300041413 Ga0439465_0218761 Ga0439465_0218761_46_639 188
724 3300041491 Ga0451833_0225210 Ga0451833_0225210_115_708 188
725 3300041494 Ga0451837_0569472 Ga0451837_0569472_500_1093 188
726 3300041496 Ga0451839_0313923 Ga0451839_0313923_3458_4051 188
727 3300041498 Ga0451841_0936760 Ga0451841_0936760_241_834 188
728 3300041503 Ga0451847_0735982 Ga0451847_0735982_137_730 188
729 3300041507 Ga0451851_0161803 Ga0451851_0161803_335_928 188
730 3300041511 Ga0451855_0713139 Ga0451855_0713139_123_716 188
731 3300041512 Ga0451853_1152098 Ga0451853_1152098_4674_5267 188
732 3300041997 Ga0439431_0028971 Ga0439431_0028971_375_968 188
733 3300042145 Ga0450906_004190 Ga0450906_004190_2072_2665 188
734 3300042145 Ga0450906_061604 Ga0450906_061604_38_631 188
735 3300042435 Ga0439434_0009578 Ga0439434_0009578_776_1369 188
736 3300046452 Ga0495617_013469 Ga0495617_013469_290_883 188
737 3300046460 Ga0495638_0000195 Ga0495638_0000195_37520_38113 188
738 3300046471 Ga0495650_0047306 Ga0495650_0047306_856_1449 188
739 3300046474 Ga0495605_0007566 Ga0495605_0007566_1516_2109 188
740 3300046492 Ga0495585_0006794 Ga0495585_0006794_1414_2007 188
741 3300046501 Ga0495607_0153511 Ga0495607_0153511_480_1073 188
742 3300046506 Ga0495583_0101246 Ga0495583_0101246_56_649 188
743 3300046507 Ga0495606_0236521 Ga0495606_0236521_218_811 188
744 3300046512 Ga0495610_0001253 Ga0495610_0001253_19926_20519 188
745 3300046512 Ga0495610_0011895 Ga0495610_0011895_280_873 188
746 3300046518 Ga0495631_0001628 Ga0495631_0001628_10722_11315 188
747 3300046522 Ga0495643_0007771 Ga0495643_0007771_3147_3740 188
748 3300046522 Ga0495643_0078291 Ga0495643_0078291_779_1372 188
749 3300046522 Ga0495643_0099412 Ga0495643_0099412_446_1039 188
750 3300046524 Ga0495648_0196670 Ga0495648_0196670_342_935 188
751 3300046616 Ga0495668_0013421 Ga0495668_0013421_2166_2759 188
752 3300046648 Ga0495611_0009701 Ga0495611_0009701_2292_2885 188
753 3300046660 Ga0495625_0000621 Ga0495625_0000621_42696_43289 188
754 3300046660 Ga0495625_0151117 Ga0495625_0151117_571_1164 188
755 3300046691 Ga0495670_0095238 Ga0495670_0095238_436_1029 188
756 3300046810 Ga0495660_0021318 Ga0495660_0021318_877_1470 188
757 3300047320 Ga0495672_0005251 Ga0495672_0005251_304_897 188
758 3300047472 Ga0495686_0003045 Ga0495686_0003045_11499_12092 188
759 3300047472 Ga0495686_0046675 Ga0495686_0046675_2040_2654 188
760 3300048091 Ga0495626_0242227 Ga0495626_0242227_68_661 188
761 3300048905 Ga0496102_0033698 Ga0496102_0033698_2649_3242 188
762 3300048909 Ga0496106_0000578 Ga0496106_0000578_22667_23260 188
763 3300048913 Ga0496110_0011425 Ga0496110_0011425_2381_2974 188
764 3300048916 Ga0496113_0178332 Ga0496113_0178332_872_1465 188
765 3300048917 Ga0496114_0986492 Ga0496114_0986492_16_648 188
766 3300048919 Ga0496116_0007652 Ga0496116_0007652_5231_5824 188
767 3300048919 Ga0496116_0021014 Ga0496116_0021014_4118_4711 188
768 3300048919 Ga0496116_0098082 Ga0496116_0098082_31_624 188
769 3300048919 Ga0496116_0301076 Ga0496116_0301076_28_642 188
770 3300048920 Ga0496117_0011077 Ga0496117_0011077_3638_4231 188
771 3300048920 Ga0496117_0076711 Ga0496117_0076711_84_677 188
772 3300048920 Ga0496117_0130386 Ga0496117_0130386_365_958 188
773 3300048921 Ga0496118_0007840 Ga0496118_0007840_9216_9809 188
774 3300048921 Ga0496118_0013080 Ga0496118_0013080_3957_4550 188
775 3300048921 Ga0496118_0027940 Ga0496118_0027940_3220_3813 188
776 3300048922 Ga0496119_0293636 Ga0496119_0293636_31_624 188
777 3300048924 Ga0496121_0009569 Ga0496121_0009569_8414_9007 188
778 3300048924 Ga0496121_0011992 Ga0496121_0011992_349_942 188
779 3300048924 Ga0496121_0029632 Ga0496121_0029632_1137_1730 188
780 3300048924 Ga0496121_0061579 Ga0496121_0061579_2431_3024 188
781 3300048924 Ga0496121_0085895 Ga0496121_0085895_740_1333 188
782 3300048924 Ga0496121_0086354 Ga0496121_0086354_671_1264 188
783 3300048924 Ga0496121_0344383 Ga0496121_0344383_237_851 188
784 3300048925 Ga0496122_0002690 Ga0496122_0002690_23251_23844 188
785 3300048925 Ga0496122_0013904 Ga0496122_0013904_3743_4336 188
786 3300048925 Ga0496122_0016080 Ga0496122_0016080_3221_3814 188
787 3300048925 Ga0496122_0035177 Ga0496122_0035177_557_1150 188
788 3300048925 Ga0496122_0045332 Ga0496122_0045332_2383_2976 188
789 3300048926 Ga0496123_0000054 Ga0496123_0000054_56823_57416 188
790 3300048926 Ga0496123_0009709 Ga0496123_0009709_4311_4904 188
791 3300048926 Ga0496123_0019000 Ga0496123_0019000_1808_2401 188
792 3300048926 Ga0496123_0045692 Ga0496123_0045692_1288_1881 188
793 3300048926 Ga0496123_0062910 Ga0496123_0062910_1317_1910 188
794 3300048927 Ga0496124_0001702 Ga0496124_0001702_23331_23924 188
795 3300048927 Ga0496124_0006525 Ga0496124_0006525_7749_8342 188
796 3300048927 Ga0496124_0034478 Ga0496124_0034478_2053_2646 188
797 3300048927 Ga0496124_0038771 Ga0496124_0038771_1086_1679 188
798 3300048927 Ga0496124_0100509 Ga0496124_0100509_1178_1771 188
799 3300048928 Ga0496125_0000273 Ga0496125_0000273_74676_75269 188
800 3300048928 Ga0496125_0012546 Ga0496125_0012546_4091_4684 188
801 3300048928 Ga0496125_0064881 Ga0496125_0064881_2084_2677 188
802 3300048928 Ga0496125_0085645 Ga0496125_0085645_293_886 188
803 3300048928 Ga0496125_0217125 Ga0496125_0217125_624_1217 188
804 3300048929 Ga0496126_0000589 Ga0496126_0000589_36888_37481 188
805 3300048929 Ga0496126_0022038 Ga0496126_0022038_3187_3780 188
806 3300048929 Ga0496126_0044422 Ga0496126_0044422_1683_2276 188
807 3300048929 Ga0496126_0373740 Ga0496126_0373740_434_1027 188
808 3300048929 Ga0496126_0518452 Ga0496126_0518452_240_833 188
809 3300049459 Ga0495678_103658 Ga0495678_103658_336_929 188
810 3300049569 Ga0501032_0057958 Ga0501032_0057958_601_1194 188
811 3300049570 Ga0501033_0150145 Ga0501033_0150145_899_1492 188
812 3300049571 Ga0501034_0780151 Ga0501034_0780151_143_736 188
813 3300049572 Ga0501036_0164362 Ga0501036_0164362_1024_1617 188
814 3300049573 Ga0501037_0123580 Ga0501037_0123580_1067_1660 188
815 3300049575 Ga0501039_0109357 Ga0501039_0109357_770_1363 188
816 3300049579 Ga0501043_0191596 Ga0501043_0191596_400_993 188
817 3300049589 Ga0501073_0213904 Ga0501073_0213904_538_1131 188
818 3300049773 Ga0501276_008926 Ga0501276_008926_29_622 188
819 3300049822 Ga0501035_0097802 Ga0501035_0097802_1001_1594 188
820 3300049823 Ga0501044_0056630 Ga0501044_0056630_1949_2542 188
821 3300049823 Ga0501044_0618799 Ga0501044_0618799_336_929 188
822 3300050491 nmdc:mga00v17_99741_c1 nmdc:mga00v17_99741_c1_997_1590 188
823 3300050492 nmdc:mga0yw44_10832_c1 nmdc:mga0yw44_10832_c1_2018_2734 188
824 3300050492 nmdc:mga0yw44_213667_c1 nmdc:mga0yw44_213667_c1_399_992 188
825 3300050496 nmdc:mga07m45_170867_c1 nmdc:mga07m45_170867_c1_332_925 188
826 3300050516 nmdc:mga0sz30_286662_c1 nmdc:mga0sz30_286662_c1_50_643 188
827 3300053079 Ga0500610_0034789 Ga0500610_0034789_1921_2514 188
828 3300053087 Ga0500643_023448 Ga0500643_023448_1229_1822 188
829 3300053105 Ga0500557_003926 Ga0500557_003926_1228_1821 188
830 3300053108 Ga0500562_019999 Ga0500562_019999_119_712 188
831 3300053109 Ga0500569_009973 Ga0500569_009973_358_951 188
832 3300053118 Ga0500594_0002292 Ga0500594_0002292_1480_2073 188
833 3300053122 Ga0500608_029678 Ga0500608_029678_112_705 188
834 3300053134 Ga0500658_0132682 Ga0500658_0132682_117_710 188
835 3300053136 Ga0500559_0005229 Ga0500559_0005229_2370_2963 188
836 3300053139 Ga0500568_0005767 Ga0500568_0005767_2012_2605 188
837 3300053139 Ga0500568_0060281 Ga0500568_0060281_107_700 188
838 3300053139 Ga0500568_0068957 Ga0500568_0068957_705_1319 188
839 3300053151 Ga0500604_0007759 Ga0500604_0007759_396_989 188
840 3300053153 Ga0500616_0000884 Ga0500616_0000884_25410_26003 188
841 3300053153 Ga0500616_0019444 Ga0500616_0019444_3139_3732 188
842 3300053153 Ga0500616_0189017 Ga0500616_0189017_172_765 188
843 3300053156 Ga0500622_0000697 Ga0500622_0000697_16083_16697 188
844 3300053156 Ga0500622_0000899 Ga0500622_0000899_3239_3832 188
845 3300053156 Ga0500622_0191860 Ga0500622_0191860_209_802 188
846 3300053158 Ga0500627_0015706 Ga0500627_0015706_405_998 188
847 3300053160 Ga0500633_0031808 Ga0500633_0031808_973_1566 188
848 3300053736 Ga0500599_004643 Ga0500599_004643_499_1092 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01810

LysE

LysE type translocator

8

180

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7t3o-assembly1.cif.gz_A rat vesicular glutamate transporter 2 (vglut2) in low cl condition 0.4651 1 184
7t3o-assembly1.cif.gz_A rat vesicular glutamate transporter 2 (vglut2) in low cl condition 0.456 1 184
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.4362 9 188
3wdo-assembly1.cif.gz_A structure of e. coli yajr transporter 0.4116 9 188
7t3n-assembly1.cif.gz_A r184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2) 0.4066 6 184
ID Description Score Start End Superfamily
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5109 4 184 1.20.1250.20
af_Q2R4J1_1_279_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4965 4 184 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.462 14 184 1.20.1250.20
af_A0A1D8PSL9_199_630_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.457 3 182 1.20.1250.20
af_P76264_30_182_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4494 14 184 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A658A6K1-F1-model_v4 deleted 0.8461 38 188
AF-A0A653L4V5-F1-model_v4 deleted 0.8351 1 187
AF-A0A653L4V5-F1-model_v4 deleted 0.8273 1 187
AF-A0A1H5JP08-F1-model_v4 deleted 0.8162 1 187
AF-Q2T994-F1-model_v4 LysE family protein 0.8148 3 187 GO:0005886
GO:0015171
GO:0033228

Feature Viewer

pLDDT pTM Quality
75.53 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map