F483300

General Info

Members Datasets Scaffolds Average Seq Length
846 326 1692 55

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_102959652|Ga0307416_1029596522
Length 66
Sequence VGDRIDGRDGDDMATWEYFVAPLLEHNPGEILNTFGEDGWELVSVVSQTTPSGVTSTVAYLKRQRG

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
169 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
170 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
171 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
178 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
189 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
190 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
191 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
196 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
197 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
198 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
199 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
228 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
229 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
242 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
243 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
244 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
245 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
248 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
255 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
260 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
263 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
295 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
296 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
297 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
311 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
312 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
313 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
314 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
315 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
316 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
325 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
326 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.14
Rhizosphere 95.86
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_102959652 3300032002 Unclassified 568
2 JGI24751J29686_10001091 3300002459 Bacteria 5882
3 Ga0070683_100756698 3300005329 Unclassified 931
4 Ga0070690_100365440 3300005330 Bacteria 1051
5 Ga0070690_100517976 3300005330 Unclassified 895
6 Ga0070670_100005282 3300005331 Bacteria 10885
7 Ga0070670_100033160 3300005331 Bacteria 4448
8 Ga0070670_100837000 3300005331 Bacteria 832
9 Ga0070677_10874341 3300005333 Bacteria 518
10 Ga0068869_100313818 3300005334 Bacteria 1270
11 Ga0070666_10495810 3300005335 Bacteria 885
12 Ga0070680_100438142 3300005336 Bacteria 1115
13 Ga0070680_101366470 3300005336 Unclassified 613
14 Ga0068868_100012011 3300005338 Bacteria 6321
15 Ga0068868_100120842 3300005338 Bacteria 2136
16 Ga0068868_101676373 3300005338 Bacteria 599
17 Ga0070660_101338047 3300005339 Bacteria 608
18 Ga0070689_100623587 3300005340 Bacteria 936
19 Ga0070689_100717618 3300005340 Unclassified 874
20 Ga0070689_101811809 3300005340 Unclassified 557
21 Ga0070691_10517405 3300005341 Bacteria 692
22 Ga0070691_11065685 3300005341 Unclassified 508
23 Ga0070661_100677504 3300005344 Unclassified 839
24 Ga0070692_10045095 3300005345 Bacteria 2273
25 Ga0070692_10073474 3300005345 Bacteria 1827
26 Ga0070692_10269595 3300005345 Bacteria 1027
27 Ga0070668_100626604 3300005347 Bacteria 943
28 Ga0070675_100157842 3300005354 Bacteria 1949
29 Ga0070675_100934080 3300005354 Bacteria 795
30 Ga0070671_100017818 3300005355 Bacteria 5756
31 Ga0070671_100766405 3300005355 Bacteria 839
32 Ga0070671_101086461 3300005355 Bacteria 702
33 Ga0070674_100009133 3300005356 Bacteria 5930
34 Ga0070674_100075741 3300005356 Bacteria 2391
35 Ga0070674_100390493 3300005356 Bacteria 1134
36 Ga0070674_100682638 3300005356 Bacteria 876
37 Ga0070674_102119209 3300005356 Bacteria 513
38 Ga0070673_100063962 3300005364 Bacteria 2929
39 Ga0070673_101155938 3300005364 Bacteria 724
40 Ga0070688_100220214 3300005365 Bacteria 1337
41 Ga0070688_100283062 3300005365 Bacteria 1192
42 Ga0070688_100292561 3300005365 Bacteria 1174
43 Ga0070688_100430769 3300005365 Unclassified 982
44 Ga0070659_100331008 3300005366 Bacteria 1275
45 Ga0070659_100391472 3300005366 Bacteria 1172
46 Ga0070659_101179150 3300005366 Bacteria 677
47 Ga0070703_10000067 3300005406 Bacteria 52456
48 Ga0070713_101778231 3300005436 Unclassified 598
49 Ga0070701_10880320 3300005438 Bacteria 617
50 Ga0070701_11076340 3300005438 Bacteria 565
51 Ga0070701_11182679 3300005438 Unclassified 542
52 Ga0070711_100007216 3300005439 Bacteria 6751
53 Ga0070711_101082504 3300005439 Unclassified 690
54 Ga0070705_100024263 3300005440 Bacteria 3271
55 Ga0070705_100044160 3300005440 Bacteria 2559
56 Ga0070705_100335486 3300005440 Bacteria 1097
57 Ga0070700_100018973 3300005441 Bacteria 3964
58 Ga0070700_100076708 3300005441 Bacteria 2147
59 Ga0070700_100129061 3300005441 Bacteria 1703
60 Ga0070700_100181998 3300005441 Bacteria 1463
61 Ga0070700_100377220 3300005441 Bacteria 1059
62 Ga0070700_100398443 3300005441 Bacteria 1034
63 Ga0070700_100735323 3300005441 Bacteria 788
64 Ga0070694_100034353 3300005444 Bacteria 3343
65 Ga0070694_100270507 3300005444 Bacteria 1292
66 Ga0070694_100567224 3300005444 Unclassified 911
67 Ga0070694_100608481 3300005444 Bacteria 881
68 Ga0070694_100894244 3300005444 Bacteria 733
69 Ga0070694_101157579 3300005444 Bacteria 647
70 Ga0070708_100000074 3300005445 Bacteria 63932
71 Ga0070708_100401386 3300005445 Bacteria 1293
72 Ga0070708_100755786 3300005445 Unclassified 914
73 Ga0070708_101519533 3300005445 Bacteria 624
74 Ga0070663_100048916 3300005455 Bacteria 3000
75 Ga0070678_100142314 3300005456 Bacteria 1921
76 Ga0070678_100162890 3300005456 Bacteria 1809
77 Ga0070678_100379209 3300005456 Bacteria 1223
78 Ga0070662_101698699 3300005457 Bacteria 545
79 Ga0070681_10187717 3300005458 Bacteria 1987
80 Ga0068867_100004737 3300005459 Bacteria 9577
81 Ga0068867_100321650 3300005459 Bacteria 1282
82 Ga0068867_100436159 3300005459 Bacteria 1113
83 Ga0068867_101739384 3300005459 Bacteria 585
84 Ga0070685_10097402 3300005466 Bacteria 1791
85 Ga0070706_100005951 3300005467 Bacteria 11536
86 Ga0070706_100655298 3300005467 Bacteria 975
87 Ga0070706_101357027 3300005467 Bacteria 651
88 Ga0070707_100118086 3300005468 Bacteria 2574
89 Ga0070707_100246245 3300005468 Bacteria 1740
90 Ga0070707_100385134 3300005468 Bacteria 1362
91 Ga0070707_102333863 3300005468 Bacteria 502
92 Ga0070698_100036787 3300005471 Bacteria 5052
93 Ga0070698_100273789 3300005471 Bacteria 1620
94 Ga0070698_100347916 3300005471 Unclassified 1413
95 Ga0070698_101445446 3300005471 Unclassified 639
96 Ga0070699_100086823 3300005518 Bacteria 2731
97 Ga0070699_100140492 3300005518 Bacteria 2132
98 Ga0070699_100342030 3300005518 Unclassified 1347
99 Ga0070699_100890300 3300005518 Bacteria 815
100 Ga0070699_101373633 3300005518 Bacteria 648
101 Ga0070684_100048882 3300005535 Bacteria 3670
102 Ga0070684_100415983 3300005535 Bacteria 1241
103 Ga0070697_100043651 3300005536 Bacteria 3631
104 Ga0070697_101680684 3300005536 Archaea 568
105 Ga0070697_101935626 3300005536 Bacteria 528
106 Ga0070697_102006196 3300005536 Bacteria 518
107 Ga0070672_100384191 3300005543 Bacteria 1201
108 Ga0070686_100004661 3300005544 Bacteria 7564
109 Ga0070686_100369957 3300005544 Bacteria 1082
110 Ga0070695_100012922 3300005545 Bacteria 5012
111 Ga0070695_100062417 3300005545 Bacteria 2420
112 Ga0070695_100323169 3300005545 Unclassified 1148
113 Ga0070695_100509996 3300005545 Bacteria 931
114 Ga0070695_101786434 3300005545 Bacteria 516
115 Ga0070696_100005561 3300005546 Bacteria 8414
116 Ga0070696_100103176 3300005546 Bacteria 2046
117 Ga0070696_100289089 3300005546 Bacteria 1252
118 Ga0070696_100630467 3300005546 Bacteria 867
119 Ga0070693_100105303 3300005547 Bacteria 1726
120 Ga0070693_101137421 3300005547 Bacteria 597
121 Ga0070665_102119741 3300005548 Bacteria 567
122 Ga0070704_100004909 3300005549 Bacteria 7762
123 Ga0070704_100033318 3300005549 Bacteria 3481
124 Ga0070704_100084501 3300005549 Bacteria 2346
125 Ga0070704_100333017 3300005549 Bacteria 1276
126 Ga0070704_100845577 3300005549 Bacteria 820
127 Ga0070704_101571745 3300005549 Bacteria 606
128 Ga0070704_101589431 3300005549 Bacteria 603
129 Ga0070664_100037395 3300005564 Bacteria 4082
130 Ga0070664_100551148 3300005564 Bacteria 1066
131 Ga0070664_101848929 3300005564 Unclassified 573
132 Ga0068857_100304864 3300005577 Bacteria 1469
133 Ga0068857_101730104 3300005577 Unclassified 611
134 Ga0068854_100082005 3300005578 Bacteria 2383
135 Ga0068856_100439408 3300005614 Bacteria 1325
136 Ga0070702_100236261 3300005615 Bacteria 1231
137 Ga0070702_100540915 3300005615 Unclassified 863
138 Ga0070702_100556692 3300005615 Unclassified 852
139 Ga0070702_101355982 3300005615 Bacteria 580
140 Ga0068852_100083811 3300005616 Bacteria 2836
141 Ga0068859_100418601 3300005617 Unclassified 1436
142 Ga0068859_101532903 3300005617 Archaea 736
143 Ga0068859_102421344 3300005617 Bacteria 578
144 Ga0068864_100039149 3300005618 Bacteria 4051
145 Ga0068864_100048128 3300005618 Bacteria 3664
146 Ga0068864_101514912 3300005618 Unclassified 674
147 Ga0068864_102550246 3300005618 Bacteria 517
148 Ga0068866_10038252 3300005718 Bacteria 2361
149 Ga0068861_100095171 3300005719 Bacteria 2358
150 Ga0068861_100454045 3300005719 Bacteria 1149
151 Ga0068861_100849178 3300005719 Unclassified 861
152 Ga0068861_100924467 3300005719 Bacteria 828
153 Ga0068861_101173564 3300005719 Bacteria 741
154 Ga0068861_101406171 3300005719 Bacteria 682
155 Ga0068851_10070137 3300005834 Bacteria 1812
156 Ga0068870_10008530 3300005840 Bacteria 4615
157 Ga0068870_10029813 3300005840 Bacteria 2752
158 Ga0068870_10266520 3300005840 Bacteria 1068
159 Ga0068870_11041288 3300005840 Bacteria 586
160 Ga0068870_11130925 3300005840 Unclassified 564
161 Ga0068870_11474892 3300005840 Bacteria 500
162 Ga0068863_100084238 3300005841 Bacteria 3013
163 Ga0068863_100761695 3300005841 Bacteria 964
164 Ga0068860_100418632 3300005843 Bacteria 1328
165 Ga0068860_100726450 3300005843 Bacteria 1004
166 Ga0068860_101072550 3300005843 Bacteria 824
167 Ga0068862_100082052 3300005844 Bacteria 2798
168 Ga0068862_102481111 3300005844 Bacteria 530
169 Ga0081455_10004271 3300005937 Bacteria 16089
170 Ga0081455_10005280 3300005937 Bacteria 14191
171 Ga0081455_10008200 3300005937 Bacteria 10893
172 Ga0081455_10067602 3300005937 Bacteria 2977
173 Ga0081455_10107080 3300005937 Bacteria 2229
174 Ga0081455_10210992 3300005937 Bacteria 1447
175 Ga0081539_10039741 3300005985 Bacteria 2772
176 Ga0075432_10027433 3300006058 Bacteria 1961
177 Ga0070715_10001775 3300006163 Bacteria 6418
178 Ga0070715_10553991 3300006163 Bacteria 667
179 Ga0070716_100011717 3300006173 Bacteria 4421
180 Ga0070712_100286457 3300006175 Unclassified 1328
181 Ga0070712_100926178 3300006175 Unclassified 752
182 Ga0068871_100344509 3300006358 Bacteria 1317
183 Ga0075428_100290186 3300006844 Bacteria 1760
184 Ga0075428_100328971 3300006844 Bacteria 1642
185 Ga0075428_100473177 3300006844 Unclassified 1341
186 Ga0075430_100014436 3300006846 Bacteria 6729
187 Ga0075431_100000656 3300006847 Bacteria 29408
188 Ga0075431_100258293 3300006847 Bacteria 1768
189 Ga0075433_10000149 3300006852 Bacteria 37279
190 Ga0075433_10002088 3300006852 Bacteria 15116
191 Ga0075433_10512393 3300006852 Unclassified 1055
192 Ga0075434_100002552 3300006871 Bacteria 16072
193 Ga0075434_100023704 3300006871 Bacteria 5986
194 Ga0075434_100081980 3300006871 Bacteria 3223
195 Ga0075434_101954340 3300006871 Bacteria 592
196 Ga0075434_102157853 3300006871 Bacteria 561
197 Ga0075434_102469671 3300006871 Bacteria 521
198 Ga0075429_100022927 3300006880 Bacteria 5412
199 Ga0075429_100057037 3300006880 Bacteria 3400
200 Ga0075429_100610873 3300006880 Bacteria 955
201 Ga0075429_100699927 3300006880 Unclassified 888
202 Ga0068865_100010544 3300006881 Bacteria 5756
203 Ga0068865_100036700 3300006881 Bacteria 3306
204 Ga0068865_100309716 3300006881 Bacteria 1267
205 Ga0068865_101494866 3300006881 Unclassified 605
206 Ga0068865_102074129 3300006881 Bacteria 517
207 Ga0075436_100410459 3300006914 Bacteria 982
208 Ga0097620_100418564 3300006931 Unclassified 1436
209 Ga0097620_101533030 3300006931 Archaea 736
210 Ga0097620_102421951 3300006931 Bacteria 578
211 Ga0075435_100019439 3300007076 Bacteria 5189
212 Ga0075435_100890944 3300007076 Bacteria 776
213 Ga0105251_10028877 3300009011 Bacteria 2799
214 Ga0105250_10282111 3300009092 Bacteria 715
215 Ga0111539_10117832 3300009094 Bacteria 3112
216 Ga0111539_10408644 3300009094 Bacteria 1581
217 Ga0111539_10427431 3300009094 Bacteria 1542
218 Ga0105245_10020084 3300009098 Bacteria 5856
219 Ga0105245_10103963 3300009098 Bacteria 2633
220 Ga0105245_10163104 3300009098 Bacteria 2116
221 Ga0105245_11139648 3300009098 Bacteria 827
222 Ga0105245_11900039 3300009098 Unclassified 648
223 Ga0105245_12995562 3300009098 Bacteria 523
224 Ga0105247_10562697 3300009101 Bacteria 840
225 Ga0114129_10000667 3300009147 Bacteria 43086
226 Ga0114129_10020441 3300009147 Bacteria 9415
227 Ga0114129_10144583 3300009147 Bacteria 3258
228 Ga0114129_10261987 3300009147 Bacteria 2316
229 Ga0114129_11482810 3300009147 Bacteria 834
230 Ga0114129_13219223 3300009147 Unclassified 530
231 Ga0105243_10002499 3300009148 Bacteria 15350
232 Ga0105243_10003191 3300009148 Bacteria 13431
233 Ga0105243_10003771 3300009148 Bacteria 12152
234 Ga0105243_10016524 3300009148 Bacteria 5579
235 Ga0105243_10274051 3300009148 Bacteria 1516
236 Ga0105243_11432584 3300009148 Unclassified 712
237 Ga0105241_11087697 3300009174 Unclassified 752
238 Ga0105242_10002614 3300009176 Bacteria 14125
239 Ga0105242_10005041 3300009176 Bacteria 10202
240 Ga0105242_10037839 3300009176 Bacteria 3878
241 Ga0105242_10246436 3300009176 Bacteria 1608
242 Ga0105248_10203482 3300009177 Bacteria 2231
243 Ga0105237_10297868 3300009545 Bacteria 1616
244 Ga0105238_10127349 3300009551 Bacteria 2525
245 Ga0105249_10028324 3300009553 Bacteria 5057
246 Ga0105249_10349104 3300009553 Bacteria 1498
247 Ga0105249_10521162 3300009553 Bacteria 1236
248 Ga0105249_10988830 3300009553 Unclassified 910
249 Ga0105249_11773184 3300009553 Bacteria 690
250 Ga0105249_12462010 3300009553 Bacteria 593
251 Ga0105249_13100340 3300009553 Bacteria 534
252 Ga0105246_10014629 3300011119 Bacteria 4939
253 Ga0105246_10124196 3300011119 Bacteria 1918
254 Ga0105246_10156647 3300011119 Bacteria 1731
255 Ga0105246_10247370 3300011119 Bacteria 1413
256 Ga0105246_10251142 3300011119 Bacteria 1404
257 Ga0105246_10593525 3300011119 Bacteria 956
258 Ga0157339_1039072 3300012505 Bacteria 588
259 Ga0157378_10006475 3300013297 Bacteria 10241
260 Ga0157378_10009223 3300013297 Bacteria 8593
261 Ga0157378_10032136 3300013297 Bacteria 4636
262 Ga0157378_10401459 3300013297 Bacteria 1351
263 Ga0157378_12252062 3300013297 Unclassified 596
264 Ga0163162_10214993 3300013306 Bacteria 2053
265 Ga0163162_11021161 3300013306 Bacteria 935
266 Ga0163162_11887333 3300013306 Bacteria 684
267 Ga0157375_10009595 3300013308 Bacteria 8502
268 Ga0157375_10025029 3300013308 Bacteria 5537
269 Ga0157375_13055751 3300013308 Bacteria 558
270 Ga0163163_10144884 3300014325 Bacteria 2419
271 Ga0163163_10287218 3300014325 Bacteria 1697
272 Ga0163163_10467760 3300014325 Bacteria 1321
273 Ga0163163_10941949 3300014325 Bacteria 927
274 Ga0163163_11232614 3300014325 Unclassified 811
275 Ga0163163_12863227 3300014325 Bacteria 538
276 Ga0157380_10032195 3300014326 Bacteria 4032
277 Ga0157380_10430072 3300014326 Bacteria 1262
278 Ga0157380_10463079 3300014326 Bacteria 1221
279 Ga0157380_10754524 3300014326 Unclassified 985
280 Ga0157377_10026861 3300014745 Bacteria 3085
281 Ga0157377_10064760 3300014745 Bacteria 2097
282 Ga0157377_10176895 3300014745 Bacteria 1339
283 Ga0157377_10436330 3300014745 Unclassified 901
284 Ga0157377_10513350 3300014745 Bacteria 840
285 Ga0157377_10930526 3300014745 Bacteria 652
286 Ga0157379_10134557 3300014968 Bacteria 2226
287 Ga0157379_11936388 3300014968 Bacteria 581
288 Ga0157379_12053970 3300014968 Bacteria 566
289 Ga0157376_10341310 3300014969 Bacteria 1431
290 Ga0157376_10342066 3300014969 Bacteria 1429
291 Ga0163161_10296423 3300017792 Bacteria 1272
292 Ga0163161_10730769 3300017792 Archaea 827
293 Ga0207656_10029289 3300025321 Bacteria 2266
294 Ga0207713_1216192 3300025735 Unclassified 580
295 Ga0207653_10000002 3300025885 Bacteria 270513
296 Ga0207653_10045089 3300025885 Bacteria 1456
297 Ga0207682_10148205 3300025893 Bacteria 1057
298 Ga0207692_10087888 3300025898 Bacteria 1678
299 Ga0207642_10199630 3300025899 Bacteria 1104
300 Ga0207642_10290419 3300025899 Unclassified 944
301 Ga0207710_10243934 3300025900 Bacteria 897
302 Ga0207688_10034615 3300025901 Bacteria 2798
303 Ga0207680_10612927 3300025903 Bacteria 779
304 Ga0207647_10307889 3300025904 Bacteria 901
305 Ga0207685_10003043 3300025905 Bacteria 3991
306 Ga0207645_10051426 3300025907 Bacteria 2633
307 Ga0207643_10002088 3300025908 Bacteria 11006
308 Ga0207643_10217274 3300025908 Bacteria 1169
309 Ga0207643_10230066 3300025908 Unclassified 1137
310 Ga0207643_10974184 3300025908 Bacteria 549
311 Ga0207684_10000612 3300025910 Bacteria 42497
312 Ga0207684_11222318 3300025910 Bacteria 621
313 Ga0207684_11483747 3300025910 Bacteria 552
314 Ga0207684_11693635 3300025910 Bacteria 510
315 Ga0207707_10434225 3300025912 Bacteria 1125
316 Ga0207707_10747841 3300025912 Bacteria 818
317 Ga0207693_10000234 3300025915 Bacteria 51024
318 Ga0207693_10637091 3300025915 Unclassified 828
319 Ga0207663_10161961 3300025916 Unclassified 1580
320 Ga0207660_10413198 3300025917 Bacteria 1088
321 Ga0207660_10436472 3300025917 Bacteria 1058
322 Ga0207660_11665672 3300025917 Unclassified 513
323 Ga0207662_10064779 3300025918 Bacteria 2200
324 Ga0207657_10762672 3300025919 Bacteria 749
325 Ga0207652_10263120 3300025921 Bacteria 1556
326 Ga0207646_10008060 3300025922 Bacteria 10619
327 Ga0207646_10580622 3300025922 Bacteria 1007
328 Ga0207646_11033565 3300025922 Bacteria 725
329 Ga0207694_10104372 3300025924 Bacteria 2249
330 Ga0207650_10006025 3300025925 Bacteria 8271
331 Ga0207650_10022995 3300025925 Bacteria 4417
332 Ga0207650_10393517 3300025925 Bacteria 1146
333 Ga0207650_10905267 3300025925 Unclassified 749
334 Ga0207659_10102939 3300025926 Bacteria 2157
335 Ga0207659_10501506 3300025926 Bacteria 1028
336 Ga0207659_10601511 3300025926 Unclassified 937
337 Ga0207687_10002239 3300025927 Bacteria 13175
338 Ga0207687_10030225 3300025927 Bacteria 3650
339 Ga0207644_10086485 3300025931 Bacteria 2328
340 Ga0207690_10239000 3300025932 Bacteria 1398
341 Ga0207690_11663218 3300025932 Unclassified 533
342 Ga0207706_11407004 3300025933 Bacteria 572
343 Ga0207706_11678941 3300025933 Unclassified 512
344 Ga0207686_10034482 3300025934 Bacteria 3029
345 Ga0207686_10063381 3300025934 Bacteria 2350
346 Ga0207686_10128094 3300025934 Bacteria 1737
347 Ga0207686_10701566 3300025934 Unclassified 804
348 Ga0207709_10009376 3300025935 Bacteria 5385
349 Ga0207709_10011763 3300025935 Unclassified 4824
350 Ga0207709_10026986 3300025935 Bacteria 3303
351 Ga0207709_10233670 3300025935 Bacteria 1333
352 Ga0207670_10211340 3300025936 Bacteria 1480
353 Ga0207670_10698887 3300025936 Bacteria 839
354 Ga0207669_10039923 3300025937 Bacteria 2718
355 Ga0207669_10064891 3300025937 Bacteria 2262
356 Ga0207669_10066615 3300025937 Bacteria 2240
357 Ga0207669_10367695 3300025937 Bacteria 1117
358 Ga0207669_10459409 3300025937 Bacteria 1011
359 Ga0207704_10238304 3300025938 Bacteria 1357
360 Ga0207704_11496277 3300025938 Unclassified 579
361 Ga0207704_11728423 3300025938 Unclassified 538
362 Ga0207691_10079700 3300025940 Bacteria 2947
363 Ga0207691_11354750 3300025940 Bacteria 586
364 Ga0207711_10258100 3300025941 Bacteria 1601
365 Ga0207689_10064638 3300025942 Bacteria 3010
366 Ga0207689_10477202 3300025942 Bacteria 1044
367 Ga0207689_11582743 3300025942 Unclassified 546
368 Ga0207661_10395383 3300025944 Bacteria 1253
369 Ga0207661_11861106 3300025944 Unclassified 547
370 Ga0207679_10001553 3300025945 Bacteria 14362
371 Ga0207679_10968091 3300025945 Unclassified 780
372 Ga0207651_10050764 3300025960 Bacteria 2819
373 Ga0207651_11827018 3300025960 Unclassified 547
374 Ga0207651_12025470 3300025960 Bacteria 517
375 Ga0207712_10009270 3300025961 Bacteria 6227
376 Ga0207712_10052995 3300025961 Bacteria 2844
377 Ga0207712_10751150 3300025961 Bacteria 854
378 Ga0207712_10962678 3300025961 Archaea 756
379 Ga0207668_11435095 3300025972 Bacteria 622
380 Ga0207668_11600491 3300025972 Bacteria 588
381 Ga0207640_10525912 3300025981 Bacteria 989
382 Ga0207640_10809386 3300025981 Bacteria 812
383 Ga0207677_10138854 3300026023 Bacteria 1857
384 Ga0207677_11787748 3300026023 Bacteria 570
385 Ga0207678_10042793 3300026067 Bacteria 3922
386 Ga0207678_10202030 3300026067 Bacteria 1700
387 Ga0207678_11579317 3300026067 Bacteria 578
388 Ga0207678_12028783 3300026067 Bacteria 500
389 Ga0207708_10015640 3300026075 Bacteria 5691
390 Ga0207708_10020897 3300026075 Bacteria 4939
391 Ga0207708_10021485 3300026075 Bacteria 4868
392 Ga0207708_10217894 3300026075 Bacteria 1528
393 Ga0207708_10681175 3300026075 Bacteria 877
394 Ga0207708_10818490 3300026075 Bacteria 803
395 Ga0207708_10921109 3300026075 Bacteria 757
396 Ga0207708_11446049 3300026075 Archaea 604
397 Ga0207702_10412121 3300026078 Bacteria 1305
398 Ga0207702_11489314 3300026078 Bacteria 670
399 Ga0207641_10016768 3300026088 Bacteria 5999
400 Ga0207641_10435616 3300026088 Bacteria 1265
401 Ga0207641_10720956 3300026088 Bacteria 983
402 Ga0207641_10776758 3300026088 Unclassified 947
403 Ga0207648_10000754 3300026089 Bacteria 36369
404 Ga0207648_10014866 3300026089 Bacteria 7177
405 Ga0207648_11537763 3300026089 Bacteria 625
406 Ga0207676_10010382 3300026095 Bacteria 6631
407 Ga0207676_10185116 3300026095 Bacteria 1827
408 Ga0207674_10055176 3300026116 Bacteria 4041
409 Ga0207674_10169100 3300026116 Bacteria 2140
410 Ga0207675_100021703 3300026118 Bacteria 5975
411 Ga0207675_100452828 3300026118 Bacteria 1272
412 Ga0207675_100585011 3300026118 Unclassified 1118
413 Ga0207675_100675515 3300026118 Bacteria 1040
414 Ga0207675_101273792 3300026118 Bacteria 756
415 Ga0207675_101949227 3300026118 Unclassified 605
416 Ga0207683_10087911 3300026121 Bacteria 2764
417 Ga0207683_10340320 3300026121 Bacteria 1376
418 Ga0207683_10437999 3300026121 Bacteria 1205
419 Ga0209966_1061503 3300027695 Bacteria 812
420 Ga0207428_10000597 3300027907 Bacteria 42692
421 Ga0207428_10000612 3300027907 Bacteria 42181
422 Ga0207428_10020218 3300027907 Bacteria 5660
423 Ga0268266_10911992 3300028379 Bacteria 850
424 Ga0268265_11088490 3300028380 Bacteria 793
425 Ga0268265_12724139 3300028380 Unclassified 500
426 Ga0268264_10073848 3300028381 Bacteria 2896
427 Ga0268264_10183862 3300028381 Bacteria 1900
428 Ga0268264_10311613 3300028381 Bacteria 1485
429 Ga0268264_12039896 3300028381 Bacteria 582
430 Ga0307410_11752067 3300031852 Unclassified 551
431 Ga0307409_101020345 3300031995 Bacteria 846
432 Ga0307416_101163149 3300032002 Bacteria 877
433 Ga0307415_100166313 3300032126 Bacteria 1715
434 Ga0307415_101770380 3300032126 Unclassified 597
435 Ga0373948_0054953 3300034817 Bacteria 863
436 Ga0373926_0001364 3300035083 Bacteria 7390
437 Ga0373944_0000653 3300035089 Bacteria 8231
438 Ga0373951_0052255 3300035091 Bacteria 1008
439 Ga0373923_0015583 3300035111 Bacteria 2872
440 Ga0373936_0001504 3300035113 Bacteria 8459
441 Ga0373939_0063808 3300035114 Bacteria 1181
442 Ga0373945_0044282 3300035116 Bacteria 1617
443 Ga0373943_0003307 3300035170 Bacteria 7323
444 Ga0373943_0450686 3300035170 Bacteria 748
445 Ga0373946_0001746 3300035171 Bacteria 7585
446 Ga0373961_0103754 3300035241 Bacteria 923
447 Ga0373961_0384651 3300035241 Bacteria 535
448 Ga0373962_0018458 3300035242 Bacteria 1815
449 Ga0373931_0046562 3300035691 Bacteria 2293
450 Ga0373935_0090920 3300035692 Bacteria 1998
451 Ga0373935_1185706 3300035692 Bacteria 569
452 Ga0373927_0007582 3300035695 Bacteria 7345
453 Ga0373927_0647566 3300035695 Bacteria 698
454 Ga0373947_0017501 3300035725 Bacteria 4122
455 Ga0373947_0291670 3300035725 Bacteria 1086
456 Ga0373947_0428976 3300035725 Bacteria 894
457 Ga0373925_0166257 3300037068 Unclassified 1740
458 Ga0373925_0278446 3300037068 Bacteria 1347
459 Ga0373925_1633637 3300037068 Unclassified 526
460 Ga0395899_0058054 3300037312 Bacteria 2855
461 Ga0395899_0070888 3300037312 Bacteria 2551
462 Ga0395899_0159722 3300037312 Bacteria 1593
463 Ga0395899_0233975 3300037312 Bacteria 1267
464 Ga0395899_0349000 3300037312 Bacteria 990
465 Ga0395900_0003775 3300037418 Bacteria 16230
466 Ga0395900_0011221 3300037418 Bacteria 9164
467 Ga0395900_0068815 3300037418 Unclassified 3638
468 Ga0395900_0155423 3300037418 Bacteria 2336
469 Ga0395900_1388807 3300037418 Unclassified 615
470 Ga0395898_0012736 3300037466 Bacteria 8686
471 Ga0395898_0091637 3300037466 Bacteria 2924
472 Ga0395898_0423128 3300037466 Unclassified 1269
473 Ga0395898_1107491 3300037466 Bacteria 725
474 Ga0395905_0022764 3300037471 Bacteria 5925
475 Ga0395905_0030701 3300037471 Bacteria 5061
476 Ga0395905_0042179 3300037471 Bacteria 4281
477 Ga0395905_0049433 3300037471 Bacteria 3941
478 Ga0395905_0092477 3300037471 Bacteria 2836
479 Ga0395905_0146397 3300037471 Bacteria 2222
480 Ga0395905_0405575 3300037471 Bacteria 1258
481 Ga0395905_1815076 3300037471 Bacteria 516
482 Ga0395901_0025036 3300038443 Bacteria 6126
483 Ga0395901_0029715 3300038443 Bacteria 5627
484 Ga0395901_0108608 3300038443 Bacteria 2912
485 Ga0395901_0124980 3300038443 Bacteria 2703
486 Ga0395901_0153373 3300038443 Bacteria 2420
487 Ga0395901_0491532 3300038443 Bacteria 1250
488 Ga0395901_0513170 3300038443 Bacteria 1219
489 Ga0395901_0901808 3300038443 Bacteria 866
490 Ga0395901_1967558 3300038443 Bacteria 531
491 Ga0439453_0071713 3300041408 Bacteria 734
492 Ga0439453_0181356 3300041408 Bacteria 514
493 Ga0451804_0468199 3300041463 Bacteria 532
494 Ga0439443_049382 3300042003 Bacteria 734
495 Ga0439448_0119894 3300042005 Bacteria 903
496 Ga0439454_023056 3300042011 Bacteria 932
497 Ga0439454_059401 3300042011 Bacteria 661
498 Ga0439463_162684 3300042016 Unclassified 579
499 Ga0439435_0194953 3300042436 Bacteria 666
500 Ga0439444_0091238 3300042437 Bacteria 680
501 Ga0439464_0033942 3300042439 Bacteria 1438
502 Ga0439460_0098712 3300042461 Bacteria 936
503 Ga0439460_0313654 3300042461 Bacteria 549
504 Ga0450893_0116578 3300042532 Bacteria 555
505 Ga0439440_0035589 3300042993 Bacteria 1195
506 Ga0439440_0089681 3300042993 Unclassified 823
507 Ga0466960_0546305 3300044901 Bacteria 683
508 Ga0495617_288815 3300046452 Bacteria 502
509 Ga0495603_0003354 3300046455 Bacteria 9529
510 Ga0495603_0005113 3300046455 Bacteria 7835
511 Ga0495603_0013661 3300046455 Bacteria 4913
512 Ga0495603_0029038 3300046455 Bacteria 3336
513 Ga0495603_0029381 3300046455 Bacteria 3315
514 Ga0495603_0119630 3300046455 Bacteria 1535
515 Ga0495629_0009809 3300046459 Bacteria 6988
516 Ga0495641_0004496 3300046461 Bacteria 9823
517 Ga0495641_0284099 3300046461 Unclassified 745
518 Ga0495653_0036179 3300046463 Bacteria 3891
519 Ga0495580_0158005 3300046472 Bacteria 1569
520 Ga0495580_0176585 3300046472 Bacteria 1475
521 Ga0495582_0003096 3300046473 Bacteria 9314
522 Ga0495582_0811485 3300046473 Bacteria 541
523 Ga0495605_0191427 3300046474 Bacteria 895
524 Ga0495639_0001049 3300046475 Bacteria 12461
525 Ga0495639_0456532 3300046475 Bacteria 649
526 Ga0495662_0000565 3300046476 Bacteria 17048
527 Ga0495584_0047079 3300046491 Unclassified 2175
528 Ga0495584_0058921 3300046491 Bacteria 1932
529 Ga0495584_0065395 3300046491 Bacteria 1829
530 Ga0495584_0173809 3300046491 Bacteria 1095
531 Ga0495584_0319262 3300046491 Bacteria 789
532 Ga0495584_0497077 3300046491 Bacteria 621
533 Ga0495584_0689255 3300046491 Bacteria 521
534 Ga0495584_0738800 3300046491 Unclassified 502
535 Ga0495585_0028209 3300046492 Bacteria 3202
536 Ga0495585_0032931 3300046492 Bacteria 2936
537 Ga0495585_0484752 3300046492 Bacteria 589
538 Ga0495594_0024091 3300046499 Bacteria 3267
539 Ga0495594_0229667 3300046499 Bacteria 1058
540 Ga0495596_0027540 3300046500 Bacteria 2285
541 Ga0495596_0100212 3300046500 Bacteria 1125
542 Ga0495607_0025182 3300046501 Bacteria 3703
543 Ga0495607_0191919 3300046501 Bacteria 1017
544 Ga0495607_0326912 3300046501 Unclassified 714
545 Ga0495583_0295753 3300046506 Bacteria 644
546 Ga0495616_0158716 3300046513 Bacteria 1019
547 Ga0495616_0357884 3300046513 Bacteria 607
548 Ga0495618_0894458 3300046514 Viruses 513
549 Ga0495620_0165666 3300046515 Archaea 858
550 Ga0495630_0013811 3300046517 Bacteria 5871
551 Ga0495631_0126366 3300046518 Bacteria 1099
552 Ga0495631_0277776 3300046518 Unclassified 713
553 Ga0495631_0375794 3300046518 Bacteria 605
554 Ga0495637_0155938 3300046520 Bacteria 859
555 Ga0495644_0038686 3300046523 Bacteria 1799
556 Ga0495644_0057380 3300046523 Bacteria 1463
557 Ga0495644_0083828 3300046523 Bacteria 1202
558 Ga0495644_0148118 3300046523 Unclassified 898
559 Ga0495663_0203456 3300046525 Bacteria 691
560 Ga0495666_0003712 3300046526 Bacteria 7717
561 Ga0495642_0044150 3300046528 Bacteria 1819
562 Ga0495642_0048726 3300046528 Unclassified 1739
563 Ga0495642_0355627 3300046528 Unclassified 644
564 Ga0495665_0000725 3300046531 Bacteria 17035
565 Ga0495665_0058128 3300046531 Bacteria 2042
566 Ga0495640_0038151 3300046533 Bacteria 3381
567 Ga0495640_0841419 3300046533 Unclassified 545
568 Ga0495586_0028185 3300046535 Bacteria 3006
569 Ga0495586_0058223 3300046535 Bacteria 2098
570 Ga0495598_0012111 3300046537 Unclassified 2107
571 Ga0495598_0052528 3300046537 Unclassified 1232
572 Ga0495598_0315016 3300046537 Bacteria 595
573 Ga0495609_0028547 3300046538 Bacteria 2546
574 Ga0495609_0086367 3300046538 Unclassified 1368
575 Ga0495609_0116816 3300046538 Bacteria 1149
576 Ga0495609_0357181 3300046538 Bacteria 589
577 Ga0495621_0349511 3300046539 Bacteria 620
578 Ga0495633_0223915 3300046558 Bacteria 861
579 Ga0495633_0336402 3300046558 Bacteria 684
580 Ga0495667_0036019 3300046559 Bacteria 3305
581 Ga0495656_0007938 3300046615 Bacteria 3774
582 Ga0495656_0050326 3300046615 Bacteria 1778
583 Ga0495656_0060129 3300046615 Unclassified 1655
584 Ga0495656_0072567 3300046615 Bacteria 1533
585 Ga0495656_0093577 3300046615 Bacteria 1378
586 Ga0495656_0156956 3300046615 Bacteria 1103
587 Ga0495656_0747362 3300046615 Bacteria 527
588 Ga0495668_0358350 3300046616 Unclassified 801
589 Ga0495634_0003424 3300046642 Bacteria 12729
590 Ga0495634_0173548 3300046642 Bacteria 1354
591 Ga0495611_0194813 3300046648 Bacteria 946
592 Ga0495611_0199917 3300046648 Bacteria 932
593 Ga0495635_0002848 3300046663 Bacteria 11882
594 Ga0495659_0040885 3300046664 Bacteria 1655
595 Ga0495659_0046873 3300046664 Bacteria 1561
596 Ga0495659_0057778 3300046664 Bacteria 1426
597 Ga0495659_0148852 3300046664 Unclassified 939
598 Ga0495661_0226925 3300046665 Bacteria 965
599 Ga0495661_0315659 3300046665 Bacteria 778
600 Ga0495661_0335682 3300046665 Unclassified 748
601 Ga0495661_0342554 3300046665 Bacteria 738
602 Ga0495661_0399891 3300046665 Bacteria 668
603 Ga0495588_0002913 3300046674 Bacteria 7379
604 Ga0495588_0158603 3300046674 Unclassified 1196
605 Ga0495588_0367313 3300046674 Bacteria 756
606 Ga0495647_0002142 3300046681 Bacteria 6172
607 Ga0495647_0008136 3300046681 Bacteria 3524
608 Ga0495647_0324988 3300046681 Bacteria 697
609 Ga0495658_0000684 3300046683 Bacteria 18347
610 Ga0495669_0538855 3300046684 Bacteria 568
611 Ga0495669_0597386 3300046684 Bacteria 537
612 Ga0495613_0053347 3300046689 Bacteria 2975
613 Ga0495624_0008536 3300046690 Bacteria 7134
614 Ga0495624_0811473 3300046690 Bacteria 553
615 Ga0495670_0010803 3300046691 Bacteria 4486
616 Ga0495670_0024051 3300046691 Bacteria 3008
617 Ga0495670_0087486 3300046691 Bacteria 1592
618 Ga0495670_0090916 3300046691 Bacteria 1562
619 Ga0495589_0512088 3300046794 Unclassified 548
620 Ga0495589_0581724 3300046794 Unclassified 510
621 Ga0495581_0001668 3300047315 Bacteria 12362
622 Ga0495581_0038078 3300047315 Bacteria 2783
623 Ga0495581_0584216 3300047315 Bacteria 647
624 Ga0495636_0222266 3300047318 Bacteria 867
625 Ga0495636_0323943 3300047318 Bacteria 724
626 Ga0495674_0003014 3300047319 Bacteria 16401
627 Ga0495676_0058596 3300047321 Bacteria 3029
628 Ga0495676_0311419 3300047321 Bacteria 1059
629 Ga0495676_0341957 3300047321 Viruses 1001
630 Ga0495676_1114790 3300047321 Unclassified 501
631 Ga0495680_0011999 3300047322 Bacteria 7646
632 Ga0495677_0034019 3300047445 Bacteria 1859
633 Ga0495677_0445103 3300047445 Unclassified 513
634 Ga0495679_080972 3300047446 Bacteria 922
635 Ga0495685_228145 3300047447 Unclassified 593
636 Ga0495684_0196397 3300047471 Bacteria 1489
637 Ga0495593_0004647 3300047673 Bacteria 8164
638 Ga0495614_0000851 3300048089 Bacteria 12897
639 Ga0495614_0542589 3300048089 Bacteria 556
640 Ga0495615_0030862 3300048090 Bacteria 1282
641 Ga0495626_0397990 3300048091 Bacteria 533
642 Ga0496100_0047513 3300048903 Bacteria 2766
643 Ga0496100_0054200 3300048903 Bacteria 2614
644 Ga0496100_0364587 3300048903 Bacteria 1094
645 Ga0496101_0064755 3300048904 Bacteria 2663
646 Ga0496101_0161114 3300048904 Bacteria 1720
647 Ga0496102_0007710 3300048905 Bacteria 9196
648 Ga0496102_0493632 3300048905 Bacteria 1146
649 Ga0496103_0078730 3300048906 Bacteria 2070
650 Ga0496104_0536919 3300048907 Bacteria 1080
651 Ga0496105_1332293 3300048908 Unclassified 523
652 Ga0496106_0004719 3300048909 Bacteria 10094
653 Ga0496106_0017260 3300048909 Bacteria 5341
654 Ga0496106_0488933 3300048909 Bacteria 989
655 Ga0496107_0149359 3300048910 Bacteria 1728
656 Ga0496107_0170592 3300048910 Bacteria 1614
657 Ga0496107_1278837 3300048910 Unclassified 525
658 Ga0496108_0021154 3300048911 Bacteria 5346
659 Ga0496108_0053107 3300048911 Bacteria 3397
660 Ga0496108_0083606 3300048911 Bacteria 2708
661 Ga0496108_1338642 3300048911 Bacteria 601
662 Ga0496109_0004247 3300048912 Bacteria 11964
663 Ga0496109_0116127 3300048912 Bacteria 2490
664 Ga0496110_0154617 3300048913 Bacteria 2078
665 Ga0496110_0229655 3300048913 Bacteria 1687
666 Ga0496110_0309038 3300048913 Unclassified 1440
667 Ga0496110_0815729 3300048913 Bacteria 838
668 Ga0496111_0109400 3300048914 Bacteria 2035
669 Ga0496111_0132465 3300048914 Bacteria 1845
670 Ga0496113_0098002 3300048916 Bacteria 2269
671 Ga0496113_0669825 3300048916 Bacteria 829
672 Ga0496114_0306152 3300048917 Bacteria 1403
673 Ga0496114_0783759 3300048917 Unclassified 832
674 Ga0496114_1040512 3300048917 Bacteria 702
675 Ga0496114_1621796 3300048917 Bacteria 535
676 Ga0501031_0010850 3300049568 Bacteria 5933
677 Ga0501031_0084896 3300049568 Unclassified 2064
678 Ga0501031_0186313 3300049568 Bacteria 1355
679 Ga0501032_0026190 3300049569 Bacteria 4014
680 Ga0501032_0503277 3300049569 Bacteria 774
681 Ga0501032_0724328 3300049569 Bacteria 630
682 Ga0501033_0061143 3300049570 Bacteria 2776
683 Ga0501033_0117447 3300049570 Bacteria 1932
684 Ga0501034_0393986 3300049571 Bacteria 1308
685 Ga0501034_0409382 3300049571 Bacteria 1278
686 Ga0501034_1386559 3300049571 Bacteria 578
687 Ga0501036_0054015 3300049572 Bacteria 3401
688 Ga0501036_0323888 3300049572 Bacteria 1287
689 Ga0501036_1283021 3300049572 Unclassified 595
690 Ga0501036_1560210 3300049572 Bacteria 534
691 Ga0501037_0004946 3300049573 Bacteria 9693
692 Ga0501037_0213065 3300049573 Bacteria 1361
693 Ga0501038_0059775 3300049574 Bacteria 3264
694 Ga0501038_0067038 3300049574 Bacteria 3054
695 Ga0501038_0187961 3300049574 Bacteria 1663
696 Ga0501039_0067804 3300049575 Bacteria 2770
697 Ga0501039_0097603 3300049575 Bacteria 2291
698 Ga0501039_0103457 3300049575 Unclassified 2223
699 Ga0501039_0462028 3300049575 Bacteria 997
700 Ga0501040_0031525 3300049576 Bacteria 3583
701 Ga0501040_0147465 3300049576 Bacteria 1659
702 Ga0501040_0341256 3300049576 Bacteria 1072
703 Ga0501040_0570882 3300049576 Bacteria 817
704 Ga0501040_0590888 3300049576 Unclassified 802
705 Ga0501040_0906678 3300049576 Unclassified 638
706 Ga0501041_0009030 3300049577 Bacteria 5864
707 Ga0501041_0091083 3300049577 Bacteria 1882
708 Ga0501041_0127710 3300049577 Bacteria 1583
709 Ga0501041_1060345 3300049577 Bacteria 522
710 Ga0501042_0025841 3300049578 Bacteria 4127
711 Ga0501042_0208989 3300049578 Bacteria 1407
712 Ga0501042_0338566 3300049578 Unclassified 1087
713 Ga0501043_0191465 3300049579 Bacteria 1590
714 Ga0501043_0311581 3300049579 Bacteria 1201
715 Ga0501043_0354891 3300049579 Bacteria 1113
716 Ga0501046_0072650 3300049580 Bacteria 2670
717 Ga0501046_0381878 3300049580 Bacteria 1019
718 Ga0501046_0400647 3300049580 Bacteria 991
719 Ga0501047_0013906 3300049581 Bacteria 7644
720 Ga0501048_0046540 3300049582 Bacteria 3096
721 Ga0501048_0152228 3300049582 Unclassified 1636
722 Ga0501048_0173038 3300049582 Bacteria 1530
723 Ga0501048_0210597 3300049582 Bacteria 1378
724 Ga0501048_0593547 3300049582 Bacteria 795
725 Ga0501048_0865561 3300049582 Bacteria 650
726 Ga0501048_1338746 3300049582 Unclassified 515
727 Ga0501067_0036919 3300049583 Bacteria 2713
728 Ga0501068_0110412 3300049584 Bacteria 1709
729 Ga0501068_0119771 3300049584 Bacteria 1640
730 Ga0501068_0637601 3300049584 Bacteria 695
731 Ga0501069_0026890 3300049585 Bacteria 3152
732 Ga0501069_0043131 3300049585 Bacteria 2496
733 Ga0501069_0153593 3300049585 Bacteria 1323
734 Ga0501069_0258957 3300049585 Bacteria 1015
735 Ga0501069_0518634 3300049585 Bacteria 712
736 Ga0501070_0003362 3300049586 Bacteria 13878
737 Ga0501070_0504799 3300049586 Bacteria 971
738 Ga0501070_0907204 3300049586 Bacteria 687
739 Ga0501071_0029529 3300049587 Bacteria 3870
740 Ga0501071_0713296 3300049587 Bacteria 772
741 Ga0501071_1214489 3300049587 Unclassified 582
742 Ga0501071_1271295 3300049587 Bacteria 568
743 Ga0501071_1580437 3300049587 Bacteria 506
744 Ga0501072_0044058 3300049588 Bacteria 3508
745 Ga0501072_0156608 3300049588 Unclassified 1816
746 Ga0501072_0187228 3300049588 Bacteria 1651
747 Ga0501072_0370065 3300049588 Bacteria 1137
748 Ga0501072_0901698 3300049588 Bacteria 690
749 Ga0501073_0461578 3300049589 Bacteria 878
750 Ga0501073_0575334 3300049589 Bacteria 778
751 Ga0501074_0031323 3300049590 Bacteria 3853
752 Ga0501074_0062246 3300049590 Unclassified 2688
753 Ga0501074_0067561 3300049590 Bacteria 2570
754 Ga0501075_0050893 3300049591 Bacteria 3114
755 Ga0501075_0255499 3300049591 Bacteria 1336
756 Ga0501075_0500719 3300049591 Bacteria 927
757 Ga0501075_0670161 3300049591 Bacteria 790
758 Ga0501075_0768442 3300049591 Bacteria 733
759 Ga0501075_0920618 3300049591 Unclassified 664
760 Ga0501076_0202140 3300049592 Bacteria 1622
761 Ga0501076_0225484 3300049592 Bacteria 1531
762 Ga0501076_0257533 3300049592 Bacteria 1428
763 Ga0501076_0798604 3300049592 Bacteria 779
764 Ga0501076_1378254 3300049592 Bacteria 579
765 Ga0501076_1762197 3300049592 Bacteria 508
766 Ga0501077_0020392 3300049593 Bacteria 4195
767 Ga0501077_0028440 3300049593 Bacteria 3552
768 Ga0501077_0796289 3300049593 Unclassified 608
769 Ga0501079_0107230 3300049741 Bacteria 2168
770 Ga0501079_0286505 3300049741 Bacteria 1288
771 Ga0501079_0316267 3300049741 Unclassified 1222
772 Ga0501079_0358023 3300049741 Bacteria 1143
773 Ga0501079_0484483 3300049741 Bacteria 972
774 Ga0501079_0548171 3300049741 Bacteria 909
775 Ga0501079_0650541 3300049741 Unclassified 830
776 Ga0501079_1041344 3300049741 Unclassified 645
777 Ga0501080_0028022 3300049742 Bacteria 5238
778 Ga0501080_0058397 3300049742 Bacteria 3591
779 Ga0501080_1061695 3300049742 Unclassified 700
780 Ga0501081_0149984 3300049743 Bacteria 1674
781 Ga0501081_0312056 3300049743 Bacteria 1155
782 Ga0501081_0637449 3300049743 Unclassified 798
783 Ga0501083_0008041 3300049744 Bacteria 7460
784 Ga0501083_0144757 3300049744 Bacteria 1556
785 Ga0501083_0161773 3300049744 Bacteria 1464
786 Ga0501035_0177502 3300049822 Bacteria 1836
787 Ga0501035_1211725 3300049822 Unclassified 585
788 Ga0501035_1285721 3300049822 Unclassified 564
789 Ga0501044_0018411 3300049823 Bacteria 7482
790 Ga0501044_0766697 3300049823 Bacteria 846
791 Ga0501045_0035689 3300049824 Unclassified 3610
792 Ga0501045_0133452 3300049824 Unclassified 1846
793 Ga0501045_0326544 3300049824 Bacteria 1142
794 Ga0501045_0606292 3300049824 Bacteria 811
795 Ga0501045_0643777 3300049824 Bacteria 783
796 Ga0501045_1158949 3300049824 Unclassified 564
797 nmdc:mga05p37_1759294_c1 3300050507 Unclassified 601
798 nmdc:mga05p37_192843_c1 3300050507 Bacteria 2473
799 nmdc:mga05p37_521625_c1 3300050507 Bacteria 1359
800 nmdc:mga05p37_663274_c1 3300050507 Bacteria 1166
801 nmdc:mga05p37_668968_c1 3300050507 Unclassified 1159
802 nmdc:mga05p37_9221_c1 3300050507 Bacteria 11661
803 nmdc:mga09592_152885_c1 3300050508 Bacteria 1991
804 nmdc:mga09592_243745_c1 3300050508 Bacteria 1558
805 nmdc:mga09592_72289_c1 3300050508 Bacteria 2929
806 nmdc:mga0qj67_109955_c1 3300050509 Bacteria 2225
807 nmdc:mga0qj67_6484_c1 3300050509 Bacteria 8599
808 nmdc:mga06r32_1489360_c1 3300050510 Unclassified 617
809 nmdc:mga06r32_4087_c1 3300050510 Bacteria 13082
810 nmdc:mga06r32_463749_c1 3300050510 Bacteria 1246
811 nmdc:mga06r32_483238_c1 3300050510 Bacteria 1216
812 nmdc:mga06r32_75069_c1 3300050510 Bacteria 3280
813 nmdc:mga08y16_432751_c1 3300050511 Unclassified 1344
814 nmdc:mga08y16_570838_c1 3300050511 Bacteria 1143
815 nmdc:mga08y16_88742_c1 3300050511 Bacteria 3223
816 nmdc:mga0n895_18407_c1 3300050512 Bacteria 6464
817 nmdc:mga0n895_83356_c1 3300050512 Bacteria 3188
818 nmdc:mga0n895_834_c1 3300050512 Bacteria 22113
819 nmdc:mga0rr50_1310_c1 3300050513 Bacteria 13552
820 nmdc:mga08x19_186124_c1 3300050514 Bacteria 1419
821 nmdc:mga0a205_262_c1 3300050515 Bacteria 37984
822 nmdc:mga0a205_56717_c1 3300050515 Bacteria 3782
823 nmdc:mga0a205_612417_c1 3300050515 Unclassified 942
824 nmdc:mga0a205_6622_c1 3300050515 Bacteria 10485
825 Ga0495655_0010744 3300053083 Bacteria 1817
826 Ga0495655_0120824 3300053083 Bacteria 797
827 Ga0495655_0220018 3300053083 Bacteria 628
828 Ga0495619_0003198 3300053085 Bacteria 10607
829 Ga0501084_0068136 3300054114 Bacteria 2980
830 Ga0501084_0152421 3300054114 Bacteria 1948
831 Ga0501084_0277463 3300054114 Unclassified 1415
832 Ga0501084_1075442 3300054114 Unclassified 675
833 Ga0590074_023263 3300059423 Bacteria 1074
834 Ga0590074_069095 3300059423 Bacteria 664
835 Ga0590075_039985 3300059424 Unclassified 1197
836 Ga0501082_0039258 3300060353 Bacteria 4084
837 Ga0501082_0102901 3300060353 Bacteria 2470
838 Ga0501082_0160801 3300060353 Bacteria 1951
839 Ga0501082_0184492 3300060353 Bacteria 1815
840 Ga0501082_0377740 3300060353 Bacteria 1236
841 Ga0501082_0395581 3300060353 Unclassified 1206
842 Ga0501082_1258918 3300060353 Bacteria 646
843 Ga0530510_0004365 3300061734 Bacteria 9786
844 Ga0530510_0066173 3300061734 Bacteria 2619
845 Ga0530510_0135003 3300061734 Bacteria 1816
846 Ga0530510_1443359 3300061734 Unclassified 528
847 Ga0307416_102959652
848 JGI24751J29686_10001091
849 Ga0070683_100756698
850 Ga0070690_100365440
851 Ga0070690_100517976
852 Ga0070670_100005282
853 Ga0070670_100033160
854 Ga0070670_100837000
855 Ga0070677_10874341
856 Ga0068869_100313818
857 Ga0070666_10495810
858 Ga0070680_100438142
859 Ga0070680_101366470
860 Ga0068868_100012011
861 Ga0068868_100120842
862 Ga0068868_101676373
863 Ga0070660_101338047
864 Ga0070689_100623587
865 Ga0070689_100717618
866 Ga0070689_101811809
867 Ga0070691_10517405
868 Ga0070691_11065685
869 Ga0070661_100677504
870 Ga0070692_10045095
871 Ga0070692_10073474
872 Ga0070692_10269595
873 Ga0070668_100626604
874 Ga0070675_100157842
875 Ga0070675_100934080
876 Ga0070671_100017818
877 Ga0070671_100766405
878 Ga0070671_101086461
879 Ga0070674_100009133
880 Ga0070674_100075741
881 Ga0070674_100390493
882 Ga0070674_100682638
883 Ga0070674_102119209
884 Ga0070673_100063962
885 Ga0070673_101155938
886 Ga0070688_100220214
887 Ga0070688_100283062
888 Ga0070688_100292561
889 Ga0070688_100430769
890 Ga0070659_100331008
891 Ga0070659_100391472
892 Ga0070659_101179150
893 Ga0070703_10000067
894 Ga0070713_101778231
895 Ga0070701_10880320
896 Ga0070701_11076340
897 Ga0070701_11182679
898 Ga0070711_100007216
899 Ga0070711_101082504
900 Ga0070705_100024263
901 Ga0070705_100044160
902 Ga0070705_100335486
903 Ga0070700_100018973
904 Ga0070700_100076708
905 Ga0070700_100129061
906 Ga0070700_100181998
907 Ga0070700_100377220
908 Ga0070700_100398443
909 Ga0070700_100735323
910 Ga0070694_100034353
911 Ga0070694_100270507
912 Ga0070694_100567224
913 Ga0070694_100608481
914 Ga0070694_100894244
915 Ga0070694_101157579
916 Ga0070708_100000074
917 Ga0070708_100401386
918 Ga0070708_100755786
919 Ga0070708_101519533
920 Ga0070663_100048916
921 Ga0070678_100142314
922 Ga0070678_100162890
923 Ga0070678_100379209
924 Ga0070662_101698699
925 Ga0070681_10187717
926 Ga0068867_100004737
927 Ga0068867_100321650
928 Ga0068867_100436159
929 Ga0068867_101739384
930 Ga0070685_10097402
931 Ga0070706_100005951
932 Ga0070706_100655298
933 Ga0070706_101357027
934 Ga0070707_100118086
935 Ga0070707_100246245
936 Ga0070707_100385134
937 Ga0070707_102333863
938 Ga0070698_100036787
939 Ga0070698_100273789
940 Ga0070698_100347916
941 Ga0070698_101445446
942 Ga0070699_100086823
943 Ga0070699_100140492
944 Ga0070699_100342030
945 Ga0070699_100890300
946 Ga0070699_101373633
947 Ga0070684_100048882
948 Ga0070684_100415983
949 Ga0070697_100043651
950 Ga0070697_101680684
951 Ga0070697_101935626
952 Ga0070697_102006196
953 Ga0070672_100384191
954 Ga0070686_100004661
955 Ga0070686_100369957
956 Ga0070695_100012922
957 Ga0070695_100062417
958 Ga0070695_100323169
959 Ga0070695_100509996
960 Ga0070695_101786434
961 Ga0070696_100005561
962 Ga0070696_100103176
963 Ga0070696_100289089
964 Ga0070696_100630467
965 Ga0070693_100105303
966 Ga0070693_101137421
967 Ga0070665_102119741
968 Ga0070704_100004909
969 Ga0070704_100033318
970 Ga0070704_100084501
971 Ga0070704_100333017
972 Ga0070704_100845577
973 Ga0070704_101571745
974 Ga0070704_101589431
975 Ga0070664_100037395
976 Ga0070664_100551148
977 Ga0070664_101848929
978 Ga0068857_100304864
979 Ga0068857_101730104
980 Ga0068854_100082005
981 Ga0068856_100439408
982 Ga0070702_100236261
983 Ga0070702_100540915
984 Ga0070702_100556692
985 Ga0070702_101355982
986 Ga0068852_100083811
987 Ga0068859_100418601
988 Ga0068859_101532903
989 Ga0068859_102421344
990 Ga0068864_100039149
991 Ga0068864_100048128
992 Ga0068864_101514912
993 Ga0068864_102550246
994 Ga0068866_10038252
995 Ga0068861_100095171
996 Ga0068861_100454045
997 Ga0068861_100849178
998 Ga0068861_100924467
999 Ga0068861_101173564
1000 Ga0068861_101406171
1001 Ga0068851_10070137
1002 Ga0068870_10008530
1003 Ga0068870_10029813
1004 Ga0068870_10266520
1005 Ga0068870_11041288
1006 Ga0068870_11130925
1007 Ga0068870_11474892
1008 Ga0068863_100084238
1009 Ga0068863_100761695
1010 Ga0068860_100418632
1011 Ga0068860_100726450
1012 Ga0068860_101072550
1013 Ga0068862_100082052
1014 Ga0068862_102481111
1015 Ga0081455_10004271
1016 Ga0081455_10005280
1017 Ga0081455_10008200
1018 Ga0081455_10067602
1019 Ga0081455_10107080
1020 Ga0081455_10210992
1021 Ga0081539_10039741
1022 Ga0075432_10027433
1023 Ga0070715_10001775
1024 Ga0070715_10553991
1025 Ga0070716_100011717
1026 Ga0070712_100286457
1027 Ga0070712_100926178
1028 Ga0068871_100344509
1029 Ga0075428_100290186
1030 Ga0075428_100328971
1031 Ga0075428_100473177
1032 Ga0075430_100014436
1033 Ga0075431_100000656
1034 Ga0075431_100258293
1035 Ga0075433_10000149
1036 Ga0075433_10002088
1037 Ga0075433_10512393
1038 Ga0075434_100002552
1039 Ga0075434_100023704
1040 Ga0075434_100081980
1041 Ga0075434_101954340
1042 Ga0075434_102157853
1043 Ga0075434_102469671
1044 Ga0075429_100022927
1045 Ga0075429_100057037
1046 Ga0075429_100610873
1047 Ga0075429_100699927
1048 Ga0068865_100010544
1049 Ga0068865_100036700
1050 Ga0068865_100309716
1051 Ga0068865_101494866
1052 Ga0068865_102074129
1053 Ga0075436_100410459
1054 Ga0097620_100418564
1055 Ga0097620_101533030
1056 Ga0097620_102421951
1057 Ga0075435_100019439
1058 Ga0075435_100890944
1059 Ga0105251_10028877
1060 Ga0105250_10282111
1061 Ga0111539_10117832
1062 Ga0111539_10408644
1063 Ga0111539_10427431
1064 Ga0105245_10020084
1065 Ga0105245_10103963
1066 Ga0105245_10163104
1067 Ga0105245_11139648
1068 Ga0105245_11900039
1069 Ga0105245_12995562
1070 Ga0105247_10562697
1071 Ga0114129_10000667
1072 Ga0114129_10020441
1073 Ga0114129_10144583
1074 Ga0114129_10261987
1075 Ga0114129_11482810
1076 Ga0114129_13219223
1077 Ga0105243_10002499
1078 Ga0105243_10003191
1079 Ga0105243_10003771
1080 Ga0105243_10016524
1081 Ga0105243_10274051
1082 Ga0105243_11432584
1083 Ga0105241_11087697
1084 Ga0105242_10002614
1085 Ga0105242_10005041
1086 Ga0105242_10037839
1087 Ga0105242_10246436
1088 Ga0105248_10203482
1089 Ga0105237_10297868
1090 Ga0105238_10127349
1091 Ga0105249_10028324
1092 Ga0105249_10349104
1093 Ga0105249_10521162
1094 Ga0105249_10988830
1095 Ga0105249_11773184
1096 Ga0105249_12462010
1097 Ga0105249_13100340
1098 Ga0105246_10014629
1099 Ga0105246_10124196
1100 Ga0105246_10156647
1101 Ga0105246_10247370
1102 Ga0105246_10251142
1103 Ga0105246_10593525
1104 Ga0157339_1039072
1105 Ga0157378_10006475
1106 Ga0157378_10009223
1107 Ga0157378_10032136
1108 Ga0157378_10401459
1109 Ga0157378_12252062
1110 Ga0163162_10214993
1111 Ga0163162_11021161
1112 Ga0163162_11887333
1113 Ga0157375_10009595
1114 Ga0157375_10025029
1115 Ga0157375_13055751
1116 Ga0163163_10144884
1117 Ga0163163_10287218
1118 Ga0163163_10467760
1119 Ga0163163_10941949
1120 Ga0163163_11232614
1121 Ga0163163_12863227
1122 Ga0157380_10032195
1123 Ga0157380_10430072
1124 Ga0157380_10463079
1125 Ga0157380_10754524
1126 Ga0157377_10026861
1127 Ga0157377_10064760
1128 Ga0157377_10176895
1129 Ga0157377_10436330
1130 Ga0157377_10513350
1131 Ga0157377_10930526
1132 Ga0157379_10134557
1133 Ga0157379_11936388
1134 Ga0157379_12053970
1135 Ga0157376_10341310
1136 Ga0157376_10342066
1137 Ga0163161_10296423
1138 Ga0163161_10730769
1139 Ga0207656_10029289
1140 Ga0207713_1216192
1141 Ga0207653_10000002
1142 Ga0207653_10045089
1143 Ga0207682_10148205
1144 Ga0207692_10087888
1145 Ga0207642_10199630
1146 Ga0207642_10290419
1147 Ga0207710_10243934
1148 Ga0207688_10034615
1149 Ga0207680_10612927
1150 Ga0207647_10307889
1151 Ga0207685_10003043
1152 Ga0207645_10051426
1153 Ga0207643_10002088
1154 Ga0207643_10217274
1155 Ga0207643_10230066
1156 Ga0207643_10974184
1157 Ga0207684_10000612
1158 Ga0207684_11222318
1159 Ga0207684_11483747
1160 Ga0207684_11693635
1161 Ga0207707_10434225
1162 Ga0207707_10747841
1163 Ga0207693_10000234
1164 Ga0207693_10637091
1165 Ga0207663_10161961
1166 Ga0207660_10413198
1167 Ga0207660_10436472
1168 Ga0207660_11665672
1169 Ga0207662_10064779
1170 Ga0207657_10762672
1171 Ga0207652_10263120
1172 Ga0207646_10008060
1173 Ga0207646_10580622
1174 Ga0207646_11033565
1175 Ga0207694_10104372
1176 Ga0207650_10006025
1177 Ga0207650_10022995
1178 Ga0207650_10393517
1179 Ga0207650_10905267
1180 Ga0207659_10102939
1181 Ga0207659_10501506
1182 Ga0207659_10601511
1183 Ga0207687_10002239
1184 Ga0207687_10030225
1185 Ga0207644_10086485
1186 Ga0207690_10239000
1187 Ga0207690_11663218
1188 Ga0207706_11407004
1189 Ga0207706_11678941
1190 Ga0207686_10034482
1191 Ga0207686_10063381
1192 Ga0207686_10128094
1193 Ga0207686_10701566
1194 Ga0207709_10009376
1195 Ga0207709_10011763
1196 Ga0207709_10026986
1197 Ga0207709_10233670
1198 Ga0207670_10211340
1199 Ga0207670_10698887
1200 Ga0207669_10039923
1201 Ga0207669_10064891
1202 Ga0207669_10066615
1203 Ga0207669_10367695
1204 Ga0207669_10459409
1205 Ga0207704_10238304
1206 Ga0207704_11496277
1207 Ga0207704_11728423
1208 Ga0207691_10079700
1209 Ga0207691_11354750
1210 Ga0207711_10258100
1211 Ga0207689_10064638
1212 Ga0207689_10477202
1213 Ga0207689_11582743
1214 Ga0207661_10395383
1215 Ga0207661_11861106
1216 Ga0207679_10001553
1217 Ga0207679_10968091
1218 Ga0207651_10050764
1219 Ga0207651_11827018
1220 Ga0207651_12025470
1221 Ga0207712_10009270
1222 Ga0207712_10052995
1223 Ga0207712_10751150
1224 Ga0207712_10962678
1225 Ga0207668_11435095
1226 Ga0207668_11600491
1227 Ga0207640_10525912
1228 Ga0207640_10809386
1229 Ga0207677_10138854
1230 Ga0207677_11787748
1231 Ga0207678_10042793
1232 Ga0207678_10202030
1233 Ga0207678_11579317
1234 Ga0207678_12028783
1235 Ga0207708_10015640
1236 Ga0207708_10020897
1237 Ga0207708_10021485
1238 Ga0207708_10217894
1239 Ga0207708_10681175
1240 Ga0207708_10818490
1241 Ga0207708_10921109
1242 Ga0207708_11446049
1243 Ga0207702_10412121
1244 Ga0207702_11489314
1245 Ga0207641_10016768
1246 Ga0207641_10435616
1247 Ga0207641_10720956
1248 Ga0207641_10776758
1249 Ga0207648_10000754
1250 Ga0207648_10014866
1251 Ga0207648_11537763
1252 Ga0207676_10010382
1253 Ga0207676_10185116
1254 Ga0207674_10055176
1255 Ga0207674_10169100
1256 Ga0207675_100021703
1257 Ga0207675_100452828
1258 Ga0207675_100585011
1259 Ga0207675_100675515
1260 Ga0207675_101273792
1261 Ga0207675_101949227
1262 Ga0207683_10087911
1263 Ga0207683_10340320
1264 Ga0207683_10437999
1265 Ga0209966_1061503
1266 Ga0207428_10000597
1267 Ga0207428_10000612
1268 Ga0207428_10020218
1269 Ga0268266_10911992
1270 Ga0268265_11088490
1271 Ga0268265_12724139
1272 Ga0268264_10073848
1273 Ga0268264_10183862
1274 Ga0268264_10311613
1275 Ga0268264_12039896
1276 Ga0307410_11752067
1277 Ga0307409_101020345
1278 Ga0307416_101163149
1279 Ga0307415_100166313
1280 Ga0307415_101770380
1281 Ga0373948_0054953
1282 Ga0373926_0001364
1283 Ga0373944_0000653
1284 Ga0373951_0052255
1285 Ga0373923_0015583
1286 Ga0373936_0001504
1287 Ga0373939_0063808
1288 Ga0373945_0044282
1289 Ga0373943_0003307
1290 Ga0373943_0450686
1291 Ga0373946_0001746
1292 Ga0373961_0103754
1293 Ga0373961_0384651
1294 Ga0373962_0018458
1295 Ga0373931_0046562
1296 Ga0373935_0090920
1297 Ga0373935_1185706
1298 Ga0373927_0007582
1299 Ga0373927_0647566
1300 Ga0373947_0017501
1301 Ga0373947_0291670
1302 Ga0373947_0428976
1303 Ga0373925_0166257
1304 Ga0373925_0278446
1305 Ga0373925_1633637
1306 Ga0395899_0058054
1307 Ga0395899_0070888
1308 Ga0395899_0159722
1309 Ga0395899_0233975
1310 Ga0395899_0349000
1311 Ga0395900_0003775
1312 Ga0395900_0011221
1313 Ga0395900_0068815
1314 Ga0395900_0155423
1315 Ga0395900_1388807
1316 Ga0395898_0012736
1317 Ga0395898_0091637
1318 Ga0395898_0423128
1319 Ga0395898_1107491
1320 Ga0395905_0022764
1321 Ga0395905_0030701
1322 Ga0395905_0042179
1323 Ga0395905_0049433
1324 Ga0395905_0092477
1325 Ga0395905_0146397
1326 Ga0395905_0405575
1327 Ga0395905_1815076
1328 Ga0395901_0025036
1329 Ga0395901_0029715
1330 Ga0395901_0108608
1331 Ga0395901_0124980
1332 Ga0395901_0153373
1333 Ga0395901_0491532
1334 Ga0395901_0513170
1335 Ga0395901_0901808
1336 Ga0395901_1967558
1337 Ga0439453_0071713
1338 Ga0439453_0181356
1339 Ga0451804_0468199
1340 Ga0439443_049382
1341 Ga0439448_0119894
1342 Ga0439454_023056
1343 Ga0439454_059401
1344 Ga0439463_162684
1345 Ga0439435_0194953
1346 Ga0439444_0091238
1347 Ga0439464_0033942
1348 Ga0439460_0098712
1349 Ga0439460_0313654
1350 Ga0450893_0116578
1351 Ga0439440_0035589
1352 Ga0439440_0089681
1353 Ga0466960_0546305
1354 Ga0495617_288815
1355 Ga0495603_0003354
1356 Ga0495603_0005113
1357 Ga0495603_0013661
1358 Ga0495603_0029038
1359 Ga0495603_0029381
1360 Ga0495603_0119630
1361 Ga0495629_0009809
1362 Ga0495641_0004496
1363 Ga0495641_0284099
1364 Ga0495653_0036179
1365 Ga0495580_0158005
1366 Ga0495580_0176585
1367 Ga0495582_0003096
1368 Ga0495582_0811485
1369 Ga0495605_0191427
1370 Ga0495639_0001049
1371 Ga0495639_0456532
1372 Ga0495662_0000565
1373 Ga0495584_0047079
1374 Ga0495584_0058921
1375 Ga0495584_0065395
1376 Ga0495584_0173809
1377 Ga0495584_0319262
1378 Ga0495584_0497077
1379 Ga0495584_0689255
1380 Ga0495584_0738800
1381 Ga0495585_0028209
1382 Ga0495585_0032931
1383 Ga0495585_0484752
1384 Ga0495594_0024091
1385 Ga0495594_0229667
1386 Ga0495596_0027540
1387 Ga0495596_0100212
1388 Ga0495607_0025182
1389 Ga0495607_0191919
1390 Ga0495607_0326912
1391 Ga0495583_0295753
1392 Ga0495616_0158716
1393 Ga0495616_0357884
1394 Ga0495618_0894458
1395 Ga0495620_0165666
1396 Ga0495630_0013811
1397 Ga0495631_0126366
1398 Ga0495631_0277776
1399 Ga0495631_0375794
1400 Ga0495637_0155938
1401 Ga0495644_0038686
1402 Ga0495644_0057380
1403 Ga0495644_0083828
1404 Ga0495644_0148118
1405 Ga0495663_0203456
1406 Ga0495666_0003712
1407 Ga0495642_0044150
1408 Ga0495642_0048726
1409 Ga0495642_0355627
1410 Ga0495665_0000725
1411 Ga0495665_0058128
1412 Ga0495640_0038151
1413 Ga0495640_0841419
1414 Ga0495586_0028185
1415 Ga0495586_0058223
1416 Ga0495598_0012111
1417 Ga0495598_0052528
1418 Ga0495598_0315016
1419 Ga0495609_0028547
1420 Ga0495609_0086367
1421 Ga0495609_0116816
1422 Ga0495609_0357181
1423 Ga0495621_0349511
1424 Ga0495633_0223915
1425 Ga0495633_0336402
1426 Ga0495667_0036019
1427 Ga0495656_0007938
1428 Ga0495656_0050326
1429 Ga0495656_0060129
1430 Ga0495656_0072567
1431 Ga0495656_0093577
1432 Ga0495656_0156956
1433 Ga0495656_0747362
1434 Ga0495668_0358350
1435 Ga0495634_0003424
1436 Ga0495634_0173548
1437 Ga0495611_0194813
1438 Ga0495611_0199917
1439 Ga0495635_0002848
1440 Ga0495659_0040885
1441 Ga0495659_0046873
1442 Ga0495659_0057778
1443 Ga0495659_0148852
1444 Ga0495661_0226925
1445 Ga0495661_0315659
1446 Ga0495661_0335682
1447 Ga0495661_0342554
1448 Ga0495661_0399891
1449 Ga0495588_0002913
1450 Ga0495588_0158603
1451 Ga0495588_0367313
1452 Ga0495647_0002142
1453 Ga0495647_0008136
1454 Ga0495647_0324988
1455 Ga0495658_0000684
1456 Ga0495669_0538855
1457 Ga0495669_0597386
1458 Ga0495613_0053347
1459 Ga0495624_0008536
1460 Ga0495624_0811473
1461 Ga0495670_0010803
1462 Ga0495670_0024051
1463 Ga0495670_0087486
1464 Ga0495670_0090916
1465 Ga0495589_0512088
1466 Ga0495589_0581724
1467 Ga0495581_0001668
1468 Ga0495581_0038078
1469 Ga0495581_0584216
1470 Ga0495636_0222266
1471 Ga0495636_0323943
1472 Ga0495674_0003014
1473 Ga0495676_0058596
1474 Ga0495676_0311419
1475 Ga0495676_0341957
1476 Ga0495676_1114790
1477 Ga0495680_0011999
1478 Ga0495677_0034019
1479 Ga0495677_0445103
1480 Ga0495679_080972
1481 Ga0495685_228145
1482 Ga0495684_0196397
1483 Ga0495593_0004647
1484 Ga0495614_0000851
1485 Ga0495614_0542589
1486 Ga0495615_0030862
1487 Ga0495626_0397990
1488 Ga0496100_0047513
1489 Ga0496100_0054200
1490 Ga0496100_0364587
1491 Ga0496101_0064755
1492 Ga0496101_0161114
1493 Ga0496102_0007710
1494 Ga0496102_0493632
1495 Ga0496103_0078730
1496 Ga0496104_0536919
1497 Ga0496105_1332293
1498 Ga0496106_0004719
1499 Ga0496106_0017260
1500 Ga0496106_0488933
1501 Ga0496107_0149359
1502 Ga0496107_0170592
1503 Ga0496107_1278837
1504 Ga0496108_0021154
1505 Ga0496108_0053107
1506 Ga0496108_0083606
1507 Ga0496108_1338642
1508 Ga0496109_0004247
1509 Ga0496109_0116127
1510 Ga0496110_0154617
1511 Ga0496110_0229655
1512 Ga0496110_0309038
1513 Ga0496110_0815729
1514 Ga0496111_0109400
1515 Ga0496111_0132465
1516 Ga0496113_0098002
1517 Ga0496113_0669825
1518 Ga0496114_0306152
1519 Ga0496114_0783759
1520 Ga0496114_1040512
1521 Ga0496114_1621796
1522 Ga0501031_0010850
1523 Ga0501031_0084896
1524 Ga0501031_0186313
1525 Ga0501032_0026190
1526 Ga0501032_0503277
1527 Ga0501032_0724328
1528 Ga0501033_0061143
1529 Ga0501033_0117447
1530 Ga0501034_0393986
1531 Ga0501034_0409382
1532 Ga0501034_1386559
1533 Ga0501036_0054015
1534 Ga0501036_0323888
1535 Ga0501036_1283021
1536 Ga0501036_1560210
1537 Ga0501037_0004946
1538 Ga0501037_0213065
1539 Ga0501038_0059775
1540 Ga0501038_0067038
1541 Ga0501038_0187961
1542 Ga0501039_0067804
1543 Ga0501039_0097603
1544 Ga0501039_0103457
1545 Ga0501039_0462028
1546 Ga0501040_0031525
1547 Ga0501040_0147465
1548 Ga0501040_0341256
1549 Ga0501040_0570882
1550 Ga0501040_0590888
1551 Ga0501040_0906678
1552 Ga0501041_0009030
1553 Ga0501041_0091083
1554 Ga0501041_0127710
1555 Ga0501041_1060345
1556 Ga0501042_0025841
1557 Ga0501042_0208989
1558 Ga0501042_0338566
1559 Ga0501043_0191465
1560 Ga0501043_0311581
1561 Ga0501043_0354891
1562 Ga0501046_0072650
1563 Ga0501046_0381878
1564 Ga0501046_0400647
1565 Ga0501047_0013906
1566 Ga0501048_0046540
1567 Ga0501048_0152228
1568 Ga0501048_0173038
1569 Ga0501048_0210597
1570 Ga0501048_0593547
1571 Ga0501048_0865561
1572 Ga0501048_1338746
1573 Ga0501067_0036919
1574 Ga0501068_0110412
1575 Ga0501068_0119771
1576 Ga0501068_0637601
1577 Ga0501069_0026890
1578 Ga0501069_0043131
1579 Ga0501069_0153593
1580 Ga0501069_0258957
1581 Ga0501069_0518634
1582 Ga0501070_0003362
1583 Ga0501070_0504799
1584 Ga0501070_0907204
1585 Ga0501071_0029529
1586 Ga0501071_0713296
1587 Ga0501071_1214489
1588 Ga0501071_1271295
1589 Ga0501071_1580437
1590 Ga0501072_0044058
1591 Ga0501072_0156608
1592 Ga0501072_0187228
1593 Ga0501072_0370065
1594 Ga0501072_0901698
1595 Ga0501073_0461578
1596 Ga0501073_0575334
1597 Ga0501074_0031323
1598 Ga0501074_0062246
1599 Ga0501074_0067561
1600 Ga0501075_0050893
1601 Ga0501075_0255499
1602 Ga0501075_0500719
1603 Ga0501075_0670161
1604 Ga0501075_0768442
1605 Ga0501075_0920618
1606 Ga0501076_0202140
1607 Ga0501076_0225484
1608 Ga0501076_0257533
1609 Ga0501076_0798604
1610 Ga0501076_1378254
1611 Ga0501076_1762197
1612 Ga0501077_0020392
1613 Ga0501077_0028440
1614 Ga0501077_0796289
1615 Ga0501079_0107230
1616 Ga0501079_0286505
1617 Ga0501079_0316267
1618 Ga0501079_0358023
1619 Ga0501079_0484483
1620 Ga0501079_0548171
1621 Ga0501079_0650541
1622 Ga0501079_1041344
1623 Ga0501080_0028022
1624 Ga0501080_0058397
1625 Ga0501080_1061695
1626 Ga0501081_0149984
1627 Ga0501081_0312056
1628 Ga0501081_0637449
1629 Ga0501083_0008041
1630 Ga0501083_0144757
1631 Ga0501083_0161773
1632 Ga0501035_0177502
1633 Ga0501035_1211725
1634 Ga0501035_1285721
1635 Ga0501044_0018411
1636 Ga0501044_0766697
1637 Ga0501045_0035689
1638 Ga0501045_0133452
1639 Ga0501045_0326544
1640 Ga0501045_0606292
1641 Ga0501045_0643777
1642 Ga0501045_1158949
1643 nmdc:mga05p37_1759294_c1
1644 nmdc:mga05p37_192843_c1
1645 nmdc:mga05p37_521625_c1
1646 nmdc:mga05p37_663274_c1
1647 nmdc:mga05p37_668968_c1
1648 nmdc:mga05p37_9221_c1
1649 nmdc:mga09592_152885_c1
1650 nmdc:mga09592_243745_c1
1651 nmdc:mga09592_72289_c1
1652 nmdc:mga0qj67_109955_c1
1653 nmdc:mga0qj67_6484_c1
1654 nmdc:mga06r32_1489360_c1
1655 nmdc:mga06r32_4087_c1
1656 nmdc:mga06r32_463749_c1
1657 nmdc:mga06r32_483238_c1
1658 nmdc:mga06r32_75069_c1
1659 nmdc:mga08y16_432751_c1
1660 nmdc:mga08y16_570838_c1
1661 nmdc:mga08y16_88742_c1
1662 nmdc:mga0n895_18407_c1
1663 nmdc:mga0n895_83356_c1
1664 nmdc:mga0n895_834_c1
1665 nmdc:mga0rr50_1310_c1
1666 nmdc:mga08x19_186124_c1
1667 nmdc:mga0a205_262_c1
1668 nmdc:mga0a205_56717_c1
1669 nmdc:mga0a205_612417_c1
1670 nmdc:mga0a205_6622_c1
1671 Ga0495655_0010744
1672 Ga0495655_0120824
1673 Ga0495655_0220018
1674 Ga0495619_0003198
1675 Ga0501084_0068136
1676 Ga0501084_0152421
1677 Ga0501084_0277463
1678 Ga0501084_1075442
1679 Ga0590074_023263
1680 Ga0590074_069095
1681 Ga0590075_039985
1682 Ga0501082_0039258
1683 Ga0501082_0102901
1684 Ga0501082_0160801
1685 Ga0501082_0184492
1686 Ga0501082_0377740
1687 Ga0501082_0395581
1688 Ga0501082_1258918
1689 Ga0530510_0004365
1690 Ga0530510_0066173
1691 Ga0530510_0135003
1692 Ga0530510_1443359

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13783

DUF4177

Domain of unknown function (DUF4177)

11

64

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dry-assembly1.cif.gz_A x-ray crystal structure of human kctd5 protein crystallized in low-salt buffer 0.7677 1 54
6xyd-assembly1.cif.gz_C crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi 0.7659 19 51
6gz5-assembly1.cif.gz_Ct trna translocation by the eukaryotic 80s ribosome and the impact of gtp hydrolysis, translocation-intermediate-post-3 (ti-post-3) 0.7657 2 52
6xyd-assembly1.cif.gz_B crystal structure of q4d6q6, a conserved kinetoplastid-specific protein from trypanosoma cruzi 0.7645 19 51
3drx-assembly1.cif.gz_B x-ray crystal structure of human kctd5 protein crystallized in high-salt buffer 0.7605 1 54
ID Description Score Start End Superfamily
af_Q9FHI0_159_328_2.30.280.10 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.8854 28 51 2.30.280.10
af_Q6F322_199_378_2.30.280.10 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.8528 28 51 2.30.280.10
af_K7N1Z6_68_256_2.30.280.10 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.815 28 51 2.30.280.10
3bi7A01 Mainly Beta;Roll;PUA domain-like;SRA-YDG 0.7907 28 51 2.30.280.10
af_Q54RD2_128_353_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.762 4 51 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537WZB5-F1-model_v4 DUF4177 domain-containing protein 0.9631 1 54
AF-A0A538ARG6-F1-model_v4 CoA-binding protein 0.9503 1 54
AF-A0A1X6WT34-F1-model_v4 DUF4177 domain-containing protein 0.9348 1 54
AF-A0A538ARG6-F1-model_v4 CoA-binding protein 0.9339 1 54
AF-A0A806GMX9-F1-model_v4 deleted 0.9264 1 54

Map