F483300
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 326 | 1692 | 55 |
Family's Representative Sequence
| Representative Sequence | 3300032002|Ga0307416_102959652|Ga0307416_1029596522 |
| Length | 66 |
| Sequence | VGDRIDGRDGDDMATWEYFVAPLLEHNPGEILNTFGEDGWELVSVVSQTTPSGVTSTVAYLKRQRG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 2 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 52 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 53 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 54 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 67 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 76 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 77 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 78 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 79 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 80 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 167 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 169 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 177 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 179 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 189 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 190 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 191 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 194 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 195 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 196 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 197 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 198 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 199 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 200 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 201 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 202 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 269 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 270 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 271 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 272 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 275 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 307 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 310 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 325 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 326 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.14 |
| Rhizosphere | 95.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0307416_102959652 | 3300032002 | Unclassified | 568 |
| 2 | JGI24751J29686_10001091 | 3300002459 | Bacteria | 5882 |
| 3 | Ga0070683_100756698 | 3300005329 | Unclassified | 931 |
| 4 | Ga0070690_100365440 | 3300005330 | Bacteria | 1051 |
| 5 | Ga0070690_100517976 | 3300005330 | Unclassified | 895 |
| 6 | Ga0070670_100005282 | 3300005331 | Bacteria | 10885 |
| 7 | Ga0070670_100033160 | 3300005331 | Bacteria | 4448 |
| 8 | Ga0070670_100837000 | 3300005331 | Bacteria | 832 |
| 9 | Ga0070677_10874341 | 3300005333 | Bacteria | 518 |
| 10 | Ga0068869_100313818 | 3300005334 | Bacteria | 1270 |
| 11 | Ga0070666_10495810 | 3300005335 | Bacteria | 885 |
| 12 | Ga0070680_100438142 | 3300005336 | Bacteria | 1115 |
| 13 | Ga0070680_101366470 | 3300005336 | Unclassified | 613 |
| 14 | Ga0068868_100012011 | 3300005338 | Bacteria | 6321 |
| 15 | Ga0068868_100120842 | 3300005338 | Bacteria | 2136 |
| 16 | Ga0068868_101676373 | 3300005338 | Bacteria | 599 |
| 17 | Ga0070660_101338047 | 3300005339 | Bacteria | 608 |
| 18 | Ga0070689_100623587 | 3300005340 | Bacteria | 936 |
| 19 | Ga0070689_100717618 | 3300005340 | Unclassified | 874 |
| 20 | Ga0070689_101811809 | 3300005340 | Unclassified | 557 |
| 21 | Ga0070691_10517405 | 3300005341 | Bacteria | 692 |
| 22 | Ga0070691_11065685 | 3300005341 | Unclassified | 508 |
| 23 | Ga0070661_100677504 | 3300005344 | Unclassified | 839 |
| 24 | Ga0070692_10045095 | 3300005345 | Bacteria | 2273 |
| 25 | Ga0070692_10073474 | 3300005345 | Bacteria | 1827 |
| 26 | Ga0070692_10269595 | 3300005345 | Bacteria | 1027 |
| 27 | Ga0070668_100626604 | 3300005347 | Bacteria | 943 |
| 28 | Ga0070675_100157842 | 3300005354 | Bacteria | 1949 |
| 29 | Ga0070675_100934080 | 3300005354 | Bacteria | 795 |
| 30 | Ga0070671_100017818 | 3300005355 | Bacteria | 5756 |
| 31 | Ga0070671_100766405 | 3300005355 | Bacteria | 839 |
| 32 | Ga0070671_101086461 | 3300005355 | Bacteria | 702 |
| 33 | Ga0070674_100009133 | 3300005356 | Bacteria | 5930 |
| 34 | Ga0070674_100075741 | 3300005356 | Bacteria | 2391 |
| 35 | Ga0070674_100390493 | 3300005356 | Bacteria | 1134 |
| 36 | Ga0070674_100682638 | 3300005356 | Bacteria | 876 |
| 37 | Ga0070674_102119209 | 3300005356 | Bacteria | 513 |
| 38 | Ga0070673_100063962 | 3300005364 | Bacteria | 2929 |
| 39 | Ga0070673_101155938 | 3300005364 | Bacteria | 724 |
| 40 | Ga0070688_100220214 | 3300005365 | Bacteria | 1337 |
| 41 | Ga0070688_100283062 | 3300005365 | Bacteria | 1192 |
| 42 | Ga0070688_100292561 | 3300005365 | Bacteria | 1174 |
| 43 | Ga0070688_100430769 | 3300005365 | Unclassified | 982 |
| 44 | Ga0070659_100331008 | 3300005366 | Bacteria | 1275 |
| 45 | Ga0070659_100391472 | 3300005366 | Bacteria | 1172 |
| 46 | Ga0070659_101179150 | 3300005366 | Bacteria | 677 |
| 47 | Ga0070703_10000067 | 3300005406 | Bacteria | 52456 |
| 48 | Ga0070713_101778231 | 3300005436 | Unclassified | 598 |
| 49 | Ga0070701_10880320 | 3300005438 | Bacteria | 617 |
| 50 | Ga0070701_11076340 | 3300005438 | Bacteria | 565 |
| 51 | Ga0070701_11182679 | 3300005438 | Unclassified | 542 |
| 52 | Ga0070711_100007216 | 3300005439 | Bacteria | 6751 |
| 53 | Ga0070711_101082504 | 3300005439 | Unclassified | 690 |
| 54 | Ga0070705_100024263 | 3300005440 | Bacteria | 3271 |
| 55 | Ga0070705_100044160 | 3300005440 | Bacteria | 2559 |
| 56 | Ga0070705_100335486 | 3300005440 | Bacteria | 1097 |
| 57 | Ga0070700_100018973 | 3300005441 | Bacteria | 3964 |
| 58 | Ga0070700_100076708 | 3300005441 | Bacteria | 2147 |
| 59 | Ga0070700_100129061 | 3300005441 | Bacteria | 1703 |
| 60 | Ga0070700_100181998 | 3300005441 | Bacteria | 1463 |
| 61 | Ga0070700_100377220 | 3300005441 | Bacteria | 1059 |
| 62 | Ga0070700_100398443 | 3300005441 | Bacteria | 1034 |
| 63 | Ga0070700_100735323 | 3300005441 | Bacteria | 788 |
| 64 | Ga0070694_100034353 | 3300005444 | Bacteria | 3343 |
| 65 | Ga0070694_100270507 | 3300005444 | Bacteria | 1292 |
| 66 | Ga0070694_100567224 | 3300005444 | Unclassified | 911 |
| 67 | Ga0070694_100608481 | 3300005444 | Bacteria | 881 |
| 68 | Ga0070694_100894244 | 3300005444 | Bacteria | 733 |
| 69 | Ga0070694_101157579 | 3300005444 | Bacteria | 647 |
| 70 | Ga0070708_100000074 | 3300005445 | Bacteria | 63932 |
| 71 | Ga0070708_100401386 | 3300005445 | Bacteria | 1293 |
| 72 | Ga0070708_100755786 | 3300005445 | Unclassified | 914 |
| 73 | Ga0070708_101519533 | 3300005445 | Bacteria | 624 |
| 74 | Ga0070663_100048916 | 3300005455 | Bacteria | 3000 |
| 75 | Ga0070678_100142314 | 3300005456 | Bacteria | 1921 |
| 76 | Ga0070678_100162890 | 3300005456 | Bacteria | 1809 |
| 77 | Ga0070678_100379209 | 3300005456 | Bacteria | 1223 |
| 78 | Ga0070662_101698699 | 3300005457 | Bacteria | 545 |
| 79 | Ga0070681_10187717 | 3300005458 | Bacteria | 1987 |
| 80 | Ga0068867_100004737 | 3300005459 | Bacteria | 9577 |
| 81 | Ga0068867_100321650 | 3300005459 | Bacteria | 1282 |
| 82 | Ga0068867_100436159 | 3300005459 | Bacteria | 1113 |
| 83 | Ga0068867_101739384 | 3300005459 | Bacteria | 585 |
| 84 | Ga0070685_10097402 | 3300005466 | Bacteria | 1791 |
| 85 | Ga0070706_100005951 | 3300005467 | Bacteria | 11536 |
| 86 | Ga0070706_100655298 | 3300005467 | Bacteria | 975 |
| 87 | Ga0070706_101357027 | 3300005467 | Bacteria | 651 |
| 88 | Ga0070707_100118086 | 3300005468 | Bacteria | 2574 |
| 89 | Ga0070707_100246245 | 3300005468 | Bacteria | 1740 |
| 90 | Ga0070707_100385134 | 3300005468 | Bacteria | 1362 |
| 91 | Ga0070707_102333863 | 3300005468 | Bacteria | 502 |
| 92 | Ga0070698_100036787 | 3300005471 | Bacteria | 5052 |
| 93 | Ga0070698_100273789 | 3300005471 | Bacteria | 1620 |
| 94 | Ga0070698_100347916 | 3300005471 | Unclassified | 1413 |
| 95 | Ga0070698_101445446 | 3300005471 | Unclassified | 639 |
| 96 | Ga0070699_100086823 | 3300005518 | Bacteria | 2731 |
| 97 | Ga0070699_100140492 | 3300005518 | Bacteria | 2132 |
| 98 | Ga0070699_100342030 | 3300005518 | Unclassified | 1347 |
| 99 | Ga0070699_100890300 | 3300005518 | Bacteria | 815 |
| 100 | Ga0070699_101373633 | 3300005518 | Bacteria | 648 |
| 101 | Ga0070684_100048882 | 3300005535 | Bacteria | 3670 |
| 102 | Ga0070684_100415983 | 3300005535 | Bacteria | 1241 |
| 103 | Ga0070697_100043651 | 3300005536 | Bacteria | 3631 |
| 104 | Ga0070697_101680684 | 3300005536 | Archaea | 568 |
| 105 | Ga0070697_101935626 | 3300005536 | Bacteria | 528 |
| 106 | Ga0070697_102006196 | 3300005536 | Bacteria | 518 |
| 107 | Ga0070672_100384191 | 3300005543 | Bacteria | 1201 |
| 108 | Ga0070686_100004661 | 3300005544 | Bacteria | 7564 |
| 109 | Ga0070686_100369957 | 3300005544 | Bacteria | 1082 |
| 110 | Ga0070695_100012922 | 3300005545 | Bacteria | 5012 |
| 111 | Ga0070695_100062417 | 3300005545 | Bacteria | 2420 |
| 112 | Ga0070695_100323169 | 3300005545 | Unclassified | 1148 |
| 113 | Ga0070695_100509996 | 3300005545 | Bacteria | 931 |
| 114 | Ga0070695_101786434 | 3300005545 | Bacteria | 516 |
| 115 | Ga0070696_100005561 | 3300005546 | Bacteria | 8414 |
| 116 | Ga0070696_100103176 | 3300005546 | Bacteria | 2046 |
| 117 | Ga0070696_100289089 | 3300005546 | Bacteria | 1252 |
| 118 | Ga0070696_100630467 | 3300005546 | Bacteria | 867 |
| 119 | Ga0070693_100105303 | 3300005547 | Bacteria | 1726 |
| 120 | Ga0070693_101137421 | 3300005547 | Bacteria | 597 |
| 121 | Ga0070665_102119741 | 3300005548 | Bacteria | 567 |
| 122 | Ga0070704_100004909 | 3300005549 | Bacteria | 7762 |
| 123 | Ga0070704_100033318 | 3300005549 | Bacteria | 3481 |
| 124 | Ga0070704_100084501 | 3300005549 | Bacteria | 2346 |
| 125 | Ga0070704_100333017 | 3300005549 | Bacteria | 1276 |
| 126 | Ga0070704_100845577 | 3300005549 | Bacteria | 820 |
| 127 | Ga0070704_101571745 | 3300005549 | Bacteria | 606 |
| 128 | Ga0070704_101589431 | 3300005549 | Bacteria | 603 |
| 129 | Ga0070664_100037395 | 3300005564 | Bacteria | 4082 |
| 130 | Ga0070664_100551148 | 3300005564 | Bacteria | 1066 |
| 131 | Ga0070664_101848929 | 3300005564 | Unclassified | 573 |
| 132 | Ga0068857_100304864 | 3300005577 | Bacteria | 1469 |
| 133 | Ga0068857_101730104 | 3300005577 | Unclassified | 611 |
| 134 | Ga0068854_100082005 | 3300005578 | Bacteria | 2383 |
| 135 | Ga0068856_100439408 | 3300005614 | Bacteria | 1325 |
| 136 | Ga0070702_100236261 | 3300005615 | Bacteria | 1231 |
| 137 | Ga0070702_100540915 | 3300005615 | Unclassified | 863 |
| 138 | Ga0070702_100556692 | 3300005615 | Unclassified | 852 |
| 139 | Ga0070702_101355982 | 3300005615 | Bacteria | 580 |
| 140 | Ga0068852_100083811 | 3300005616 | Bacteria | 2836 |
| 141 | Ga0068859_100418601 | 3300005617 | Unclassified | 1436 |
| 142 | Ga0068859_101532903 | 3300005617 | Archaea | 736 |
| 143 | Ga0068859_102421344 | 3300005617 | Bacteria | 578 |
| 144 | Ga0068864_100039149 | 3300005618 | Bacteria | 4051 |
| 145 | Ga0068864_100048128 | 3300005618 | Bacteria | 3664 |
| 146 | Ga0068864_101514912 | 3300005618 | Unclassified | 674 |
| 147 | Ga0068864_102550246 | 3300005618 | Bacteria | 517 |
| 148 | Ga0068866_10038252 | 3300005718 | Bacteria | 2361 |
| 149 | Ga0068861_100095171 | 3300005719 | Bacteria | 2358 |
| 150 | Ga0068861_100454045 | 3300005719 | Bacteria | 1149 |
| 151 | Ga0068861_100849178 | 3300005719 | Unclassified | 861 |
| 152 | Ga0068861_100924467 | 3300005719 | Bacteria | 828 |
| 153 | Ga0068861_101173564 | 3300005719 | Bacteria | 741 |
| 154 | Ga0068861_101406171 | 3300005719 | Bacteria | 682 |
| 155 | Ga0068851_10070137 | 3300005834 | Bacteria | 1812 |
| 156 | Ga0068870_10008530 | 3300005840 | Bacteria | 4615 |
| 157 | Ga0068870_10029813 | 3300005840 | Bacteria | 2752 |
| 158 | Ga0068870_10266520 | 3300005840 | Bacteria | 1068 |
| 159 | Ga0068870_11041288 | 3300005840 | Bacteria | 586 |
| 160 | Ga0068870_11130925 | 3300005840 | Unclassified | 564 |
| 161 | Ga0068870_11474892 | 3300005840 | Bacteria | 500 |
| 162 | Ga0068863_100084238 | 3300005841 | Bacteria | 3013 |
| 163 | Ga0068863_100761695 | 3300005841 | Bacteria | 964 |
| 164 | Ga0068860_100418632 | 3300005843 | Bacteria | 1328 |
| 165 | Ga0068860_100726450 | 3300005843 | Bacteria | 1004 |
| 166 | Ga0068860_101072550 | 3300005843 | Bacteria | 824 |
| 167 | Ga0068862_100082052 | 3300005844 | Bacteria | 2798 |
| 168 | Ga0068862_102481111 | 3300005844 | Bacteria | 530 |
| 169 | Ga0081455_10004271 | 3300005937 | Bacteria | 16089 |
| 170 | Ga0081455_10005280 | 3300005937 | Bacteria | 14191 |
| 171 | Ga0081455_10008200 | 3300005937 | Bacteria | 10893 |
| 172 | Ga0081455_10067602 | 3300005937 | Bacteria | 2977 |
| 173 | Ga0081455_10107080 | 3300005937 | Bacteria | 2229 |
| 174 | Ga0081455_10210992 | 3300005937 | Bacteria | 1447 |
| 175 | Ga0081539_10039741 | 3300005985 | Bacteria | 2772 |
| 176 | Ga0075432_10027433 | 3300006058 | Bacteria | 1961 |
| 177 | Ga0070715_10001775 | 3300006163 | Bacteria | 6418 |
| 178 | Ga0070715_10553991 | 3300006163 | Bacteria | 667 |
| 179 | Ga0070716_100011717 | 3300006173 | Bacteria | 4421 |
| 180 | Ga0070712_100286457 | 3300006175 | Unclassified | 1328 |
| 181 | Ga0070712_100926178 | 3300006175 | Unclassified | 752 |
| 182 | Ga0068871_100344509 | 3300006358 | Bacteria | 1317 |
| 183 | Ga0075428_100290186 | 3300006844 | Bacteria | 1760 |
| 184 | Ga0075428_100328971 | 3300006844 | Bacteria | 1642 |
| 185 | Ga0075428_100473177 | 3300006844 | Unclassified | 1341 |
| 186 | Ga0075430_100014436 | 3300006846 | Bacteria | 6729 |
| 187 | Ga0075431_100000656 | 3300006847 | Bacteria | 29408 |
| 188 | Ga0075431_100258293 | 3300006847 | Bacteria | 1768 |
| 189 | Ga0075433_10000149 | 3300006852 | Bacteria | 37279 |
| 190 | Ga0075433_10002088 | 3300006852 | Bacteria | 15116 |
| 191 | Ga0075433_10512393 | 3300006852 | Unclassified | 1055 |
| 192 | Ga0075434_100002552 | 3300006871 | Bacteria | 16072 |
| 193 | Ga0075434_100023704 | 3300006871 | Bacteria | 5986 |
| 194 | Ga0075434_100081980 | 3300006871 | Bacteria | 3223 |
| 195 | Ga0075434_101954340 | 3300006871 | Bacteria | 592 |
| 196 | Ga0075434_102157853 | 3300006871 | Bacteria | 561 |
| 197 | Ga0075434_102469671 | 3300006871 | Bacteria | 521 |
| 198 | Ga0075429_100022927 | 3300006880 | Bacteria | 5412 |
| 199 | Ga0075429_100057037 | 3300006880 | Bacteria | 3400 |
| 200 | Ga0075429_100610873 | 3300006880 | Bacteria | 955 |
| 201 | Ga0075429_100699927 | 3300006880 | Unclassified | 888 |
| 202 | Ga0068865_100010544 | 3300006881 | Bacteria | 5756 |
| 203 | Ga0068865_100036700 | 3300006881 | Bacteria | 3306 |
| 204 | Ga0068865_100309716 | 3300006881 | Bacteria | 1267 |
| 205 | Ga0068865_101494866 | 3300006881 | Unclassified | 605 |
| 206 | Ga0068865_102074129 | 3300006881 | Bacteria | 517 |
| 207 | Ga0075436_100410459 | 3300006914 | Bacteria | 982 |
| 208 | Ga0097620_100418564 | 3300006931 | Unclassified | 1436 |
| 209 | Ga0097620_101533030 | 3300006931 | Archaea | 736 |
| 210 | Ga0097620_102421951 | 3300006931 | Bacteria | 578 |
| 211 | Ga0075435_100019439 | 3300007076 | Bacteria | 5189 |
| 212 | Ga0075435_100890944 | 3300007076 | Bacteria | 776 |
| 213 | Ga0105251_10028877 | 3300009011 | Bacteria | 2799 |
| 214 | Ga0105250_10282111 | 3300009092 | Bacteria | 715 |
| 215 | Ga0111539_10117832 | 3300009094 | Bacteria | 3112 |
| 216 | Ga0111539_10408644 | 3300009094 | Bacteria | 1581 |
| 217 | Ga0111539_10427431 | 3300009094 | Bacteria | 1542 |
| 218 | Ga0105245_10020084 | 3300009098 | Bacteria | 5856 |
| 219 | Ga0105245_10103963 | 3300009098 | Bacteria | 2633 |
| 220 | Ga0105245_10163104 | 3300009098 | Bacteria | 2116 |
| 221 | Ga0105245_11139648 | 3300009098 | Bacteria | 827 |
| 222 | Ga0105245_11900039 | 3300009098 | Unclassified | 648 |
| 223 | Ga0105245_12995562 | 3300009098 | Bacteria | 523 |
| 224 | Ga0105247_10562697 | 3300009101 | Bacteria | 840 |
| 225 | Ga0114129_10000667 | 3300009147 | Bacteria | 43086 |
| 226 | Ga0114129_10020441 | 3300009147 | Bacteria | 9415 |
| 227 | Ga0114129_10144583 | 3300009147 | Bacteria | 3258 |
| 228 | Ga0114129_10261987 | 3300009147 | Bacteria | 2316 |
| 229 | Ga0114129_11482810 | 3300009147 | Bacteria | 834 |
| 230 | Ga0114129_13219223 | 3300009147 | Unclassified | 530 |
| 231 | Ga0105243_10002499 | 3300009148 | Bacteria | 15350 |
| 232 | Ga0105243_10003191 | 3300009148 | Bacteria | 13431 |
| 233 | Ga0105243_10003771 | 3300009148 | Bacteria | 12152 |
| 234 | Ga0105243_10016524 | 3300009148 | Bacteria | 5579 |
| 235 | Ga0105243_10274051 | 3300009148 | Bacteria | 1516 |
| 236 | Ga0105243_11432584 | 3300009148 | Unclassified | 712 |
| 237 | Ga0105241_11087697 | 3300009174 | Unclassified | 752 |
| 238 | Ga0105242_10002614 | 3300009176 | Bacteria | 14125 |
| 239 | Ga0105242_10005041 | 3300009176 | Bacteria | 10202 |
| 240 | Ga0105242_10037839 | 3300009176 | Bacteria | 3878 |
| 241 | Ga0105242_10246436 | 3300009176 | Bacteria | 1608 |
| 242 | Ga0105248_10203482 | 3300009177 | Bacteria | 2231 |
| 243 | Ga0105237_10297868 | 3300009545 | Bacteria | 1616 |
| 244 | Ga0105238_10127349 | 3300009551 | Bacteria | 2525 |
| 245 | Ga0105249_10028324 | 3300009553 | Bacteria | 5057 |
| 246 | Ga0105249_10349104 | 3300009553 | Bacteria | 1498 |
| 247 | Ga0105249_10521162 | 3300009553 | Bacteria | 1236 |
| 248 | Ga0105249_10988830 | 3300009553 | Unclassified | 910 |
| 249 | Ga0105249_11773184 | 3300009553 | Bacteria | 690 |
| 250 | Ga0105249_12462010 | 3300009553 | Bacteria | 593 |
| 251 | Ga0105249_13100340 | 3300009553 | Bacteria | 534 |
| 252 | Ga0105246_10014629 | 3300011119 | Bacteria | 4939 |
| 253 | Ga0105246_10124196 | 3300011119 | Bacteria | 1918 |
| 254 | Ga0105246_10156647 | 3300011119 | Bacteria | 1731 |
| 255 | Ga0105246_10247370 | 3300011119 | Bacteria | 1413 |
| 256 | Ga0105246_10251142 | 3300011119 | Bacteria | 1404 |
| 257 | Ga0105246_10593525 | 3300011119 | Bacteria | 956 |
| 258 | Ga0157339_1039072 | 3300012505 | Bacteria | 588 |
| 259 | Ga0157378_10006475 | 3300013297 | Bacteria | 10241 |
| 260 | Ga0157378_10009223 | 3300013297 | Bacteria | 8593 |
| 261 | Ga0157378_10032136 | 3300013297 | Bacteria | 4636 |
| 262 | Ga0157378_10401459 | 3300013297 | Bacteria | 1351 |
| 263 | Ga0157378_12252062 | 3300013297 | Unclassified | 596 |
| 264 | Ga0163162_10214993 | 3300013306 | Bacteria | 2053 |
| 265 | Ga0163162_11021161 | 3300013306 | Bacteria | 935 |
| 266 | Ga0163162_11887333 | 3300013306 | Bacteria | 684 |
| 267 | Ga0157375_10009595 | 3300013308 | Bacteria | 8502 |
| 268 | Ga0157375_10025029 | 3300013308 | Bacteria | 5537 |
| 269 | Ga0157375_13055751 | 3300013308 | Bacteria | 558 |
| 270 | Ga0163163_10144884 | 3300014325 | Bacteria | 2419 |
| 271 | Ga0163163_10287218 | 3300014325 | Bacteria | 1697 |
| 272 | Ga0163163_10467760 | 3300014325 | Bacteria | 1321 |
| 273 | Ga0163163_10941949 | 3300014325 | Bacteria | 927 |
| 274 | Ga0163163_11232614 | 3300014325 | Unclassified | 811 |
| 275 | Ga0163163_12863227 | 3300014325 | Bacteria | 538 |
| 276 | Ga0157380_10032195 | 3300014326 | Bacteria | 4032 |
| 277 | Ga0157380_10430072 | 3300014326 | Bacteria | 1262 |
| 278 | Ga0157380_10463079 | 3300014326 | Bacteria | 1221 |
| 279 | Ga0157380_10754524 | 3300014326 | Unclassified | 985 |
| 280 | Ga0157377_10026861 | 3300014745 | Bacteria | 3085 |
| 281 | Ga0157377_10064760 | 3300014745 | Bacteria | 2097 |
| 282 | Ga0157377_10176895 | 3300014745 | Bacteria | 1339 |
| 283 | Ga0157377_10436330 | 3300014745 | Unclassified | 901 |
| 284 | Ga0157377_10513350 | 3300014745 | Bacteria | 840 |
| 285 | Ga0157377_10930526 | 3300014745 | Bacteria | 652 |
| 286 | Ga0157379_10134557 | 3300014968 | Bacteria | 2226 |
| 287 | Ga0157379_11936388 | 3300014968 | Bacteria | 581 |
| 288 | Ga0157379_12053970 | 3300014968 | Bacteria | 566 |
| 289 | Ga0157376_10341310 | 3300014969 | Bacteria | 1431 |
| 290 | Ga0157376_10342066 | 3300014969 | Bacteria | 1429 |
| 291 | Ga0163161_10296423 | 3300017792 | Bacteria | 1272 |
| 292 | Ga0163161_10730769 | 3300017792 | Archaea | 827 |
| 293 | Ga0207656_10029289 | 3300025321 | Bacteria | 2266 |
| 294 | Ga0207713_1216192 | 3300025735 | Unclassified | 580 |
| 295 | Ga0207653_10000002 | 3300025885 | Bacteria | 270513 |
| 296 | Ga0207653_10045089 | 3300025885 | Bacteria | 1456 |
| 297 | Ga0207682_10148205 | 3300025893 | Bacteria | 1057 |
| 298 | Ga0207692_10087888 | 3300025898 | Bacteria | 1678 |
| 299 | Ga0207642_10199630 | 3300025899 | Bacteria | 1104 |
| 300 | Ga0207642_10290419 | 3300025899 | Unclassified | 944 |
| 301 | Ga0207710_10243934 | 3300025900 | Bacteria | 897 |
| 302 | Ga0207688_10034615 | 3300025901 | Bacteria | 2798 |
| 303 | Ga0207680_10612927 | 3300025903 | Bacteria | 779 |
| 304 | Ga0207647_10307889 | 3300025904 | Bacteria | 901 |
| 305 | Ga0207685_10003043 | 3300025905 | Bacteria | 3991 |
| 306 | Ga0207645_10051426 | 3300025907 | Bacteria | 2633 |
| 307 | Ga0207643_10002088 | 3300025908 | Bacteria | 11006 |
| 308 | Ga0207643_10217274 | 3300025908 | Bacteria | 1169 |
| 309 | Ga0207643_10230066 | 3300025908 | Unclassified | 1137 |
| 310 | Ga0207643_10974184 | 3300025908 | Bacteria | 549 |
| 311 | Ga0207684_10000612 | 3300025910 | Bacteria | 42497 |
| 312 | Ga0207684_11222318 | 3300025910 | Bacteria | 621 |
| 313 | Ga0207684_11483747 | 3300025910 | Bacteria | 552 |
| 314 | Ga0207684_11693635 | 3300025910 | Bacteria | 510 |
| 315 | Ga0207707_10434225 | 3300025912 | Bacteria | 1125 |
| 316 | Ga0207707_10747841 | 3300025912 | Bacteria | 818 |
| 317 | Ga0207693_10000234 | 3300025915 | Bacteria | 51024 |
| 318 | Ga0207693_10637091 | 3300025915 | Unclassified | 828 |
| 319 | Ga0207663_10161961 | 3300025916 | Unclassified | 1580 |
| 320 | Ga0207660_10413198 | 3300025917 | Bacteria | 1088 |
| 321 | Ga0207660_10436472 | 3300025917 | Bacteria | 1058 |
| 322 | Ga0207660_11665672 | 3300025917 | Unclassified | 513 |
| 323 | Ga0207662_10064779 | 3300025918 | Bacteria | 2200 |
| 324 | Ga0207657_10762672 | 3300025919 | Bacteria | 749 |
| 325 | Ga0207652_10263120 | 3300025921 | Bacteria | 1556 |
| 326 | Ga0207646_10008060 | 3300025922 | Bacteria | 10619 |
| 327 | Ga0207646_10580622 | 3300025922 | Bacteria | 1007 |
| 328 | Ga0207646_11033565 | 3300025922 | Bacteria | 725 |
| 329 | Ga0207694_10104372 | 3300025924 | Bacteria | 2249 |
| 330 | Ga0207650_10006025 | 3300025925 | Bacteria | 8271 |
| 331 | Ga0207650_10022995 | 3300025925 | Bacteria | 4417 |
| 332 | Ga0207650_10393517 | 3300025925 | Bacteria | 1146 |
| 333 | Ga0207650_10905267 | 3300025925 | Unclassified | 749 |
| 334 | Ga0207659_10102939 | 3300025926 | Bacteria | 2157 |
| 335 | Ga0207659_10501506 | 3300025926 | Bacteria | 1028 |
| 336 | Ga0207659_10601511 | 3300025926 | Unclassified | 937 |
| 337 | Ga0207687_10002239 | 3300025927 | Bacteria | 13175 |
| 338 | Ga0207687_10030225 | 3300025927 | Bacteria | 3650 |
| 339 | Ga0207644_10086485 | 3300025931 | Bacteria | 2328 |
| 340 | Ga0207690_10239000 | 3300025932 | Bacteria | 1398 |
| 341 | Ga0207690_11663218 | 3300025932 | Unclassified | 533 |
| 342 | Ga0207706_11407004 | 3300025933 | Bacteria | 572 |
| 343 | Ga0207706_11678941 | 3300025933 | Unclassified | 512 |
| 344 | Ga0207686_10034482 | 3300025934 | Bacteria | 3029 |
| 345 | Ga0207686_10063381 | 3300025934 | Bacteria | 2350 |
| 346 | Ga0207686_10128094 | 3300025934 | Bacteria | 1737 |
| 347 | Ga0207686_10701566 | 3300025934 | Unclassified | 804 |
| 348 | Ga0207709_10009376 | 3300025935 | Bacteria | 5385 |
| 349 | Ga0207709_10011763 | 3300025935 | Unclassified | 4824 |
| 350 | Ga0207709_10026986 | 3300025935 | Bacteria | 3303 |
| 351 | Ga0207709_10233670 | 3300025935 | Bacteria | 1333 |
| 352 | Ga0207670_10211340 | 3300025936 | Bacteria | 1480 |
| 353 | Ga0207670_10698887 | 3300025936 | Bacteria | 839 |
| 354 | Ga0207669_10039923 | 3300025937 | Bacteria | 2718 |
| 355 | Ga0207669_10064891 | 3300025937 | Bacteria | 2262 |
| 356 | Ga0207669_10066615 | 3300025937 | Bacteria | 2240 |
| 357 | Ga0207669_10367695 | 3300025937 | Bacteria | 1117 |
| 358 | Ga0207669_10459409 | 3300025937 | Bacteria | 1011 |
| 359 | Ga0207704_10238304 | 3300025938 | Bacteria | 1357 |
| 360 | Ga0207704_11496277 | 3300025938 | Unclassified | 579 |
| 361 | Ga0207704_11728423 | 3300025938 | Unclassified | 538 |
| 362 | Ga0207691_10079700 | 3300025940 | Bacteria | 2947 |
| 363 | Ga0207691_11354750 | 3300025940 | Bacteria | 586 |
| 364 | Ga0207711_10258100 | 3300025941 | Bacteria | 1601 |
| 365 | Ga0207689_10064638 | 3300025942 | Bacteria | 3010 |
| 366 | Ga0207689_10477202 | 3300025942 | Bacteria | 1044 |
| 367 | Ga0207689_11582743 | 3300025942 | Unclassified | 546 |
| 368 | Ga0207661_10395383 | 3300025944 | Bacteria | 1253 |
| 369 | Ga0207661_11861106 | 3300025944 | Unclassified | 547 |
| 370 | Ga0207679_10001553 | 3300025945 | Bacteria | 14362 |
| 371 | Ga0207679_10968091 | 3300025945 | Unclassified | 780 |
| 372 | Ga0207651_10050764 | 3300025960 | Bacteria | 2819 |
| 373 | Ga0207651_11827018 | 3300025960 | Unclassified | 547 |
| 374 | Ga0207651_12025470 | 3300025960 | Bacteria | 517 |
| 375 | Ga0207712_10009270 | 3300025961 | Bacteria | 6227 |
| 376 | Ga0207712_10052995 | 3300025961 | Bacteria | 2844 |
| 377 | Ga0207712_10751150 | 3300025961 | Bacteria | 854 |
| 378 | Ga0207712_10962678 | 3300025961 | Archaea | 756 |
| 379 | Ga0207668_11435095 | 3300025972 | Bacteria | 622 |
| 380 | Ga0207668_11600491 | 3300025972 | Bacteria | 588 |
| 381 | Ga0207640_10525912 | 3300025981 | Bacteria | 989 |
| 382 | Ga0207640_10809386 | 3300025981 | Bacteria | 812 |
| 383 | Ga0207677_10138854 | 3300026023 | Bacteria | 1857 |
| 384 | Ga0207677_11787748 | 3300026023 | Bacteria | 570 |
| 385 | Ga0207678_10042793 | 3300026067 | Bacteria | 3922 |
| 386 | Ga0207678_10202030 | 3300026067 | Bacteria | 1700 |
| 387 | Ga0207678_11579317 | 3300026067 | Bacteria | 578 |
| 388 | Ga0207678_12028783 | 3300026067 | Bacteria | 500 |
| 389 | Ga0207708_10015640 | 3300026075 | Bacteria | 5691 |
| 390 | Ga0207708_10020897 | 3300026075 | Bacteria | 4939 |
| 391 | Ga0207708_10021485 | 3300026075 | Bacteria | 4868 |
| 392 | Ga0207708_10217894 | 3300026075 | Bacteria | 1528 |
| 393 | Ga0207708_10681175 | 3300026075 | Bacteria | 877 |
| 394 | Ga0207708_10818490 | 3300026075 | Bacteria | 803 |
| 395 | Ga0207708_10921109 | 3300026075 | Bacteria | 757 |
| 396 | Ga0207708_11446049 | 3300026075 | Archaea | 604 |
| 397 | Ga0207702_10412121 | 3300026078 | Bacteria | 1305 |
| 398 | Ga0207702_11489314 | 3300026078 | Bacteria | 670 |
| 399 | Ga0207641_10016768 | 3300026088 | Bacteria | 5999 |
| 400 | Ga0207641_10435616 | 3300026088 | Bacteria | 1265 |
| 401 | Ga0207641_10720956 | 3300026088 | Bacteria | 983 |
| 402 | Ga0207641_10776758 | 3300026088 | Unclassified | 947 |
| 403 | Ga0207648_10000754 | 3300026089 | Bacteria | 36369 |
| 404 | Ga0207648_10014866 | 3300026089 | Bacteria | 7177 |
| 405 | Ga0207648_11537763 | 3300026089 | Bacteria | 625 |
| 406 | Ga0207676_10010382 | 3300026095 | Bacteria | 6631 |
| 407 | Ga0207676_10185116 | 3300026095 | Bacteria | 1827 |
| 408 | Ga0207674_10055176 | 3300026116 | Bacteria | 4041 |
| 409 | Ga0207674_10169100 | 3300026116 | Bacteria | 2140 |
| 410 | Ga0207675_100021703 | 3300026118 | Bacteria | 5975 |
| 411 | Ga0207675_100452828 | 3300026118 | Bacteria | 1272 |
| 412 | Ga0207675_100585011 | 3300026118 | Unclassified | 1118 |
| 413 | Ga0207675_100675515 | 3300026118 | Bacteria | 1040 |
| 414 | Ga0207675_101273792 | 3300026118 | Bacteria | 756 |
| 415 | Ga0207675_101949227 | 3300026118 | Unclassified | 605 |
| 416 | Ga0207683_10087911 | 3300026121 | Bacteria | 2764 |
| 417 | Ga0207683_10340320 | 3300026121 | Bacteria | 1376 |
| 418 | Ga0207683_10437999 | 3300026121 | Bacteria | 1205 |
| 419 | Ga0209966_1061503 | 3300027695 | Bacteria | 812 |
| 420 | Ga0207428_10000597 | 3300027907 | Bacteria | 42692 |
| 421 | Ga0207428_10000612 | 3300027907 | Bacteria | 42181 |
| 422 | Ga0207428_10020218 | 3300027907 | Bacteria | 5660 |
| 423 | Ga0268266_10911992 | 3300028379 | Bacteria | 850 |
| 424 | Ga0268265_11088490 | 3300028380 | Bacteria | 793 |
| 425 | Ga0268265_12724139 | 3300028380 | Unclassified | 500 |
| 426 | Ga0268264_10073848 | 3300028381 | Bacteria | 2896 |
| 427 | Ga0268264_10183862 | 3300028381 | Bacteria | 1900 |
| 428 | Ga0268264_10311613 | 3300028381 | Bacteria | 1485 |
| 429 | Ga0268264_12039896 | 3300028381 | Bacteria | 582 |
| 430 | Ga0307410_11752067 | 3300031852 | Unclassified | 551 |
| 431 | Ga0307409_101020345 | 3300031995 | Bacteria | 846 |
| 432 | Ga0307416_101163149 | 3300032002 | Bacteria | 877 |
| 433 | Ga0307415_100166313 | 3300032126 | Bacteria | 1715 |
| 434 | Ga0307415_101770380 | 3300032126 | Unclassified | 597 |
| 435 | Ga0373948_0054953 | 3300034817 | Bacteria | 863 |
| 436 | Ga0373926_0001364 | 3300035083 | Bacteria | 7390 |
| 437 | Ga0373944_0000653 | 3300035089 | Bacteria | 8231 |
| 438 | Ga0373951_0052255 | 3300035091 | Bacteria | 1008 |
| 439 | Ga0373923_0015583 | 3300035111 | Bacteria | 2872 |
| 440 | Ga0373936_0001504 | 3300035113 | Bacteria | 8459 |
| 441 | Ga0373939_0063808 | 3300035114 | Bacteria | 1181 |
| 442 | Ga0373945_0044282 | 3300035116 | Bacteria | 1617 |
| 443 | Ga0373943_0003307 | 3300035170 | Bacteria | 7323 |
| 444 | Ga0373943_0450686 | 3300035170 | Bacteria | 748 |
| 445 | Ga0373946_0001746 | 3300035171 | Bacteria | 7585 |
| 446 | Ga0373961_0103754 | 3300035241 | Bacteria | 923 |
| 447 | Ga0373961_0384651 | 3300035241 | Bacteria | 535 |
| 448 | Ga0373962_0018458 | 3300035242 | Bacteria | 1815 |
| 449 | Ga0373931_0046562 | 3300035691 | Bacteria | 2293 |
| 450 | Ga0373935_0090920 | 3300035692 | Bacteria | 1998 |
| 451 | Ga0373935_1185706 | 3300035692 | Bacteria | 569 |
| 452 | Ga0373927_0007582 | 3300035695 | Bacteria | 7345 |
| 453 | Ga0373927_0647566 | 3300035695 | Bacteria | 698 |
| 454 | Ga0373947_0017501 | 3300035725 | Bacteria | 4122 |
| 455 | Ga0373947_0291670 | 3300035725 | Bacteria | 1086 |
| 456 | Ga0373947_0428976 | 3300035725 | Bacteria | 894 |
| 457 | Ga0373925_0166257 | 3300037068 | Unclassified | 1740 |
| 458 | Ga0373925_0278446 | 3300037068 | Bacteria | 1347 |
| 459 | Ga0373925_1633637 | 3300037068 | Unclassified | 526 |
| 460 | Ga0395899_0058054 | 3300037312 | Bacteria | 2855 |
| 461 | Ga0395899_0070888 | 3300037312 | Bacteria | 2551 |
| 462 | Ga0395899_0159722 | 3300037312 | Bacteria | 1593 |
| 463 | Ga0395899_0233975 | 3300037312 | Bacteria | 1267 |
| 464 | Ga0395899_0349000 | 3300037312 | Bacteria | 990 |
| 465 | Ga0395900_0003775 | 3300037418 | Bacteria | 16230 |
| 466 | Ga0395900_0011221 | 3300037418 | Bacteria | 9164 |
| 467 | Ga0395900_0068815 | 3300037418 | Unclassified | 3638 |
| 468 | Ga0395900_0155423 | 3300037418 | Bacteria | 2336 |
| 469 | Ga0395900_1388807 | 3300037418 | Unclassified | 615 |
| 470 | Ga0395898_0012736 | 3300037466 | Bacteria | 8686 |
| 471 | Ga0395898_0091637 | 3300037466 | Bacteria | 2924 |
| 472 | Ga0395898_0423128 | 3300037466 | Unclassified | 1269 |
| 473 | Ga0395898_1107491 | 3300037466 | Bacteria | 725 |
| 474 | Ga0395905_0022764 | 3300037471 | Bacteria | 5925 |
| 475 | Ga0395905_0030701 | 3300037471 | Bacteria | 5061 |
| 476 | Ga0395905_0042179 | 3300037471 | Bacteria | 4281 |
| 477 | Ga0395905_0049433 | 3300037471 | Bacteria | 3941 |
| 478 | Ga0395905_0092477 | 3300037471 | Bacteria | 2836 |
| 479 | Ga0395905_0146397 | 3300037471 | Bacteria | 2222 |
| 480 | Ga0395905_0405575 | 3300037471 | Bacteria | 1258 |
| 481 | Ga0395905_1815076 | 3300037471 | Bacteria | 516 |
| 482 | Ga0395901_0025036 | 3300038443 | Bacteria | 6126 |
| 483 | Ga0395901_0029715 | 3300038443 | Bacteria | 5627 |
| 484 | Ga0395901_0108608 | 3300038443 | Bacteria | 2912 |
| 485 | Ga0395901_0124980 | 3300038443 | Bacteria | 2703 |
| 486 | Ga0395901_0153373 | 3300038443 | Bacteria | 2420 |
| 487 | Ga0395901_0491532 | 3300038443 | Bacteria | 1250 |
| 488 | Ga0395901_0513170 | 3300038443 | Bacteria | 1219 |
| 489 | Ga0395901_0901808 | 3300038443 | Bacteria | 866 |
| 490 | Ga0395901_1967558 | 3300038443 | Bacteria | 531 |
| 491 | Ga0439453_0071713 | 3300041408 | Bacteria | 734 |
| 492 | Ga0439453_0181356 | 3300041408 | Bacteria | 514 |
| 493 | Ga0451804_0468199 | 3300041463 | Bacteria | 532 |
| 494 | Ga0439443_049382 | 3300042003 | Bacteria | 734 |
| 495 | Ga0439448_0119894 | 3300042005 | Bacteria | 903 |
| 496 | Ga0439454_023056 | 3300042011 | Bacteria | 932 |
| 497 | Ga0439454_059401 | 3300042011 | Bacteria | 661 |
| 498 | Ga0439463_162684 | 3300042016 | Unclassified | 579 |
| 499 | Ga0439435_0194953 | 3300042436 | Bacteria | 666 |
| 500 | Ga0439444_0091238 | 3300042437 | Bacteria | 680 |
| 501 | Ga0439464_0033942 | 3300042439 | Bacteria | 1438 |
| 502 | Ga0439460_0098712 | 3300042461 | Bacteria | 936 |
| 503 | Ga0439460_0313654 | 3300042461 | Bacteria | 549 |
| 504 | Ga0450893_0116578 | 3300042532 | Bacteria | 555 |
| 505 | Ga0439440_0035589 | 3300042993 | Bacteria | 1195 |
| 506 | Ga0439440_0089681 | 3300042993 | Unclassified | 823 |
| 507 | Ga0466960_0546305 | 3300044901 | Bacteria | 683 |
| 508 | Ga0495617_288815 | 3300046452 | Bacteria | 502 |
| 509 | Ga0495603_0003354 | 3300046455 | Bacteria | 9529 |
| 510 | Ga0495603_0005113 | 3300046455 | Bacteria | 7835 |
| 511 | Ga0495603_0013661 | 3300046455 | Bacteria | 4913 |
| 512 | Ga0495603_0029038 | 3300046455 | Bacteria | 3336 |
| 513 | Ga0495603_0029381 | 3300046455 | Bacteria | 3315 |
| 514 | Ga0495603_0119630 | 3300046455 | Bacteria | 1535 |
| 515 | Ga0495629_0009809 | 3300046459 | Bacteria | 6988 |
| 516 | Ga0495641_0004496 | 3300046461 | Bacteria | 9823 |
| 517 | Ga0495641_0284099 | 3300046461 | Unclassified | 745 |
| 518 | Ga0495653_0036179 | 3300046463 | Bacteria | 3891 |
| 519 | Ga0495580_0158005 | 3300046472 | Bacteria | 1569 |
| 520 | Ga0495580_0176585 | 3300046472 | Bacteria | 1475 |
| 521 | Ga0495582_0003096 | 3300046473 | Bacteria | 9314 |
| 522 | Ga0495582_0811485 | 3300046473 | Bacteria | 541 |
| 523 | Ga0495605_0191427 | 3300046474 | Bacteria | 895 |
| 524 | Ga0495639_0001049 | 3300046475 | Bacteria | 12461 |
| 525 | Ga0495639_0456532 | 3300046475 | Bacteria | 649 |
| 526 | Ga0495662_0000565 | 3300046476 | Bacteria | 17048 |
| 527 | Ga0495584_0047079 | 3300046491 | Unclassified | 2175 |
| 528 | Ga0495584_0058921 | 3300046491 | Bacteria | 1932 |
| 529 | Ga0495584_0065395 | 3300046491 | Bacteria | 1829 |
| 530 | Ga0495584_0173809 | 3300046491 | Bacteria | 1095 |
| 531 | Ga0495584_0319262 | 3300046491 | Bacteria | 789 |
| 532 | Ga0495584_0497077 | 3300046491 | Bacteria | 621 |
| 533 | Ga0495584_0689255 | 3300046491 | Bacteria | 521 |
| 534 | Ga0495584_0738800 | 3300046491 | Unclassified | 502 |
| 535 | Ga0495585_0028209 | 3300046492 | Bacteria | 3202 |
| 536 | Ga0495585_0032931 | 3300046492 | Bacteria | 2936 |
| 537 | Ga0495585_0484752 | 3300046492 | Bacteria | 589 |
| 538 | Ga0495594_0024091 | 3300046499 | Bacteria | 3267 |
| 539 | Ga0495594_0229667 | 3300046499 | Bacteria | 1058 |
| 540 | Ga0495596_0027540 | 3300046500 | Bacteria | 2285 |
| 541 | Ga0495596_0100212 | 3300046500 | Bacteria | 1125 |
| 542 | Ga0495607_0025182 | 3300046501 | Bacteria | 3703 |
| 543 | Ga0495607_0191919 | 3300046501 | Bacteria | 1017 |
| 544 | Ga0495607_0326912 | 3300046501 | Unclassified | 714 |
| 545 | Ga0495583_0295753 | 3300046506 | Bacteria | 644 |
| 546 | Ga0495616_0158716 | 3300046513 | Bacteria | 1019 |
| 547 | Ga0495616_0357884 | 3300046513 | Bacteria | 607 |
| 548 | Ga0495618_0894458 | 3300046514 | Viruses | 513 |
| 549 | Ga0495620_0165666 | 3300046515 | Archaea | 858 |
| 550 | Ga0495630_0013811 | 3300046517 | Bacteria | 5871 |
| 551 | Ga0495631_0126366 | 3300046518 | Bacteria | 1099 |
| 552 | Ga0495631_0277776 | 3300046518 | Unclassified | 713 |
| 553 | Ga0495631_0375794 | 3300046518 | Bacteria | 605 |
| 554 | Ga0495637_0155938 | 3300046520 | Bacteria | 859 |
| 555 | Ga0495644_0038686 | 3300046523 | Bacteria | 1799 |
| 556 | Ga0495644_0057380 | 3300046523 | Bacteria | 1463 |
| 557 | Ga0495644_0083828 | 3300046523 | Bacteria | 1202 |
| 558 | Ga0495644_0148118 | 3300046523 | Unclassified | 898 |
| 559 | Ga0495663_0203456 | 3300046525 | Bacteria | 691 |
| 560 | Ga0495666_0003712 | 3300046526 | Bacteria | 7717 |
| 561 | Ga0495642_0044150 | 3300046528 | Bacteria | 1819 |
| 562 | Ga0495642_0048726 | 3300046528 | Unclassified | 1739 |
| 563 | Ga0495642_0355627 | 3300046528 | Unclassified | 644 |
| 564 | Ga0495665_0000725 | 3300046531 | Bacteria | 17035 |
| 565 | Ga0495665_0058128 | 3300046531 | Bacteria | 2042 |
| 566 | Ga0495640_0038151 | 3300046533 | Bacteria | 3381 |
| 567 | Ga0495640_0841419 | 3300046533 | Unclassified | 545 |
| 568 | Ga0495586_0028185 | 3300046535 | Bacteria | 3006 |
| 569 | Ga0495586_0058223 | 3300046535 | Bacteria | 2098 |
| 570 | Ga0495598_0012111 | 3300046537 | Unclassified | 2107 |
| 571 | Ga0495598_0052528 | 3300046537 | Unclassified | 1232 |
| 572 | Ga0495598_0315016 | 3300046537 | Bacteria | 595 |
| 573 | Ga0495609_0028547 | 3300046538 | Bacteria | 2546 |
| 574 | Ga0495609_0086367 | 3300046538 | Unclassified | 1368 |
| 575 | Ga0495609_0116816 | 3300046538 | Bacteria | 1149 |
| 576 | Ga0495609_0357181 | 3300046538 | Bacteria | 589 |
| 577 | Ga0495621_0349511 | 3300046539 | Bacteria | 620 |
| 578 | Ga0495633_0223915 | 3300046558 | Bacteria | 861 |
| 579 | Ga0495633_0336402 | 3300046558 | Bacteria | 684 |
| 580 | Ga0495667_0036019 | 3300046559 | Bacteria | 3305 |
| 581 | Ga0495656_0007938 | 3300046615 | Bacteria | 3774 |
| 582 | Ga0495656_0050326 | 3300046615 | Bacteria | 1778 |
| 583 | Ga0495656_0060129 | 3300046615 | Unclassified | 1655 |
| 584 | Ga0495656_0072567 | 3300046615 | Bacteria | 1533 |
| 585 | Ga0495656_0093577 | 3300046615 | Bacteria | 1378 |
| 586 | Ga0495656_0156956 | 3300046615 | Bacteria | 1103 |
| 587 | Ga0495656_0747362 | 3300046615 | Bacteria | 527 |
| 588 | Ga0495668_0358350 | 3300046616 | Unclassified | 801 |
| 589 | Ga0495634_0003424 | 3300046642 | Bacteria | 12729 |
| 590 | Ga0495634_0173548 | 3300046642 | Bacteria | 1354 |
| 591 | Ga0495611_0194813 | 3300046648 | Bacteria | 946 |
| 592 | Ga0495611_0199917 | 3300046648 | Bacteria | 932 |
| 593 | Ga0495635_0002848 | 3300046663 | Bacteria | 11882 |
| 594 | Ga0495659_0040885 | 3300046664 | Bacteria | 1655 |
| 595 | Ga0495659_0046873 | 3300046664 | Bacteria | 1561 |
| 596 | Ga0495659_0057778 | 3300046664 | Bacteria | 1426 |
| 597 | Ga0495659_0148852 | 3300046664 | Unclassified | 939 |
| 598 | Ga0495661_0226925 | 3300046665 | Bacteria | 965 |
| 599 | Ga0495661_0315659 | 3300046665 | Bacteria | 778 |
| 600 | Ga0495661_0335682 | 3300046665 | Unclassified | 748 |
| 601 | Ga0495661_0342554 | 3300046665 | Bacteria | 738 |
| 602 | Ga0495661_0399891 | 3300046665 | Bacteria | 668 |
| 603 | Ga0495588_0002913 | 3300046674 | Bacteria | 7379 |
| 604 | Ga0495588_0158603 | 3300046674 | Unclassified | 1196 |
| 605 | Ga0495588_0367313 | 3300046674 | Bacteria | 756 |
| 606 | Ga0495647_0002142 | 3300046681 | Bacteria | 6172 |
| 607 | Ga0495647_0008136 | 3300046681 | Bacteria | 3524 |
| 608 | Ga0495647_0324988 | 3300046681 | Bacteria | 697 |
| 609 | Ga0495658_0000684 | 3300046683 | Bacteria | 18347 |
| 610 | Ga0495669_0538855 | 3300046684 | Bacteria | 568 |
| 611 | Ga0495669_0597386 | 3300046684 | Bacteria | 537 |
| 612 | Ga0495613_0053347 | 3300046689 | Bacteria | 2975 |
| 613 | Ga0495624_0008536 | 3300046690 | Bacteria | 7134 |
| 614 | Ga0495624_0811473 | 3300046690 | Bacteria | 553 |
| 615 | Ga0495670_0010803 | 3300046691 | Bacteria | 4486 |
| 616 | Ga0495670_0024051 | 3300046691 | Bacteria | 3008 |
| 617 | Ga0495670_0087486 | 3300046691 | Bacteria | 1592 |
| 618 | Ga0495670_0090916 | 3300046691 | Bacteria | 1562 |
| 619 | Ga0495589_0512088 | 3300046794 | Unclassified | 548 |
| 620 | Ga0495589_0581724 | 3300046794 | Unclassified | 510 |
| 621 | Ga0495581_0001668 | 3300047315 | Bacteria | 12362 |
| 622 | Ga0495581_0038078 | 3300047315 | Bacteria | 2783 |
| 623 | Ga0495581_0584216 | 3300047315 | Bacteria | 647 |
| 624 | Ga0495636_0222266 | 3300047318 | Bacteria | 867 |
| 625 | Ga0495636_0323943 | 3300047318 | Bacteria | 724 |
| 626 | Ga0495674_0003014 | 3300047319 | Bacteria | 16401 |
| 627 | Ga0495676_0058596 | 3300047321 | Bacteria | 3029 |
| 628 | Ga0495676_0311419 | 3300047321 | Bacteria | 1059 |
| 629 | Ga0495676_0341957 | 3300047321 | Viruses | 1001 |
| 630 | Ga0495676_1114790 | 3300047321 | Unclassified | 501 |
| 631 | Ga0495680_0011999 | 3300047322 | Bacteria | 7646 |
| 632 | Ga0495677_0034019 | 3300047445 | Bacteria | 1859 |
| 633 | Ga0495677_0445103 | 3300047445 | Unclassified | 513 |
| 634 | Ga0495679_080972 | 3300047446 | Bacteria | 922 |
| 635 | Ga0495685_228145 | 3300047447 | Unclassified | 593 |
| 636 | Ga0495684_0196397 | 3300047471 | Bacteria | 1489 |
| 637 | Ga0495593_0004647 | 3300047673 | Bacteria | 8164 |
| 638 | Ga0495614_0000851 | 3300048089 | Bacteria | 12897 |
| 639 | Ga0495614_0542589 | 3300048089 | Bacteria | 556 |
| 640 | Ga0495615_0030862 | 3300048090 | Bacteria | 1282 |
| 641 | Ga0495626_0397990 | 3300048091 | Bacteria | 533 |
| 642 | Ga0496100_0047513 | 3300048903 | Bacteria | 2766 |
| 643 | Ga0496100_0054200 | 3300048903 | Bacteria | 2614 |
| 644 | Ga0496100_0364587 | 3300048903 | Bacteria | 1094 |
| 645 | Ga0496101_0064755 | 3300048904 | Bacteria | 2663 |
| 646 | Ga0496101_0161114 | 3300048904 | Bacteria | 1720 |
| 647 | Ga0496102_0007710 | 3300048905 | Bacteria | 9196 |
| 648 | Ga0496102_0493632 | 3300048905 | Bacteria | 1146 |
| 649 | Ga0496103_0078730 | 3300048906 | Bacteria | 2070 |
| 650 | Ga0496104_0536919 | 3300048907 | Bacteria | 1080 |
| 651 | Ga0496105_1332293 | 3300048908 | Unclassified | 523 |
| 652 | Ga0496106_0004719 | 3300048909 | Bacteria | 10094 |
| 653 | Ga0496106_0017260 | 3300048909 | Bacteria | 5341 |
| 654 | Ga0496106_0488933 | 3300048909 | Bacteria | 989 |
| 655 | Ga0496107_0149359 | 3300048910 | Bacteria | 1728 |
| 656 | Ga0496107_0170592 | 3300048910 | Bacteria | 1614 |
| 657 | Ga0496107_1278837 | 3300048910 | Unclassified | 525 |
| 658 | Ga0496108_0021154 | 3300048911 | Bacteria | 5346 |
| 659 | Ga0496108_0053107 | 3300048911 | Bacteria | 3397 |
| 660 | Ga0496108_0083606 | 3300048911 | Bacteria | 2708 |
| 661 | Ga0496108_1338642 | 3300048911 | Bacteria | 601 |
| 662 | Ga0496109_0004247 | 3300048912 | Bacteria | 11964 |
| 663 | Ga0496109_0116127 | 3300048912 | Bacteria | 2490 |
| 664 | Ga0496110_0154617 | 3300048913 | Bacteria | 2078 |
| 665 | Ga0496110_0229655 | 3300048913 | Bacteria | 1687 |
| 666 | Ga0496110_0309038 | 3300048913 | Unclassified | 1440 |
| 667 | Ga0496110_0815729 | 3300048913 | Bacteria | 838 |
| 668 | Ga0496111_0109400 | 3300048914 | Bacteria | 2035 |
| 669 | Ga0496111_0132465 | 3300048914 | Bacteria | 1845 |
| 670 | Ga0496113_0098002 | 3300048916 | Bacteria | 2269 |
| 671 | Ga0496113_0669825 | 3300048916 | Bacteria | 829 |
| 672 | Ga0496114_0306152 | 3300048917 | Bacteria | 1403 |
| 673 | Ga0496114_0783759 | 3300048917 | Unclassified | 832 |
| 674 | Ga0496114_1040512 | 3300048917 | Bacteria | 702 |
| 675 | Ga0496114_1621796 | 3300048917 | Bacteria | 535 |
| 676 | Ga0501031_0010850 | 3300049568 | Bacteria | 5933 |
| 677 | Ga0501031_0084896 | 3300049568 | Unclassified | 2064 |
| 678 | Ga0501031_0186313 | 3300049568 | Bacteria | 1355 |
| 679 | Ga0501032_0026190 | 3300049569 | Bacteria | 4014 |
| 680 | Ga0501032_0503277 | 3300049569 | Bacteria | 774 |
| 681 | Ga0501032_0724328 | 3300049569 | Bacteria | 630 |
| 682 | Ga0501033_0061143 | 3300049570 | Bacteria | 2776 |
| 683 | Ga0501033_0117447 | 3300049570 | Bacteria | 1932 |
| 684 | Ga0501034_0393986 | 3300049571 | Bacteria | 1308 |
| 685 | Ga0501034_0409382 | 3300049571 | Bacteria | 1278 |
| 686 | Ga0501034_1386559 | 3300049571 | Bacteria | 578 |
| 687 | Ga0501036_0054015 | 3300049572 | Bacteria | 3401 |
| 688 | Ga0501036_0323888 | 3300049572 | Bacteria | 1287 |
| 689 | Ga0501036_1283021 | 3300049572 | Unclassified | 595 |
| 690 | Ga0501036_1560210 | 3300049572 | Bacteria | 534 |
| 691 | Ga0501037_0004946 | 3300049573 | Bacteria | 9693 |
| 692 | Ga0501037_0213065 | 3300049573 | Bacteria | 1361 |
| 693 | Ga0501038_0059775 | 3300049574 | Bacteria | 3264 |
| 694 | Ga0501038_0067038 | 3300049574 | Bacteria | 3054 |
| 695 | Ga0501038_0187961 | 3300049574 | Bacteria | 1663 |
| 696 | Ga0501039_0067804 | 3300049575 | Bacteria | 2770 |
| 697 | Ga0501039_0097603 | 3300049575 | Bacteria | 2291 |
| 698 | Ga0501039_0103457 | 3300049575 | Unclassified | 2223 |
| 699 | Ga0501039_0462028 | 3300049575 | Bacteria | 997 |
| 700 | Ga0501040_0031525 | 3300049576 | Bacteria | 3583 |
| 701 | Ga0501040_0147465 | 3300049576 | Bacteria | 1659 |
| 702 | Ga0501040_0341256 | 3300049576 | Bacteria | 1072 |
| 703 | Ga0501040_0570882 | 3300049576 | Bacteria | 817 |
| 704 | Ga0501040_0590888 | 3300049576 | Unclassified | 802 |
| 705 | Ga0501040_0906678 | 3300049576 | Unclassified | 638 |
| 706 | Ga0501041_0009030 | 3300049577 | Bacteria | 5864 |
| 707 | Ga0501041_0091083 | 3300049577 | Bacteria | 1882 |
| 708 | Ga0501041_0127710 | 3300049577 | Bacteria | 1583 |
| 709 | Ga0501041_1060345 | 3300049577 | Bacteria | 522 |
| 710 | Ga0501042_0025841 | 3300049578 | Bacteria | 4127 |
| 711 | Ga0501042_0208989 | 3300049578 | Bacteria | 1407 |
| 712 | Ga0501042_0338566 | 3300049578 | Unclassified | 1087 |
| 713 | Ga0501043_0191465 | 3300049579 | Bacteria | 1590 |
| 714 | Ga0501043_0311581 | 3300049579 | Bacteria | 1201 |
| 715 | Ga0501043_0354891 | 3300049579 | Bacteria | 1113 |
| 716 | Ga0501046_0072650 | 3300049580 | Bacteria | 2670 |
| 717 | Ga0501046_0381878 | 3300049580 | Bacteria | 1019 |
| 718 | Ga0501046_0400647 | 3300049580 | Bacteria | 991 |
| 719 | Ga0501047_0013906 | 3300049581 | Bacteria | 7644 |
| 720 | Ga0501048_0046540 | 3300049582 | Bacteria | 3096 |
| 721 | Ga0501048_0152228 | 3300049582 | Unclassified | 1636 |
| 722 | Ga0501048_0173038 | 3300049582 | Bacteria | 1530 |
| 723 | Ga0501048_0210597 | 3300049582 | Bacteria | 1378 |
| 724 | Ga0501048_0593547 | 3300049582 | Bacteria | 795 |
| 725 | Ga0501048_0865561 | 3300049582 | Bacteria | 650 |
| 726 | Ga0501048_1338746 | 3300049582 | Unclassified | 515 |
| 727 | Ga0501067_0036919 | 3300049583 | Bacteria | 2713 |
| 728 | Ga0501068_0110412 | 3300049584 | Bacteria | 1709 |
| 729 | Ga0501068_0119771 | 3300049584 | Bacteria | 1640 |
| 730 | Ga0501068_0637601 | 3300049584 | Bacteria | 695 |
| 731 | Ga0501069_0026890 | 3300049585 | Bacteria | 3152 |
| 732 | Ga0501069_0043131 | 3300049585 | Bacteria | 2496 |
| 733 | Ga0501069_0153593 | 3300049585 | Bacteria | 1323 |
| 734 | Ga0501069_0258957 | 3300049585 | Bacteria | 1015 |
| 735 | Ga0501069_0518634 | 3300049585 | Bacteria | 712 |
| 736 | Ga0501070_0003362 | 3300049586 | Bacteria | 13878 |
| 737 | Ga0501070_0504799 | 3300049586 | Bacteria | 971 |
| 738 | Ga0501070_0907204 | 3300049586 | Bacteria | 687 |
| 739 | Ga0501071_0029529 | 3300049587 | Bacteria | 3870 |
| 740 | Ga0501071_0713296 | 3300049587 | Bacteria | 772 |
| 741 | Ga0501071_1214489 | 3300049587 | Unclassified | 582 |
| 742 | Ga0501071_1271295 | 3300049587 | Bacteria | 568 |
| 743 | Ga0501071_1580437 | 3300049587 | Bacteria | 506 |
| 744 | Ga0501072_0044058 | 3300049588 | Bacteria | 3508 |
| 745 | Ga0501072_0156608 | 3300049588 | Unclassified | 1816 |
| 746 | Ga0501072_0187228 | 3300049588 | Bacteria | 1651 |
| 747 | Ga0501072_0370065 | 3300049588 | Bacteria | 1137 |
| 748 | Ga0501072_0901698 | 3300049588 | Bacteria | 690 |
| 749 | Ga0501073_0461578 | 3300049589 | Bacteria | 878 |
| 750 | Ga0501073_0575334 | 3300049589 | Bacteria | 778 |
| 751 | Ga0501074_0031323 | 3300049590 | Bacteria | 3853 |
| 752 | Ga0501074_0062246 | 3300049590 | Unclassified | 2688 |
| 753 | Ga0501074_0067561 | 3300049590 | Bacteria | 2570 |
| 754 | Ga0501075_0050893 | 3300049591 | Bacteria | 3114 |
| 755 | Ga0501075_0255499 | 3300049591 | Bacteria | 1336 |
| 756 | Ga0501075_0500719 | 3300049591 | Bacteria | 927 |
| 757 | Ga0501075_0670161 | 3300049591 | Bacteria | 790 |
| 758 | Ga0501075_0768442 | 3300049591 | Bacteria | 733 |
| 759 | Ga0501075_0920618 | 3300049591 | Unclassified | 664 |
| 760 | Ga0501076_0202140 | 3300049592 | Bacteria | 1622 |
| 761 | Ga0501076_0225484 | 3300049592 | Bacteria | 1531 |
| 762 | Ga0501076_0257533 | 3300049592 | Bacteria | 1428 |
| 763 | Ga0501076_0798604 | 3300049592 | Bacteria | 779 |
| 764 | Ga0501076_1378254 | 3300049592 | Bacteria | 579 |
| 765 | Ga0501076_1762197 | 3300049592 | Bacteria | 508 |
| 766 | Ga0501077_0020392 | 3300049593 | Bacteria | 4195 |
| 767 | Ga0501077_0028440 | 3300049593 | Bacteria | 3552 |
| 768 | Ga0501077_0796289 | 3300049593 | Unclassified | 608 |
| 769 | Ga0501079_0107230 | 3300049741 | Bacteria | 2168 |
| 770 | Ga0501079_0286505 | 3300049741 | Bacteria | 1288 |
| 771 | Ga0501079_0316267 | 3300049741 | Unclassified | 1222 |
| 772 | Ga0501079_0358023 | 3300049741 | Bacteria | 1143 |
| 773 | Ga0501079_0484483 | 3300049741 | Bacteria | 972 |
| 774 | Ga0501079_0548171 | 3300049741 | Bacteria | 909 |
| 775 | Ga0501079_0650541 | 3300049741 | Unclassified | 830 |
| 776 | Ga0501079_1041344 | 3300049741 | Unclassified | 645 |
| 777 | Ga0501080_0028022 | 3300049742 | Bacteria | 5238 |
| 778 | Ga0501080_0058397 | 3300049742 | Bacteria | 3591 |
| 779 | Ga0501080_1061695 | 3300049742 | Unclassified | 700 |
| 780 | Ga0501081_0149984 | 3300049743 | Bacteria | 1674 |
| 781 | Ga0501081_0312056 | 3300049743 | Bacteria | 1155 |
| 782 | Ga0501081_0637449 | 3300049743 | Unclassified | 798 |
| 783 | Ga0501083_0008041 | 3300049744 | Bacteria | 7460 |
| 784 | Ga0501083_0144757 | 3300049744 | Bacteria | 1556 |
| 785 | Ga0501083_0161773 | 3300049744 | Bacteria | 1464 |
| 786 | Ga0501035_0177502 | 3300049822 | Bacteria | 1836 |
| 787 | Ga0501035_1211725 | 3300049822 | Unclassified | 585 |
| 788 | Ga0501035_1285721 | 3300049822 | Unclassified | 564 |
| 789 | Ga0501044_0018411 | 3300049823 | Bacteria | 7482 |
| 790 | Ga0501044_0766697 | 3300049823 | Bacteria | 846 |
| 791 | Ga0501045_0035689 | 3300049824 | Unclassified | 3610 |
| 792 | Ga0501045_0133452 | 3300049824 | Unclassified | 1846 |
| 793 | Ga0501045_0326544 | 3300049824 | Bacteria | 1142 |
| 794 | Ga0501045_0606292 | 3300049824 | Bacteria | 811 |
| 795 | Ga0501045_0643777 | 3300049824 | Bacteria | 783 |
| 796 | Ga0501045_1158949 | 3300049824 | Unclassified | 564 |
| 797 | nmdc:mga05p37_1759294_c1 | 3300050507 | Unclassified | 601 |
| 798 | nmdc:mga05p37_192843_c1 | 3300050507 | Bacteria | 2473 |
| 799 | nmdc:mga05p37_521625_c1 | 3300050507 | Bacteria | 1359 |
| 800 | nmdc:mga05p37_663274_c1 | 3300050507 | Bacteria | 1166 |
| 801 | nmdc:mga05p37_668968_c1 | 3300050507 | Unclassified | 1159 |
| 802 | nmdc:mga05p37_9221_c1 | 3300050507 | Bacteria | 11661 |
| 803 | nmdc:mga09592_152885_c1 | 3300050508 | Bacteria | 1991 |
| 804 | nmdc:mga09592_243745_c1 | 3300050508 | Bacteria | 1558 |
| 805 | nmdc:mga09592_72289_c1 | 3300050508 | Bacteria | 2929 |
| 806 | nmdc:mga0qj67_109955_c1 | 3300050509 | Bacteria | 2225 |
| 807 | nmdc:mga0qj67_6484_c1 | 3300050509 | Bacteria | 8599 |
| 808 | nmdc:mga06r32_1489360_c1 | 3300050510 | Unclassified | 617 |
| 809 | nmdc:mga06r32_4087_c1 | 3300050510 | Bacteria | 13082 |
| 810 | nmdc:mga06r32_463749_c1 | 3300050510 | Bacteria | 1246 |
| 811 | nmdc:mga06r32_483238_c1 | 3300050510 | Bacteria | 1216 |
| 812 | nmdc:mga06r32_75069_c1 | 3300050510 | Bacteria | 3280 |
| 813 | nmdc:mga08y16_432751_c1 | 3300050511 | Unclassified | 1344 |
| 814 | nmdc:mga08y16_570838_c1 | 3300050511 | Bacteria | 1143 |
| 815 | nmdc:mga08y16_88742_c1 | 3300050511 | Bacteria | 3223 |
| 816 | nmdc:mga0n895_18407_c1 | 3300050512 | Bacteria | 6464 |
| 817 | nmdc:mga0n895_83356_c1 | 3300050512 | Bacteria | 3188 |
| 818 | nmdc:mga0n895_834_c1 | 3300050512 | Bacteria | 22113 |
| 819 | nmdc:mga0rr50_1310_c1 | 3300050513 | Bacteria | 13552 |
| 820 | nmdc:mga08x19_186124_c1 | 3300050514 | Bacteria | 1419 |
| 821 | nmdc:mga0a205_262_c1 | 3300050515 | Bacteria | 37984 |
| 822 | nmdc:mga0a205_56717_c1 | 3300050515 | Bacteria | 3782 |
| 823 | nmdc:mga0a205_612417_c1 | 3300050515 | Unclassified | 942 |
| 824 | nmdc:mga0a205_6622_c1 | 3300050515 | Bacteria | 10485 |
| 825 | Ga0495655_0010744 | 3300053083 | Bacteria | 1817 |
| 826 | Ga0495655_0120824 | 3300053083 | Bacteria | 797 |
| 827 | Ga0495655_0220018 | 3300053083 | Bacteria | 628 |
| 828 | Ga0495619_0003198 | 3300053085 | Bacteria | 10607 |
| 829 | Ga0501084_0068136 | 3300054114 | Bacteria | 2980 |
| 830 | Ga0501084_0152421 | 3300054114 | Bacteria | 1948 |
| 831 | Ga0501084_0277463 | 3300054114 | Unclassified | 1415 |
| 832 | Ga0501084_1075442 | 3300054114 | Unclassified | 675 |
| 833 | Ga0590074_023263 | 3300059423 | Bacteria | 1074 |
| 834 | Ga0590074_069095 | 3300059423 | Bacteria | 664 |
| 835 | Ga0590075_039985 | 3300059424 | Unclassified | 1197 |
| 836 | Ga0501082_0039258 | 3300060353 | Bacteria | 4084 |
| 837 | Ga0501082_0102901 | 3300060353 | Bacteria | 2470 |
| 838 | Ga0501082_0160801 | 3300060353 | Bacteria | 1951 |
| 839 | Ga0501082_0184492 | 3300060353 | Bacteria | 1815 |
| 840 | Ga0501082_0377740 | 3300060353 | Bacteria | 1236 |
| 841 | Ga0501082_0395581 | 3300060353 | Unclassified | 1206 |
| 842 | Ga0501082_1258918 | 3300060353 | Bacteria | 646 |
| 843 | Ga0530510_0004365 | 3300061734 | Bacteria | 9786 |
| 844 | Ga0530510_0066173 | 3300061734 | Bacteria | 2619 |
| 845 | Ga0530510_0135003 | 3300061734 | Bacteria | 1816 |
| 846 | Ga0530510_1443359 | 3300061734 | Unclassified | 528 |
| 847 | Ga0307416_102959652 | |||
| 848 | JGI24751J29686_10001091 | |||
| 849 | Ga0070683_100756698 | |||
| 850 | Ga0070690_100365440 | |||
| 851 | Ga0070690_100517976 | |||
| 852 | Ga0070670_100005282 | |||
| 853 | Ga0070670_100033160 | |||
| 854 | Ga0070670_100837000 | |||
| 855 | Ga0070677_10874341 | |||
| 856 | Ga0068869_100313818 | |||
| 857 | Ga0070666_10495810 | |||
| 858 | Ga0070680_100438142 | |||
| 859 | Ga0070680_101366470 | |||
| 860 | Ga0068868_100012011 | |||
| 861 | Ga0068868_100120842 | |||
| 862 | Ga0068868_101676373 | |||
| 863 | Ga0070660_101338047 | |||
| 864 | Ga0070689_100623587 | |||
| 865 | Ga0070689_100717618 | |||
| 866 | Ga0070689_101811809 | |||
| 867 | Ga0070691_10517405 | |||
| 868 | Ga0070691_11065685 | |||
| 869 | Ga0070661_100677504 | |||
| 870 | Ga0070692_10045095 | |||
| 871 | Ga0070692_10073474 | |||
| 872 | Ga0070692_10269595 | |||
| 873 | Ga0070668_100626604 | |||
| 874 | Ga0070675_100157842 | |||
| 875 | Ga0070675_100934080 | |||
| 876 | Ga0070671_100017818 | |||
| 877 | Ga0070671_100766405 | |||
| 878 | Ga0070671_101086461 | |||
| 879 | Ga0070674_100009133 | |||
| 880 | Ga0070674_100075741 | |||
| 881 | Ga0070674_100390493 | |||
| 882 | Ga0070674_100682638 | |||
| 883 | Ga0070674_102119209 | |||
| 884 | Ga0070673_100063962 | |||
| 885 | Ga0070673_101155938 | |||
| 886 | Ga0070688_100220214 | |||
| 887 | Ga0070688_100283062 | |||
| 888 | Ga0070688_100292561 | |||
| 889 | Ga0070688_100430769 | |||
| 890 | Ga0070659_100331008 | |||
| 891 | Ga0070659_100391472 | |||
| 892 | Ga0070659_101179150 | |||
| 893 | Ga0070703_10000067 | |||
| 894 | Ga0070713_101778231 | |||
| 895 | Ga0070701_10880320 | |||
| 896 | Ga0070701_11076340 | |||
| 897 | Ga0070701_11182679 | |||
| 898 | Ga0070711_100007216 | |||
| 899 | Ga0070711_101082504 | |||
| 900 | Ga0070705_100024263 | |||
| 901 | Ga0070705_100044160 | |||
| 902 | Ga0070705_100335486 | |||
| 903 | Ga0070700_100018973 | |||
| 904 | Ga0070700_100076708 | |||
| 905 | Ga0070700_100129061 | |||
| 906 | Ga0070700_100181998 | |||
| 907 | Ga0070700_100377220 | |||
| 908 | Ga0070700_100398443 | |||
| 909 | Ga0070700_100735323 | |||
| 910 | Ga0070694_100034353 | |||
| 911 | Ga0070694_100270507 | |||
| 912 | Ga0070694_100567224 | |||
| 913 | Ga0070694_100608481 | |||
| 914 | Ga0070694_100894244 | |||
| 915 | Ga0070694_101157579 | |||
| 916 | Ga0070708_100000074 | |||
| 917 | Ga0070708_100401386 | |||
| 918 | Ga0070708_100755786 | |||
| 919 | Ga0070708_101519533 | |||
| 920 | Ga0070663_100048916 | |||
| 921 | Ga0070678_100142314 | |||
| 922 | Ga0070678_100162890 | |||
| 923 | Ga0070678_100379209 | |||
| 924 | Ga0070662_101698699 | |||
| 925 | Ga0070681_10187717 | |||
| 926 | Ga0068867_100004737 | |||
| 927 | Ga0068867_100321650 | |||
| 928 | Ga0068867_100436159 | |||
| 929 | Ga0068867_101739384 | |||
| 930 | Ga0070685_10097402 | |||
| 931 | Ga0070706_100005951 | |||
| 932 | Ga0070706_100655298 | |||
| 933 | Ga0070706_101357027 | |||
| 934 | Ga0070707_100118086 | |||
| 935 | Ga0070707_100246245 | |||
| 936 | Ga0070707_100385134 | |||
| 937 | Ga0070707_102333863 | |||
| 938 | Ga0070698_100036787 | |||
| 939 | Ga0070698_100273789 | |||
| 940 | Ga0070698_100347916 | |||
| 941 | Ga0070698_101445446 | |||
| 942 | Ga0070699_100086823 | |||
| 943 | Ga0070699_100140492 | |||
| 944 | Ga0070699_100342030 | |||
| 945 | Ga0070699_100890300 | |||
| 946 | Ga0070699_101373633 | |||
| 947 | Ga0070684_100048882 | |||
| 948 | Ga0070684_100415983 | |||
| 949 | Ga0070697_100043651 | |||
| 950 | Ga0070697_101680684 | |||
| 951 | Ga0070697_101935626 | |||
| 952 | Ga0070697_102006196 | |||
| 953 | Ga0070672_100384191 | |||
| 954 | Ga0070686_100004661 | |||
| 955 | Ga0070686_100369957 | |||
| 956 | Ga0070695_100012922 | |||
| 957 | Ga0070695_100062417 | |||
| 958 | Ga0070695_100323169 | |||
| 959 | Ga0070695_100509996 | |||
| 960 | Ga0070695_101786434 | |||
| 961 | Ga0070696_100005561 | |||
| 962 | Ga0070696_100103176 | |||
| 963 | Ga0070696_100289089 | |||
| 964 | Ga0070696_100630467 | |||
| 965 | Ga0070693_100105303 | |||
| 966 | Ga0070693_101137421 | |||
| 967 | Ga0070665_102119741 | |||
| 968 | Ga0070704_100004909 | |||
| 969 | Ga0070704_100033318 | |||
| 970 | Ga0070704_100084501 | |||
| 971 | Ga0070704_100333017 | |||
| 972 | Ga0070704_100845577 | |||
| 973 | Ga0070704_101571745 | |||
| 974 | Ga0070704_101589431 | |||
| 975 | Ga0070664_100037395 | |||
| 976 | Ga0070664_100551148 | |||
| 977 | Ga0070664_101848929 | |||
| 978 | Ga0068857_100304864 | |||
| 979 | Ga0068857_101730104 | |||
| 980 | Ga0068854_100082005 | |||
| 981 | Ga0068856_100439408 | |||
| 982 | Ga0070702_100236261 | |||
| 983 | Ga0070702_100540915 | |||
| 984 | Ga0070702_100556692 | |||
| 985 | Ga0070702_101355982 | |||
| 986 | Ga0068852_100083811 | |||
| 987 | Ga0068859_100418601 | |||
| 988 | Ga0068859_101532903 | |||
| 989 | Ga0068859_102421344 | |||
| 990 | Ga0068864_100039149 | |||
| 991 | Ga0068864_100048128 | |||
| 992 | Ga0068864_101514912 | |||
| 993 | Ga0068864_102550246 | |||
| 994 | Ga0068866_10038252 | |||
| 995 | Ga0068861_100095171 | |||
| 996 | Ga0068861_100454045 | |||
| 997 | Ga0068861_100849178 | |||
| 998 | Ga0068861_100924467 | |||
| 999 | Ga0068861_101173564 | |||
| 1000 | Ga0068861_101406171 | |||
| 1001 | Ga0068851_10070137 | |||
| 1002 | Ga0068870_10008530 | |||
| 1003 | Ga0068870_10029813 | |||
| 1004 | Ga0068870_10266520 | |||
| 1005 | Ga0068870_11041288 | |||
| 1006 | Ga0068870_11130925 | |||
| 1007 | Ga0068870_11474892 | |||
| 1008 | Ga0068863_100084238 | |||
| 1009 | Ga0068863_100761695 | |||
| 1010 | Ga0068860_100418632 | |||
| 1011 | Ga0068860_100726450 | |||
| 1012 | Ga0068860_101072550 | |||
| 1013 | Ga0068862_100082052 | |||
| 1014 | Ga0068862_102481111 | |||
| 1015 | Ga0081455_10004271 | |||
| 1016 | Ga0081455_10005280 | |||
| 1017 | Ga0081455_10008200 | |||
| 1018 | Ga0081455_10067602 | |||
| 1019 | Ga0081455_10107080 | |||
| 1020 | Ga0081455_10210992 | |||
| 1021 | Ga0081539_10039741 | |||
| 1022 | Ga0075432_10027433 | |||
| 1023 | Ga0070715_10001775 | |||
| 1024 | Ga0070715_10553991 | |||
| 1025 | Ga0070716_100011717 | |||
| 1026 | Ga0070712_100286457 | |||
| 1027 | Ga0070712_100926178 | |||
| 1028 | Ga0068871_100344509 | |||
| 1029 | Ga0075428_100290186 | |||
| 1030 | Ga0075428_100328971 | |||
| 1031 | Ga0075428_100473177 | |||
| 1032 | Ga0075430_100014436 | |||
| 1033 | Ga0075431_100000656 | |||
| 1034 | Ga0075431_100258293 | |||
| 1035 | Ga0075433_10000149 | |||
| 1036 | Ga0075433_10002088 | |||
| 1037 | Ga0075433_10512393 | |||
| 1038 | Ga0075434_100002552 | |||
| 1039 | Ga0075434_100023704 | |||
| 1040 | Ga0075434_100081980 | |||
| 1041 | Ga0075434_101954340 | |||
| 1042 | Ga0075434_102157853 | |||
| 1043 | Ga0075434_102469671 | |||
| 1044 | Ga0075429_100022927 | |||
| 1045 | Ga0075429_100057037 | |||
| 1046 | Ga0075429_100610873 | |||
| 1047 | Ga0075429_100699927 | |||
| 1048 | Ga0068865_100010544 | |||
| 1049 | Ga0068865_100036700 | |||
| 1050 | Ga0068865_100309716 | |||
| 1051 | Ga0068865_101494866 | |||
| 1052 | Ga0068865_102074129 | |||
| 1053 | Ga0075436_100410459 | |||
| 1054 | Ga0097620_100418564 | |||
| 1055 | Ga0097620_101533030 | |||
| 1056 | Ga0097620_102421951 | |||
| 1057 | Ga0075435_100019439 | |||
| 1058 | Ga0075435_100890944 | |||
| 1059 | Ga0105251_10028877 | |||
| 1060 | Ga0105250_10282111 | |||
| 1061 | Ga0111539_10117832 | |||
| 1062 | Ga0111539_10408644 | |||
| 1063 | Ga0111539_10427431 | |||
| 1064 | Ga0105245_10020084 | |||
| 1065 | Ga0105245_10103963 | |||
| 1066 | Ga0105245_10163104 | |||
| 1067 | Ga0105245_11139648 | |||
| 1068 | Ga0105245_11900039 | |||
| 1069 | Ga0105245_12995562 | |||
| 1070 | Ga0105247_10562697 | |||
| 1071 | Ga0114129_10000667 | |||
| 1072 | Ga0114129_10020441 | |||
| 1073 | Ga0114129_10144583 | |||
| 1074 | Ga0114129_10261987 | |||
| 1075 | Ga0114129_11482810 | |||
| 1076 | Ga0114129_13219223 | |||
| 1077 | Ga0105243_10002499 | |||
| 1078 | Ga0105243_10003191 | |||
| 1079 | Ga0105243_10003771 | |||
| 1080 | Ga0105243_10016524 | |||
| 1081 | Ga0105243_10274051 | |||
| 1082 | Ga0105243_11432584 | |||
| 1083 | Ga0105241_11087697 | |||
| 1084 | Ga0105242_10002614 | |||
| 1085 | Ga0105242_10005041 | |||
| 1086 | Ga0105242_10037839 | |||
| 1087 | Ga0105242_10246436 | |||
| 1088 | Ga0105248_10203482 | |||
| 1089 | Ga0105237_10297868 | |||
| 1090 | Ga0105238_10127349 | |||
| 1091 | Ga0105249_10028324 | |||
| 1092 | Ga0105249_10349104 | |||
| 1093 | Ga0105249_10521162 | |||
| 1094 | Ga0105249_10988830 | |||
| 1095 | Ga0105249_11773184 | |||
| 1096 | Ga0105249_12462010 | |||
| 1097 | Ga0105249_13100340 | |||
| 1098 | Ga0105246_10014629 | |||
| 1099 | Ga0105246_10124196 | |||
| 1100 | Ga0105246_10156647 | |||
| 1101 | Ga0105246_10247370 | |||
| 1102 | Ga0105246_10251142 | |||
| 1103 | Ga0105246_10593525 | |||
| 1104 | Ga0157339_1039072 | |||
| 1105 | Ga0157378_10006475 | |||
| 1106 | Ga0157378_10009223 | |||
| 1107 | Ga0157378_10032136 | |||
| 1108 | Ga0157378_10401459 | |||
| 1109 | Ga0157378_12252062 | |||
| 1110 | Ga0163162_10214993 | |||
| 1111 | Ga0163162_11021161 | |||
| 1112 | Ga0163162_11887333 | |||
| 1113 | Ga0157375_10009595 | |||
| 1114 | Ga0157375_10025029 | |||
| 1115 | Ga0157375_13055751 | |||
| 1116 | Ga0163163_10144884 | |||
| 1117 | Ga0163163_10287218 | |||
| 1118 | Ga0163163_10467760 | |||
| 1119 | Ga0163163_10941949 | |||
| 1120 | Ga0163163_11232614 | |||
| 1121 | Ga0163163_12863227 | |||
| 1122 | Ga0157380_10032195 | |||
| 1123 | Ga0157380_10430072 | |||
| 1124 | Ga0157380_10463079 | |||
| 1125 | Ga0157380_10754524 | |||
| 1126 | Ga0157377_10026861 | |||
| 1127 | Ga0157377_10064760 | |||
| 1128 | Ga0157377_10176895 | |||
| 1129 | Ga0157377_10436330 | |||
| 1130 | Ga0157377_10513350 | |||
| 1131 | Ga0157377_10930526 | |||
| 1132 | Ga0157379_10134557 | |||
| 1133 | Ga0157379_11936388 | |||
| 1134 | Ga0157379_12053970 | |||
| 1135 | Ga0157376_10341310 | |||
| 1136 | Ga0157376_10342066 | |||
| 1137 | Ga0163161_10296423 | |||
| 1138 | Ga0163161_10730769 | |||
| 1139 | Ga0207656_10029289 | |||
| 1140 | Ga0207713_1216192 | |||
| 1141 | Ga0207653_10000002 | |||
| 1142 | Ga0207653_10045089 | |||
| 1143 | Ga0207682_10148205 | |||
| 1144 | Ga0207692_10087888 | |||
| 1145 | Ga0207642_10199630 | |||
| 1146 | Ga0207642_10290419 | |||
| 1147 | Ga0207710_10243934 | |||
| 1148 | Ga0207688_10034615 | |||
| 1149 | Ga0207680_10612927 | |||
| 1150 | Ga0207647_10307889 | |||
| 1151 | Ga0207685_10003043 | |||
| 1152 | Ga0207645_10051426 | |||
| 1153 | Ga0207643_10002088 | |||
| 1154 | Ga0207643_10217274 | |||
| 1155 | Ga0207643_10230066 | |||
| 1156 | Ga0207643_10974184 | |||
| 1157 | Ga0207684_10000612 | |||
| 1158 | Ga0207684_11222318 | |||
| 1159 | Ga0207684_11483747 | |||
| 1160 | Ga0207684_11693635 | |||
| 1161 | Ga0207707_10434225 | |||
| 1162 | Ga0207707_10747841 | |||
| 1163 | Ga0207693_10000234 | |||
| 1164 | Ga0207693_10637091 | |||
| 1165 | Ga0207663_10161961 | |||
| 1166 | Ga0207660_10413198 | |||
| 1167 | Ga0207660_10436472 | |||
| 1168 | Ga0207660_11665672 | |||
| 1169 | Ga0207662_10064779 | |||
| 1170 | Ga0207657_10762672 | |||
| 1171 | Ga0207652_10263120 | |||
| 1172 | Ga0207646_10008060 | |||
| 1173 | Ga0207646_10580622 | |||
| 1174 | Ga0207646_11033565 | |||
| 1175 | Ga0207694_10104372 | |||
| 1176 | Ga0207650_10006025 | |||
| 1177 | Ga0207650_10022995 | |||
| 1178 | Ga0207650_10393517 | |||
| 1179 | Ga0207650_10905267 | |||
| 1180 | Ga0207659_10102939 | |||
| 1181 | Ga0207659_10501506 | |||
| 1182 | Ga0207659_10601511 | |||
| 1183 | Ga0207687_10002239 | |||
| 1184 | Ga0207687_10030225 | |||
| 1185 | Ga0207644_10086485 | |||
| 1186 | Ga0207690_10239000 | |||
| 1187 | Ga0207690_11663218 | |||
| 1188 | Ga0207706_11407004 | |||
| 1189 | Ga0207706_11678941 | |||
| 1190 | Ga0207686_10034482 | |||
| 1191 | Ga0207686_10063381 | |||
| 1192 | Ga0207686_10128094 | |||
| 1193 | Ga0207686_10701566 | |||
| 1194 | Ga0207709_10009376 | |||
| 1195 | Ga0207709_10011763 | |||
| 1196 | Ga0207709_10026986 | |||
| 1197 | Ga0207709_10233670 | |||
| 1198 | Ga0207670_10211340 | |||
| 1199 | Ga0207670_10698887 | |||
| 1200 | Ga0207669_10039923 | |||
| 1201 | Ga0207669_10064891 | |||
| 1202 | Ga0207669_10066615 | |||
| 1203 | Ga0207669_10367695 | |||
| 1204 | Ga0207669_10459409 | |||
| 1205 | Ga0207704_10238304 | |||
| 1206 | Ga0207704_11496277 | |||
| 1207 | Ga0207704_11728423 | |||
| 1208 | Ga0207691_10079700 | |||
| 1209 | Ga0207691_11354750 | |||
| 1210 | Ga0207711_10258100 | |||
| 1211 | Ga0207689_10064638 | |||
| 1212 | Ga0207689_10477202 | |||
| 1213 | Ga0207689_11582743 | |||
| 1214 | Ga0207661_10395383 | |||
| 1215 | Ga0207661_11861106 | |||
| 1216 | Ga0207679_10001553 | |||
| 1217 | Ga0207679_10968091 | |||
| 1218 | Ga0207651_10050764 | |||
| 1219 | Ga0207651_11827018 | |||
| 1220 | Ga0207651_12025470 | |||
| 1221 | Ga0207712_10009270 | |||
| 1222 | Ga0207712_10052995 | |||
| 1223 | Ga0207712_10751150 | |||
| 1224 | Ga0207712_10962678 | |||
| 1225 | Ga0207668_11435095 | |||
| 1226 | Ga0207668_11600491 | |||
| 1227 | Ga0207640_10525912 | |||
| 1228 | Ga0207640_10809386 | |||
| 1229 | Ga0207677_10138854 | |||
| 1230 | Ga0207677_11787748 | |||
| 1231 | Ga0207678_10042793 | |||
| 1232 | Ga0207678_10202030 | |||
| 1233 | Ga0207678_11579317 | |||
| 1234 | Ga0207678_12028783 | |||
| 1235 | Ga0207708_10015640 | |||
| 1236 | Ga0207708_10020897 | |||
| 1237 | Ga0207708_10021485 | |||
| 1238 | Ga0207708_10217894 | |||
| 1239 | Ga0207708_10681175 | |||
| 1240 | Ga0207708_10818490 | |||
| 1241 | Ga0207708_10921109 | |||
| 1242 | Ga0207708_11446049 | |||
| 1243 | Ga0207702_10412121 | |||
| 1244 | Ga0207702_11489314 | |||
| 1245 | Ga0207641_10016768 | |||
| 1246 | Ga0207641_10435616 | |||
| 1247 | Ga0207641_10720956 | |||
| 1248 | Ga0207641_10776758 | |||
| 1249 | Ga0207648_10000754 | |||
| 1250 | Ga0207648_10014866 | |||
| 1251 | Ga0207648_11537763 | |||
| 1252 | Ga0207676_10010382 | |||
| 1253 | Ga0207676_10185116 | |||
| 1254 | Ga0207674_10055176 | |||
| 1255 | Ga0207674_10169100 | |||
| 1256 | Ga0207675_100021703 | |||
| 1257 | Ga0207675_100452828 | |||
| 1258 | Ga0207675_100585011 | |||
| 1259 | Ga0207675_100675515 | |||
| 1260 | Ga0207675_101273792 | |||
| 1261 | Ga0207675_101949227 | |||
| 1262 | Ga0207683_10087911 | |||
| 1263 | Ga0207683_10340320 | |||
| 1264 | Ga0207683_10437999 | |||
| 1265 | Ga0209966_1061503 | |||
| 1266 | Ga0207428_10000597 | |||
| 1267 | Ga0207428_10000612 | |||
| 1268 | Ga0207428_10020218 | |||
| 1269 | Ga0268266_10911992 | |||
| 1270 | Ga0268265_11088490 | |||
| 1271 | Ga0268265_12724139 | |||
| 1272 | Ga0268264_10073848 | |||
| 1273 | Ga0268264_10183862 | |||
| 1274 | Ga0268264_10311613 | |||
| 1275 | Ga0268264_12039896 | |||
| 1276 | Ga0307410_11752067 | |||
| 1277 | Ga0307409_101020345 | |||
| 1278 | Ga0307416_101163149 | |||
| 1279 | Ga0307415_100166313 | |||
| 1280 | Ga0307415_101770380 | |||
| 1281 | Ga0373948_0054953 | |||
| 1282 | Ga0373926_0001364 | |||
| 1283 | Ga0373944_0000653 | |||
| 1284 | Ga0373951_0052255 | |||
| 1285 | Ga0373923_0015583 | |||
| 1286 | Ga0373936_0001504 | |||
| 1287 | Ga0373939_0063808 | |||
| 1288 | Ga0373945_0044282 | |||
| 1289 | Ga0373943_0003307 | |||
| 1290 | Ga0373943_0450686 | |||
| 1291 | Ga0373946_0001746 | |||
| 1292 | Ga0373961_0103754 | |||
| 1293 | Ga0373961_0384651 | |||
| 1294 | Ga0373962_0018458 | |||
| 1295 | Ga0373931_0046562 | |||
| 1296 | Ga0373935_0090920 | |||
| 1297 | Ga0373935_1185706 | |||
| 1298 | Ga0373927_0007582 | |||
| 1299 | Ga0373927_0647566 | |||
| 1300 | Ga0373947_0017501 | |||
| 1301 | Ga0373947_0291670 | |||
| 1302 | Ga0373947_0428976 | |||
| 1303 | Ga0373925_0166257 | |||
| 1304 | Ga0373925_0278446 | |||
| 1305 | Ga0373925_1633637 | |||
| 1306 | Ga0395899_0058054 | |||
| 1307 | Ga0395899_0070888 | |||
| 1308 | Ga0395899_0159722 | |||
| 1309 | Ga0395899_0233975 | |||
| 1310 | Ga0395899_0349000 | |||
| 1311 | Ga0395900_0003775 | |||
| 1312 | Ga0395900_0011221 | |||
| 1313 | Ga0395900_0068815 | |||
| 1314 | Ga0395900_0155423 | |||
| 1315 | Ga0395900_1388807 | |||
| 1316 | Ga0395898_0012736 | |||
| 1317 | Ga0395898_0091637 | |||
| 1318 | Ga0395898_0423128 | |||
| 1319 | Ga0395898_1107491 | |||
| 1320 | Ga0395905_0022764 | |||
| 1321 | Ga0395905_0030701 | |||
| 1322 | Ga0395905_0042179 | |||
| 1323 | Ga0395905_0049433 | |||
| 1324 | Ga0395905_0092477 | |||
| 1325 | Ga0395905_0146397 | |||
| 1326 | Ga0395905_0405575 | |||
| 1327 | Ga0395905_1815076 | |||
| 1328 | Ga0395901_0025036 | |||
| 1329 | Ga0395901_0029715 | |||
| 1330 | Ga0395901_0108608 | |||
| 1331 | Ga0395901_0124980 | |||
| 1332 | Ga0395901_0153373 | |||
| 1333 | Ga0395901_0491532 | |||
| 1334 | Ga0395901_0513170 | |||
| 1335 | Ga0395901_0901808 | |||
| 1336 | Ga0395901_1967558 | |||
| 1337 | Ga0439453_0071713 | |||
| 1338 | Ga0439453_0181356 | |||
| 1339 | Ga0451804_0468199 | |||
| 1340 | Ga0439443_049382 | |||
| 1341 | Ga0439448_0119894 | |||
| 1342 | Ga0439454_023056 | |||
| 1343 | Ga0439454_059401 | |||
| 1344 | Ga0439463_162684 | |||
| 1345 | Ga0439435_0194953 | |||
| 1346 | Ga0439444_0091238 | |||
| 1347 | Ga0439464_0033942 | |||
| 1348 | Ga0439460_0098712 | |||
| 1349 | Ga0439460_0313654 | |||
| 1350 | Ga0450893_0116578 | |||
| 1351 | Ga0439440_0035589 | |||
| 1352 | Ga0439440_0089681 | |||
| 1353 | Ga0466960_0546305 | |||
| 1354 | Ga0495617_288815 | |||
| 1355 | Ga0495603_0003354 | |||
| 1356 | Ga0495603_0005113 | |||
| 1357 | Ga0495603_0013661 | |||
| 1358 | Ga0495603_0029038 | |||
| 1359 | Ga0495603_0029381 | |||
| 1360 | Ga0495603_0119630 | |||
| 1361 | Ga0495629_0009809 | |||
| 1362 | Ga0495641_0004496 | |||
| 1363 | Ga0495641_0284099 | |||
| 1364 | Ga0495653_0036179 | |||
| 1365 | Ga0495580_0158005 | |||
| 1366 | Ga0495580_0176585 | |||
| 1367 | Ga0495582_0003096 | |||
| 1368 | Ga0495582_0811485 | |||
| 1369 | Ga0495605_0191427 | |||
| 1370 | Ga0495639_0001049 | |||
| 1371 | Ga0495639_0456532 | |||
| 1372 | Ga0495662_0000565 | |||
| 1373 | Ga0495584_0047079 | |||
| 1374 | Ga0495584_0058921 | |||
| 1375 | Ga0495584_0065395 | |||
| 1376 | Ga0495584_0173809 | |||
| 1377 | Ga0495584_0319262 | |||
| 1378 | Ga0495584_0497077 | |||
| 1379 | Ga0495584_0689255 | |||
| 1380 | Ga0495584_0738800 | |||
| 1381 | Ga0495585_0028209 | |||
| 1382 | Ga0495585_0032931 | |||
| 1383 | Ga0495585_0484752 | |||
| 1384 | Ga0495594_0024091 | |||
| 1385 | Ga0495594_0229667 | |||
| 1386 | Ga0495596_0027540 | |||
| 1387 | Ga0495596_0100212 | |||
| 1388 | Ga0495607_0025182 | |||
| 1389 | Ga0495607_0191919 | |||
| 1390 | Ga0495607_0326912 | |||
| 1391 | Ga0495583_0295753 | |||
| 1392 | Ga0495616_0158716 | |||
| 1393 | Ga0495616_0357884 | |||
| 1394 | Ga0495618_0894458 | |||
| 1395 | Ga0495620_0165666 | |||
| 1396 | Ga0495630_0013811 | |||
| 1397 | Ga0495631_0126366 | |||
| 1398 | Ga0495631_0277776 | |||
| 1399 | Ga0495631_0375794 | |||
| 1400 | Ga0495637_0155938 | |||
| 1401 | Ga0495644_0038686 | |||
| 1402 | Ga0495644_0057380 | |||
| 1403 | Ga0495644_0083828 | |||
| 1404 | Ga0495644_0148118 | |||
| 1405 | Ga0495663_0203456 | |||
| 1406 | Ga0495666_0003712 | |||
| 1407 | Ga0495642_0044150 | |||
| 1408 | Ga0495642_0048726 | |||
| 1409 | Ga0495642_0355627 | |||
| 1410 | Ga0495665_0000725 | |||
| 1411 | Ga0495665_0058128 | |||
| 1412 | Ga0495640_0038151 | |||
| 1413 | Ga0495640_0841419 | |||
| 1414 | Ga0495586_0028185 | |||
| 1415 | Ga0495586_0058223 | |||
| 1416 | Ga0495598_0012111 | |||
| 1417 | Ga0495598_0052528 | |||
| 1418 | Ga0495598_0315016 | |||
| 1419 | Ga0495609_0028547 | |||
| 1420 | Ga0495609_0086367 | |||
| 1421 | Ga0495609_0116816 | |||
| 1422 | Ga0495609_0357181 | |||
| 1423 | Ga0495621_0349511 | |||
| 1424 | Ga0495633_0223915 | |||
| 1425 | Ga0495633_0336402 | |||
| 1426 | Ga0495667_0036019 | |||
| 1427 | Ga0495656_0007938 | |||
| 1428 | Ga0495656_0050326 | |||
| 1429 | Ga0495656_0060129 | |||
| 1430 | Ga0495656_0072567 | |||
| 1431 | Ga0495656_0093577 | |||
| 1432 | Ga0495656_0156956 | |||
| 1433 | Ga0495656_0747362 | |||
| 1434 | Ga0495668_0358350 | |||
| 1435 | Ga0495634_0003424 | |||
| 1436 | Ga0495634_0173548 | |||
| 1437 | Ga0495611_0194813 | |||
| 1438 | Ga0495611_0199917 | |||
| 1439 | Ga0495635_0002848 | |||
| 1440 | Ga0495659_0040885 | |||
| 1441 | Ga0495659_0046873 | |||
| 1442 | Ga0495659_0057778 | |||
| 1443 | Ga0495659_0148852 | |||
| 1444 | Ga0495661_0226925 | |||
| 1445 | Ga0495661_0315659 | |||
| 1446 | Ga0495661_0335682 | |||
| 1447 | Ga0495661_0342554 | |||
| 1448 | Ga0495661_0399891 | |||
| 1449 | Ga0495588_0002913 | |||
| 1450 | Ga0495588_0158603 | |||
| 1451 | Ga0495588_0367313 | |||
| 1452 | Ga0495647_0002142 | |||
| 1453 | Ga0495647_0008136 | |||
| 1454 | Ga0495647_0324988 | |||
| 1455 | Ga0495658_0000684 | |||
| 1456 | Ga0495669_0538855 | |||
| 1457 | Ga0495669_0597386 | |||
| 1458 | Ga0495613_0053347 | |||
| 1459 | Ga0495624_0008536 | |||
| 1460 | Ga0495624_0811473 | |||
| 1461 | Ga0495670_0010803 | |||
| 1462 | Ga0495670_0024051 | |||
| 1463 | Ga0495670_0087486 | |||
| 1464 | Ga0495670_0090916 | |||
| 1465 | Ga0495589_0512088 | |||
| 1466 | Ga0495589_0581724 | |||
| 1467 | Ga0495581_0001668 | |||
| 1468 | Ga0495581_0038078 | |||
| 1469 | Ga0495581_0584216 | |||
| 1470 | Ga0495636_0222266 | |||
| 1471 | Ga0495636_0323943 | |||
| 1472 | Ga0495674_0003014 | |||
| 1473 | Ga0495676_0058596 | |||
| 1474 | Ga0495676_0311419 | |||
| 1475 | Ga0495676_0341957 | |||
| 1476 | Ga0495676_1114790 | |||
| 1477 | Ga0495680_0011999 | |||
| 1478 | Ga0495677_0034019 | |||
| 1479 | Ga0495677_0445103 | |||
| 1480 | Ga0495679_080972 | |||
| 1481 | Ga0495685_228145 | |||
| 1482 | Ga0495684_0196397 | |||
| 1483 | Ga0495593_0004647 | |||
| 1484 | Ga0495614_0000851 | |||
| 1485 | Ga0495614_0542589 | |||
| 1486 | Ga0495615_0030862 | |||
| 1487 | Ga0495626_0397990 | |||
| 1488 | Ga0496100_0047513 | |||
| 1489 | Ga0496100_0054200 | |||
| 1490 | Ga0496100_0364587 | |||
| 1491 | Ga0496101_0064755 | |||
| 1492 | Ga0496101_0161114 | |||
| 1493 | Ga0496102_0007710 | |||
| 1494 | Ga0496102_0493632 | |||
| 1495 | Ga0496103_0078730 | |||
| 1496 | Ga0496104_0536919 | |||
| 1497 | Ga0496105_1332293 | |||
| 1498 | Ga0496106_0004719 | |||
| 1499 | Ga0496106_0017260 | |||
| 1500 | Ga0496106_0488933 | |||
| 1501 | Ga0496107_0149359 | |||
| 1502 | Ga0496107_0170592 | |||
| 1503 | Ga0496107_1278837 | |||
| 1504 | Ga0496108_0021154 | |||
| 1505 | Ga0496108_0053107 | |||
| 1506 | Ga0496108_0083606 | |||
| 1507 | Ga0496108_1338642 | |||
| 1508 | Ga0496109_0004247 | |||
| 1509 | Ga0496109_0116127 | |||
| 1510 | Ga0496110_0154617 | |||
| 1511 | Ga0496110_0229655 | |||
| 1512 | Ga0496110_0309038 | |||
| 1513 | Ga0496110_0815729 | |||
| 1514 | Ga0496111_0109400 | |||
| 1515 | Ga0496111_0132465 | |||
| 1516 | Ga0496113_0098002 | |||
| 1517 | Ga0496113_0669825 | |||
| 1518 | Ga0496114_0306152 | |||
| 1519 | Ga0496114_0783759 | |||
| 1520 | Ga0496114_1040512 | |||
| 1521 | Ga0496114_1621796 | |||
| 1522 | Ga0501031_0010850 | |||
| 1523 | Ga0501031_0084896 | |||
| 1524 | Ga0501031_0186313 | |||
| 1525 | Ga0501032_0026190 | |||
| 1526 | Ga0501032_0503277 | |||
| 1527 | Ga0501032_0724328 | |||
| 1528 | Ga0501033_0061143 | |||
| 1529 | Ga0501033_0117447 | |||
| 1530 | Ga0501034_0393986 | |||
| 1531 | Ga0501034_0409382 | |||
| 1532 | Ga0501034_1386559 | |||
| 1533 | Ga0501036_0054015 | |||
| 1534 | Ga0501036_0323888 | |||
| 1535 | Ga0501036_1283021 | |||
| 1536 | Ga0501036_1560210 | |||
| 1537 | Ga0501037_0004946 | |||
| 1538 | Ga0501037_0213065 | |||
| 1539 | Ga0501038_0059775 | |||
| 1540 | Ga0501038_0067038 | |||
| 1541 | Ga0501038_0187961 | |||
| 1542 | Ga0501039_0067804 | |||
| 1543 | Ga0501039_0097603 | |||
| 1544 | Ga0501039_0103457 | |||
| 1545 | Ga0501039_0462028 | |||
| 1546 | Ga0501040_0031525 | |||
| 1547 | Ga0501040_0147465 | |||
| 1548 | Ga0501040_0341256 | |||
| 1549 | Ga0501040_0570882 | |||
| 1550 | Ga0501040_0590888 | |||
| 1551 | Ga0501040_0906678 | |||
| 1552 | Ga0501041_0009030 | |||
| 1553 | Ga0501041_0091083 | |||
| 1554 | Ga0501041_0127710 | |||
| 1555 | Ga0501041_1060345 | |||
| 1556 | Ga0501042_0025841 | |||
| 1557 | Ga0501042_0208989 | |||
| 1558 | Ga0501042_0338566 | |||
| 1559 | Ga0501043_0191465 | |||
| 1560 | Ga0501043_0311581 | |||
| 1561 | Ga0501043_0354891 | |||
| 1562 | Ga0501046_0072650 | |||
| 1563 | Ga0501046_0381878 | |||
| 1564 | Ga0501046_0400647 | |||
| 1565 | Ga0501047_0013906 | |||
| 1566 | Ga0501048_0046540 | |||
| 1567 | Ga0501048_0152228 | |||
| 1568 | Ga0501048_0173038 | |||
| 1569 | Ga0501048_0210597 | |||
| 1570 | Ga0501048_0593547 | |||
| 1571 | Ga0501048_0865561 | |||
| 1572 | Ga0501048_1338746 | |||
| 1573 | Ga0501067_0036919 | |||
| 1574 | Ga0501068_0110412 | |||
| 1575 | Ga0501068_0119771 | |||
| 1576 | Ga0501068_0637601 | |||
| 1577 | Ga0501069_0026890 | |||
| 1578 | Ga0501069_0043131 | |||
| 1579 | Ga0501069_0153593 | |||
| 1580 | Ga0501069_0258957 | |||
| 1581 | Ga0501069_0518634 | |||
| 1582 | Ga0501070_0003362 | |||
| 1583 | Ga0501070_0504799 | |||
| 1584 | Ga0501070_0907204 | |||
| 1585 | Ga0501071_0029529 | |||
| 1586 | Ga0501071_0713296 | |||
| 1587 | Ga0501071_1214489 | |||
| 1588 | Ga0501071_1271295 | |||
| 1589 | Ga0501071_1580437 | |||
| 1590 | Ga0501072_0044058 | |||
| 1591 | Ga0501072_0156608 | |||
| 1592 | Ga0501072_0187228 | |||
| 1593 | Ga0501072_0370065 | |||
| 1594 | Ga0501072_0901698 | |||
| 1595 | Ga0501073_0461578 | |||
| 1596 | Ga0501073_0575334 | |||
| 1597 | Ga0501074_0031323 | |||
| 1598 | Ga0501074_0062246 | |||
| 1599 | Ga0501074_0067561 | |||
| 1600 | Ga0501075_0050893 | |||
| 1601 | Ga0501075_0255499 | |||
| 1602 | Ga0501075_0500719 | |||
| 1603 | Ga0501075_0670161 | |||
| 1604 | Ga0501075_0768442 | |||
| 1605 | Ga0501075_0920618 | |||
| 1606 | Ga0501076_0202140 | |||
| 1607 | Ga0501076_0225484 | |||
| 1608 | Ga0501076_0257533 | |||
| 1609 | Ga0501076_0798604 | |||
| 1610 | Ga0501076_1378254 | |||
| 1611 | Ga0501076_1762197 | |||
| 1612 | Ga0501077_0020392 | |||
| 1613 | Ga0501077_0028440 | |||
| 1614 | Ga0501077_0796289 | |||
| 1615 | Ga0501079_0107230 | |||
| 1616 | Ga0501079_0286505 | |||
| 1617 | Ga0501079_0316267 | |||
| 1618 | Ga0501079_0358023 | |||
| 1619 | Ga0501079_0484483 | |||
| 1620 | Ga0501079_0548171 | |||
| 1621 | Ga0501079_0650541 | |||
| 1622 | Ga0501079_1041344 | |||
| 1623 | Ga0501080_0028022 | |||
| 1624 | Ga0501080_0058397 | |||
| 1625 | Ga0501080_1061695 | |||
| 1626 | Ga0501081_0149984 | |||
| 1627 | Ga0501081_0312056 | |||
| 1628 | Ga0501081_0637449 | |||
| 1629 | Ga0501083_0008041 | |||
| 1630 | Ga0501083_0144757 | |||
| 1631 | Ga0501083_0161773 | |||
| 1632 | Ga0501035_0177502 | |||
| 1633 | Ga0501035_1211725 | |||
| 1634 | Ga0501035_1285721 | |||
| 1635 | Ga0501044_0018411 | |||
| 1636 | Ga0501044_0766697 | |||
| 1637 | Ga0501045_0035689 | |||
| 1638 | Ga0501045_0133452 | |||
| 1639 | Ga0501045_0326544 | |||
| 1640 | Ga0501045_0606292 | |||
| 1641 | Ga0501045_0643777 | |||
| 1642 | Ga0501045_1158949 | |||
| 1643 | nmdc:mga05p37_1759294_c1 | |||
| 1644 | nmdc:mga05p37_192843_c1 | |||
| 1645 | nmdc:mga05p37_521625_c1 | |||
| 1646 | nmdc:mga05p37_663274_c1 | |||
| 1647 | nmdc:mga05p37_668968_c1 | |||
| 1648 | nmdc:mga05p37_9221_c1 | |||
| 1649 | nmdc:mga09592_152885_c1 | |||
| 1650 | nmdc:mga09592_243745_c1 | |||
| 1651 | nmdc:mga09592_72289_c1 | |||
| 1652 | nmdc:mga0qj67_109955_c1 | |||
| 1653 | nmdc:mga0qj67_6484_c1 | |||
| 1654 | nmdc:mga06r32_1489360_c1 | |||
| 1655 | nmdc:mga06r32_4087_c1 | |||
| 1656 | nmdc:mga06r32_463749_c1 | |||
| 1657 | nmdc:mga06r32_483238_c1 | |||
| 1658 | nmdc:mga06r32_75069_c1 | |||
| 1659 | nmdc:mga08y16_432751_c1 | |||
| 1660 | nmdc:mga08y16_570838_c1 | |||
| 1661 | nmdc:mga08y16_88742_c1 | |||
| 1662 | nmdc:mga0n895_18407_c1 | |||
| 1663 | nmdc:mga0n895_83356_c1 | |||
| 1664 | nmdc:mga0n895_834_c1 | |||
| 1665 | nmdc:mga0rr50_1310_c1 | |||
| 1666 | nmdc:mga08x19_186124_c1 | |||
| 1667 | nmdc:mga0a205_262_c1 | |||
| 1668 | nmdc:mga0a205_56717_c1 | |||
| 1669 | nmdc:mga0a205_612417_c1 | |||
| 1670 | nmdc:mga0a205_6622_c1 | |||
| 1671 | Ga0495655_0010744 | |||
| 1672 | Ga0495655_0120824 | |||
| 1673 | Ga0495655_0220018 | |||
| 1674 | Ga0495619_0003198 | |||
| 1675 | Ga0501084_0068136 | |||
| 1676 | Ga0501084_0152421 | |||
| 1677 | Ga0501084_0277463 | |||
| 1678 | Ga0501084_1075442 | |||
| 1679 | Ga0590074_023263 | |||
| 1680 | Ga0590074_069095 | |||
| 1681 | Ga0590075_039985 | |||
| 1682 | Ga0501082_0039258 | |||
| 1683 | Ga0501082_0102901 | |||
| 1684 | Ga0501082_0160801 | |||
| 1685 | Ga0501082_0184492 | |||
| 1686 | Ga0501082_0377740 | |||
| 1687 | Ga0501082_0395581 | |||
| 1688 | Ga0501082_1258918 | |||
| 1689 | Ga0530510_0004365 | |||
| 1690 | Ga0530510_0066173 | |||
| 1691 | Ga0530510_0135003 | |||
| 1692 | Ga0530510_1443359 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dry-assembly1.cif.gz_A | x-ray crystal structure of human kctd5 protein crystallized in low-salt buffer | 0.7677 | 1 | 54 |
| 6xyd-assembly1.cif.gz_C | crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi | 0.7659 | 19 | 51 |
| 6gz5-assembly1.cif.gz_Ct | trna translocation by the eukaryotic 80s ribosome and the impact of gtp hydrolysis, translocation-intermediate-post-3 (ti-post-3) | 0.7657 | 2 | 52 |
| 6xyd-assembly1.cif.gz_B | crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi | 0.7645 | 19 | 51 |
| 3drx-assembly1.cif.gz_B | x-ray crystal structure of human kctd5 protein crystallized in high-salt buffer | 0.7605 | 1 | 54 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9FHI0_159_328_2.30.280.10 | Mainly Beta;Roll;PUA domain-like;SRA-YDG | 0.8854 | 28 | 51 | 2.30.280.10 |
| af_Q6F322_199_378_2.30.280.10 | Mainly Beta;Roll;PUA domain-like;SRA-YDG | 0.8528 | 28 | 51 | 2.30.280.10 |
| af_K7N1Z6_68_256_2.30.280.10 | Mainly Beta;Roll;PUA domain-like;SRA-YDG | 0.815 | 28 | 51 | 2.30.280.10 |
| 3bi7A01 | Mainly Beta;Roll;PUA domain-like;SRA-YDG | 0.7907 | 28 | 51 | 2.30.280.10 |
| af_Q54RD2_128_353_3.40.630.30 | Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) | 0.762 | 4 | 51 | 3.40.630.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537WZB5-F1-model_v4 | DUF4177 domain-containing protein | 0.9631 | 1 | 54 |
|
| AF-A0A538ARG6-F1-model_v4 | CoA-binding protein | 0.9503 | 1 | 54 |
|
| AF-A0A1X6WT34-F1-model_v4 | DUF4177 domain-containing protein | 0.9348 | 1 | 54 |
|
| AF-A0A538ARG6-F1-model_v4 | CoA-binding protein | 0.9339 | 1 | 54 |
|
| AF-A0A806GMX9-F1-model_v4 | deleted | 0.9264 | 1 | 54 |
|