F483280

General Info

Members Datasets Scaffolds Average Seq Length
846 470 811 403

Family's Representative Sequence

Representative Sequence 3300005437|Ga0070710_10029533|Ga0070710_100295332
Length 490
Sequence MMGASIEATLELWASSLRDVKGRMRPLFTQERVAASAGSFLDGLLGAEQRKTGWMRAEAAGDRGPWRQQAILGRGRWDADALRDIVRDYALETLADPDAVLVLDETGFLKQGKASCGVGRQYTGSAGKITNCQIGVFAAYVSRHGHALIDRALYLPKAWTDDPARIAAAHVPACTGFATKPRLALAMIARATAANAPLAWVAADTVYGVGEIEKALRRAGKGYVLGVPGNHLFRSWGKRPPIAGMALEIAHALDPSLWKRLSAGEGTKGARLHDWAYCELADLDAAEYDDQRTGLWTRGVLIRRNIADDDMAFFSTWCPYGTSIETLVKVEGHRWAIEDSFETAKNELGLDHNESRSWHGWHRHVSLVMLAFAMMAKSHRHRSPGRSRRSAASPSVLRKDGSTPLTSLHGPSGDAYIKPSLEKLISSEICNCNARCVVPDCDGASLSLIRQGEDGLWQAFFTAAPARRRVFEPSSKRRKRAPAPLPPATA

Samples

Sample ID Description Type Environment
1 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
5 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
6 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
7 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
8 2738541293 Rhizobium sp. GV031 Isolate Unclassified
9 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
10 2791355263 Rhizobium chutanense C5 Isolate Nodule
11 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
12 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
13 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
14 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
15 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
16 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
17 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
18 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
19 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
20 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
21 3004167301 Mesorhizobium loti 582 Isolate Unclassified
22 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
23 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
24 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
25 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
26 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
27 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
28 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
29 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
30 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
33 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
34 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
35 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
36 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
37 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
38 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
39 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
40 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
41 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
42 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
43 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
44 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
45 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
46 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
48 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
49 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
50 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
51 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
52 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
53 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
54 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
55 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
56 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
59 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
60 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
61 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
62 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
63 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
64 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
65 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
66 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
67 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
68 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
69 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
70 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
71 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
72 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
73 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
74 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
77 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
78 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
79 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
80 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
92 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
93 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
107 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
110 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
111 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
112 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
113 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
114 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
115 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
116 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
117 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
118 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
119 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
120 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
126 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
130 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
131 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
132 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
133 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
134 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
135 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
136 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
142 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
143 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
144 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
145 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
146 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
147 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
148 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
149 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
150 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
151 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
153 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
154 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
156 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
159 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
160 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
161 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
162 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
222 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
228 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
229 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
230 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
231 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
232 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
233 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
234 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
235 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
236 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
237 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
241 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
242 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
243 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
244 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
245 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
246 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
247 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
248 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
249 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
250 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
251 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
252 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
253 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
254 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
255 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
256 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
257 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
258 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
259 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
260 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
261 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
262 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
263 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
264 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
265 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
266 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
267 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
268 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
269 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
270 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
271 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
272 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
273 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
274 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
275 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
276 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
277 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
278 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
279 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
280 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
281 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
282 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
283 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
284 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
285 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
286 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
287 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
288 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
289 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
290 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
291 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
292 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
293 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
294 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
295 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
296 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
297 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
298 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
299 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
300 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
301 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
302 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
303 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
304 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
305 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
306 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
307 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
308 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
309 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
310 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
311 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
312 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
313 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
314 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
315 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
316 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
317 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
318 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
319 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
320 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
321 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
324 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
325 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
326 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
327 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
328 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
329 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
330 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
331 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
332 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
333 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
334 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
335 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
336 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
337 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
338 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
339 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
340 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
341 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
342 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
343 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
344 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
345 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
346 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
347 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
348 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
349 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
350 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
351 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
352 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
353 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
354 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
355 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
356 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
357 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
358 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
359 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
360 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
361 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
362 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
363 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
364 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
365 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
366 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
367 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
368 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
369 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
370 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
371 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
372 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
373 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
374 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
375 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
376 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
377 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
378 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
379 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
380 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
381 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
382 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
383 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
384 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
385 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
386 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
387 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
388 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
389 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
390 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
391 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
392 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
393 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
394 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
395 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
396 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
397 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
398 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
399 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
400 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
401 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
402 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
403 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
404 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
405 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
406 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
407 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
408 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
409 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
410 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
411 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
412 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
413 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
414 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
415 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
416 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
417 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
418 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
419 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
420 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
421 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
422 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
423 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
424 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
425 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
426 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
427 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
428 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
429 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
441 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
442 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
443 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
444 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
445 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
446 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
447 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
448 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
449 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
450 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
451 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
452 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
453 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
454 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
455 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
456 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
457 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
458 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
459 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
460 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
461 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
462 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
463 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
464 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
465 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
466 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
467 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
468 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
469 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
470 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.86
Metatranscriptomes 0
Isolates 4.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.03
Nodule 2.25
Rhizoplane 4.61
Rhizosphere 80.61
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001629 3300001904 Bacteria 4080
2 JGI24736J21556_1003726 3300001904 Bacteria 2632
3 JGI24746J21847_1001879 3300001977 Bacteria 3349
4 JGI24746J21847_1009752 3300001977 Bacteria 1429
5 JGI24747J21853_1001883 3300001978 Bacteria 1635
6 JGI24740J21852_10009422 3300001979 Bacteria 3824
7 JGI24740J21852_10013036 3300001979 Bacteria 3116
8 JGI24740J21852_10017173 3300001979 Bacteria 2594
9 JGI24740J21852_10037640 3300001979 Bacteria 1491
10 JGI24739J22299_10006299 3300001989 Bacteria 4481
11 JGI24739J22299_10011398 3300001989 Bacteria 3283
12 JGI24739J22299_10029983 3300001989 Bacteria 1888
13 JGI24739J22299_10042476 3300001989 Bacteria 1508
14 JGI24737J22298_10008340 3300001990 Bacteria 3473
15 JGI24737J22298_10017182 3300001990 Bacteria 2332
16 JGI24737J22298_10038737 3300001990 Bacteria 1467
17 JGI24737J22298_10040074 3300001990 Bacteria 1439
18 JGI24737J22298_10040661 3300001990 Bacteria 1427
19 JGI24743J22301_10013955 3300001991 Bacteria 1477
20 JGI24735J21928_10008586 3300002067 Bacteria 3299
21 JGI24735J21928_10035465 3300002067 Bacteria 1466
22 JGI24735J21928_10037285 3300002067 Bacteria 1425
23 JGI24745J21846_1000203 3300002073 Bacteria 4811
24 JGI24745J21846_1005085 3300002073 Bacteria 1428
25 JGI24748J21848_1002255 3300002074 Bacteria 2162
26 JGI24748J21848_1004189 3300002074 Bacteria 1651
27 JGI24748J21848_1005704 3300002074 Bacteria 1448
28 JGI24738J21930_10006727 3300002075 Bacteria 2675
29 JGI24738J21930_10006766 3300002075 Bacteria 2665
30 JGI24738J21930_10007872 3300002075 Bacteria 2440
31 JGI24738J21930_10017496 3300002075 Bacteria 1506
32 JGI24738J21930_10019204 3300002075 Bacteria 1427
33 JGI24744J21845_10017361 3300002077 Bacteria 1430
34 JGI24033J26618_1005009 3300002155 Bacteria 1448
35 JGI24033J26618_1005234 3300002155 Bacteria 1426
36 JGI24034J26672_10002275 3300002239 Bacteria 2628
37 JGI24034J26672_10005082 3300002239 Bacteria 1880
38 JGI24034J26672_10008959 3300002239 Bacteria 1471
39 JGI24034J26672_10009517 3300002239 Bacteria 1434
40 JGI24742J22300_10004357 3300002244 Bacteria 2315
41 JGI24742J22300_10004598 3300002244 Bacteria 2263
42 JGI24751J29686_10003347 3300002459 Bacteria 3232
43 JGI25162J39368_1005355 3300002737 Bacteria 2554
44 JGI25152J39213_1015316 3300002773 Bacteria 1516
45 JGI25150J39212_1012362 3300002774 Bacteria 1514
46 JGI25151J46595_10046711 3300003187 Bacteria 1514
47 JGI25165J46597_1004612 3300003214 Bacteria 2897
48 JGI25153J46596_10038275 3300003215 Bacteria 1514
49 JGI25404J52841_10019148 3300003659 Bacteria 1483
50 Ga0055539_1003335 3300003752 Bacteria 2258
51 Ga0055539_1003349 3300003752 Bacteria 2252
52 Ga0055526_1027249 3300003771 Bacteria 1772
53 Ga0065712_10018815 3300005290 Bacteria 1527
54 Ga0065715_10120700 3300005293 Bacteria 2251
55 Ga0070658_10182003 3300005327 Bacteria 1768
56 Ga0070676_10054127 3300005328 Bacteria 2365
57 Ga0070683_100050969 3300005329 Bacteria 3834
58 Ga0070683_100180692 3300005329 Bacteria 2002
59 Ga0070683_100276702 3300005329 Bacteria 1597
60 Ga0070682_100164057 3300005337 Bacteria 1537
61 Ga0068868_100188958 3300005338 Bacteria 1712
62 Ga0068868_100201610 3300005338 Bacteria 1659
63 Ga0068868_100273182 3300005338 Bacteria 1428
64 Ga0070660_100036157 3300005339 Bacteria 3740
65 Ga0070660_100088303 3300005339 Bacteria 2441
66 Ga0070689_100063783 3300005340 Bacteria 2866
67 Ga0070691_10026813 3300005341 Bacteria 2687
68 Ga0070691_10041218 3300005341 Bacteria 2183
69 Ga0070691_10086774 3300005341 Bacteria 1538
70 Ga0070687_100019531 3300005343 Bacteria 3154
71 Ga0070661_100009928 3300005344 Bacteria 6605
72 Ga0070661_100068827 3300005344 Bacteria 2601
73 Ga0070661_100130118 3300005344 Bacteria 1890
74 Ga0070692_10093763 3300005345 Bacteria 1635
75 Ga0070668_100159071 3300005347 Bacteria 1832
76 Ga0070668_100169321 3300005347 Bacteria 1777
77 Ga0070669_100112871 3300005353 Bacteria 2064
78 Ga0070675_100052472 3300005354 Bacteria 3352
79 Ga0070675_100095890 3300005354 Bacteria 2491
80 Ga0070671_100246375 3300005355 Bacteria 1517
81 Ga0070674_100105965 3300005356 Bacteria 2056
82 Ga0070674_100108253 3300005356 Bacteria 2036
83 Ga0070674_100230033 3300005356 Bacteria 1446
84 Ga0070673_100177665 3300005364 Bacteria 1821
85 Ga0070673_100182447 3300005364 Bacteria 1797
86 Ga0070659_100023370 3300005366 Bacteria 4729
87 Ga0070659_100048751 3300005366 Bacteria 3328
88 Ga0070667_100088281 3300005367 Bacteria 2662
89 Ga0070667_100101591 3300005367 Bacteria 2484
90 Ga0070667_100214681 3300005367 Bacteria 1711
91 Ga0070713_100279025 3300005436 Bacteria 1532
92 Ga0070710_10029533 3300005437 Bacteria 2942
93 Ga0070701_10134740 3300005438 Bacteria 1407
94 Ga0070705_100036978 3300005440 Bacteria 2750
95 Ga0070705_100039412 3300005440 Bacteria 2680
96 Ga0070700_100166167 3300005441 Bacteria 1524
97 Ga0070663_100007527 3300005455 Bacteria 6633
98 Ga0070663_100083886 3300005455 Bacteria 2347
99 Ga0070663_100258308 3300005455 Bacteria 1381
100 Ga0070678_100166193 3300005456 Bacteria 1792
101 Ga0070678_100188657 3300005456 Bacteria 1693
102 Ga0070678_100260467 3300005456 Bacteria 1458
103 Ga0070662_100074978 3300005457 Bacteria 2504
104 Ga0070662_100145049 3300005457 Bacteria 1843
105 Ga0070662_100173135 3300005457 Bacteria 1697
106 Ga0068867_100187981 3300005459 Bacteria 1646
107 Ga0070684_100137781 3300005535 Bacteria 2205
108 Ga0070684_100169739 3300005535 Bacteria 1981
109 Ga0068853_100031591 3300005539 Bacteria 4479
110 Ga0068853_100161980 3300005539 Bacteria 2019
111 Ga0068853_100326430 3300005539 Bacteria 1423
112 Ga0070686_100058700 3300005544 Bacteria 2476
113 Ga0070686_100166420 3300005544 Bacteria 1556
114 Ga0070695_100145334 3300005545 Bacteria 1649
115 Ga0070696_100219634 3300005546 Bacteria 1426
116 Ga0070693_100174684 3300005547 Bacteria 1378
117 Ga0070665_100227421 3300005548 Bacteria 1865
118 Ga0070665_100311494 3300005548 Bacteria 1578
119 Ga0070665_100372587 3300005548 Bacteria 1435
120 Ga0070704_100199922 3300005549 Bacteria 1613
121 Ga0068855_100340528 3300005563 Bacteria 1654
122 Ga0068855_100442922 3300005563 Bacteria 1418
123 Ga0070664_100038370 3300005564 Bacteria 4031
124 Ga0070664_100068047 3300005564 Bacteria 3044
125 Ga0068857_100077096 3300005577 Bacteria 2973
126 Ga0068857_100245008 3300005577 Bacteria 1642
127 Ga0068854_100054545 3300005578 Bacteria 2875
128 Ga0068854_100076483 3300005578 Bacteria 2460
129 Ga0068854_100120330 3300005578 Bacteria 1992
130 Ga0068854_100185699 3300005578 Bacteria 1626
131 Ga0068854_100211915 3300005578 Bacteria 1528
132 Ga0068854_100229178 3300005578 Bacteria 1474
133 Ga0068856_100239726 3300005614 Bacteria 1829
134 Ga0068856_100246075 3300005614 Bacteria 1803
135 Ga0068856_100384796 3300005614 Bacteria 1422
136 Ga0070702_100090131 3300005615 Bacteria 1858
137 Ga0070702_100157089 3300005615 Bacteria 1466
138 Ga0068852_100108598 3300005616 Bacteria 2518
139 Ga0068852_100182843 3300005616 Bacteria 1972
140 Ga0068852_100259703 3300005616 Bacteria 1667
141 Ga0068852_100360744 3300005616 Bacteria 1421
142 Ga0068864_100128989 3300005618 Bacteria 2269
143 Ga0068866_10094407 3300005718 Bacteria 1636
144 Ga0068866_10111203 3300005718 Bacteria 1529
145 Ga0068866_10144059 3300005718 Bacteria 1371
146 Ga0068866_10173595 3300005718 Bacteria 1267
147 Ga0068861_100209678 3300005719 Bacteria 1640
148 Ga0068861_100282730 3300005719 Bacteria 1429
149 Ga0068851_10034196 3300005834 Bacteria 2536
150 Ga0068851_10061010 3300005834 Bacteria 1932
151 Ga0068851_10115337 3300005834 Bacteria 1438
152 Ga0068870_10123606 3300005840 Bacteria 1494
153 Ga0068863_100194373 3300005841 Bacteria 1950
154 Ga0068858_100128867 3300005842 Bacteria 2371
155 Ga0068860_100090744 3300005843 Bacteria 2911
156 Ga0068860_100149670 3300005843 Bacteria 2247
157 Ga0068860_100203207 3300005843 Bacteria 1920
158 Ga0068860_100309675 3300005843 Bacteria 1548
159 Ga0068862_100228977 3300005844 Bacteria 1685
160 Ga0068862_100370799 3300005844 Bacteria 1333
161 Ga0081455_10059299 3300005937 Bacteria 3232
162 Ga0081455_10097017 3300005937 Bacteria 2376
163 Ga0081538_10025935 3300005981 Bacteria 4117
164 Ga0081540_1029113 3300005983 Bacteria 3085
165 Ga0075365_10065192 3300006038 Bacteria 2441
166 Ga0075369_10024761 3300006186 Bacteria 2490
167 Ga0068871_100199051 3300006358 Bacteria 1729
168 Ga0075430_100155278 3300006846 Bacteria 1905
169 Ga0075434_100338023 3300006871 Bacteria 1526
170 Ga0075429_100237943 3300006880 Bacteria 1595
171 Ga0068865_100166182 3300006881 Bacteria 1687
172 Ga0075436_100037047 3300006914 Bacteria 3367
173 Ga0075435_100215460 3300007076 Bacteria 1630
174 Ga0099794_10066792 3300007265 Bacteria 1755
175 Ga0105251_10028297 3300009011 Bacteria 2833
176 Ga0105251_10088488 3300009011 Bacteria 1425
177 Ga0105250_10041120 3300009092 Bacteria 1854
178 Ga0105240_10000308 3300009093 Bacteria 94340
179 Ga0105240_10266717 3300009093 Bacteria 1973
180 Ga0105240_10295080 3300009093 Bacteria 1857
181 Ga0105240_10459403 3300009093 Bacteria 1423
182 Ga0105245_10109986 3300009098 Bacteria 2562
183 Ga0105245_10282682 3300009098 Bacteria 1622
184 Ga0105245_10286936 3300009098 Bacteria 1611
185 Ga0105247_10118728 3300009101 Bacteria 1711
186 Ga0105247_10150533 3300009101 Bacteria 1533
187 Ga0105241_10222877 3300009174 Bacteria 1586
188 Ga0105241_10282350 3300009174 Bacteria 1418
189 Ga0105242_10116637 3300009176 Bacteria 2284
190 Ga0105248_10066968 3300009177 Bacteria 4032
191 Ga0105248_10102143 3300009177 Bacteria 3232
192 Ga0105248_10416183 3300009177 Bacteria 1513
193 Ga0105237_10000931 3300009545 Bacteria 39411
194 Ga0105237_10305888 3300009545 Bacteria 1593
195 Ga0105237_10377046 3300009545 Bacteria 1423
196 Ga0105237_10377990 3300009545 Bacteria 1421
197 Ga0105238_10033243 3300009551 Bacteria 5249
198 Ga0105238_10175469 3300009551 Bacteria 2120
199 Ga0105238_10370664 3300009551 Bacteria 1422
200 Ga0105249_10029672 3300009553 Bacteria 4940
201 Ga0105249_10047410 3300009553 Bacteria 3916
202 Ga0105249_10135759 3300009553 Bacteria 2353
203 Ga0105249_10155248 3300009553 Bacteria 2207
204 Ga0105249_10176321 3300009553 Bacteria 2076
205 Ga0105239_10000535 3300010375 Bacteria 55025
206 Ga0105239_10340666 3300010375 Bacteria 1692
207 Ga0105239_10405500 3300010375 Bacteria 1543
208 Ga0105239_10476291 3300010375 Bacteria 1418
209 Ga0105246_10032799 3300011119 Bacteria 3447
210 Ga0105246_10113862 3300011119 Bacteria 1992
211 Ga0105246_10148400 3300011119 Bacteria 1772
212 Ga0105246_10254240 3300011119 Bacteria 1396
213 Ga0157346_1000434 3300012480 Bacteria 1771
214 Ga0157326_1003224 3300012513 Bacteria 1723
215 Ga0157373_10057003 3300013100 Bacteria 2772
216 Ga0157373_10188625 3300013100 Bacteria 1453
217 Ga0157371_10057231 3300013102 Bacteria 2765
218 Ga0157371_10113596 3300013102 Bacteria 1923
219 Ga0157371_10207790 3300013102 Bacteria 1404
220 Ga0157370_10000481 3300013104 Bacteria 49689
221 Ga0157370_10184762 3300013104 Bacteria 1936
222 Ga0157369_10304516 3300013105 Bacteria 1657
223 Ga0157374_10305477 3300013296 Bacteria 1574
224 Ga0157378_10143919 3300013297 Bacteria 2216
225 Ga0163162_10206598 3300013306 Bacteria 2093
226 Ga0163162_10336394 3300013306 Bacteria 1642
227 Ga0157372_10255388 3300013307 Bacteria 2035
228 Ga0157372_10549251 3300013307 Bacteria 1347
229 Ga0157380_10097019 3300014326 Bacteria 2445
230 Ga0157380_10278421 3300014326 Bacteria 1529
231 Ga0157380_10324302 3300014326 Bacteria 1429
232 Ga0182008_10064832 3300014497 Bacteria 1798
233 Ga0157377_10068544 3300014745 Bacteria 2044
234 Ga0157379_10063705 3300014968 Bacteria 3295
235 Ga0157379_10164985 3300014968 Bacteria 1999
236 Ga0157376_10145642 3300014969 Bacteria 2130
237 Ga0157376_10251513 3300014969 Bacteria 1651
238 Ga0182007_10002448 3300015262 Bacteria 9223
239 Ga0163161_10110263 3300017792 Bacteria 2057
240 Ga0163161_10223205 3300017792 Bacteria 1460
241 Ga0213874_10026637 3300021377 Bacteria 1638
242 Ga0213876_10039350 3300021384 Bacteria 2497
243 Ga0213876_10061079 3300021384 Bacteria 1988
244 Ga0213875_10035242 3300021388 Bacteria 2361
245 Ga0213875_10091052 3300021388 Bacteria 1422
246 Ga0213871_10021369 3300021441 Bacteria 1612
247 Ga0228598_1017406 3300024227 Bacteria 1418
248 Ga0207672_1001902 3300025223 Bacteria 1388
249 Ga0209437_102208 3300025233 Bacteria 3868
250 Ga0209646_1003033 3300025246 Bacteria 3448
251 Ga0209677_100188 3300025253 Bacteria 50341
252 Ga0209677_111076 3300025253 Bacteria 1440
253 Ga0209233_1023826 3300025261 Bacteria 1542
254 Ga0209233_1026373 3300025261 Bacteria 1422
255 Ga0207666_1004706 3300025271 Bacteria 1720
256 Ga0209673_1020412 3300025273 Bacteria 2347
257 Ga0207673_1002108 3300025290 Bacteria 2235
258 Ga0209675_1017841 3300025291 Bacteria 2010
259 Ga0209564_1009330 3300025295 Bacteria 4687
260 Ga0209256_1018117 3300025299 Bacteria 2306
261 Ga0207697_10018927 3300025315 Bacteria 2822
262 Ga0207656_10019888 3300025321 Bacteria 2660
263 Ga0207656_10026497 3300025321 Bacteria 2364
264 Ga0207656_10081977 3300025321 Bacteria 1451
265 Ga0207696_1031544 3300025711 Bacteria 1602
266 Ga0207655_1064872 3300025728 Bacteria 1390
267 Ga0207713_1008718 3300025735 Bacteria 5791
268 Ga0207713_1060450 3300025735 Bacteria 1448
269 Ga0207682_10008521 3300025893 Bacteria 4052
270 Ga0207642_10065310 3300025899 Bacteria 1709
271 Ga0207642_10078292 3300025899 Bacteria 1597
272 Ga0207642_10113707 3300025899 Bacteria 1383
273 Ga0207710_10032775 3300025900 Bacteria 2277
274 Ga0207688_10018361 3300025901 Bacteria 3806
275 Ga0207688_10034576 3300025901 Bacteria 2799
276 Ga0207688_10091350 3300025901 Bacteria 1749
277 Ga0207680_10176474 3300025903 Bacteria 1442
278 Ga0207647_10013300 3300025904 Bacteria 5710
279 Ga0207647_10044628 3300025904 Bacteria 2768
280 Ga0207647_10100121 3300025904 Bacteria 1720
281 Ga0207685_10069084 3300025905 Bacteria 1426
282 Ga0207645_10046984 3300025907 Bacteria 2757
283 Ga0207645_10064768 3300025907 Bacteria 2335
284 Ga0207643_10120175 3300025908 Bacteria 1556
285 Ga0207705_10010107 3300025909 Bacteria 6870
286 Ga0207684_10121641 3300025910 Bacteria 2238
287 Ga0207654_10004912 3300025911 Bacteria 6770
288 Ga0207654_10150907 3300025911 Bacteria 1491
289 Ga0207654_10167603 3300025911 Bacteria 1424
290 Ga0207695_10269459 3300025913 Bacteria 1599
291 Ga0207695_10326818 3300025913 Bacteria 1423
292 Ga0207695_10364776 3300025913 Bacteria 1331
293 Ga0207671_10006891 3300025914 Bacteria 10027
294 Ga0207671_10014260 3300025914 Bacteria 6289
295 Ga0207671_10239936 3300025914 Bacteria 1424
296 Ga0207671_10242248 3300025914 Bacteria 1417
297 Ga0207660_10232043 3300025917 Bacteria 1451
298 Ga0207662_10013371 3300025918 Bacteria 4590
299 Ga0207662_10057318 3300025918 Bacteria 2328
300 Ga0207657_10006357 3300025919 Bacteria 12272
301 Ga0207657_10067535 3300025919 Bacteria 3040
302 Ga0207649_10028417 3300025920 Bacteria 3292
303 Ga0207649_10039631 3300025920 Bacteria 2858
304 Ga0207649_10150955 3300025920 Bacteria 1600
305 Ga0207681_10151217 3300025923 Bacteria 1740
306 Ga0207681_10214187 3300025923 Bacteria 1486
307 Ga0207681_10233510 3300025923 Bacteria 1428
308 Ga0207694_10009301 3300025924 Bacteria 7416
309 Ga0207694_10239001 3300025924 Bacteria 1484
310 Ga0207694_10261335 3300025924 Bacteria 1418
311 Ga0207650_10094429 3300025925 Bacteria 2291
312 Ga0207650_10248628 3300025925 Bacteria 1439
313 Ga0207659_10212501 3300025926 Bacteria 1551
314 Ga0207659_10237755 3300025926 Bacteria 1472
315 Ga0207687_10175879 3300025927 Bacteria 1655
316 Ga0207644_10176541 3300025931 Bacteria 1671
317 Ga0207644_10293787 3300025931 Bacteria 1307
318 Ga0207690_10057463 3300025932 Bacteria 2628
319 Ga0207706_10051587 3300025933 Bacteria 3632
320 Ga0207706_10052391 3300025933 Bacteria 3603
321 Ga0207706_10052960 3300025933 Bacteria 3583
322 Ga0207706_10062748 3300025933 Bacteria 3272
323 Ga0207706_10087799 3300025933 Bacteria 2735
324 Ga0207686_10194181 3300025934 Bacteria 1449
325 Ga0207709_10175405 3300025935 Bacteria 1509
326 Ga0207709_10195720 3300025935 Bacteria 1440
327 Ga0207669_10204042 3300025937 Bacteria 1437
328 Ga0207704_10063944 3300025938 Bacteria 2296
329 Ga0207665_10101688 3300025939 Bacteria 2007
330 Ga0207691_10121420 3300025940 Bacteria 2315
331 Ga0207691_10145990 3300025940 Bacteria 2082
332 Ga0207711_10073795 3300025941 Bacteria 2966
333 Ga0207711_10292412 3300025941 Bacteria 1502
334 Ga0207689_10035246 3300025942 Bacteria 4158
335 Ga0207689_10067675 3300025942 Bacteria 2935
336 Ga0207689_10068141 3300025942 Bacteria 2925
337 Ga0207661_10271556 3300025944 Bacteria 1513
338 Ga0207661_10287175 3300025944 Bacteria 1471
339 Ga0207679_10242350 3300025945 Bacteria 1528
340 Ga0207667_10004045 3300025949 Bacteria 18017
341 Ga0207667_10319500 3300025949 Bacteria 1586
342 Ga0207667_10406565 3300025949 Bacteria 1386
343 Ga0207651_10217384 3300025960 Bacteria 1542
344 Ga0207712_10017722 3300025961 Bacteria 4629
345 Ga0207712_10155207 3300025961 Bacteria 1772
346 Ga0207712_10191246 3300025961 Bacteria 1616
347 Ga0207712_10196062 3300025961 Bacteria 1598
348 Ga0207712_10241668 3300025961 Bacteria 1455
349 Ga0207668_10236841 3300025972 Bacteria 1474
350 Ga0207668_10248053 3300025972 Bacteria 1444
351 Ga0207668_10251502 3300025972 Bacteria 1435
352 Ga0207640_10016415 3300025981 Bacteria 4307
353 Ga0207640_10057504 3300025981 Bacteria 2558
354 Ga0207640_10208569 3300025981 Bacteria 1487
355 Ga0207640_10214025 3300025981 Bacteria 1470
356 Ga0207640_10218912 3300025981 Bacteria 1456
357 Ga0207658_10184405 3300025986 Bacteria 1729
358 Ga0207658_10242884 3300025986 Bacteria 1526
359 Ga0207677_10077830 3300026023 Bacteria 2366
360 Ga0207677_10091831 3300026023 Bacteria 2209
361 Ga0207677_10253259 3300026023 Bacteria 1431
362 Ga0207703_10280410 3300026035 Bacteria 1513
363 Ga0207703_10303758 3300026035 Bacteria 1456
364 Ga0207639_10012416 3300026041 Bacteria 5930
365 Ga0207639_10102542 3300026041 Bacteria 2316
366 Ga0207639_10240596 3300026041 Bacteria 1573
367 Ga0207639_10270885 3300026041 Bacteria 1489
368 Ga0207678_10016055 3300026067 Bacteria 6576
369 Ga0207678_10044268 3300026067 Bacteria 3850
370 Ga0207678_10059527 3300026067 Bacteria 3286
371 Ga0207678_10064579 3300026067 Bacteria 3145
372 Ga0207678_10109189 3300026067 Bacteria 2360
373 Ga0207678_10219621 3300026067 Bacteria 1627
374 Ga0207708_10045868 3300026075 Bacteria 3331
375 Ga0207708_10053639 3300026075 Bacteria 3072
376 Ga0207708_10082010 3300026075 Bacteria 2479
377 Ga0207708_10113657 3300026075 Bacteria 2104
378 Ga0207702_10074173 3300026078 Bacteria 2936
379 Ga0207702_10329893 3300026078 Bacteria 1455
380 Ga0207702_10345511 3300026078 Bacteria 1422
381 Ga0207641_10294581 3300026088 Bacteria 1530
382 Ga0207641_10320114 3300026088 Bacteria 1470
383 Ga0207648_10129458 3300026089 Bacteria 2221
384 Ga0207648_10146339 3300026089 Bacteria 2084
385 Ga0207676_10141604 3300026095 Bacteria 2059
386 Ga0207676_10246588 3300026095 Bacteria 1605
387 Ga0207676_10252292 3300026095 Bacteria 1589
388 Ga0207674_10004418 3300026116 Bacteria 16920
389 Ga0207674_10034570 3300026116 Bacteria 5281
390 Ga0207674_10271371 3300026116 Bacteria 1644
391 Ga0207683_10076955 3300026121 Bacteria 2954
392 Ga0207683_10141143 3300026121 Bacteria 2171
393 Ga0207683_10216598 3300026121 Bacteria 1744
394 Ga0207698_10003339 3300026142 Bacteria 9657
395 Ga0207698_10051504 3300026142 Bacteria 3148
396 Ga0207698_10065520 3300026142 Bacteria 2854
397 Ga0207698_10334838 3300026142 Bacteria 1423
398 Ga0207428_10207642 3300027907 Bacteria 1473
399 Ga0268266_10183783 3300028379 Bacteria 1905
400 Ga0268266_10242374 3300028379 Bacteria 1664
401 Ga0268265_10254523 3300028380 Bacteria 1557
402 Ga0268265_10294379 3300028380 Bacteria 1458
403 Ga0268264_10121962 3300028381 Bacteria 2298
404 Ga0268264_10308467 3300028381 Bacteria 1492
405 Ga0268264_10384610 3300028381 Bacteria 1344
406 Ga0307517_10158121 3300028786 Bacteria 1530
407 Ga0307517_10162880 3300028786 Bacteria 1491
408 Ga0307515_10238113 3300028794 Bacteria 1597
409 Ga0307515_10261552 3300028794 Bacteria 1466
410 Ga0307512_10078909 3300030522 Bacteria 2381
411 Ga0307513_10225373 3300031456 Bacteria 1692
412 Ga0307509_10262469 3300031507 Bacteria 1501
413 Ga0307408_100247957 3300031548 Bacteria 1467
414 Ga0307408_100314248 3300031548 Bacteria 1317
415 Ga0316575_10010037 3300031665 Bacteria 3472
416 Ga0316575_10054395 3300031665 Bacteria 1594
417 Ga0316579_10059565 3300031691 Bacteria 1794
418 Ga0316579_10088354 3300031691 Bacteria 1479
419 Ga0316576_10050140 3300031727 Bacteria 3034
420 Ga0316578_10030994 3300031728 Bacteria 3043
421 Ga0307516_10257976 3300031730 Bacteria 1434
422 Ga0307405_10056244 3300031731 Bacteria 2466
423 Ga0307405_10086883 3300031731 Bacteria 2059
424 Ga0307405_10136463 3300031731 Bacteria 1704
425 Ga0316577_10042126 3300031733 Bacteria 2554
426 Ga0307413_10057187 3300031824 Bacteria 2383
427 Ga0307410_10216579 3300031852 Bacteria 1470
428 Ga0307410_10224597 3300031852 Bacteria 1446
429 Ga0307406_10143715 3300031901 Bacteria 1692
430 Ga0307407_10044636 3300031903 Bacteria 2499
431 Ga0307407_10160545 3300031903 Bacteria 1470
432 Ga0307412_10143976 3300031911 Bacteria 1749
433 Ga0307412_10177747 3300031911 Bacteria 1597
434 Ga0307412_10283114 3300031911 Bacteria 1302
435 Ga0307409_100280983 3300031995 Bacteria 1538
436 Ga0307409_100304378 3300031995 Bacteria 1484
437 Ga0307416_100256260 3300032002 Bacteria 1706
438 Ga0307416_100288686 3300032002 Bacteria 1622
439 Ga0307416_100314051 3300032002 Bacteria 1565
440 Ga0307414_10100285 3300032004 Bacteria 2177
441 Ga0307414_10206720 3300032004 Bacteria 1601
442 Ga0307414_10234584 3300032004 Bacteria 1515
443 Ga0307411_10098287 3300032005 Bacteria 2062
444 Ga0307415_100229999 3300032126 Bacteria 1492
445 Ga0307415_100238026 3300032126 Bacteria 1470
446 Ga0316583_10013438 3300032133 Bacteria 2954
447 Ga0316583_10024088 3300032133 Bacteria 2173
448 Ga0316583_10044883 3300032133 Bacteria 1561
449 Ga0316585_10017297 3300032137 Bacteria 2179
450 Ga0316580_10005200 3300032139 Bacteria 3788
451 Ga0307510_10229246 3300033180 Bacteria 1361
452 Ga0373930_0010223 3300034816 Bacteria 1673
453 Ga0373948_0002181 3300034817 Bacteria 2855
454 Ga0373950_0009520 3300034818 Bacteria 1553
455 Ga0373950_0012048 3300034818 Bacteria 1422
456 Ga0373958_0011236 3300034819 Bacteria 1509
457 Ga0373959_0003787 3300034820 Bacteria 2422
458 Ga0373938_0015854 3300034957 Bacteria 1465
459 Ga0373926_0049853 3300035083 Bacteria 1508
460 Ga0373928_0005341 3300035084 Bacteria 2454
461 Ga0373928_0006474 3300035084 Bacteria 2251
462 Ga0373934_0062852 3300035086 Bacteria 1480
463 Ga0373940_0015337 3300035088 Bacteria 1883
464 Ga0373940_0028238 3300035088 Bacteria 1479
465 Ga0373944_0012435 3300035089 Bacteria 2345
466 Ga0373949_0004601 3300035090 Bacteria 3144
467 Ga0373923_0015651 3300035111 Bacteria 2867
468 Ga0373923_0025794 3300035111 Bacteria 2332
469 Ga0373936_0020407 3300035113 Bacteria 2574
470 Ga0373936_0070207 3300035113 Bacteria 1442
471 Ga0373939_0028664 3300035114 Bacteria 1586
472 Ga0373941_0009046 3300035115 Bacteria 2496
473 Ga0373941_0010267 3300035115 Bacteria 2386
474 Ga0373945_0046229 3300035116 Bacteria 1587
475 Ga0373953_0044256 3300035117 Bacteria 1779
476 Ga0373953_0063118 3300035117 Bacteria 1517
477 Ga0373954_0089071 3300035118 Bacteria 1480
478 Ga0373954_0089587 3300035118 Bacteria 1476
479 Ga0373956_0036984 3300035119 Bacteria 2156
480 Ga0373956_0067958 3300035119 Bacteria 1622
481 Ga0373957_0018967 3300035120 Bacteria 2414
482 Ga0373957_0043032 3300035120 Bacteria 1705
483 Ga0373943_0039207 3300035170 Bacteria 2281
484 Ga0373946_0045710 3300035171 Bacteria 1812
485 Ga0373946_0072989 3300035171 Bacteria 1486
486 Ga0373955_0108375 3300035172 Bacteria 1603
487 Ga0373955_0114869 3300035172 Bacteria 1559
488 Ga0373942_0012635 3300035207 Bacteria 2021
489 Ga0373942_0014057 3300035207 Bacteria 1932
490 Ga0373942_0027947 3300035207 Bacteria 1471
491 Ga0373961_0021039 3300035241 Bacteria 1731
492 Ga0373962_0030931 3300035242 Bacteria 1466
493 Ga0316574_0031946 3300035398 Bacteria 3196
494 Ga0373924_0014650 3300035410 Bacteria 2965
495 Ga0373924_0070424 3300035410 Bacteria 1474
496 Ga0373931_0008147 3300035691 Bacteria 4964
497 Ga0373931_0041894 3300035691 Bacteria 2406
498 Ga0373931_0042527 3300035691 Bacteria 2389
499 Ga0373935_0037418 3300035692 Bacteria 3036
500 Ga0373935_0092120 3300035692 Bacteria 1985
501 Ga0373935_0171448 3300035692 Bacteria 1484
502 Ga0373927_0092326 3300035695 Bacteria 1966
503 Ga0373933_0113942 3300035724 Bacteria 1688
504 Ga0373933_0135460 3300035724 Bacteria 1551
505 Ga0373947_0110499 3300035725 Bacteria 1736
506 Ga0373947_0176269 3300035725 Bacteria 1389
507 Ga0373937_0283911 3300036401 Bacteria 1563
508 Ga0316582_0015441 3300036647 Bacteria 4368
509 Ga0316582_0061508 3300036647 Bacteria 2408
510 Ga0316584_0016275 3300036712 Bacteria 5331
511 Ga0373925_0092348 3300037068 Bacteria 2315
512 Ga0373925_0226506 3300037068 Bacteria 1493
513 Ga0373925_0245852 3300037068 Bacteria 1434
514 Ga0395899_0163493 3300037312 Bacteria 1571
515 Ga0395898_0252085 3300037466 Bacteria 1683
516 Ga0395898_0317804 3300037466 Bacteria 1485
517 Ga0316581_0012173 3300037588 Bacteria 2418
518 Ga0316581_0034990 3300037588 Bacteria 1521
519 Ga0436364_0200835 3300037853 Bacteria 3219
520 Ga0436364_1218439 3300037853 Bacteria 1757
521 Ga0436364_1239479 3300037853 Bacteria 2184
522 Ga0436365_0422968 3300039437 Bacteria 1890
523 Ga0436360_0084886 3300039438 Bacteria 2542
524 Ga0436360_0148117 3300039438 Bacteria 3286
525 Ga0436360_0894651 3300039438 Bacteria 1623
526 Ga0436363_0261507 3300039450 Bacteria 4213
527 Ga0436363_0277506 3300039450 Bacteria 1696
528 Ga0436363_1149058 3300039450 Bacteria 7197
529 Ga0436363_1611071 3300039450 Bacteria 1554
530 Ga0439436_0023562 3300041404 Bacteria 1820
531 Ga0439438_029343 3300041405 Bacteria 1472
532 Ga0439439_0007978 3300041406 Bacteria 2488
533 Ga0439439_0013190 3300041406 Bacteria 2002
534 Ga0439461_0018148 3300041410 Bacteria 1374
535 Ga0439466_0012851 3300041411 Bacteria 3071
536 Ga0439466_0023393 3300041411 Bacteria 2173
537 Ga0439465_0023758 3300041413 Bacteria 1930
538 Ga0439465_0026088 3300041413 Bacteria 1846
539 Ga0439431_0007448 3300041997 Bacteria 2441
540 Ga0439433_0007590 3300041999 Bacteria 2344
541 Ga0439442_004918 3300042002 Bacteria 2662
542 Ga0439445_0011925 3300042004 Bacteria 2079
543 Ga0439432_019040 3300042006 Bacteria 2290
544 Ga0439432_032108 3300042006 Bacteria 1695
545 Ga0439449_0015464 3300042007 Bacteria 2867
546 Ga0439449_0036471 3300042007 Bacteria 1829
547 Ga0439450_023567 3300042008 Bacteria 1336
548 Ga0439452_026401 3300042010 Bacteria 1465
549 Ga0439457_007919 3300042014 Bacteria 2525
550 Ga0439462_0003810 3300042015 Bacteria 3639
551 Ga0439462_0008518 3300042015 Bacteria 2588
552 Ga0439434_0006142 3300042435 Bacteria 3501
553 Ga0439460_0018984 3300042461 Bacteria 1857
554 Ga0466966_0132662 3300044684 Bacteria 1524
555 Ga0466961_0111097 3300044693 Bacteria 1724
556 Ga0466963_0167964 3300044694 Bacteria 1528
557 Ga0466963_0213314 3300044694 Bacteria 1351
558 Ga0466971_0051724 3300044719 Bacteria 1849
559 Ga0466968_0027291 3300044735 Bacteria 2349
560 Ga0466968_0027393 3300044735 Bacteria 2345
561 Ga0466957_0041443 3300044842 Bacteria 2784
562 Ga0466957_0111884 3300044842 Bacteria 1732
563 Ga0466960_0085078 3300044901 Bacteria 1601
564 Ga0466960_0108304 3300044901 Bacteria 1440
565 Ga0466959_0145808 3300045049 Bacteria 1670
566 Ga0466958_0047629 3300045836 Bacteria 2588
567 Ga0466958_0080462 3300045836 Bacteria 2004
568 Ga0466967_0105079 3300045976 Bacteria 2587
569 Ga0466967_0175043 3300045976 Bacteria 2021
570 Ga0466967_0214140 3300045976 Bacteria 1828
571 Ga0466967_0454943 3300045976 Bacteria 1251
572 Ga0495617_026608 3300046452 Bacteria 1948
573 Ga0495627_015591 3300046453 Bacteria 2620
574 Ga0495627_040731 3300046453 Bacteria 1429
575 Ga0495592_0074302 3300046454 Bacteria 2469
576 Ga0495592_0173871 3300046454 Bacteria 1472
577 Ga0495603_0046950 3300046455 Bacteria 2572
578 Ga0495629_0121008 3300046459 Bacteria 1823
579 Ga0495629_0161252 3300046459 Bacteria 1557
580 Ga0495638_0093551 3300046460 Bacteria 1807
581 Ga0495641_0025950 3300046461 Bacteria 2868
582 Ga0495651_0077744 3300046462 Bacteria 2511
583 Ga0495653_0042189 3300046463 Bacteria 3555
584 Ga0495653_0075850 3300046463 Bacteria 2501
585 Ga0495653_0152584 3300046463 Bacteria 1612
586 Ga0495653_0164620 3300046463 Bacteria 1536
587 Ga0495650_0033554 3300046471 Bacteria 2283
588 Ga0495580_0096547 3300046472 Bacteria 2055
589 Ga0495580_0148277 3300046472 Bacteria 1625
590 Ga0495582_0055659 3300046473 Bacteria 2180
591 Ga0495582_0121551 3300046473 Bacteria 1471
592 Ga0495639_0022652 3300046475 Bacteria 2756
593 Ga0495639_0034799 3300046475 Bacteria 2253
594 Ga0495662_0033868 3300046476 Bacteria 2467
595 Ga0495662_0036992 3300046476 Bacteria 2356
596 Ga0495664_0030006 3300046477 Bacteria 3183
597 Ga0495664_0118222 3300046477 Bacteria 1602
598 Ga0495585_0085287 3300046492 Bacteria 1707
599 Ga0495594_0126442 3300046499 Bacteria 1446
600 Ga0495606_0136304 3300046507 Bacteria 1453
601 Ga0495608_0058694 3300046511 Bacteria 2536
602 Ga0495610_0022436 3300046512 Bacteria 3453
603 Ga0495620_0053656 3300046515 Bacteria 1706
604 Ga0495628_0082475 3300046516 Bacteria 2497
605 Ga0495628_0169762 3300046516 Bacteria 1654
606 Ga0495630_0056928 3300046517 Bacteria 2929
607 Ga0495630_0089703 3300046517 Bacteria 2322
608 Ga0495631_0038480 3300046518 Bacteria 2126
609 Ga0495632_0000197 3300046519 Bacteria 61171
610 Ga0495643_0001792 3300046522 Bacteria 18380
611 Ga0495643_0029016 3300046522 Bacteria 3097
612 Ga0495643_0081049 3300046522 Bacteria 1688
613 Ga0495644_0046480 3300046523 Bacteria 1631
614 Ga0495644_0063299 3300046523 Bacteria 1390
615 Ga0495648_0031243 3300046524 Bacteria 3509
616 Ga0495648_0080148 3300046524 Bacteria 1861
617 Ga0495666_0026364 3300046526 Bacteria 2865
618 Ga0495652_0121963 3300046529 Bacteria 2077
619 Ga0495652_0156056 3300046529 Bacteria 1777
620 Ga0495652_0207471 3300046529 Bacteria 1482
621 Ga0495665_0098671 3300046531 Bacteria 1533
622 Ga0495665_0118812 3300046531 Bacteria 1385
623 Ga0495640_0064393 3300046533 Bacteria 2479
624 Ga0495587_0049964 3300046536 Bacteria 2474
625 Ga0495598_0017047 3300046537 Bacteria 1866
626 Ga0495645_0042142 3300046543 Bacteria 3328
627 Ga0495622_0049263 3300046557 Bacteria 1955
628 Ga0495622_0078687 3300046557 Bacteria 1518
629 Ga0495667_0146909 3300046559 Bacteria 1518
630 Ga0495667_0159799 3300046559 Bacteria 1449
631 Ga0495634_0137675 3300046642 Bacteria 1552
632 Ga0495611_0085065 3300046648 Bacteria 1458
633 Ga0495611_0085153 3300046648 Bacteria 1457
634 Ga0495625_0071534 3300046660 Bacteria 2434
635 Ga0495625_0137776 3300046660 Bacteria 1648
636 Ga0495635_0044022 3300046663 Bacteria 3079
637 Ga0495635_0101179 3300046663 Bacteria 1969
638 Ga0495635_0154080 3300046663 Bacteria 1564
639 Ga0495659_0013897 3300046664 Bacteria 2627
640 Ga0495659_0050684 3300046664 Bacteria 1510
641 Ga0495588_0017251 3300046674 Bacteria 3501
642 Ga0495588_0044169 3300046674 Bacteria 2281
643 Ga0495657_0034436 3300046675 Bacteria 3517
644 Ga0495657_0089375 3300046675 Bacteria 1979
645 Ga0495657_0152955 3300046675 Bacteria 1431
646 Ga0495599_0049369 3300046678 Bacteria 2637
647 Ga0495646_0116768 3300046680 Bacteria 1513
648 Ga0495647_0033369 3300046681 Bacteria 1923
649 Ga0495647_0061842 3300046681 Bacteria 1479
650 Ga0495658_0052601 3300046683 Bacteria 2310
651 Ga0495658_0083019 3300046683 Bacteria 1883
652 Ga0495669_0000800 3300046684 Bacteria 13438
653 Ga0495669_0031310 3300046684 Bacteria 2336
654 Ga0495613_0184921 3300046689 Bacteria 1474
655 Ga0495613_0190992 3300046689 Bacteria 1447
656 Ga0495624_0061056 3300046690 Bacteria 2362
657 Ga0495624_0123652 3300046690 Bacteria 1588
658 Ga0495670_0084117 3300046691 Bacteria 1623
659 Ga0495670_0105787 3300046691 Bacteria 1453
660 Ga0495671_0029158 3300046692 Bacteria 2836
661 Ga0495600_0092576 3300046809 Bacteria 1972
662 Ga0495600_0122604 3300046809 Bacteria 1690
663 Ga0495600_0131858 3300046809 Bacteria 1624
664 Ga0495600_0139002 3300046809 Bacteria 1576
665 Ga0495660_0101557 3300046810 Bacteria 1480
666 Ga0495581_0103120 3300047315 Bacteria 1657
667 Ga0495604_0165521 3300047317 Bacteria 1559
668 Ga0495674_0107142 3300047319 Bacteria 2372
669 Ga0495674_0109700 3300047319 Bacteria 2340
670 Ga0495676_0084880 3300047321 Bacteria 2387
671 Ga0495676_0101013 3300047321 Bacteria 2134
672 Ga0495676_0208588 3300047321 Bacteria 1353
673 Ga0495680_0083539 3300047322 Bacteria 2407
674 Ga0495680_0148507 3300047322 Bacteria 1710
675 Ga0495680_0176318 3300047322 Bacteria 1545
676 Ga0495687_060558 3300047443 Bacteria 1561
677 Ga0495687_064363 3300047443 Bacteria 1497
678 Ga0495675_0127018 3300047444 Bacteria 1586
679 Ga0495675_0147534 3300047444 Bacteria 1455
680 Ga0495673_0059141 3300047469 Bacteria 1648
681 Ga0495681_0073090 3300047470 Bacteria 1549
682 Ga0495684_0053308 3300047471 Bacteria 3086
683 Ga0495684_0076602 3300047471 Bacteria 2540
684 Ga0495684_0194384 3300047471 Bacteria 1498
685 Ga0495686_0140956 3300047472 Bacteria 1422
686 Ga0495593_0042093 3300047673 Bacteria 2453
687 Ga0495593_0071503 3300047673 Bacteria 1801
688 Ga0495602_0198497 3300048088 Bacteria 1532
689 Ga0495602_0230358 3300048088 Bacteria 1392
690 Ga0495614_0028999 3300048089 Bacteria 2382
691 Ga0495615_0003431 3300048090 Bacteria 2654
692 Ga0496100_0132809 3300048903 Bacteria 1755
693 Ga0496100_0173304 3300048903 Bacteria 1555
694 Ga0496101_0044356 3300048904 Bacteria 3182
695 Ga0496101_0053700 3300048904 Bacteria 2908
696 Ga0496101_0081595 3300048904 Bacteria 2392
697 Ga0496102_0000922 3300048905 Bacteria 27690
698 Ga0496102_0130010 3300048905 Bacteria 2356
699 Ga0496102_0190555 3300048905 Bacteria 1932
700 Ga0496102_0253713 3300048905 Bacteria 1658
701 Ga0496103_0015879 3300048906 Bacteria 4489
702 Ga0496103_0059647 3300048906 Bacteria 2370
703 Ga0496103_0178256 3300048906 Bacteria 1365
704 Ga0496105_0164027 3300048908 Bacteria 1823
705 Ga0496106_0082465 3300048909 Bacteria 2471
706 Ga0496106_0086902 3300048909 Bacteria 2409
707 Ga0496106_0087230 3300048909 Bacteria 2404
708 Ga0496106_0207260 3300048909 Bacteria 1561
709 Ga0496106_0240782 3300048909 Bacteria 1445
710 Ga0496107_0065729 3300048910 Bacteria 2630
711 Ga0496107_0166280 3300048910 Bacteria 1635
712 Ga0496108_0228807 3300048911 Bacteria 1616
713 Ga0496108_0239393 3300048911 Bacteria 1578
714 Ga0496109_0128465 3300048912 Bacteria 2364
715 Ga0496109_0175049 3300048912 Bacteria 2014
716 Ga0496109_0222178 3300048912 Bacteria 1776
717 Ga0496109_0284131 3300048912 Bacteria 1559
718 Ga0496110_0048354 3300048913 Bacteria 3728
719 Ga0496110_0310775 3300048913 Bacteria 1435
720 Ga0496111_0158576 3300048914 Bacteria 1679
721 Ga0496111_0193391 3300048914 Bacteria 1512
722 Ga0496112_0160912 3300048915 Bacteria 2211
723 Ga0496112_0365930 3300048915 Bacteria 1383
724 Ga0496113_0088035 3300048916 Bacteria 2388
725 Ga0496113_0175436 3300048916 Bacteria 1698
726 Ga0496114_0154733 3300048917 Bacteria 1990
727 Ga0496114_0225302 3300048917 Bacteria 1646
728 Ga0496114_0230409 3300048917 Bacteria 1627
729 Ga0496115_0256244 3300048918 Bacteria 1439
730 Ga0496115_0258769 3300048918 Bacteria 1431
731 Ga0496117_0114862 3300048920 Bacteria 1667
732 Ga0496118_0001907 3300048921 Bacteria 29679
733 Ga0496118_0125911 3300048921 Bacteria 1658
734 Ga0496118_0138711 3300048921 Bacteria 1546
735 Ga0496120_0118214 3300048923 Bacteria 1374
736 Ga0496121_0049894 3300048924 Bacteria 3542
737 Ga0496121_0091682 3300048924 Bacteria 2371
738 Ga0496121_0156808 3300048924 Bacteria 1669
739 Ga0496122_0045753 3300048925 Bacteria 3397
740 Ga0496122_0076516 3300048925 Bacteria 2354
741 Ga0496124_0011484 3300048927 Bacteria 8849
742 Ga0496124_0099989 3300048927 Bacteria 2351
743 Ga0496124_0192395 3300048927 Bacteria 1559
744 Ga0496125_0027565 3300048928 Bacteria 5148
745 Ga0496125_0155316 3300048928 Bacteria 1564
746 Ga0496126_0156427 3300048929 Bacteria 1950
747 Ga0496126_0216133 3300048929 Bacteria 1612
748 Ga0496126_0231832 3300048929 Bacteria 1546
749 Ga0495682_0066457 3300049460 Bacteria 1300
750 Ga0501298_009010 3300049521 Bacteria 1688
751 Ga0501067_0124183 3300049583 Bacteria 1437
752 Ga0501069_0067935 3300049585 Bacteria 1994
753 Ga0501202_016120 3300049652 Bacteria 1446
754 Ga0501251_002082 3300049681 Bacteria 1913
755 Ga0501256_002896 3300049685 Bacteria 1392
756 Ga0501261_005675 3300049690 Bacteria 1575
757 Ga0501270_002546 3300049767 Bacteria 1878
758 Ga0501274_001853 3300049771 Bacteria 1627
759 Ga0501283_007359 3300049779 Bacteria 1565
760 Ga0501212_008581 3300049851 Bacteria 1424
761 nmdc:mga0yw44_55892_c1 3300050492 Bacteria 2402
762 nmdc:mga06z11_112326_c1 3300050494 Bacteria 1510
763 nmdc:mga09592_230577_c1 3300050508 Bacteria 1604
764 nmdc:mga0qj67_215564_c1 3300050509 Bacteria 1559
765 nmdc:mga06r32_346185_c1 3300050510 Bacteria 1471
766 nmdc:mga06r32_410551_c1 3300050510 Bacteria 1336
767 nmdc:mga08y16_367692_c1 3300050511 Bacteria 1476
768 nmdc:mga0n895_239331_c1 3300050512 Bacteria 1842
769 nmdc:mga0a205_278902_c1 3300050515 Bacteria 1547
770 Ga0495601_0061605 3300053077 Bacteria 2381
771 Ga0495601_0149888 3300053077 Bacteria 1522
772 Ga0495612_0018353 3300053078 Bacteria 2802
773 Ga0495612_0028499 3300053078 Bacteria 2248
774 Ga0495612_0051758 3300053078 Bacteria 1688
775 Ga0495595_0056635 3300053084 Bacteria 1827
776 Ga0495595_0058030 3300053084 Bacteria 1806
777 Ga0495595_0077883 3300053084 Bacteria 1575
778 Ga0495595_0097014 3300053084 Bacteria 1419
779 Ga0495619_0045573 3300053085 Bacteria 2881
780 Ga0495619_0068938 3300053085 Bacteria 2363
781 Ga0495619_0169054 3300053085 Bacteria 1511
782 Ga0500643_025450 3300053087 Bacteria 1866
783 Ga0500643_038715 3300053087 Bacteria 1412
784 Ga0500644_0007640 3300053088 Bacteria 2823
785 Ga0500646_0036700 3300053090 Bacteria 1366
786 Ga0500651_0117140 3300053093 Bacteria 1620
787 Ga0500650_0075685 3300053098 Bacteria 1573
788 Ga0500556_0055432 3300053104 Bacteria 1445
789 Ga0500557_006154 3300053105 Bacteria 2689
790 Ga0500569_030015 3300053109 Bacteria 1518
791 Ga0500572_009025 3300053111 Bacteria 2346
792 Ga0500607_045741 3300053121 Bacteria 2348
793 Ga0500614_006776 3300053123 Bacteria 2409
794 Ga0500621_061250 3300053126 Bacteria 1520
795 Ga0500623_070094 3300053127 Bacteria 1703
796 Ga0500642_0007763 3300053130 Bacteria 3624
797 Ga0500642_0083304 3300053130 Bacteria 1471
798 Ga0500655_014483 3300053133 Bacteria 1443
799 Ga0500577_0071150 3300053142 Bacteria 1364
800 Ga0500579_086417 3300053143 Bacteria 1720
801 Ga0500588_0021253 3300053146 Bacteria 1750
802 Ga0500589_029248 3300053147 Bacteria 2561
803 Ga0500590_000843 3300053148 Bacteria 11533
804 Ga0500616_0001524 3300053153 Bacteria 21828
805 Ga0500622_0041976 3300053156 Bacteria 2378
806 Ga0500622_0067414 3300053156 Bacteria 1815
807 Ga0500627_0020083 3300053158 Bacteria 2674
808 Ga0500611_006389 3300053727 Bacteria 1714
809 Ga0500611_009506 3300053727 Bacteria 1543
810 Ga0500656_002341 3300053732 Bacteria 1709
811 Ga0501084_0282406 3300054114 Bacteria 1402

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044901 Ga0466960_0108304 Ga0466960_0108304_170_1393 348
2 3300048910 Ga0496107_0065729 Ga0496107_0065729_371_1573 371
3 3300050510 nmdc:mga06r32_410551_c1 nmdc:mga06r32_410551_c1_105_1310 372
4 3300039438 Ga0436360_0894651 Ga0436360_0894651_216_1460 378
5 3300031731 Ga0307405_10136463 Ga0307405_101364632 381
6 3300032002 Ga0307416_100314051 Ga0307416_1003140511 381
7 3300005844 Ga0068862_100370799 Ga0068862_1003707992 383
8 3300044735 Ga0466968_0027393 Ga0466968_0027393_1000_2238 383
9 3300005547 Ga0070693_100174684 Ga0070693_1001746841 384
10 3300011119 Ga0105246_10113862 Ga0105246_101138622 384
11 3300026023 Ga0207677_10253259 Ga0207677_102532591 384
12 3300046507 Ga0495606_0136304 Ga0495606_0136304_63_1316 384
13 3300005338 Ga0068868_100188958 Ga0068868_1001889582 385
14 3300005347 Ga0070668_100169321 Ga0070668_1001693211 385
15 3300005356 Ga0070674_100108253 Ga0070674_1001082531 385
16 3300005367 Ga0070667_100214681 Ga0070667_1002146812 385
17 3300005436 Ga0070713_100279025 Ga0070713_1002790251 385
18 3300005456 Ga0070678_100166193 Ga0070678_1001661931 385
19 3300005544 Ga0070686_100166420 Ga0070686_1001664201 385
20 3300005718 Ga0068866_10094407 Ga0068866_100944072 385
21 3300005719 Ga0068861_100209678 Ga0068861_1002096782 385
22 3300006881 Ga0068865_100166182 Ga0068865_1001661821 385
23 3300009011 Ga0105251_10028297 Ga0105251_100282973 385
24 3300009101 Ga0105247_10150533 Ga0105247_101505331 385
25 3300009174 Ga0105241_10222877 Ga0105241_102228771 385
26 3300011119 Ga0105246_10254240 Ga0105246_102542401 385
27 3300013297 Ga0157378_10143919 Ga0157378_101439191 385
28 3300014968 Ga0157379_10164985 Ga0157379_101649852 385
29 3300014969 Ga0157376_10251513 Ga0157376_102515132 385
30 3300025735 Ga0207713_1060450 Ga0207713_10604501 385
31 3300025905 Ga0207685_10069084 Ga0207685_100690841 385
32 3300025911 Ga0207654_10150907 Ga0207654_101509071 385
33 3300025931 Ga0207644_10176541 Ga0207644_101765411 385
34 3300025933 Ga0207706_10062748 Ga0207706_100627481 385
35 3300026116 Ga0207674_10271371 Ga0207674_102713712 385
36 3300026121 Ga0207683_10216598 Ga0207683_102165981 385
37 3300048905 Ga0496102_0253713 Ga0496102_0253713_204_1415 385
38 3300048906 Ga0496103_0178256 Ga0496103_0178256_115_1326 385
39 3300048908 Ga0496105_0164027 Ga0496105_0164027_12_1193 385
40 3300048909 Ga0496106_0082465 Ga0496106_0082465_117_1328 385
41 3300048910 Ga0496107_0166280 Ga0496107_0166280_354_1565 385
42 3300048911 Ga0496108_0228807 Ga0496108_0228807_191_1372 385
43 3300048914 Ga0496111_0193391 Ga0496111_0193391_10_1191 385
44 3300048915 Ga0496112_0160912 Ga0496112_0160912_261_1442 385
45 3300048916 Ga0496113_0088035 Ga0496113_0088035_84_1265 385
46 3300048917 Ga0496114_0230409 Ga0496114_0230409_107_1318 385
47 3300048918 Ga0496115_0258769 Ga0496115_0258769_102_1313 385
48 iso_pu_bacteria 2842357229 2842362840 385
49 3300021441 Ga0213871_10021369 Ga0213871_100213691 386
50 iso_pu_bacteria 2617270742 2617386805 386
51 iso_pu_bacteria 2791355263 2793338925 386
52 3300006186 Ga0075369_10024761 Ga0075369_100247612 387
53 3300009553 Ga0105249_10135759 Ga0105249_101357591 387
54 3300021384 Ga0213876_10061079 Ga0213876_100610792 387
55 3300025961 Ga0207712_10155207 Ga0207712_101552072 387
56 3300035171 Ga0373946_0045710 Ga0373946_0045710_83_1282 387
57 3300035692 Ga0373935_0171448 Ga0373935_0171448_207_1406 387
58 3300035725 Ga0373947_0110499 Ga0373947_0110499_68_1267 387
59 3300037068 Ga0373925_0226506 Ga0373925_0226506_221_1420 387
60 3300037466 Ga0395898_0252085 Ga0395898_0252085_434_1642 387
61 3300037853 Ga0436364_1239479 Ga0436364_1239479_352_1683 387
62 3300039437 Ga0436365_0422968 Ga0436365_0422968_494_1825 387
63 3300039438 Ga0436360_0148117 Ga0436360_0148117_1090_2421 387
64 3300039450 Ga0436363_1149058 Ga0436363_1149058_4006_5337 387
65 3300046512 Ga0495610_0022436 Ga0495610_0022436_474_1679 387
66 3300046660 Ga0495625_0071534 Ga0495625_0071534_297_1499 387
67 3300047321 Ga0495676_0208588 Ga0495676_0208588_68_1267 387
68 3300048904 Ga0496101_0081595 Ga0496101_0081595_629_1948 387
69 3300048917 Ga0496114_0154733 Ga0496114_0154733_166_1485 387
70 3300053109 Ga0500569_030015 Ga0500569_030015_50_1252 387
71 iso_pu_bacteria 2513237137 2513864403 387
72 iso_pu_bacteria 2545555834 2545676560 387
73 3300005338 Ga0068868_100201610 Ga0068868_1002016101 388
74 3300005341 Ga0070691_10086774 Ga0070691_100867741 388
75 3300005344 Ga0070661_100068827 Ga0070661_1000688272 388
76 3300005441 Ga0070700_100166167 Ga0070700_1001661671 388
77 3300005456 Ga0070678_100260467 Ga0070678_1002604671 388
78 3300005548 Ga0070665_100311494 Ga0070665_1003114942 388
79 3300005564 Ga0070664_100038370 Ga0070664_1000383703 388
80 3300005615 Ga0070702_100157089 Ga0070702_1001570891 388
81 3300005843 Ga0068860_100090744 Ga0068860_1000907441 388
82 3300012480 Ga0157346_1000434 Ga0157346_10004342 388
83 3300012513 Ga0157326_1003224 Ga0157326_10032241 388
84 3300013296 Ga0157374_10305477 Ga0157374_103054771 388
85 3300014326 Ga0157380_10324302 Ga0157380_103243021 388
86 3300024227 Ga0228598_1017406 Ga0228598_10174061 388
87 3300025901 Ga0207688_10091350 Ga0207688_100913501 388
88 3300025910 Ga0207684_10121641 Ga0207684_101216411 388
89 3300025925 Ga0207650_10248628 Ga0207650_102486281 388
90 3300025933 Ga0207706_10052391 Ga0207706_100523912 388
91 3300025939 Ga0207665_10101688 Ga0207665_101016882 388
92 3300025940 Ga0207691_10145990 Ga0207691_101459903 388
93 3300025942 Ga0207689_10035246 Ga0207689_100352461 388
94 3300026023 Ga0207677_10091831 Ga0207677_100918313 388
95 3300026067 Ga0207678_10064579 Ga0207678_100645791 388
96 3300026067 Ga0207678_10219621 Ga0207678_102196211 388
97 3300026075 Ga0207708_10053639 Ga0207708_100536392 388
98 3300026121 Ga0207683_10141143 Ga0207683_101411431 388
99 3300028381 Ga0268264_10121962 Ga0268264_101219623 388
100 3300028381 Ga0268264_10384610 Ga0268264_103846101 388
101 3300028786 Ga0307517_10158121 Ga0307517_101581211 388
102 3300028786 Ga0307517_10162880 Ga0307517_101628801 388
103 3300028794 Ga0307515_10238113 Ga0307515_102381132 388
104 3300028794 Ga0307515_10261552 Ga0307515_102615522 388
105 3300030522 Ga0307512_10078909 Ga0307512_100789094 388
106 3300031456 Ga0307513_10225373 Ga0307513_102253731 388
107 3300031507 Ga0307509_10262469 Ga0307509_102624692 388
108 3300031548 Ga0307408_100247957 Ga0307408_1002479571 388
109 3300031665 Ga0316575_10054395 Ga0316575_100543952 388
110 3300031691 Ga0316579_10088354 Ga0316579_100883541 388
111 3300031730 Ga0307516_10257976 Ga0307516_102579761 388
112 3300032133 Ga0316583_10024088 Ga0316583_100240882 388
113 3300032133 Ga0316583_10044883 Ga0316583_100448832 388
114 3300033180 Ga0307510_10229246 Ga0307510_102292461 388
115 3300035084 Ga0373928_0005341 Ga0373928_0005341_1043_2245 388
116 3300035114 Ga0373939_0028664 Ga0373939_0028664_84_1286 388
117 3300035115 Ga0373941_0010267 Ga0373941_0010267_1119_2321 388
118 3300035207 Ga0373942_0014057 Ga0373942_0014057_99_1301 388
119 3300035241 Ga0373961_0021039 Ga0373961_0021039_150_1352 388
120 3300035691 Ga0373931_0041894 Ga0373931_0041894_78_1280 388
121 3300036647 Ga0316582_0061508 Ga0316582_0061508_1046_2248 388
122 3300037312 Ga0395899_0163493 Ga0395899_0163493_192_1394 388
123 3300037466 Ga0395898_0317804 Ga0395898_0317804_169_1422 388
124 3300046463 Ga0495653_0164620 Ga0495653_0164620_162_1364 388
125 3300046472 Ga0495580_0096547 Ga0495580_0096547_440_1642 388
126 3300046492 Ga0495585_0085287 Ga0495585_0085287_200_1453 388
127 3300046523 Ga0495644_0046480 Ga0495644_0046480_204_1457 388
128 3300046529 Ga0495652_0156056 Ga0495652_0156056_407_1609 388
129 3300046531 Ga0495665_0118812 Ga0495665_0118812_20_1222 388
130 3300046648 Ga0495611_0085153 Ga0495611_0085153_209_1420 388
131 3300046660 Ga0495625_0137776 Ga0495625_0137776_270_1481 388
132 3300046675 Ga0495657_0089375 Ga0495657_0089375_546_1748 388
133 3300046691 Ga0495670_0105787 Ga0495670_0105787_120_1373 388
134 3300046809 Ga0495600_0122604 Ga0495600_0122604_260_1462 388
135 3300046810 Ga0495660_0101557 Ga0495660_0101557_135_1388 388
136 3300047317 Ga0495604_0165521 Ga0495604_0165521_116_1318 388
137 3300047322 Ga0495680_0148507 Ga0495680_0148507_265_1467 388
138 3300047471 Ga0495684_0053308 Ga0495684_0053308_228_1430 388
139 3300048088 Ga0495602_0230358 Ga0495602_0230358_176_1378 388
140 3300048903 Ga0496100_0173304 Ga0496100_0173304_68_1270 388
141 3300048912 Ga0496109_0128465 Ga0496109_0128465_1130_2332 388
142 3300048918 Ga0496115_0256244 Ga0496115_0256244_202_1404 388
143 3300053078 Ga0495612_0051758 Ga0495612_0051758_302_1504 388
144 3300053084 Ga0495595_0077883 Ga0495595_0077883_288_1490 388
145 3300053085 Ga0495619_0169054 Ga0495619_0169054_170_1372 388
146 3300053087 Ga0500643_038715 Ga0500643_038715_35_1246 388
147 3300053098 Ga0500650_0075685 Ga0500650_0075685_78_1289 388
148 3300053104 Ga0500556_0055432 Ga0500556_0055432_72_1283 388
149 3300053105 Ga0500557_006154 Ga0500557_006154_1086_2297 388
150 3300053126 Ga0500621_061250 Ga0500621_061250_149_1360 388
151 3300053127 Ga0500623_070094 Ga0500623_070094_219_1430 388
152 3300053130 Ga0500642_0007763 Ga0500642_0007763_2246_3457 388
153 3300053133 Ga0500655_014483 Ga0500655_014483_77_1288 388
154 3300053142 Ga0500577_0071150 Ga0500577_0071150_93_1304 388
155 3300053143 Ga0500579_086417 Ga0500579_086417_432_1643 388
156 3300053146 Ga0500588_0021253 Ga0500588_0021253_347_1558 388
157 3300053147 Ga0500589_029248 Ga0500589_029248_918_2129 388
158 3300053156 Ga0500622_0067414 Ga0500622_0067414_294_1505 388
159 3300053158 Ga0500627_0020083 Ga0500627_0020083_1200_2411 388
160 3300053727 Ga0500611_009506 Ga0500611_009506_156_1367 388
161 3300053732 Ga0500656_002341 Ga0500656_002341_128_1339 388
162 3300054114 Ga0501084_0282406 Ga0501084_0282406_128_1330 388
163 iso_pu_bacteria 2511231052 2511501325 388
164 iso_pu_bacteria 2551306090 2551719840 388
165 iso_pu_bacteria 2582581299 2585231560 388
166 iso_pu_bacteria 2615840626 2616307564 388
167 iso_pu_bacteria 2615840626 2616313165 388
168 iso_pu_bacteria 2738541293 2738805977 388
169 iso_pu_bacteria 2738541293 2738805978 388
170 iso_pu_bacteria 2775506901 2776266251 388
171 iso_pu_bacteria 2842482326 2842488126 388
172 iso_pu_bacteria 2882632389 2882640125 388
173 iso_pu_bacteria 2916000859 2916002139 388
174 iso_pu_bacteria 2919709256 2919713434 388
175 iso_pu_bacteria 2924179722 2924180965 388
176 iso_pu_bacteria 2924186466 2924192210 388
177 iso_pu_bacteria 2957422303 2957425896 388
178 iso_pu_bacteria 2957505466 2957512035 388
179 iso_pu_bacteria 2970095765 2970098059 388
180 iso_pu_bacteria 3004167301 3004171916 388
181 iso_pu_bacteria 3004167301 3004175375 388
182 iso_pu_bacteria 3004334049 3004336564 388
183 iso_pu_bacteria 3004334049 3004337252 388
184 iso_pu_bacteria 3004334049 3004340010 388
185 iso_pu_bacteria 3004334049 3004341836 388
186 iso_pu_bacteria 3005409236 3005415714 388
187 3300001977 JGI24746J21847_1001879 JGI24746J21847_10018794 389
188 3300001978 JGI24747J21853_1001883 JGI24747J21853_10018832 389
189 3300001979 JGI24740J21852_10037640 JGI24740J21852_100376401 389
190 3300001989 JGI24739J22299_10042476 JGI24739J22299_100424761 389
191 3300001990 JGI24737J22298_10017182 JGI24737J22298_100171821 389
192 3300002067 JGI24735J21928_10037285 JGI24735J21928_100372851 389
193 3300002073 JGI24745J21846_1000203 JGI24745J21846_10002035 389
194 3300002074 JGI24748J21848_1005704 JGI24748J21848_10057041 389
195 3300002075 JGI24738J21930_10017496 JGI24738J21930_100174961 389
196 3300002155 JGI24033J26618_1005009 JGI24033J26618_10050091 389
197 3300002239 JGI24034J26672_10009517 JGI24034J26672_100095171 389
198 3300002244 JGI24742J22300_10004357 JGI24742J22300_100043571 389
199 3300005327 Ga0070658_10182003 Ga0070658_101820032 389
200 3300005328 Ga0070676_10054127 Ga0070676_100541271 389
201 3300005329 Ga0070683_100180692 Ga0070683_1001806921 389
202 3300005337 Ga0070682_100164057 Ga0070682_1001640571 389
203 3300005338 Ga0068868_100273182 Ga0068868_1002731821 389
204 3300005339 Ga0070660_100088303 Ga0070660_1000883033 389
205 3300005340 Ga0070689_100063783 Ga0070689_1000637832 389
206 3300005341 Ga0070691_10041218 Ga0070691_100412181 389
207 3300005343 Ga0070687_100019531 Ga0070687_1000195313 389
208 3300005345 Ga0070692_10093763 Ga0070692_100937631 389
209 3300005353 Ga0070669_100112871 Ga0070669_1001128711 389
210 3300005354 Ga0070675_100095890 Ga0070675_1000958903 389
211 3300005355 Ga0070671_100246375 Ga0070671_1002463751 389
212 3300005356 Ga0070674_100230033 Ga0070674_1002300331 389
213 3300005364 Ga0070673_100177665 Ga0070673_1001776651 389
214 3300005366 Ga0070659_100048751 Ga0070659_1000487513 389
215 3300005367 Ga0070667_100101591 Ga0070667_1001015914 389
216 3300005438 Ga0070701_10134740 Ga0070701_101347401 389
217 3300005440 Ga0070705_100036978 Ga0070705_1000369782 389
218 3300005455 Ga0070663_100083886 Ga0070663_1000838862 389
219 3300005456 Ga0070678_100188657 Ga0070678_1001886571 389
220 3300005457 Ga0070662_100074978 Ga0070662_1000749781 389
221 3300005539 Ga0068853_100031591 Ga0068853_1000315915 389
222 3300005544 Ga0070686_100058700 Ga0070686_1000587003 389
223 3300005548 Ga0070665_100227421 Ga0070665_1002274211 389
224 3300005549 Ga0070704_100199922 Ga0070704_1001999221 389
225 3300005578 Ga0068854_100054545 Ga0068854_1000545454 389
226 3300005614 Ga0068856_100246075 Ga0068856_1002460752 389
227 3300005616 Ga0068852_100108598 Ga0068852_1001085982 389
228 3300005618 Ga0068864_100128989 Ga0068864_1001289893 389
229 3300005719 Ga0068861_100282730 Ga0068861_1002827301 389
230 3300005834 Ga0068851_10034196 Ga0068851_100341962 389
231 3300005840 Ga0068870_10123606 Ga0068870_101236062 389
232 3300005841 Ga0068863_100194373 Ga0068863_1001943731 389
233 3300005842 Ga0068858_100128867 Ga0068858_1001288673 389
234 3300005843 Ga0068860_100149670 Ga0068860_1001496702 389
235 3300005844 Ga0068862_100228977 Ga0068862_1002289772 389
236 3300006358 Ga0068871_100199051 Ga0068871_1001990512 389
237 3300009092 Ga0105250_10041120 Ga0105250_100411202 389
238 3300009093 Ga0105240_10295080 Ga0105240_102950802 389
239 3300009101 Ga0105247_10118728 Ga0105247_101187282 389
240 3300009176 Ga0105242_10116637 Ga0105242_101166372 389
241 3300009177 Ga0105248_10416183 Ga0105248_104161832 389
242 3300009545 Ga0105237_10305888 Ga0105237_103058881 389
243 3300009551 Ga0105238_10175469 Ga0105238_101754692 389
244 3300009553 Ga0105249_10047410 Ga0105249_100474101 389
245 3300010375 Ga0105239_10340666 Ga0105239_103406662 389
246 3300011119 Ga0105246_10032799 Ga0105246_100327993 389
247 3300013102 Ga0157371_10113596 Ga0157371_101135962 389
248 3300013306 Ga0163162_10336394 Ga0163162_103363942 389
249 3300014326 Ga0157380_10278421 Ga0157380_102784211 389
250 3300014745 Ga0157377_10068544 Ga0157377_100685441 389
251 3300014968 Ga0157379_10063705 Ga0157379_100637053 389
252 3300014969 Ga0157376_10145642 Ga0157376_101456421 389
253 3300025321 Ga0207656_10081977 Ga0207656_100819771 389
254 3300025711 Ga0207696_1031544 Ga0207696_10315441 389
255 3300025728 Ga0207655_1064872 Ga0207655_10648721 389
256 3300025893 Ga0207682_10008521 Ga0207682_100085214 389
257 3300025899 Ga0207642_10113707 Ga0207642_101137071 389
258 3300025900 Ga0207710_10032775 Ga0207710_100327753 389
259 3300025903 Ga0207680_10176474 Ga0207680_101764741 389
260 3300025907 Ga0207645_10046984 Ga0207645_100469843 389
261 3300025918 Ga0207662_10013371 Ga0207662_100133716 389
262 3300025923 Ga0207681_10214187 Ga0207681_102141871 389
263 3300025924 Ga0207694_10239001 Ga0207694_102390011 389
264 3300025926 Ga0207659_10212501 Ga0207659_102125011 389
265 3300025927 Ga0207687_10175879 Ga0207687_101758791 389
266 3300025931 Ga0207644_10293787 Ga0207644_102937871 389
267 3300025934 Ga0207686_10194181 Ga0207686_101941811 389
268 3300025935 Ga0207709_10175405 Ga0207709_101754051 389
269 3300025938 Ga0207704_10063944 Ga0207704_100639442 389
270 3300025941 Ga0207711_10292412 Ga0207711_102924122 389
271 3300025961 Ga0207712_10196062 Ga0207712_101960622 389
272 3300025972 Ga0207668_10236841 Ga0207668_102368411 389
273 3300025981 Ga0207640_10214025 Ga0207640_102140251 389
274 3300025986 Ga0207658_10184405 Ga0207658_101844052 389
275 3300026023 Ga0207677_10077830 Ga0207677_100778301 389
276 3300026035 Ga0207703_10280410 Ga0207703_102804101 389
277 3300026041 Ga0207639_10270885 Ga0207639_102708851 389
278 3300026067 Ga0207678_10109189 Ga0207678_101091893 389
279 3300026078 Ga0207702_10329893 Ga0207702_103298932 389
280 3300026088 Ga0207641_10320114 Ga0207641_103201141 389
281 3300026095 Ga0207676_10141604 Ga0207676_101416042 389
282 3300026142 Ga0207698_10065520 Ga0207698_100655202 389
283 3300028379 Ga0268266_10242374 Ga0268266_102423741 389
284 3300028380 Ga0268265_10254523 Ga0268265_102545231 389
285 3300028381 Ga0268264_10308467 Ga0268264_103084671 389
286 3300046684 Ga0495669_0000800 Ga0495669_0000800_12056_13261 389
287 3300048904 Ga0496101_0053700 Ga0496101_0053700_966_2162 389
288 3300048906 Ga0496103_0059647 Ga0496103_0059647_174_1370 389
289 3300048909 Ga0496106_0087230 Ga0496106_0087230_296_1492 389
290 3300048912 Ga0496109_0175049 Ga0496109_0175049_82_1278 389
291 3300048913 Ga0496110_0310775 Ga0496110_0310775_65_1261 389
292 3300048917 Ga0496114_0225302 Ga0496114_0225302_178_1374 389
293 3300005937 Ga0081455_10059299 Ga0081455_100592992 390
294 3300009093 Ga0105240_10000308 Ga0105240_1000030822 390
295 3300009545 Ga0105237_10000931 Ga0105237_1000093112 390
296 3300010375 Ga0105239_10000535 Ga0105239_1000053539 390
297 3300013104 Ga0157370_10000481 Ga0157370_1000048122 390
298 3300015262 Ga0182007_10002448 Ga0182007_100024482 390
299 3300025223 Ga0207672_1001902 Ga0207672_10019021 390
300 3300031548 Ga0307408_100314248 Ga0307408_1003142481 390
301 3300032004 Ga0307414_10234584 Ga0307414_102345842 390
302 3300046515 Ga0495620_0053656 Ga0495620_0053656_35_1252 390
303 3300046518 Ga0495631_0038480 Ga0495631_0038480_782_1990 390
304 3300046537 Ga0495598_0017047 Ga0495598_0017047_560_1777 390
305 3300048904 Ga0496101_0044356 Ga0496101_0044356_826_2175 390
306 3300048905 Ga0496102_0000922 Ga0496102_0000922_24562_25911 390
307 3300048906 Ga0496103_0015879 Ga0496103_0015879_1749_3098 390
308 3300048921 Ga0496118_0001907 Ga0496118_0001907_24925_26274 390
309 3300048928 Ga0496125_0027565 Ga0496125_0027565_1843_3192 390
310 3300048929 Ga0496126_0156427 Ga0496126_0156427_158_1507 390
311 3300049583 Ga0501067_0124183 Ga0501067_0124183_139_1359 390
312 3300053156 Ga0500622_0041976 Ga0500622_0041976_155_1345 390
313 3300001977 JGI24746J21847_1009752 JGI24746J21847_10097521 391
314 3300001990 JGI24737J22298_10040661 JGI24737J22298_100406611 391
315 3300001991 JGI24743J22301_10013955 JGI24743J22301_100139551 391
316 3300002073 JGI24745J21846_1005085 JGI24745J21846_10050851 391
317 3300002075 JGI24738J21930_10019204 JGI24738J21930_100192041 391
318 3300002077 JGI24744J21845_10017361 JGI24744J21845_100173611 391
319 3300002155 JGI24033J26618_1005234 JGI24033J26618_10052341 391
320 3300002239 JGI24034J26672_10008959 JGI24034J26672_100089591 391
321 3300002244 JGI24742J22300_10004598 JGI24742J22300_100045981 391
322 3300002459 JGI24751J29686_10003347 JGI24751J29686_100033471 391
323 3300005290 Ga0065712_10018815 Ga0065712_100188151 391
324 3300005293 Ga0065715_10120700 Ga0065715_101207003 391
325 3300005329 Ga0070683_100276702 Ga0070683_1002767021 391
326 3300005354 Ga0070675_100052472 Ga0070675_1000524722 391
327 3300005356 Ga0070674_100105965 Ga0070674_1001059653 391
328 3300005364 Ga0070673_100182447 Ga0070673_1001824472 391
329 3300005440 Ga0070705_100039412 Ga0070705_1000394122 391
330 3300005455 Ga0070663_100258308 Ga0070663_1002583081 391
331 3300005457 Ga0070662_100173135 Ga0070662_1001731352 391
332 3300005459 Ga0068867_100187981 Ga0068867_1001879812 391
333 3300005535 Ga0070684_100137781 Ga0070684_1001377813 391
334 3300005535 Ga0070684_100169739 Ga0070684_1001697392 391
335 3300005546 Ga0070696_100219634 Ga0070696_1002196341 391
336 3300005577 Ga0068857_100245008 Ga0068857_1002450081 391
337 3300005578 Ga0068854_100229178 Ga0068854_1002291781 391
338 3300005614 Ga0068856_100239726 Ga0068856_1002397262 391
339 3300005615 Ga0070702_100090131 Ga0070702_1000901311 391
340 3300005616 Ga0068852_100182843 Ga0068852_1001828431 391
341 3300005718 Ga0068866_10111203 Ga0068866_101112031 391
342 3300005718 Ga0068866_10144059 Ga0068866_101440591 391
343 3300005718 Ga0068866_10173595 Ga0068866_101735951 391
344 3300005843 Ga0068860_100203207 Ga0068860_1002032072 391
345 3300006871 Ga0075434_100338023 Ga0075434_1003380232 391
346 3300006880 Ga0075429_100237943 Ga0075429_1002379431 391
347 3300006914 Ga0075436_100037047 Ga0075436_1000370474 391
348 3300007076 Ga0075435_100215460 Ga0075435_1002154602 391
349 3300009093 Ga0105240_10266717 Ga0105240_102667172 391
350 3300009098 Ga0105245_10109986 Ga0105245_101099861 391
351 3300009098 Ga0105245_10282682 Ga0105245_102826821 391
352 3300009098 Ga0105245_10286936 Ga0105245_102869361 391
353 3300009177 Ga0105248_10102143 Ga0105248_101021432 391
354 3300009553 Ga0105249_10155248 Ga0105249_101552481 391
355 3300009553 Ga0105249_10176321 Ga0105249_101763213 391
356 3300011119 Ga0105246_10148400 Ga0105246_101484002 391
357 3300013100 Ga0157373_10188625 Ga0157373_101886252 391
358 3300013102 Ga0157371_10057231 Ga0157371_100572313 391
359 3300013306 Ga0163162_10206598 Ga0163162_102065981 391
360 3300013307 Ga0157372_10549251 Ga0157372_105492511 391
361 3300014326 Ga0157380_10097019 Ga0157380_100970191 391
362 3300014497 Ga0182008_10064832 Ga0182008_100648322 391
363 3300025271 Ga0207666_1004706 Ga0207666_10047062 391
364 3300025290 Ga0207673_1002108 Ga0207673_10021082 391
365 3300025315 Ga0207697_10018927 Ga0207697_100189274 391
366 3300025899 Ga0207642_10065310 Ga0207642_100653101 391
367 3300025899 Ga0207642_10078292 Ga0207642_100782921 391
368 3300025901 Ga0207688_10018361 Ga0207688_100183613 391
369 3300025901 Ga0207688_10034576 Ga0207688_100345762 391
370 3300025904 Ga0207647_10100121 Ga0207647_101001211 391
371 3300025907 Ga0207645_10064768 Ga0207645_100647683 391
372 3300025908 Ga0207643_10120175 Ga0207643_101201751 391
373 3300025913 Ga0207695_10364776 Ga0207695_103647761 391
374 3300025917 Ga0207660_10232043 Ga0207660_102320431 391
375 3300025918 Ga0207662_10057318 Ga0207662_100573183 391
376 3300025919 Ga0207657_10067535 Ga0207657_100675353 391
377 3300025920 Ga0207649_10039631 Ga0207649_100396312 391
378 3300025923 Ga0207681_10233510 Ga0207681_102335101 391
379 3300025925 Ga0207650_10094429 Ga0207650_100944291 391
380 3300025926 Ga0207659_10237755 Ga0207659_102377551 391
381 3300025933 Ga0207706_10051587 Ga0207706_100515873 391
382 3300025933 Ga0207706_10087799 Ga0207706_100877994 391
383 3300025935 Ga0207709_10195720 Ga0207709_101957201 391
384 3300025937 Ga0207669_10204042 Ga0207669_102040421 391
385 3300025940 Ga0207691_10121420 Ga0207691_101214202 391
386 3300025942 Ga0207689_10067675 Ga0207689_100676751 391
387 3300025942 Ga0207689_10068141 Ga0207689_100681414 391
388 3300025944 Ga0207661_10271556 Ga0207661_102715561 391
389 3300025944 Ga0207661_10287175 Ga0207661_102871751 391
390 3300025945 Ga0207679_10242350 Ga0207679_102423501 391
391 3300025960 Ga0207651_10217384 Ga0207651_102173841 391
392 3300025961 Ga0207712_10191246 Ga0207712_101912461 391
393 3300025961 Ga0207712_10241668 Ga0207712_102416681 391
394 3300025972 Ga0207668_10251502 Ga0207668_102515021 391
395 3300025981 Ga0207640_10218912 Ga0207640_102189121 391
396 3300026035 Ga0207703_10303758 Ga0207703_103037581 391
397 3300026067 Ga0207678_10044268 Ga0207678_100442683 391
398 3300026067 Ga0207678_10059527 Ga0207678_100595272 391
399 3300026075 Ga0207708_10045868 Ga0207708_100458681 391
400 3300026075 Ga0207708_10082010 Ga0207708_100820102 391
401 3300026075 Ga0207708_10113657 Ga0207708_101136571 391
402 3300026088 Ga0207641_10294581 Ga0207641_102945811 391
403 3300026089 Ga0207648_10129458 Ga0207648_101294582 391
404 3300026089 Ga0207648_10146339 Ga0207648_101463392 391
405 3300026095 Ga0207676_10246588 Ga0207676_102465881 391
406 3300026095 Ga0207676_10252292 Ga0207676_102522921 391
407 3300026121 Ga0207683_10076955 Ga0207683_100769551 391
408 3300027907 Ga0207428_10207642 Ga0207428_102076421 391
409 3300028380 Ga0268265_10294379 Ga0268265_102943791 391
410 3300031665 Ga0316575_10010037 Ga0316575_100100372 391
411 3300031691 Ga0316579_10059565 Ga0316579_100595652 391
412 3300031727 Ga0316576_10050140 Ga0316576_100501403 391
413 3300031728 Ga0316578_10030994 Ga0316578_100309941 391
414 3300031733 Ga0316577_10042126 Ga0316577_100421264 391
415 3300032133 Ga0316583_10013438 Ga0316583_100134381 391
416 3300032137 Ga0316585_10017297 Ga0316585_100172973 391
417 3300032139 Ga0316580_10005200 Ga0316580_100052002 391
418 3300034816 Ga0373930_0010223 Ga0373930_0010223_320_1522 391
419 3300034817 Ga0373948_0002181 Ga0373948_0002181_1485_2687 391
420 3300034818 Ga0373950_0009520 Ga0373950_0009520_170_1372 391
421 3300034818 Ga0373950_0012048 Ga0373950_0012048_96_1364 391
422 3300034819 Ga0373958_0011236 Ga0373958_0011236_268_1470 391
423 3300034820 Ga0373959_0003787 Ga0373959_0003787_458_1660 391
424 3300034957 Ga0373938_0015854 Ga0373938_0015854_172_1374 391
425 3300035083 Ga0373926_0049853 Ga0373926_0049853_205_1407 391
426 3300035084 Ga0373928_0006474 Ga0373928_0006474_43_1245 391
427 3300035086 Ga0373934_0062852 Ga0373934_0062852_163_1365 391
428 3300035088 Ga0373940_0015337 Ga0373940_0015337_503_1771 391
429 3300035088 Ga0373940_0028238 Ga0373940_0028238_35_1237 391
430 3300035089 Ga0373944_0012435 Ga0373944_0012435_961_2163 391
431 3300035090 Ga0373949_0004601 Ga0373949_0004601_202_1404 391
432 3300035111 Ga0373923_0015651 Ga0373923_0015651_202_1404 391
433 3300035113 Ga0373936_0070207 Ga0373936_0070207_72_1274 391
434 3300035115 Ga0373941_0009046 Ga0373941_0009046_92_1294 391
435 3300035116 Ga0373945_0046229 Ga0373945_0046229_297_1499 391
436 3300035117 Ga0373953_0044256 Ga0373953_0044256_493_1695 391
437 3300035118 Ga0373954_0089587 Ga0373954_0089587_174_1376 391
438 3300035119 Ga0373956_0036984 Ga0373956_0036984_224_1426 391
439 3300035120 Ga0373957_0043032 Ga0373957_0043032_267_1469 391
440 3300035170 Ga0373943_0039207 Ga0373943_0039207_159_1361 391
441 3300035171 Ga0373946_0072989 Ga0373946_0072989_179_1381 391
442 3300035172 Ga0373955_0108375 Ga0373955_0108375_193_1395 391
443 3300035207 Ga0373942_0012635 Ga0373942_0012635_315_1517 391
444 3300035207 Ga0373942_0027947 Ga0373942_0027947_88_1356 391
445 3300035242 Ga0373962_0030931 Ga0373962_0030931_193_1395 391
446 3300035398 Ga0316574_0031946 Ga0316574_0031946_219_1460 391
447 3300035410 Ga0373924_0070424 Ga0373924_0070424_102_1304 391
448 3300035691 Ga0373931_0008147 Ga0373931_0008147_3634_4836 391
449 3300035691 Ga0373931_0042527 Ga0373931_0042527_91_1359 391
450 3300035692 Ga0373935_0037418 Ga0373935_0037418_851_2053 391
451 3300035695 Ga0373927_0092326 Ga0373927_0092326_589_1791 391
452 3300035724 Ga0373933_0135460 Ga0373933_0135460_243_1445 391
453 3300035725 Ga0373947_0176269 Ga0373947_0176269_155_1357 391
454 3300036401 Ga0373937_0283911 Ga0373937_0283911_274_1476 391
455 3300036647 Ga0316582_0015441 Ga0316582_0015441_2974_4215 391
456 3300036712 Ga0316584_0016275 Ga0316584_0016275_3974_5215 391
457 3300037068 Ga0373925_0092348 Ga0373925_0092348_900_2102 391
458 3300037588 Ga0316581_0012173 Ga0316581_0012173_1018_2259 391
459 3300042008 Ga0439450_023567 Ga0439450_023567_45_1277 391
460 3300044694 Ga0466963_0213314 Ga0466963_0213314_119_1321 391
461 3300045976 Ga0466967_0454943 Ga0466967_0454943_14_1216 391
462 3300046455 Ga0495603_0046950 Ga0495603_0046950_682_1884 391
463 3300046459 Ga0495629_0121008 Ga0495629_0121008_458_1660 391
464 3300046461 Ga0495641_0025950 Ga0495641_0025950_747_1949 391
465 3300046463 Ga0495653_0152584 Ga0495653_0152584_248_1450 391
466 3300046472 Ga0495580_0148277 Ga0495580_0148277_286_1488 391
467 3300046473 Ga0495582_0121551 Ga0495582_0121551_179_1381 391
468 3300046475 Ga0495639_0034799 Ga0495639_0034799_632_1834 391
469 3300046476 Ga0495662_0036992 Ga0495662_0036992_984_2186 391
470 3300046477 Ga0495664_0118222 Ga0495664_0118222_199_1401 391
471 3300046499 Ga0495594_0126442 Ga0495594_0126442_80_1282 391
472 3300046517 Ga0495630_0089703 Ga0495630_0089703_71_1273 391
473 3300046523 Ga0495644_0063299 Ga0495644_0063299_73_1314 391
474 3300046526 Ga0495666_0026364 Ga0495666_0026364_281_1483 391
475 3300046531 Ga0495665_0098671 Ga0495665_0098671_88_1290 391
476 3300046533 Ga0495640_0064393 Ga0495640_0064393_1089_2291 391
477 3300046557 Ga0495622_0049263 Ga0495622_0049263_572_1774 391
478 3300046559 Ga0495667_0146909 Ga0495667_0146909_198_1400 391
479 3300046642 Ga0495634_0137675 Ga0495634_0137675_134_1336 391
480 3300046663 Ga0495635_0154080 Ga0495635_0154080_189_1391 391
481 3300046674 Ga0495588_0044169 Ga0495588_0044169_906_2108 391
482 3300046681 Ga0495647_0033369 Ga0495647_0033369_358_1560 391
483 3300046683 Ga0495658_0052601 Ga0495658_0052601_1032_2234 391
484 3300046689 Ga0495613_0184921 Ga0495613_0184921_182_1384 391
485 3300046690 Ga0495624_0123652 Ga0495624_0123652_198_1400 391
486 3300046809 Ga0495600_0139002 Ga0495600_0139002_109_1311 391
487 3300047315 Ga0495581_0103120 Ga0495581_0103120_380_1582 391
488 3300047319 Ga0495674_0107142 Ga0495674_0107142_1138_2340 391
489 3300047321 Ga0495676_0101013 Ga0495676_0101013_848_2050 391
490 3300047322 Ga0495680_0176318 Ga0495680_0176318_216_1418 391
491 3300047444 Ga0495675_0147534 Ga0495675_0147534_75_1409 391
492 3300047471 Ga0495684_0194384 Ga0495684_0194384_212_1414 391
493 3300047673 Ga0495593_0071503 Ga0495593_0071503_231_1433 391
494 3300048089 Ga0495614_0028999 Ga0495614_0028999_169_1371 391
495 3300048903 Ga0496100_0132809 Ga0496100_0132809_333_1535 391
496 3300048905 Ga0496102_0130010 Ga0496102_0130010_20_1354 391
497 3300048909 Ga0496106_0207260 Ga0496106_0207260_201_1535 391
498 3300048909 Ga0496106_0240782 Ga0496106_0240782_83_1285 391
499 3300048911 Ga0496108_0239393 Ga0496108_0239393_163_1497 391
500 3300048912 Ga0496109_0222178 Ga0496109_0222178_180_1514 391
501 3300048912 Ga0496109_0284131 Ga0496109_0284131_159_1361 391
502 3300048913 Ga0496110_0048354 Ga0496110_0048354_1583_2785 391
503 3300048914 Ga0496111_0158576 Ga0496111_0158576_263_1465 391
504 3300048915 Ga0496112_0365930 Ga0496112_0365930_163_1365 391
505 3300049585 Ga0501069_0067935 Ga0501069_0067935_324_1529 391
506 3300050508 nmdc:mga09592_230577_c1 nmdc:mga09592_230577_c1_252_1454 391
507 3300050511 nmdc:mga08y16_367692_c1 nmdc:mga08y16_367692_c1_100_1302 391
508 3300050512 nmdc:mga0n895_239331_c1 nmdc:mga0n895_239331_c1_247_1449 391
509 3300050515 nmdc:mga0a205_278902_c1 nmdc:mga0a205_278902_c1_268_1470 391
510 3300053077 Ga0495601_0149888 Ga0495601_0149888_243_1445 391
511 3300053078 Ga0495612_0018353 Ga0495612_0018353_987_2255 391
512 3300053078 Ga0495612_0028499 Ga0495612_0028499_205_1407 391
513 3300053084 Ga0495595_0056635 Ga0495595_0056635_81_1349 391
514 3300053084 Ga0495595_0058030 Ga0495595_0058030_333_1535 391
515 3300053085 Ga0495619_0068938 Ga0495619_0068938_205_1407 391
516 3300001904 JGI24736J21556_1003726 JGI24736J21556_10037264 392
517 3300001979 JGI24740J21852_10013036 JGI24740J21852_100130361 392
518 3300001979 JGI24740J21852_10017173 JGI24740J21852_100171732 392
519 3300001989 JGI24739J22299_10011398 JGI24739J22299_100113985 392
520 3300001989 JGI24739J22299_10029983 JGI24739J22299_100299832 392
521 3300001990 JGI24737J22298_10038737 JGI24737J22298_100387371 392
522 3300001990 JGI24737J22298_10040074 JGI24737J22298_100400741 392
523 3300002067 JGI24735J21928_10035465 JGI24735J21928_100354651 392
524 3300002074 JGI24748J21848_1002255 JGI24748J21848_10022552 392
525 3300002074 JGI24748J21848_1004189 JGI24748J21848_10041892 392
526 3300002075 JGI24738J21930_10006727 JGI24738J21930_100067271 392
527 3300002075 JGI24738J21930_10006766 JGI24738J21930_100067661 392
528 3300002239 JGI24034J26672_10002275 JGI24034J26672_100022751 392
529 3300002239 JGI24034J26672_10005082 JGI24034J26672_100050823 392
530 3300002737 JGI25162J39368_1005355 JGI25162J39368_10053553 392
531 3300002773 JGI25152J39213_1015316 JGI25152J39213_10153161 392
532 3300002774 JGI25150J39212_1012362 JGI25150J39212_10123621 392
533 3300003187 JGI25151J46595_10046711 JGI25151J46595_100467111 392
534 3300003214 JGI25165J46597_1004612 JGI25165J46597_10046124 392
535 3300003215 JGI25153J46596_10038275 JGI25153J46596_100382751 392
536 3300003659 JGI25404J52841_10019148 JGI25404J52841_100191481 392
537 3300003752 Ga0055539_1003335 Ga0055539_10033353 392
538 3300003752 Ga0055539_1003349 Ga0055539_10033491 392
539 3300003771 Ga0055526_1027249 Ga0055526_10272492 392
540 3300005341 Ga0070691_10026813 Ga0070691_100268134 392
541 3300005344 Ga0070661_100130118 Ga0070661_1001301181 392
542 3300005347 Ga0070668_100159071 Ga0070668_1001590712 392
543 3300005367 Ga0070667_100088281 Ga0070667_1000882812 392
544 3300005437 Ga0070710_10029533 Ga0070710_100295332 392
545 3300005457 Ga0070662_100145049 Ga0070662_1001450491 392
546 3300005539 Ga0068853_100161980 Ga0068853_1001619802 392
547 3300005539 Ga0068853_100326430 Ga0068853_1003264301 392
548 3300005545 Ga0070695_100145334 Ga0070695_1001453341 392
549 3300005548 Ga0070665_100372587 Ga0070665_1003725871 392
550 3300005563 Ga0068855_100340528 Ga0068855_1003405282 392
551 3300005563 Ga0068855_100442922 Ga0068855_1004429221 392
552 3300005577 Ga0068857_100077096 Ga0068857_1000770963 392
553 3300005578 Ga0068854_100076483 Ga0068854_1000764832 392
554 3300005578 Ga0068854_100185699 Ga0068854_1001856992 392
555 3300005578 Ga0068854_100211915 Ga0068854_1002119152 392
556 3300005614 Ga0068856_100384796 Ga0068856_1003847961 392
557 3300005616 Ga0068852_100259703 Ga0068852_1002597032 392
558 3300005616 Ga0068852_100360744 Ga0068852_1003607441 392
559 3300005834 Ga0068851_10061010 Ga0068851_100610102 392
560 3300005834 Ga0068851_10115337 Ga0068851_101153371 392
561 3300005843 Ga0068860_100309675 Ga0068860_1003096751 392
562 3300005937 Ga0081455_10097017 Ga0081455_100970171 392
563 3300005981 Ga0081538_10025935 Ga0081538_100259354 392
564 3300005983 Ga0081540_1029113 Ga0081540_10291133 392
565 3300006038 Ga0075365_10065192 Ga0075365_100651923 392
566 3300006846 Ga0075430_100155278 Ga0075430_1001552782 392
567 3300007265 Ga0099794_10066792 Ga0099794_100667922 392
568 3300009011 Ga0105251_10088488 Ga0105251_100884881 392
569 3300009093 Ga0105240_10459403 Ga0105240_104594031 392
570 3300009174 Ga0105241_10282350 Ga0105241_102823501 392
571 3300009177 Ga0105248_10066968 Ga0105248_100669683 392
572 3300009545 Ga0105237_10377046 Ga0105237_103770461 392
573 3300009545 Ga0105237_10377990 Ga0105237_103779901 392
574 3300009551 Ga0105238_10033243 Ga0105238_100332434 392
575 3300009551 Ga0105238_10370664 Ga0105238_103706641 392
576 3300009553 Ga0105249_10029672 Ga0105249_100296721 392
577 3300010375 Ga0105239_10405500 Ga0105239_104055001 392
578 3300010375 Ga0105239_10476291 Ga0105239_104762911 392
579 3300013100 Ga0157373_10057003 Ga0157373_100570034 392
580 3300013102 Ga0157371_10207790 Ga0157371_102077901 392
581 3300013104 Ga0157370_10184762 Ga0157370_101847622 392
582 3300013105 Ga0157369_10304516 Ga0157369_103045161 392
583 3300013307 Ga0157372_10255388 Ga0157372_102553882 392
584 3300017792 Ga0163161_10110263 Ga0163161_101102632 392
585 3300017792 Ga0163161_10223205 Ga0163161_102232051 392
586 3300021377 Ga0213874_10026637 Ga0213874_100266371 392
587 3300021384 Ga0213876_10039350 Ga0213876_100393502 392
588 3300021388 Ga0213875_10035242 Ga0213875_100352421 392
589 3300021388 Ga0213875_10091052 Ga0213875_100910521 392
590 3300025233 Ga0209437_102208 Ga0209437_1022084 392
591 3300025246 Ga0209646_1003033 Ga0209646_10030332 392
592 3300025253 Ga0209677_100188 Ga0209677_10018853 392
593 3300025253 Ga0209677_111076 Ga0209677_1110761 392
594 3300025261 Ga0209233_1023826 Ga0209233_10238261 392
595 3300025261 Ga0209233_1026373 Ga0209233_10263731 392
596 3300025273 Ga0209673_1020412 Ga0209673_10204123 392
597 3300025291 Ga0209675_1017841 Ga0209675_10178411 392
598 3300025295 Ga0209564_1009330 Ga0209564_10093303 392
599 3300025299 Ga0209256_1018117 Ga0209256_10181171 392
600 3300025321 Ga0207656_10019888 Ga0207656_100198881 392
601 3300025735 Ga0207713_1008718 Ga0207713_10087184 392
602 3300025904 Ga0207647_10044628 Ga0207647_100446284 392
603 3300025911 Ga0207654_10167603 Ga0207654_101676031 392
604 3300025913 Ga0207695_10326818 Ga0207695_103268181 392
605 3300025914 Ga0207671_10006891 Ga0207671_100068916 392
606 3300025914 Ga0207671_10239936 Ga0207671_102399361 392
607 3300025914 Ga0207671_10242248 Ga0207671_102422481 392
608 3300025920 Ga0207649_10150955 Ga0207649_101509551 392
609 3300025923 Ga0207681_10151217 Ga0207681_101512172 392
610 3300025924 Ga0207694_10261335 Ga0207694_102613351 392
611 3300025933 Ga0207706_10052960 Ga0207706_100529607 392
612 3300025941 Ga0207711_10073795 Ga0207711_100737953 392
613 3300025949 Ga0207667_10319500 Ga0207667_103195001 392
614 3300025949 Ga0207667_10406565 Ga0207667_104065651 392
615 3300025961 Ga0207712_10017722 Ga0207712_100177222 392
616 3300025972 Ga0207668_10248053 Ga0207668_102480531 392
617 3300025981 Ga0207640_10057504 Ga0207640_100575043 392
618 3300025981 Ga0207640_10208569 Ga0207640_102085691 392
619 3300025986 Ga0207658_10242884 Ga0207658_102428842 392
620 3300026041 Ga0207639_10102542 Ga0207639_101025422 392
621 3300026041 Ga0207639_10240596 Ga0207639_102405961 392
622 3300026078 Ga0207702_10345511 Ga0207702_103455111 392
623 3300026116 Ga0207674_10034570 Ga0207674_100345706 392
624 3300026142 Ga0207698_10051504 Ga0207698_100515041 392
625 3300026142 Ga0207698_10334838 Ga0207698_103348381 392
626 3300028379 Ga0268266_10183783 Ga0268266_101837831 392
627 3300031731 Ga0307405_10056244 Ga0307405_100562443 392
628 3300031731 Ga0307405_10086883 Ga0307405_100868832 392
629 3300031824 Ga0307413_10057187 Ga0307413_100571871 392
630 3300031852 Ga0307410_10216579 Ga0307410_102165791 392
631 3300031852 Ga0307410_10224597 Ga0307410_102245971 392
632 3300031901 Ga0307406_10143715 Ga0307406_101437151 392
633 3300031903 Ga0307407_10044636 Ga0307407_100446362 392
634 3300031903 Ga0307407_10160545 Ga0307407_101605451 392
635 3300031911 Ga0307412_10143976 Ga0307412_101439761 392
636 3300031911 Ga0307412_10177747 Ga0307412_101777472 392
637 3300031911 Ga0307412_10283114 Ga0307412_102831141 392
638 3300031995 Ga0307409_100280983 Ga0307409_1002809831 392
639 3300031995 Ga0307409_100304378 Ga0307409_1003043781 392
640 3300032002 Ga0307416_100256260 Ga0307416_1002562602 392
641 3300032002 Ga0307416_100288686 Ga0307416_1002886862 392
642 3300032004 Ga0307414_10100285 Ga0307414_101002852 392
643 3300032004 Ga0307414_10206720 Ga0307414_102067201 392
644 3300032005 Ga0307411_10098287 Ga0307411_100982872 392
645 3300032126 Ga0307415_100229999 Ga0307415_1002299991 392
646 3300032126 Ga0307415_100238026 Ga0307415_1002380261 392
647 3300035111 Ga0373923_0025794 Ga0373923_0025794_169_1374 392
648 3300035113 Ga0373936_0020407 Ga0373936_0020407_1216_2421 392
649 3300035117 Ga0373953_0063118 Ga0373953_0063118_93_1298 392
650 3300035118 Ga0373954_0089071 Ga0373954_0089071_183_1388 392
651 3300035119 Ga0373956_0067958 Ga0373956_0067958_77_1282 392
652 3300035120 Ga0373957_0018967 Ga0373957_0018967_1080_2285 392
653 3300035172 Ga0373955_0114869 Ga0373955_0114869_74_1279 392
654 3300035410 Ga0373924_0014650 Ga0373924_0014650_1588_2793 392
655 3300035692 Ga0373935_0092120 Ga0373935_0092120_710_1915 392
656 3300035724 Ga0373933_0113942 Ga0373933_0113942_181_1386 392
657 3300037068 Ga0373925_0245852 Ga0373925_0245852_218_1423 392
658 3300037588 Ga0316581_0034990 Ga0316581_0034990_155_1351 392
659 3300037853 Ga0436364_0200835 Ga0436364_0200835_1874_3106 392
660 3300037853 Ga0436364_1218439 Ga0436364_1218439_201_1466 392
661 3300039438 Ga0436360_0084886 Ga0436360_0084886_1136_2368 392
662 3300039450 Ga0436363_0261507 Ga0436363_0261507_2889_4154 392
663 3300039450 Ga0436363_0277506 Ga0436363_0277506_153_1487 392
664 3300039450 Ga0436363_1611071 Ga0436363_1611071_170_1438 392
665 3300041404 Ga0439436_0023562 Ga0439436_0023562_191_1387 392
666 3300041405 Ga0439438_029343 Ga0439438_029343_149_1345 392
667 3300041406 Ga0439439_0007978 Ga0439439_0007978_467_1663 392
668 3300041406 Ga0439439_0013190 Ga0439439_0013190_683_1957 392
669 3300041410 Ga0439461_0018148 Ga0439461_0018148_34_1230 392
670 3300041411 Ga0439466_0012851 Ga0439466_0012851_1707_2903 392
671 3300041411 Ga0439466_0023393 Ga0439466_0023393_182_1456 392
672 3300041413 Ga0439465_0023758 Ga0439465_0023758_316_1590 392
673 3300041413 Ga0439465_0026088 Ga0439465_0026088_182_1378 392
674 3300041997 Ga0439431_0007448 Ga0439431_0007448_892_2088 392
675 3300041999 Ga0439433_0007590 Ga0439433_0007590_172_1368 392
676 3300042002 Ga0439442_004918 Ga0439442_004918_1331_2527 392
677 3300042004 Ga0439445_0011925 Ga0439445_0011925_683_1879 392
678 3300042006 Ga0439432_019040 Ga0439432_019040_404_1600 392
679 3300042006 Ga0439432_032108 Ga0439432_032108_378_1652 392
680 3300042007 Ga0439449_0015464 Ga0439449_0015464_659_1855 392
681 3300042007 Ga0439449_0036471 Ga0439449_0036471_113_1387 392
682 3300042010 Ga0439452_026401 Ga0439452_026401_156_1352 392
683 3300042014 Ga0439457_007919 Ga0439457_007919_210_1406 392
684 3300042015 Ga0439462_0003810 Ga0439462_0003810_1692_2888 392
685 3300042015 Ga0439462_0008518 Ga0439462_0008518_1213_2487 392
686 3300042435 Ga0439434_0006142 Ga0439434_0006142_1956_3152 392
687 3300042461 Ga0439460_0018984 Ga0439460_0018984_536_1810 392
688 3300044684 Ga0466966_0132662 Ga0466966_0132662_112_1455 392
689 3300044693 Ga0466961_0111097 Ga0466961_0111097_95_1438 392
690 3300044694 Ga0466963_0167964 Ga0466963_0167964_112_1455 392
691 3300044719 Ga0466971_0051724 Ga0466971_0051724_122_1465 392
692 3300044735 Ga0466968_0027291 Ga0466968_0027291_892_2235 392
693 3300044842 Ga0466957_0041443 Ga0466957_0041443_1278_2621 392
694 3300044842 Ga0466957_0111884 Ga0466957_0111884_360_1634 392
695 3300044901 Ga0466960_0085078 Ga0466960_0085078_82_1356 392
696 3300045049 Ga0466959_0145808 Ga0466959_0145808_273_1616 392
697 3300045836 Ga0466958_0047629 Ga0466958_0047629_1289_2563 392
698 3300045836 Ga0466958_0080462 Ga0466958_0080462_508_1851 392
699 3300045976 Ga0466967_0105079 Ga0466967_0105079_389_1663 392
700 3300045976 Ga0466967_0175043 Ga0466967_0175043_146_1420 392
701 3300045976 Ga0466967_0214140 Ga0466967_0214140_264_1607 392
702 3300046452 Ga0495617_026608 Ga0495617_026608_258_1454 392
703 3300046453 Ga0495627_015591 Ga0495627_015591_396_1592 392
704 3300046453 Ga0495627_040731 Ga0495627_040731_163_1359 392
705 3300046454 Ga0495592_0074302 Ga0495592_0074302_1080_2294 392
706 3300046454 Ga0495592_0173871 Ga0495592_0173871_90_1295 392
707 3300046459 Ga0495629_0161252 Ga0495629_0161252_53_1267 392
708 3300046460 Ga0495638_0093551 Ga0495638_0093551_416_1612 392
709 3300046462 Ga0495651_0077744 Ga0495651_0077744_1107_2312 392
710 3300046463 Ga0495653_0042189 Ga0495653_0042189_1545_2750 392
711 3300046463 Ga0495653_0075850 Ga0495653_0075850_1094_2308 392
712 3300046471 Ga0495650_0033554 Ga0495650_0033554_428_1624 392
713 3300046473 Ga0495582_0055659 Ga0495582_0055659_586_1800 392
714 3300046475 Ga0495639_0022652 Ga0495639_0022652_1323_2537 392
715 3300046476 Ga0495662_0033868 Ga0495662_0033868_172_1386 392
716 3300046477 Ga0495664_0030006 Ga0495664_0030006_1559_2773 392
717 3300046511 Ga0495608_0058694 Ga0495608_0058694_275_1480 392
718 3300046516 Ga0495628_0082475 Ga0495628_0082475_334_1539 392
719 3300046516 Ga0495628_0169762 Ga0495628_0169762_147_1352 392
720 3300046517 Ga0495630_0056928 Ga0495630_0056928_1384_2598 392
721 3300046519 Ga0495632_0000197 Ga0495632_0000197_36140_37354 392
722 3300046522 Ga0495643_0001792 Ga0495643_0001792_280_1476 392
723 3300046522 Ga0495643_0029016 Ga0495643_0029016_1026_2222 392
724 3300046522 Ga0495643_0081049 Ga0495643_0081049_140_1336 392
725 3300046524 Ga0495648_0031243 Ga0495648_0031243_180_1376 392
726 3300046524 Ga0495648_0080148 Ga0495648_0080148_235_1431 392
727 3300046529 Ga0495652_0121963 Ga0495652_0121963_676_1890 392
728 3300046529 Ga0495652_0207471 Ga0495652_0207471_257_1462 392
729 3300046536 Ga0495587_0049964 Ga0495587_0049964_1108_2313 392
730 3300046543 Ga0495645_0042142 Ga0495645_0042142_129_1334 392
731 3300046557 Ga0495622_0078687 Ga0495622_0078687_149_1345 392
732 3300046559 Ga0495667_0159799 Ga0495667_0159799_167_1372 392
733 3300046648 Ga0495611_0085065 Ga0495611_0085065_169_1365 392
734 3300046663 Ga0495635_0044022 Ga0495635_0044022_1625_2830 392
735 3300046663 Ga0495635_0101179 Ga0495635_0101179_490_1704 392
736 3300046664 Ga0495659_0013897 Ga0495659_0013897_390_1586 392
737 3300046664 Ga0495659_0050684 Ga0495659_0050684_277_1473 392
738 3300046674 Ga0495588_0017251 Ga0495588_0017251_1436_2650 392
739 3300046675 Ga0495657_0034436 Ga0495657_0034436_986_2182 392
740 3300046675 Ga0495657_0152955 Ga0495657_0152955_120_1325 392
741 3300046678 Ga0495599_0049369 Ga0495599_0049369_1310_2515 392
742 3300046680 Ga0495646_0116768 Ga0495646_0116768_78_1292 392
743 3300046681 Ga0495647_0061842 Ga0495647_0061842_195_1409 392
744 3300046683 Ga0495658_0083019 Ga0495658_0083019_165_1379 392
745 3300046684 Ga0495669_0031310 Ga0495669_0031310_48_1244 392
746 3300046689 Ga0495613_0190992 Ga0495613_0190992_161_1375 392
747 3300046690 Ga0495624_0061056 Ga0495624_0061056_1090_2304 392
748 3300046691 Ga0495670_0084117 Ga0495670_0084117_254_1450 392
749 3300046692 Ga0495671_0029158 Ga0495671_0029158_1173_2369 392
750 3300046809 Ga0495600_0092576 Ga0495600_0092576_155_1369 392
751 3300046809 Ga0495600_0131858 Ga0495600_0131858_346_1551 392
752 3300047319 Ga0495674_0109700 Ga0495674_0109700_965_2179 392
753 3300047321 Ga0495676_0084880 Ga0495676_0084880_983_2197 392
754 3300047322 Ga0495680_0083539 Ga0495680_0083539_1130_2335 392
755 3300047443 Ga0495687_060558 Ga0495687_060558_190_1386 392
756 3300047443 Ga0495687_064363 Ga0495687_064363_111_1307 392
757 3300047444 Ga0495675_0127018 Ga0495675_0127018_219_1424 392
758 3300047469 Ga0495673_0059141 Ga0495673_0059141_381_1577 392
759 3300047470 Ga0495681_0073090 Ga0495681_0073090_187_1383 392
760 3300047471 Ga0495684_0076602 Ga0495684_0076602_1254_2459 392
761 3300047472 Ga0495686_0140956 Ga0495686_0140956_68_1264 392
762 3300047673 Ga0495593_0042093 Ga0495593_0042093_520_1734 392
763 3300048088 Ga0495602_0198497 Ga0495602_0198497_157_1362 392
764 3300048090 Ga0495615_0003431 Ga0495615_0003431_1236_2432 392
765 3300048905 Ga0496102_0190555 Ga0496102_0190555_215_1411 392
766 3300048909 Ga0496106_0086902 Ga0496106_0086902_416_1612 392
767 3300048916 Ga0496113_0175436 Ga0496113_0175436_387_1583 392
768 3300048920 Ga0496117_0114862 Ga0496117_0114862_282_1496 392
769 3300048921 Ga0496118_0125911 Ga0496118_0125911_243_1439 392
770 3300048921 Ga0496118_0138711 Ga0496118_0138711_51_1265 392
771 3300048923 Ga0496120_0118214 Ga0496120_0118214_160_1356 392
772 3300048924 Ga0496121_0049894 Ga0496121_0049894_1309_2505 392
773 3300048924 Ga0496121_0091682 Ga0496121_0091682_999_2213 392
774 3300048924 Ga0496121_0156808 Ga0496121_0156808_394_1590 392
775 3300048925 Ga0496122_0045753 Ga0496122_0045753_2154_3350 392
776 3300048925 Ga0496122_0076516 Ga0496122_0076516_283_1479 392
777 3300048927 Ga0496124_0011484 Ga0496124_0011484_7367_8563 392
778 3300048927 Ga0496124_0099989 Ga0496124_0099989_680_1885 392
779 3300048927 Ga0496124_0192395 Ga0496124_0192395_210_1406 392
780 3300048928 Ga0496125_0155316 Ga0496125_0155316_174_1370 392
781 3300048929 Ga0496126_0216133 Ga0496126_0216133_124_1329 392
782 3300048929 Ga0496126_0231832 Ga0496126_0231832_161_1375 392
783 3300049460 Ga0495682_0066457 Ga0495682_0066457_80_1276 392
784 3300049521 Ga0501298_009010 Ga0501298_009010_339_1613 392
785 3300049652 Ga0501202_016120 Ga0501202_016120_107_1381 392
786 3300049681 Ga0501251_002082 Ga0501251_002082_424_1698 392
787 3300049685 Ga0501256_002896 Ga0501256_002896_27_1301 392
788 3300049690 Ga0501261_005675 Ga0501261_005675_71_1345 392
789 3300049767 Ga0501270_002546 Ga0501270_002546_535_1809 392
790 3300049771 Ga0501274_001853 Ga0501274_001853_282_1556 392
791 3300049779 Ga0501283_007359 Ga0501283_007359_70_1344 392
792 3300049851 Ga0501212_008581 Ga0501212_008581_35_1309 392
793 3300050492 nmdc:mga0yw44_55892_c1 nmdc:mga0yw44_55892_c1_185_1381 392
794 3300050494 nmdc:mga06z11_112326_c1 nmdc:mga06z11_112326_c1_81_1355 392
795 3300050509 nmdc:mga0qj67_215564_c1 nmdc:mga0qj67_215564_c1_101_1438 392
796 3300050510 nmdc:mga06r32_346185_c1 nmdc:mga06r32_346185_c1_50_1387 392
797 3300053077 Ga0495601_0061605 Ga0495601_0061605_185_1399 392
798 3300053084 Ga0495595_0097014 Ga0495595_0097014_56_1261 392
799 3300053085 Ga0495619_0045573 Ga0495619_0045573_1005_2219 392
800 3300053087 Ga0500643_025450 Ga0500643_025450_518_1714 392
801 3300053088 Ga0500644_0007640 Ga0500644_0007640_1205_2401 392
802 3300053090 Ga0500646_0036700 Ga0500646_0036700_111_1307 392
803 3300053093 Ga0500651_0117140 Ga0500651_0117140_153_1499 392
804 3300053111 Ga0500572_009025 Ga0500572_009025_1056_2252 392
805 3300053121 Ga0500607_045741 Ga0500607_045741_66_1280 392
806 3300053123 Ga0500614_006776 Ga0500614_006776_204_1418 392
807 3300053130 Ga0500642_0083304 Ga0500642_0083304_198_1394 392
808 3300053148 Ga0500590_000843 Ga0500590_000843_1478_2674 392
809 3300053153 Ga0500616_0001524 Ga0500616_0001524_8685_9899 392
810 3300053727 Ga0500611_006389 Ga0500611_006389_417_1613 392
811 iso_pu_bacteria 2511231052 2511498566 392
812 iso_pu_bacteria 2511231052 2511503405 392
813 iso_pu_bacteria 637000159 637078064 392
814 iso_pu_bacteria 641228493 641336581 392
815 iso_pu_bacteria 641228493 641336671 392
816 iso_pu_bacteria 8016557553 8016559513 392
817 3300001904 JGI24736J21556_1001629 JGI24736J21556_10016293 399
818 3300001979 JGI24740J21852_10009422 JGI24740J21852_100094222 399
819 3300001989 JGI24739J22299_10006299 JGI24739J22299_100062994 399
820 3300001990 JGI24737J22298_10008340 JGI24737J22298_100083403 399
821 3300002067 JGI24735J21928_10008586 JGI24735J21928_100085863 399
822 3300002075 JGI24738J21930_10007872 JGI24738J21930_100078723 399
823 3300005329 Ga0070683_100050969 Ga0070683_1000509694 399
824 3300005339 Ga0070660_100036157 Ga0070660_1000361574 399
825 3300005344 Ga0070661_100009928 Ga0070661_1000099286 399
826 3300005366 Ga0070659_100023370 Ga0070659_1000233703 399
827 3300005455 Ga0070663_100007527 Ga0070663_1000075274 399
828 3300005564 Ga0070664_100068047 Ga0070664_1000680475 399
829 3300005578 Ga0068854_100120330 Ga0068854_1001203302 399
830 3300025321 Ga0207656_10026497 Ga0207656_100264971 399
831 3300025904 Ga0207647_10013300 Ga0207647_100133005 399
832 3300025909 Ga0207705_10010107 Ga0207705_100101076 399
833 3300025911 Ga0207654_10004912 Ga0207654_100049125 399
834 3300025913 Ga0207695_10269459 Ga0207695_102694591 399
835 3300025914 Ga0207671_10014260 Ga0207671_100142602 399
836 3300025919 Ga0207657_10006357 Ga0207657_100063574 399
837 3300025920 Ga0207649_10028417 Ga0207649_100284172 399
838 3300025924 Ga0207694_10009301 Ga0207694_100093013 399
839 3300025932 Ga0207690_10057463 Ga0207690_100574632 399
840 3300025949 Ga0207667_10004045 Ga0207667_1000404517 399
841 3300025981 Ga0207640_10016415 Ga0207640_100164152 399
842 3300026041 Ga0207639_10012416 Ga0207639_100124166 399
843 3300026067 Ga0207678_10016055 Ga0207678_100160554 399
844 3300026078 Ga0207702_10074173 Ga0207702_100741732 399
845 3300026116 Ga0207674_10004418 Ga0207674_100044184 399
846 3300026142 Ga0207698_10003339 Ga0207698_1000333911 399

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13546

DDE_5

DDE superfamily endonuclease

23

268

0.94

PF01609

DDE_Tnp_1

Transposase DDE domain

166

374

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mus-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with resolved outside end dna 0.6435 62 388
1muh-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with transposon end dna 0.641 62 382
4dm0-assembly1.cif.gz_A-2 tn5 transposase: 20mer outside end 2 mn complex 0.6374 62 382
3ecp-assembly1.cif.gz_A-2 crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna 0.6335 62 379
3bbj-assembly1.cif.gz_A crystal structure of a putative thioesterase ii (tfu_2367) from thermobifida fusca yx at 2.45 a resolution 0.6317 271 323
ID Description Score Start End Superfamily
af_Q9H3E2_504_632_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.686 276 320 3.30.1520.10
5cz1D00 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6502 97 224 3.30.420.10
1musA02 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6214 79 350 3.90.350.10
1b7eA01 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6111 79 346 3.90.350.10
1musA02 Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 0.6043 79 350 3.90.350.10
ID Description Score Start End GO Terms
AF-A0A4R5PUL5-F1-model_v4 IS701 family transposase 0.9848 185 336
AF-A0A1R3U2G8-F1-model_v4 FOG: Transposase 0.9691 213 384
AF-A0A158S804-F1-model_v4 Transposase 0.9589 138 342
AF-A0A252B1I9-F1-model_v4 Transposase 0.9563 171 390 GO:0003677
GO:0004803
GO:0006313
AF-A0A4R5PUL5-F1-model_v4 IS701 family transposase 0.9538 185 336

Feature Viewer

pLDDT pTM Quality
74.8 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map