F483280
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 846 | 470 | 811 | 403 |
Family's Representative Sequence
| Representative Sequence | 3300005437|Ga0070710_10029533|Ga0070710_100295332 |
| Length | 490 |
| Sequence | MMGASIEATLELWASSLRDVKGRMRPLFTQERVAASAGSFLDGLLGAEQRKTGWMRAEAAGDRGPWRQQAILGRGRWDADALRDIVRDYALETLADPDAVLVLDETGFLKQGKASCGVGRQYTGSAGKITNCQIGVFAAYVSRHGHALIDRALYLPKAWTDDPARIAAAHVPACTGFATKPRLALAMIARATAANAPLAWVAADTVYGVGEIEKALRRAGKGYVLGVPGNHLFRSWGKRPPIAGMALEIAHALDPSLWKRLSAGEGTKGARLHDWAYCELADLDAAEYDDQRTGLWTRGVLIRRNIADDDMAFFSTWCPYGTSIETLVKVEGHRWAIEDSFETAKNELGLDHNESRSWHGWHRHVSLVMLAFAMMAKSHRHRSPGRSRRSAASPSVLRKDGSTPLTSLHGPSGDAYIKPSLEKLISSEICNCNARCVVPDCDGASLSLIRQGEDGLWQAFFTAAPARRRVFEPSSKRRKRAPAPLPPATA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 5 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 6 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 7 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 8 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 9 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 10 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 11 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 12 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 13 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 14 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 15 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 16 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 17 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 18 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 19 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 20 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 21 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 22 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 23 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 24 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 25 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 26 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 27 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 28 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 29 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 30 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 31 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 32 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 33 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 34 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 35 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 36 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 37 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 38 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 39 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 40 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 41 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 42 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 43 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 44 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 45 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 46 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 47 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 48 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 49 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 50 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 51 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 56 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 79 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 80 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 81 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 82 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 83 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 88 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 90 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 91 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 92 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 94 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 95 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 96 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 97 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 98 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 99 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 100 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 101 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 102 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 103 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 104 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 105 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 106 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 107 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 108 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 109 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 110 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 111 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 112 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 113 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 114 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 115 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 116 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 130 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 131 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 144 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 145 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 146 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 147 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 148 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 149 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 150 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 151 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 154 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 160 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 161 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 162 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 222 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 228 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 229 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 230 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 231 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 232 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 233 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 234 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 235 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 236 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 238 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 239 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 240 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 241 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 242 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 243 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 244 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 245 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 246 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 247 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 248 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 249 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 250 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 251 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 252 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 253 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 254 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 255 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 256 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 257 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 258 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 259 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 260 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 261 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 263 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 264 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 265 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 266 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 267 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 268 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 269 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 270 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 271 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 273 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 274 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 275 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 276 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 277 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 278 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 279 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 280 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 281 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 282 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 283 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 284 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 285 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 286 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 287 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 288 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 289 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 290 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 291 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 292 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 293 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 294 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 295 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 296 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 297 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 298 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 299 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 300 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 301 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 302 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 303 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 304 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 305 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 306 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 307 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 308 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 309 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 310 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 311 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 312 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 313 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 314 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 315 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 316 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 317 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 318 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 319 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 320 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 321 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 322 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 323 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 324 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 325 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 388 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 389 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 390 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 391 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 392 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 395 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 396 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 397 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 398 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 399 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 400 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 401 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 402 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 403 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 404 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 405 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 406 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 407 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 408 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 409 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 410 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 411 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 412 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 413 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 414 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 415 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 416 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 417 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 418 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 420 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 423 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 424 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 425 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 427 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 428 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 429 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 433 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 434 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 439 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 440 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 441 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 443 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 444 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 445 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 446 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 447 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 448 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 449 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 450 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 451 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 452 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 453 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 454 | 3300053127 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere | Metagenome | Endosphere |
| 455 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 456 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 457 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 458 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 459 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 460 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 461 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 462 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 463 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 464 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 465 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 466 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 467 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 468 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 469 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 470 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.86 |
| Metatranscriptomes | 0 |
| Isolates | 4.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.03 |
| Nodule | 2.25 |
| Rhizoplane | 4.61 |
| Rhizosphere | 80.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1001629 | 3300001904 | Bacteria | 4080 |
| 2 | JGI24736J21556_1003726 | 3300001904 | Bacteria | 2632 |
| 3 | JGI24746J21847_1001879 | 3300001977 | Bacteria | 3349 |
| 4 | JGI24746J21847_1009752 | 3300001977 | Bacteria | 1429 |
| 5 | JGI24747J21853_1001883 | 3300001978 | Bacteria | 1635 |
| 6 | JGI24740J21852_10009422 | 3300001979 | Bacteria | 3824 |
| 7 | JGI24740J21852_10013036 | 3300001979 | Bacteria | 3116 |
| 8 | JGI24740J21852_10017173 | 3300001979 | Bacteria | 2594 |
| 9 | JGI24740J21852_10037640 | 3300001979 | Bacteria | 1491 |
| 10 | JGI24739J22299_10006299 | 3300001989 | Bacteria | 4481 |
| 11 | JGI24739J22299_10011398 | 3300001989 | Bacteria | 3283 |
| 12 | JGI24739J22299_10029983 | 3300001989 | Bacteria | 1888 |
| 13 | JGI24739J22299_10042476 | 3300001989 | Bacteria | 1508 |
| 14 | JGI24737J22298_10008340 | 3300001990 | Bacteria | 3473 |
| 15 | JGI24737J22298_10017182 | 3300001990 | Bacteria | 2332 |
| 16 | JGI24737J22298_10038737 | 3300001990 | Bacteria | 1467 |
| 17 | JGI24737J22298_10040074 | 3300001990 | Bacteria | 1439 |
| 18 | JGI24737J22298_10040661 | 3300001990 | Bacteria | 1427 |
| 19 | JGI24743J22301_10013955 | 3300001991 | Bacteria | 1477 |
| 20 | JGI24735J21928_10008586 | 3300002067 | Bacteria | 3299 |
| 21 | JGI24735J21928_10035465 | 3300002067 | Bacteria | 1466 |
| 22 | JGI24735J21928_10037285 | 3300002067 | Bacteria | 1425 |
| 23 | JGI24745J21846_1000203 | 3300002073 | Bacteria | 4811 |
| 24 | JGI24745J21846_1005085 | 3300002073 | Bacteria | 1428 |
| 25 | JGI24748J21848_1002255 | 3300002074 | Bacteria | 2162 |
| 26 | JGI24748J21848_1004189 | 3300002074 | Bacteria | 1651 |
| 27 | JGI24748J21848_1005704 | 3300002074 | Bacteria | 1448 |
| 28 | JGI24738J21930_10006727 | 3300002075 | Bacteria | 2675 |
| 29 | JGI24738J21930_10006766 | 3300002075 | Bacteria | 2665 |
| 30 | JGI24738J21930_10007872 | 3300002075 | Bacteria | 2440 |
| 31 | JGI24738J21930_10017496 | 3300002075 | Bacteria | 1506 |
| 32 | JGI24738J21930_10019204 | 3300002075 | Bacteria | 1427 |
| 33 | JGI24744J21845_10017361 | 3300002077 | Bacteria | 1430 |
| 34 | JGI24033J26618_1005009 | 3300002155 | Bacteria | 1448 |
| 35 | JGI24033J26618_1005234 | 3300002155 | Bacteria | 1426 |
| 36 | JGI24034J26672_10002275 | 3300002239 | Bacteria | 2628 |
| 37 | JGI24034J26672_10005082 | 3300002239 | Bacteria | 1880 |
| 38 | JGI24034J26672_10008959 | 3300002239 | Bacteria | 1471 |
| 39 | JGI24034J26672_10009517 | 3300002239 | Bacteria | 1434 |
| 40 | JGI24742J22300_10004357 | 3300002244 | Bacteria | 2315 |
| 41 | JGI24742J22300_10004598 | 3300002244 | Bacteria | 2263 |
| 42 | JGI24751J29686_10003347 | 3300002459 | Bacteria | 3232 |
| 43 | JGI25162J39368_1005355 | 3300002737 | Bacteria | 2554 |
| 44 | JGI25152J39213_1015316 | 3300002773 | Bacteria | 1516 |
| 45 | JGI25150J39212_1012362 | 3300002774 | Bacteria | 1514 |
| 46 | JGI25151J46595_10046711 | 3300003187 | Bacteria | 1514 |
| 47 | JGI25165J46597_1004612 | 3300003214 | Bacteria | 2897 |
| 48 | JGI25153J46596_10038275 | 3300003215 | Bacteria | 1514 |
| 49 | JGI25404J52841_10019148 | 3300003659 | Bacteria | 1483 |
| 50 | Ga0055539_1003335 | 3300003752 | Bacteria | 2258 |
| 51 | Ga0055539_1003349 | 3300003752 | Bacteria | 2252 |
| 52 | Ga0055526_1027249 | 3300003771 | Bacteria | 1772 |
| 53 | Ga0065712_10018815 | 3300005290 | Bacteria | 1527 |
| 54 | Ga0065715_10120700 | 3300005293 | Bacteria | 2251 |
| 55 | Ga0070658_10182003 | 3300005327 | Bacteria | 1768 |
| 56 | Ga0070676_10054127 | 3300005328 | Bacteria | 2365 |
| 57 | Ga0070683_100050969 | 3300005329 | Bacteria | 3834 |
| 58 | Ga0070683_100180692 | 3300005329 | Bacteria | 2002 |
| 59 | Ga0070683_100276702 | 3300005329 | Bacteria | 1597 |
| 60 | Ga0070682_100164057 | 3300005337 | Bacteria | 1537 |
| 61 | Ga0068868_100188958 | 3300005338 | Bacteria | 1712 |
| 62 | Ga0068868_100201610 | 3300005338 | Bacteria | 1659 |
| 63 | Ga0068868_100273182 | 3300005338 | Bacteria | 1428 |
| 64 | Ga0070660_100036157 | 3300005339 | Bacteria | 3740 |
| 65 | Ga0070660_100088303 | 3300005339 | Bacteria | 2441 |
| 66 | Ga0070689_100063783 | 3300005340 | Bacteria | 2866 |
| 67 | Ga0070691_10026813 | 3300005341 | Bacteria | 2687 |
| 68 | Ga0070691_10041218 | 3300005341 | Bacteria | 2183 |
| 69 | Ga0070691_10086774 | 3300005341 | Bacteria | 1538 |
| 70 | Ga0070687_100019531 | 3300005343 | Bacteria | 3154 |
| 71 | Ga0070661_100009928 | 3300005344 | Bacteria | 6605 |
| 72 | Ga0070661_100068827 | 3300005344 | Bacteria | 2601 |
| 73 | Ga0070661_100130118 | 3300005344 | Bacteria | 1890 |
| 74 | Ga0070692_10093763 | 3300005345 | Bacteria | 1635 |
| 75 | Ga0070668_100159071 | 3300005347 | Bacteria | 1832 |
| 76 | Ga0070668_100169321 | 3300005347 | Bacteria | 1777 |
| 77 | Ga0070669_100112871 | 3300005353 | Bacteria | 2064 |
| 78 | Ga0070675_100052472 | 3300005354 | Bacteria | 3352 |
| 79 | Ga0070675_100095890 | 3300005354 | Bacteria | 2491 |
| 80 | Ga0070671_100246375 | 3300005355 | Bacteria | 1517 |
| 81 | Ga0070674_100105965 | 3300005356 | Bacteria | 2056 |
| 82 | Ga0070674_100108253 | 3300005356 | Bacteria | 2036 |
| 83 | Ga0070674_100230033 | 3300005356 | Bacteria | 1446 |
| 84 | Ga0070673_100177665 | 3300005364 | Bacteria | 1821 |
| 85 | Ga0070673_100182447 | 3300005364 | Bacteria | 1797 |
| 86 | Ga0070659_100023370 | 3300005366 | Bacteria | 4729 |
| 87 | Ga0070659_100048751 | 3300005366 | Bacteria | 3328 |
| 88 | Ga0070667_100088281 | 3300005367 | Bacteria | 2662 |
| 89 | Ga0070667_100101591 | 3300005367 | Bacteria | 2484 |
| 90 | Ga0070667_100214681 | 3300005367 | Bacteria | 1711 |
| 91 | Ga0070713_100279025 | 3300005436 | Bacteria | 1532 |
| 92 | Ga0070710_10029533 | 3300005437 | Bacteria | 2942 |
| 93 | Ga0070701_10134740 | 3300005438 | Bacteria | 1407 |
| 94 | Ga0070705_100036978 | 3300005440 | Bacteria | 2750 |
| 95 | Ga0070705_100039412 | 3300005440 | Bacteria | 2680 |
| 96 | Ga0070700_100166167 | 3300005441 | Bacteria | 1524 |
| 97 | Ga0070663_100007527 | 3300005455 | Bacteria | 6633 |
| 98 | Ga0070663_100083886 | 3300005455 | Bacteria | 2347 |
| 99 | Ga0070663_100258308 | 3300005455 | Bacteria | 1381 |
| 100 | Ga0070678_100166193 | 3300005456 | Bacteria | 1792 |
| 101 | Ga0070678_100188657 | 3300005456 | Bacteria | 1693 |
| 102 | Ga0070678_100260467 | 3300005456 | Bacteria | 1458 |
| 103 | Ga0070662_100074978 | 3300005457 | Bacteria | 2504 |
| 104 | Ga0070662_100145049 | 3300005457 | Bacteria | 1843 |
| 105 | Ga0070662_100173135 | 3300005457 | Bacteria | 1697 |
| 106 | Ga0068867_100187981 | 3300005459 | Bacteria | 1646 |
| 107 | Ga0070684_100137781 | 3300005535 | Bacteria | 2205 |
| 108 | Ga0070684_100169739 | 3300005535 | Bacteria | 1981 |
| 109 | Ga0068853_100031591 | 3300005539 | Bacteria | 4479 |
| 110 | Ga0068853_100161980 | 3300005539 | Bacteria | 2019 |
| 111 | Ga0068853_100326430 | 3300005539 | Bacteria | 1423 |
| 112 | Ga0070686_100058700 | 3300005544 | Bacteria | 2476 |
| 113 | Ga0070686_100166420 | 3300005544 | Bacteria | 1556 |
| 114 | Ga0070695_100145334 | 3300005545 | Bacteria | 1649 |
| 115 | Ga0070696_100219634 | 3300005546 | Bacteria | 1426 |
| 116 | Ga0070693_100174684 | 3300005547 | Bacteria | 1378 |
| 117 | Ga0070665_100227421 | 3300005548 | Bacteria | 1865 |
| 118 | Ga0070665_100311494 | 3300005548 | Bacteria | 1578 |
| 119 | Ga0070665_100372587 | 3300005548 | Bacteria | 1435 |
| 120 | Ga0070704_100199922 | 3300005549 | Bacteria | 1613 |
| 121 | Ga0068855_100340528 | 3300005563 | Bacteria | 1654 |
| 122 | Ga0068855_100442922 | 3300005563 | Bacteria | 1418 |
| 123 | Ga0070664_100038370 | 3300005564 | Bacteria | 4031 |
| 124 | Ga0070664_100068047 | 3300005564 | Bacteria | 3044 |
| 125 | Ga0068857_100077096 | 3300005577 | Bacteria | 2973 |
| 126 | Ga0068857_100245008 | 3300005577 | Bacteria | 1642 |
| 127 | Ga0068854_100054545 | 3300005578 | Bacteria | 2875 |
| 128 | Ga0068854_100076483 | 3300005578 | Bacteria | 2460 |
| 129 | Ga0068854_100120330 | 3300005578 | Bacteria | 1992 |
| 130 | Ga0068854_100185699 | 3300005578 | Bacteria | 1626 |
| 131 | Ga0068854_100211915 | 3300005578 | Bacteria | 1528 |
| 132 | Ga0068854_100229178 | 3300005578 | Bacteria | 1474 |
| 133 | Ga0068856_100239726 | 3300005614 | Bacteria | 1829 |
| 134 | Ga0068856_100246075 | 3300005614 | Bacteria | 1803 |
| 135 | Ga0068856_100384796 | 3300005614 | Bacteria | 1422 |
| 136 | Ga0070702_100090131 | 3300005615 | Bacteria | 1858 |
| 137 | Ga0070702_100157089 | 3300005615 | Bacteria | 1466 |
| 138 | Ga0068852_100108598 | 3300005616 | Bacteria | 2518 |
| 139 | Ga0068852_100182843 | 3300005616 | Bacteria | 1972 |
| 140 | Ga0068852_100259703 | 3300005616 | Bacteria | 1667 |
| 141 | Ga0068852_100360744 | 3300005616 | Bacteria | 1421 |
| 142 | Ga0068864_100128989 | 3300005618 | Bacteria | 2269 |
| 143 | Ga0068866_10094407 | 3300005718 | Bacteria | 1636 |
| 144 | Ga0068866_10111203 | 3300005718 | Bacteria | 1529 |
| 145 | Ga0068866_10144059 | 3300005718 | Bacteria | 1371 |
| 146 | Ga0068866_10173595 | 3300005718 | Bacteria | 1267 |
| 147 | Ga0068861_100209678 | 3300005719 | Bacteria | 1640 |
| 148 | Ga0068861_100282730 | 3300005719 | Bacteria | 1429 |
| 149 | Ga0068851_10034196 | 3300005834 | Bacteria | 2536 |
| 150 | Ga0068851_10061010 | 3300005834 | Bacteria | 1932 |
| 151 | Ga0068851_10115337 | 3300005834 | Bacteria | 1438 |
| 152 | Ga0068870_10123606 | 3300005840 | Bacteria | 1494 |
| 153 | Ga0068863_100194373 | 3300005841 | Bacteria | 1950 |
| 154 | Ga0068858_100128867 | 3300005842 | Bacteria | 2371 |
| 155 | Ga0068860_100090744 | 3300005843 | Bacteria | 2911 |
| 156 | Ga0068860_100149670 | 3300005843 | Bacteria | 2247 |
| 157 | Ga0068860_100203207 | 3300005843 | Bacteria | 1920 |
| 158 | Ga0068860_100309675 | 3300005843 | Bacteria | 1548 |
| 159 | Ga0068862_100228977 | 3300005844 | Bacteria | 1685 |
| 160 | Ga0068862_100370799 | 3300005844 | Bacteria | 1333 |
| 161 | Ga0081455_10059299 | 3300005937 | Bacteria | 3232 |
| 162 | Ga0081455_10097017 | 3300005937 | Bacteria | 2376 |
| 163 | Ga0081538_10025935 | 3300005981 | Bacteria | 4117 |
| 164 | Ga0081540_1029113 | 3300005983 | Bacteria | 3085 |
| 165 | Ga0075365_10065192 | 3300006038 | Bacteria | 2441 |
| 166 | Ga0075369_10024761 | 3300006186 | Bacteria | 2490 |
| 167 | Ga0068871_100199051 | 3300006358 | Bacteria | 1729 |
| 168 | Ga0075430_100155278 | 3300006846 | Bacteria | 1905 |
| 169 | Ga0075434_100338023 | 3300006871 | Bacteria | 1526 |
| 170 | Ga0075429_100237943 | 3300006880 | Bacteria | 1595 |
| 171 | Ga0068865_100166182 | 3300006881 | Bacteria | 1687 |
| 172 | Ga0075436_100037047 | 3300006914 | Bacteria | 3367 |
| 173 | Ga0075435_100215460 | 3300007076 | Bacteria | 1630 |
| 174 | Ga0099794_10066792 | 3300007265 | Bacteria | 1755 |
| 175 | Ga0105251_10028297 | 3300009011 | Bacteria | 2833 |
| 176 | Ga0105251_10088488 | 3300009011 | Bacteria | 1425 |
| 177 | Ga0105250_10041120 | 3300009092 | Bacteria | 1854 |
| 178 | Ga0105240_10000308 | 3300009093 | Bacteria | 94340 |
| 179 | Ga0105240_10266717 | 3300009093 | Bacteria | 1973 |
| 180 | Ga0105240_10295080 | 3300009093 | Bacteria | 1857 |
| 181 | Ga0105240_10459403 | 3300009093 | Bacteria | 1423 |
| 182 | Ga0105245_10109986 | 3300009098 | Bacteria | 2562 |
| 183 | Ga0105245_10282682 | 3300009098 | Bacteria | 1622 |
| 184 | Ga0105245_10286936 | 3300009098 | Bacteria | 1611 |
| 185 | Ga0105247_10118728 | 3300009101 | Bacteria | 1711 |
| 186 | Ga0105247_10150533 | 3300009101 | Bacteria | 1533 |
| 187 | Ga0105241_10222877 | 3300009174 | Bacteria | 1586 |
| 188 | Ga0105241_10282350 | 3300009174 | Bacteria | 1418 |
| 189 | Ga0105242_10116637 | 3300009176 | Bacteria | 2284 |
| 190 | Ga0105248_10066968 | 3300009177 | Bacteria | 4032 |
| 191 | Ga0105248_10102143 | 3300009177 | Bacteria | 3232 |
| 192 | Ga0105248_10416183 | 3300009177 | Bacteria | 1513 |
| 193 | Ga0105237_10000931 | 3300009545 | Bacteria | 39411 |
| 194 | Ga0105237_10305888 | 3300009545 | Bacteria | 1593 |
| 195 | Ga0105237_10377046 | 3300009545 | Bacteria | 1423 |
| 196 | Ga0105237_10377990 | 3300009545 | Bacteria | 1421 |
| 197 | Ga0105238_10033243 | 3300009551 | Bacteria | 5249 |
| 198 | Ga0105238_10175469 | 3300009551 | Bacteria | 2120 |
| 199 | Ga0105238_10370664 | 3300009551 | Bacteria | 1422 |
| 200 | Ga0105249_10029672 | 3300009553 | Bacteria | 4940 |
| 201 | Ga0105249_10047410 | 3300009553 | Bacteria | 3916 |
| 202 | Ga0105249_10135759 | 3300009553 | Bacteria | 2353 |
| 203 | Ga0105249_10155248 | 3300009553 | Bacteria | 2207 |
| 204 | Ga0105249_10176321 | 3300009553 | Bacteria | 2076 |
| 205 | Ga0105239_10000535 | 3300010375 | Bacteria | 55025 |
| 206 | Ga0105239_10340666 | 3300010375 | Bacteria | 1692 |
| 207 | Ga0105239_10405500 | 3300010375 | Bacteria | 1543 |
| 208 | Ga0105239_10476291 | 3300010375 | Bacteria | 1418 |
| 209 | Ga0105246_10032799 | 3300011119 | Bacteria | 3447 |
| 210 | Ga0105246_10113862 | 3300011119 | Bacteria | 1992 |
| 211 | Ga0105246_10148400 | 3300011119 | Bacteria | 1772 |
| 212 | Ga0105246_10254240 | 3300011119 | Bacteria | 1396 |
| 213 | Ga0157346_1000434 | 3300012480 | Bacteria | 1771 |
| 214 | Ga0157326_1003224 | 3300012513 | Bacteria | 1723 |
| 215 | Ga0157373_10057003 | 3300013100 | Bacteria | 2772 |
| 216 | Ga0157373_10188625 | 3300013100 | Bacteria | 1453 |
| 217 | Ga0157371_10057231 | 3300013102 | Bacteria | 2765 |
| 218 | Ga0157371_10113596 | 3300013102 | Bacteria | 1923 |
| 219 | Ga0157371_10207790 | 3300013102 | Bacteria | 1404 |
| 220 | Ga0157370_10000481 | 3300013104 | Bacteria | 49689 |
| 221 | Ga0157370_10184762 | 3300013104 | Bacteria | 1936 |
| 222 | Ga0157369_10304516 | 3300013105 | Bacteria | 1657 |
| 223 | Ga0157374_10305477 | 3300013296 | Bacteria | 1574 |
| 224 | Ga0157378_10143919 | 3300013297 | Bacteria | 2216 |
| 225 | Ga0163162_10206598 | 3300013306 | Bacteria | 2093 |
| 226 | Ga0163162_10336394 | 3300013306 | Bacteria | 1642 |
| 227 | Ga0157372_10255388 | 3300013307 | Bacteria | 2035 |
| 228 | Ga0157372_10549251 | 3300013307 | Bacteria | 1347 |
| 229 | Ga0157380_10097019 | 3300014326 | Bacteria | 2445 |
| 230 | Ga0157380_10278421 | 3300014326 | Bacteria | 1529 |
| 231 | Ga0157380_10324302 | 3300014326 | Bacteria | 1429 |
| 232 | Ga0182008_10064832 | 3300014497 | Bacteria | 1798 |
| 233 | Ga0157377_10068544 | 3300014745 | Bacteria | 2044 |
| 234 | Ga0157379_10063705 | 3300014968 | Bacteria | 3295 |
| 235 | Ga0157379_10164985 | 3300014968 | Bacteria | 1999 |
| 236 | Ga0157376_10145642 | 3300014969 | Bacteria | 2130 |
| 237 | Ga0157376_10251513 | 3300014969 | Bacteria | 1651 |
| 238 | Ga0182007_10002448 | 3300015262 | Bacteria | 9223 |
| 239 | Ga0163161_10110263 | 3300017792 | Bacteria | 2057 |
| 240 | Ga0163161_10223205 | 3300017792 | Bacteria | 1460 |
| 241 | Ga0213874_10026637 | 3300021377 | Bacteria | 1638 |
| 242 | Ga0213876_10039350 | 3300021384 | Bacteria | 2497 |
| 243 | Ga0213876_10061079 | 3300021384 | Bacteria | 1988 |
| 244 | Ga0213875_10035242 | 3300021388 | Bacteria | 2361 |
| 245 | Ga0213875_10091052 | 3300021388 | Bacteria | 1422 |
| 246 | Ga0213871_10021369 | 3300021441 | Bacteria | 1612 |
| 247 | Ga0228598_1017406 | 3300024227 | Bacteria | 1418 |
| 248 | Ga0207672_1001902 | 3300025223 | Bacteria | 1388 |
| 249 | Ga0209437_102208 | 3300025233 | Bacteria | 3868 |
| 250 | Ga0209646_1003033 | 3300025246 | Bacteria | 3448 |
| 251 | Ga0209677_100188 | 3300025253 | Bacteria | 50341 |
| 252 | Ga0209677_111076 | 3300025253 | Bacteria | 1440 |
| 253 | Ga0209233_1023826 | 3300025261 | Bacteria | 1542 |
| 254 | Ga0209233_1026373 | 3300025261 | Bacteria | 1422 |
| 255 | Ga0207666_1004706 | 3300025271 | Bacteria | 1720 |
| 256 | Ga0209673_1020412 | 3300025273 | Bacteria | 2347 |
| 257 | Ga0207673_1002108 | 3300025290 | Bacteria | 2235 |
| 258 | Ga0209675_1017841 | 3300025291 | Bacteria | 2010 |
| 259 | Ga0209564_1009330 | 3300025295 | Bacteria | 4687 |
| 260 | Ga0209256_1018117 | 3300025299 | Bacteria | 2306 |
| 261 | Ga0207697_10018927 | 3300025315 | Bacteria | 2822 |
| 262 | Ga0207656_10019888 | 3300025321 | Bacteria | 2660 |
| 263 | Ga0207656_10026497 | 3300025321 | Bacteria | 2364 |
| 264 | Ga0207656_10081977 | 3300025321 | Bacteria | 1451 |
| 265 | Ga0207696_1031544 | 3300025711 | Bacteria | 1602 |
| 266 | Ga0207655_1064872 | 3300025728 | Bacteria | 1390 |
| 267 | Ga0207713_1008718 | 3300025735 | Bacteria | 5791 |
| 268 | Ga0207713_1060450 | 3300025735 | Bacteria | 1448 |
| 269 | Ga0207682_10008521 | 3300025893 | Bacteria | 4052 |
| 270 | Ga0207642_10065310 | 3300025899 | Bacteria | 1709 |
| 271 | Ga0207642_10078292 | 3300025899 | Bacteria | 1597 |
| 272 | Ga0207642_10113707 | 3300025899 | Bacteria | 1383 |
| 273 | Ga0207710_10032775 | 3300025900 | Bacteria | 2277 |
| 274 | Ga0207688_10018361 | 3300025901 | Bacteria | 3806 |
| 275 | Ga0207688_10034576 | 3300025901 | Bacteria | 2799 |
| 276 | Ga0207688_10091350 | 3300025901 | Bacteria | 1749 |
| 277 | Ga0207680_10176474 | 3300025903 | Bacteria | 1442 |
| 278 | Ga0207647_10013300 | 3300025904 | Bacteria | 5710 |
| 279 | Ga0207647_10044628 | 3300025904 | Bacteria | 2768 |
| 280 | Ga0207647_10100121 | 3300025904 | Bacteria | 1720 |
| 281 | Ga0207685_10069084 | 3300025905 | Bacteria | 1426 |
| 282 | Ga0207645_10046984 | 3300025907 | Bacteria | 2757 |
| 283 | Ga0207645_10064768 | 3300025907 | Bacteria | 2335 |
| 284 | Ga0207643_10120175 | 3300025908 | Bacteria | 1556 |
| 285 | Ga0207705_10010107 | 3300025909 | Bacteria | 6870 |
| 286 | Ga0207684_10121641 | 3300025910 | Bacteria | 2238 |
| 287 | Ga0207654_10004912 | 3300025911 | Bacteria | 6770 |
| 288 | Ga0207654_10150907 | 3300025911 | Bacteria | 1491 |
| 289 | Ga0207654_10167603 | 3300025911 | Bacteria | 1424 |
| 290 | Ga0207695_10269459 | 3300025913 | Bacteria | 1599 |
| 291 | Ga0207695_10326818 | 3300025913 | Bacteria | 1423 |
| 292 | Ga0207695_10364776 | 3300025913 | Bacteria | 1331 |
| 293 | Ga0207671_10006891 | 3300025914 | Bacteria | 10027 |
| 294 | Ga0207671_10014260 | 3300025914 | Bacteria | 6289 |
| 295 | Ga0207671_10239936 | 3300025914 | Bacteria | 1424 |
| 296 | Ga0207671_10242248 | 3300025914 | Bacteria | 1417 |
| 297 | Ga0207660_10232043 | 3300025917 | Bacteria | 1451 |
| 298 | Ga0207662_10013371 | 3300025918 | Bacteria | 4590 |
| 299 | Ga0207662_10057318 | 3300025918 | Bacteria | 2328 |
| 300 | Ga0207657_10006357 | 3300025919 | Bacteria | 12272 |
| 301 | Ga0207657_10067535 | 3300025919 | Bacteria | 3040 |
| 302 | Ga0207649_10028417 | 3300025920 | Bacteria | 3292 |
| 303 | Ga0207649_10039631 | 3300025920 | Bacteria | 2858 |
| 304 | Ga0207649_10150955 | 3300025920 | Bacteria | 1600 |
| 305 | Ga0207681_10151217 | 3300025923 | Bacteria | 1740 |
| 306 | Ga0207681_10214187 | 3300025923 | Bacteria | 1486 |
| 307 | Ga0207681_10233510 | 3300025923 | Bacteria | 1428 |
| 308 | Ga0207694_10009301 | 3300025924 | Bacteria | 7416 |
| 309 | Ga0207694_10239001 | 3300025924 | Bacteria | 1484 |
| 310 | Ga0207694_10261335 | 3300025924 | Bacteria | 1418 |
| 311 | Ga0207650_10094429 | 3300025925 | Bacteria | 2291 |
| 312 | Ga0207650_10248628 | 3300025925 | Bacteria | 1439 |
| 313 | Ga0207659_10212501 | 3300025926 | Bacteria | 1551 |
| 314 | Ga0207659_10237755 | 3300025926 | Bacteria | 1472 |
| 315 | Ga0207687_10175879 | 3300025927 | Bacteria | 1655 |
| 316 | Ga0207644_10176541 | 3300025931 | Bacteria | 1671 |
| 317 | Ga0207644_10293787 | 3300025931 | Bacteria | 1307 |
| 318 | Ga0207690_10057463 | 3300025932 | Bacteria | 2628 |
| 319 | Ga0207706_10051587 | 3300025933 | Bacteria | 3632 |
| 320 | Ga0207706_10052391 | 3300025933 | Bacteria | 3603 |
| 321 | Ga0207706_10052960 | 3300025933 | Bacteria | 3583 |
| 322 | Ga0207706_10062748 | 3300025933 | Bacteria | 3272 |
| 323 | Ga0207706_10087799 | 3300025933 | Bacteria | 2735 |
| 324 | Ga0207686_10194181 | 3300025934 | Bacteria | 1449 |
| 325 | Ga0207709_10175405 | 3300025935 | Bacteria | 1509 |
| 326 | Ga0207709_10195720 | 3300025935 | Bacteria | 1440 |
| 327 | Ga0207669_10204042 | 3300025937 | Bacteria | 1437 |
| 328 | Ga0207704_10063944 | 3300025938 | Bacteria | 2296 |
| 329 | Ga0207665_10101688 | 3300025939 | Bacteria | 2007 |
| 330 | Ga0207691_10121420 | 3300025940 | Bacteria | 2315 |
| 331 | Ga0207691_10145990 | 3300025940 | Bacteria | 2082 |
| 332 | Ga0207711_10073795 | 3300025941 | Bacteria | 2966 |
| 333 | Ga0207711_10292412 | 3300025941 | Bacteria | 1502 |
| 334 | Ga0207689_10035246 | 3300025942 | Bacteria | 4158 |
| 335 | Ga0207689_10067675 | 3300025942 | Bacteria | 2935 |
| 336 | Ga0207689_10068141 | 3300025942 | Bacteria | 2925 |
| 337 | Ga0207661_10271556 | 3300025944 | Bacteria | 1513 |
| 338 | Ga0207661_10287175 | 3300025944 | Bacteria | 1471 |
| 339 | Ga0207679_10242350 | 3300025945 | Bacteria | 1528 |
| 340 | Ga0207667_10004045 | 3300025949 | Bacteria | 18017 |
| 341 | Ga0207667_10319500 | 3300025949 | Bacteria | 1586 |
| 342 | Ga0207667_10406565 | 3300025949 | Bacteria | 1386 |
| 343 | Ga0207651_10217384 | 3300025960 | Bacteria | 1542 |
| 344 | Ga0207712_10017722 | 3300025961 | Bacteria | 4629 |
| 345 | Ga0207712_10155207 | 3300025961 | Bacteria | 1772 |
| 346 | Ga0207712_10191246 | 3300025961 | Bacteria | 1616 |
| 347 | Ga0207712_10196062 | 3300025961 | Bacteria | 1598 |
| 348 | Ga0207712_10241668 | 3300025961 | Bacteria | 1455 |
| 349 | Ga0207668_10236841 | 3300025972 | Bacteria | 1474 |
| 350 | Ga0207668_10248053 | 3300025972 | Bacteria | 1444 |
| 351 | Ga0207668_10251502 | 3300025972 | Bacteria | 1435 |
| 352 | Ga0207640_10016415 | 3300025981 | Bacteria | 4307 |
| 353 | Ga0207640_10057504 | 3300025981 | Bacteria | 2558 |
| 354 | Ga0207640_10208569 | 3300025981 | Bacteria | 1487 |
| 355 | Ga0207640_10214025 | 3300025981 | Bacteria | 1470 |
| 356 | Ga0207640_10218912 | 3300025981 | Bacteria | 1456 |
| 357 | Ga0207658_10184405 | 3300025986 | Bacteria | 1729 |
| 358 | Ga0207658_10242884 | 3300025986 | Bacteria | 1526 |
| 359 | Ga0207677_10077830 | 3300026023 | Bacteria | 2366 |
| 360 | Ga0207677_10091831 | 3300026023 | Bacteria | 2209 |
| 361 | Ga0207677_10253259 | 3300026023 | Bacteria | 1431 |
| 362 | Ga0207703_10280410 | 3300026035 | Bacteria | 1513 |
| 363 | Ga0207703_10303758 | 3300026035 | Bacteria | 1456 |
| 364 | Ga0207639_10012416 | 3300026041 | Bacteria | 5930 |
| 365 | Ga0207639_10102542 | 3300026041 | Bacteria | 2316 |
| 366 | Ga0207639_10240596 | 3300026041 | Bacteria | 1573 |
| 367 | Ga0207639_10270885 | 3300026041 | Bacteria | 1489 |
| 368 | Ga0207678_10016055 | 3300026067 | Bacteria | 6576 |
| 369 | Ga0207678_10044268 | 3300026067 | Bacteria | 3850 |
| 370 | Ga0207678_10059527 | 3300026067 | Bacteria | 3286 |
| 371 | Ga0207678_10064579 | 3300026067 | Bacteria | 3145 |
| 372 | Ga0207678_10109189 | 3300026067 | Bacteria | 2360 |
| 373 | Ga0207678_10219621 | 3300026067 | Bacteria | 1627 |
| 374 | Ga0207708_10045868 | 3300026075 | Bacteria | 3331 |
| 375 | Ga0207708_10053639 | 3300026075 | Bacteria | 3072 |
| 376 | Ga0207708_10082010 | 3300026075 | Bacteria | 2479 |
| 377 | Ga0207708_10113657 | 3300026075 | Bacteria | 2104 |
| 378 | Ga0207702_10074173 | 3300026078 | Bacteria | 2936 |
| 379 | Ga0207702_10329893 | 3300026078 | Bacteria | 1455 |
| 380 | Ga0207702_10345511 | 3300026078 | Bacteria | 1422 |
| 381 | Ga0207641_10294581 | 3300026088 | Bacteria | 1530 |
| 382 | Ga0207641_10320114 | 3300026088 | Bacteria | 1470 |
| 383 | Ga0207648_10129458 | 3300026089 | Bacteria | 2221 |
| 384 | Ga0207648_10146339 | 3300026089 | Bacteria | 2084 |
| 385 | Ga0207676_10141604 | 3300026095 | Bacteria | 2059 |
| 386 | Ga0207676_10246588 | 3300026095 | Bacteria | 1605 |
| 387 | Ga0207676_10252292 | 3300026095 | Bacteria | 1589 |
| 388 | Ga0207674_10004418 | 3300026116 | Bacteria | 16920 |
| 389 | Ga0207674_10034570 | 3300026116 | Bacteria | 5281 |
| 390 | Ga0207674_10271371 | 3300026116 | Bacteria | 1644 |
| 391 | Ga0207683_10076955 | 3300026121 | Bacteria | 2954 |
| 392 | Ga0207683_10141143 | 3300026121 | Bacteria | 2171 |
| 393 | Ga0207683_10216598 | 3300026121 | Bacteria | 1744 |
| 394 | Ga0207698_10003339 | 3300026142 | Bacteria | 9657 |
| 395 | Ga0207698_10051504 | 3300026142 | Bacteria | 3148 |
| 396 | Ga0207698_10065520 | 3300026142 | Bacteria | 2854 |
| 397 | Ga0207698_10334838 | 3300026142 | Bacteria | 1423 |
| 398 | Ga0207428_10207642 | 3300027907 | Bacteria | 1473 |
| 399 | Ga0268266_10183783 | 3300028379 | Bacteria | 1905 |
| 400 | Ga0268266_10242374 | 3300028379 | Bacteria | 1664 |
| 401 | Ga0268265_10254523 | 3300028380 | Bacteria | 1557 |
| 402 | Ga0268265_10294379 | 3300028380 | Bacteria | 1458 |
| 403 | Ga0268264_10121962 | 3300028381 | Bacteria | 2298 |
| 404 | Ga0268264_10308467 | 3300028381 | Bacteria | 1492 |
| 405 | Ga0268264_10384610 | 3300028381 | Bacteria | 1344 |
| 406 | Ga0307517_10158121 | 3300028786 | Bacteria | 1530 |
| 407 | Ga0307517_10162880 | 3300028786 | Bacteria | 1491 |
| 408 | Ga0307515_10238113 | 3300028794 | Bacteria | 1597 |
| 409 | Ga0307515_10261552 | 3300028794 | Bacteria | 1466 |
| 410 | Ga0307512_10078909 | 3300030522 | Bacteria | 2381 |
| 411 | Ga0307513_10225373 | 3300031456 | Bacteria | 1692 |
| 412 | Ga0307509_10262469 | 3300031507 | Bacteria | 1501 |
| 413 | Ga0307408_100247957 | 3300031548 | Bacteria | 1467 |
| 414 | Ga0307408_100314248 | 3300031548 | Bacteria | 1317 |
| 415 | Ga0316575_10010037 | 3300031665 | Bacteria | 3472 |
| 416 | Ga0316575_10054395 | 3300031665 | Bacteria | 1594 |
| 417 | Ga0316579_10059565 | 3300031691 | Bacteria | 1794 |
| 418 | Ga0316579_10088354 | 3300031691 | Bacteria | 1479 |
| 419 | Ga0316576_10050140 | 3300031727 | Bacteria | 3034 |
| 420 | Ga0316578_10030994 | 3300031728 | Bacteria | 3043 |
| 421 | Ga0307516_10257976 | 3300031730 | Bacteria | 1434 |
| 422 | Ga0307405_10056244 | 3300031731 | Bacteria | 2466 |
| 423 | Ga0307405_10086883 | 3300031731 | Bacteria | 2059 |
| 424 | Ga0307405_10136463 | 3300031731 | Bacteria | 1704 |
| 425 | Ga0316577_10042126 | 3300031733 | Bacteria | 2554 |
| 426 | Ga0307413_10057187 | 3300031824 | Bacteria | 2383 |
| 427 | Ga0307410_10216579 | 3300031852 | Bacteria | 1470 |
| 428 | Ga0307410_10224597 | 3300031852 | Bacteria | 1446 |
| 429 | Ga0307406_10143715 | 3300031901 | Bacteria | 1692 |
| 430 | Ga0307407_10044636 | 3300031903 | Bacteria | 2499 |
| 431 | Ga0307407_10160545 | 3300031903 | Bacteria | 1470 |
| 432 | Ga0307412_10143976 | 3300031911 | Bacteria | 1749 |
| 433 | Ga0307412_10177747 | 3300031911 | Bacteria | 1597 |
| 434 | Ga0307412_10283114 | 3300031911 | Bacteria | 1302 |
| 435 | Ga0307409_100280983 | 3300031995 | Bacteria | 1538 |
| 436 | Ga0307409_100304378 | 3300031995 | Bacteria | 1484 |
| 437 | Ga0307416_100256260 | 3300032002 | Bacteria | 1706 |
| 438 | Ga0307416_100288686 | 3300032002 | Bacteria | 1622 |
| 439 | Ga0307416_100314051 | 3300032002 | Bacteria | 1565 |
| 440 | Ga0307414_10100285 | 3300032004 | Bacteria | 2177 |
| 441 | Ga0307414_10206720 | 3300032004 | Bacteria | 1601 |
| 442 | Ga0307414_10234584 | 3300032004 | Bacteria | 1515 |
| 443 | Ga0307411_10098287 | 3300032005 | Bacteria | 2062 |
| 444 | Ga0307415_100229999 | 3300032126 | Bacteria | 1492 |
| 445 | Ga0307415_100238026 | 3300032126 | Bacteria | 1470 |
| 446 | Ga0316583_10013438 | 3300032133 | Bacteria | 2954 |
| 447 | Ga0316583_10024088 | 3300032133 | Bacteria | 2173 |
| 448 | Ga0316583_10044883 | 3300032133 | Bacteria | 1561 |
| 449 | Ga0316585_10017297 | 3300032137 | Bacteria | 2179 |
| 450 | Ga0316580_10005200 | 3300032139 | Bacteria | 3788 |
| 451 | Ga0307510_10229246 | 3300033180 | Bacteria | 1361 |
| 452 | Ga0373930_0010223 | 3300034816 | Bacteria | 1673 |
| 453 | Ga0373948_0002181 | 3300034817 | Bacteria | 2855 |
| 454 | Ga0373950_0009520 | 3300034818 | Bacteria | 1553 |
| 455 | Ga0373950_0012048 | 3300034818 | Bacteria | 1422 |
| 456 | Ga0373958_0011236 | 3300034819 | Bacteria | 1509 |
| 457 | Ga0373959_0003787 | 3300034820 | Bacteria | 2422 |
| 458 | Ga0373938_0015854 | 3300034957 | Bacteria | 1465 |
| 459 | Ga0373926_0049853 | 3300035083 | Bacteria | 1508 |
| 460 | Ga0373928_0005341 | 3300035084 | Bacteria | 2454 |
| 461 | Ga0373928_0006474 | 3300035084 | Bacteria | 2251 |
| 462 | Ga0373934_0062852 | 3300035086 | Bacteria | 1480 |
| 463 | Ga0373940_0015337 | 3300035088 | Bacteria | 1883 |
| 464 | Ga0373940_0028238 | 3300035088 | Bacteria | 1479 |
| 465 | Ga0373944_0012435 | 3300035089 | Bacteria | 2345 |
| 466 | Ga0373949_0004601 | 3300035090 | Bacteria | 3144 |
| 467 | Ga0373923_0015651 | 3300035111 | Bacteria | 2867 |
| 468 | Ga0373923_0025794 | 3300035111 | Bacteria | 2332 |
| 469 | Ga0373936_0020407 | 3300035113 | Bacteria | 2574 |
| 470 | Ga0373936_0070207 | 3300035113 | Bacteria | 1442 |
| 471 | Ga0373939_0028664 | 3300035114 | Bacteria | 1586 |
| 472 | Ga0373941_0009046 | 3300035115 | Bacteria | 2496 |
| 473 | Ga0373941_0010267 | 3300035115 | Bacteria | 2386 |
| 474 | Ga0373945_0046229 | 3300035116 | Bacteria | 1587 |
| 475 | Ga0373953_0044256 | 3300035117 | Bacteria | 1779 |
| 476 | Ga0373953_0063118 | 3300035117 | Bacteria | 1517 |
| 477 | Ga0373954_0089071 | 3300035118 | Bacteria | 1480 |
| 478 | Ga0373954_0089587 | 3300035118 | Bacteria | 1476 |
| 479 | Ga0373956_0036984 | 3300035119 | Bacteria | 2156 |
| 480 | Ga0373956_0067958 | 3300035119 | Bacteria | 1622 |
| 481 | Ga0373957_0018967 | 3300035120 | Bacteria | 2414 |
| 482 | Ga0373957_0043032 | 3300035120 | Bacteria | 1705 |
| 483 | Ga0373943_0039207 | 3300035170 | Bacteria | 2281 |
| 484 | Ga0373946_0045710 | 3300035171 | Bacteria | 1812 |
| 485 | Ga0373946_0072989 | 3300035171 | Bacteria | 1486 |
| 486 | Ga0373955_0108375 | 3300035172 | Bacteria | 1603 |
| 487 | Ga0373955_0114869 | 3300035172 | Bacteria | 1559 |
| 488 | Ga0373942_0012635 | 3300035207 | Bacteria | 2021 |
| 489 | Ga0373942_0014057 | 3300035207 | Bacteria | 1932 |
| 490 | Ga0373942_0027947 | 3300035207 | Bacteria | 1471 |
| 491 | Ga0373961_0021039 | 3300035241 | Bacteria | 1731 |
| 492 | Ga0373962_0030931 | 3300035242 | Bacteria | 1466 |
| 493 | Ga0316574_0031946 | 3300035398 | Bacteria | 3196 |
| 494 | Ga0373924_0014650 | 3300035410 | Bacteria | 2965 |
| 495 | Ga0373924_0070424 | 3300035410 | Bacteria | 1474 |
| 496 | Ga0373931_0008147 | 3300035691 | Bacteria | 4964 |
| 497 | Ga0373931_0041894 | 3300035691 | Bacteria | 2406 |
| 498 | Ga0373931_0042527 | 3300035691 | Bacteria | 2389 |
| 499 | Ga0373935_0037418 | 3300035692 | Bacteria | 3036 |
| 500 | Ga0373935_0092120 | 3300035692 | Bacteria | 1985 |
| 501 | Ga0373935_0171448 | 3300035692 | Bacteria | 1484 |
| 502 | Ga0373927_0092326 | 3300035695 | Bacteria | 1966 |
| 503 | Ga0373933_0113942 | 3300035724 | Bacteria | 1688 |
| 504 | Ga0373933_0135460 | 3300035724 | Bacteria | 1551 |
| 505 | Ga0373947_0110499 | 3300035725 | Bacteria | 1736 |
| 506 | Ga0373947_0176269 | 3300035725 | Bacteria | 1389 |
| 507 | Ga0373937_0283911 | 3300036401 | Bacteria | 1563 |
| 508 | Ga0316582_0015441 | 3300036647 | Bacteria | 4368 |
| 509 | Ga0316582_0061508 | 3300036647 | Bacteria | 2408 |
| 510 | Ga0316584_0016275 | 3300036712 | Bacteria | 5331 |
| 511 | Ga0373925_0092348 | 3300037068 | Bacteria | 2315 |
| 512 | Ga0373925_0226506 | 3300037068 | Bacteria | 1493 |
| 513 | Ga0373925_0245852 | 3300037068 | Bacteria | 1434 |
| 514 | Ga0395899_0163493 | 3300037312 | Bacteria | 1571 |
| 515 | Ga0395898_0252085 | 3300037466 | Bacteria | 1683 |
| 516 | Ga0395898_0317804 | 3300037466 | Bacteria | 1485 |
| 517 | Ga0316581_0012173 | 3300037588 | Bacteria | 2418 |
| 518 | Ga0316581_0034990 | 3300037588 | Bacteria | 1521 |
| 519 | Ga0436364_0200835 | 3300037853 | Bacteria | 3219 |
| 520 | Ga0436364_1218439 | 3300037853 | Bacteria | 1757 |
| 521 | Ga0436364_1239479 | 3300037853 | Bacteria | 2184 |
| 522 | Ga0436365_0422968 | 3300039437 | Bacteria | 1890 |
| 523 | Ga0436360_0084886 | 3300039438 | Bacteria | 2542 |
| 524 | Ga0436360_0148117 | 3300039438 | Bacteria | 3286 |
| 525 | Ga0436360_0894651 | 3300039438 | Bacteria | 1623 |
| 526 | Ga0436363_0261507 | 3300039450 | Bacteria | 4213 |
| 527 | Ga0436363_0277506 | 3300039450 | Bacteria | 1696 |
| 528 | Ga0436363_1149058 | 3300039450 | Bacteria | 7197 |
| 529 | Ga0436363_1611071 | 3300039450 | Bacteria | 1554 |
| 530 | Ga0439436_0023562 | 3300041404 | Bacteria | 1820 |
| 531 | Ga0439438_029343 | 3300041405 | Bacteria | 1472 |
| 532 | Ga0439439_0007978 | 3300041406 | Bacteria | 2488 |
| 533 | Ga0439439_0013190 | 3300041406 | Bacteria | 2002 |
| 534 | Ga0439461_0018148 | 3300041410 | Bacteria | 1374 |
| 535 | Ga0439466_0012851 | 3300041411 | Bacteria | 3071 |
| 536 | Ga0439466_0023393 | 3300041411 | Bacteria | 2173 |
| 537 | Ga0439465_0023758 | 3300041413 | Bacteria | 1930 |
| 538 | Ga0439465_0026088 | 3300041413 | Bacteria | 1846 |
| 539 | Ga0439431_0007448 | 3300041997 | Bacteria | 2441 |
| 540 | Ga0439433_0007590 | 3300041999 | Bacteria | 2344 |
| 541 | Ga0439442_004918 | 3300042002 | Bacteria | 2662 |
| 542 | Ga0439445_0011925 | 3300042004 | Bacteria | 2079 |
| 543 | Ga0439432_019040 | 3300042006 | Bacteria | 2290 |
| 544 | Ga0439432_032108 | 3300042006 | Bacteria | 1695 |
| 545 | Ga0439449_0015464 | 3300042007 | Bacteria | 2867 |
| 546 | Ga0439449_0036471 | 3300042007 | Bacteria | 1829 |
| 547 | Ga0439450_023567 | 3300042008 | Bacteria | 1336 |
| 548 | Ga0439452_026401 | 3300042010 | Bacteria | 1465 |
| 549 | Ga0439457_007919 | 3300042014 | Bacteria | 2525 |
| 550 | Ga0439462_0003810 | 3300042015 | Bacteria | 3639 |
| 551 | Ga0439462_0008518 | 3300042015 | Bacteria | 2588 |
| 552 | Ga0439434_0006142 | 3300042435 | Bacteria | 3501 |
| 553 | Ga0439460_0018984 | 3300042461 | Bacteria | 1857 |
| 554 | Ga0466966_0132662 | 3300044684 | Bacteria | 1524 |
| 555 | Ga0466961_0111097 | 3300044693 | Bacteria | 1724 |
| 556 | Ga0466963_0167964 | 3300044694 | Bacteria | 1528 |
| 557 | Ga0466963_0213314 | 3300044694 | Bacteria | 1351 |
| 558 | Ga0466971_0051724 | 3300044719 | Bacteria | 1849 |
| 559 | Ga0466968_0027291 | 3300044735 | Bacteria | 2349 |
| 560 | Ga0466968_0027393 | 3300044735 | Bacteria | 2345 |
| 561 | Ga0466957_0041443 | 3300044842 | Bacteria | 2784 |
| 562 | Ga0466957_0111884 | 3300044842 | Bacteria | 1732 |
| 563 | Ga0466960_0085078 | 3300044901 | Bacteria | 1601 |
| 564 | Ga0466960_0108304 | 3300044901 | Bacteria | 1440 |
| 565 | Ga0466959_0145808 | 3300045049 | Bacteria | 1670 |
| 566 | Ga0466958_0047629 | 3300045836 | Bacteria | 2588 |
| 567 | Ga0466958_0080462 | 3300045836 | Bacteria | 2004 |
| 568 | Ga0466967_0105079 | 3300045976 | Bacteria | 2587 |
| 569 | Ga0466967_0175043 | 3300045976 | Bacteria | 2021 |
| 570 | Ga0466967_0214140 | 3300045976 | Bacteria | 1828 |
| 571 | Ga0466967_0454943 | 3300045976 | Bacteria | 1251 |
| 572 | Ga0495617_026608 | 3300046452 | Bacteria | 1948 |
| 573 | Ga0495627_015591 | 3300046453 | Bacteria | 2620 |
| 574 | Ga0495627_040731 | 3300046453 | Bacteria | 1429 |
| 575 | Ga0495592_0074302 | 3300046454 | Bacteria | 2469 |
| 576 | Ga0495592_0173871 | 3300046454 | Bacteria | 1472 |
| 577 | Ga0495603_0046950 | 3300046455 | Bacteria | 2572 |
| 578 | Ga0495629_0121008 | 3300046459 | Bacteria | 1823 |
| 579 | Ga0495629_0161252 | 3300046459 | Bacteria | 1557 |
| 580 | Ga0495638_0093551 | 3300046460 | Bacteria | 1807 |
| 581 | Ga0495641_0025950 | 3300046461 | Bacteria | 2868 |
| 582 | Ga0495651_0077744 | 3300046462 | Bacteria | 2511 |
| 583 | Ga0495653_0042189 | 3300046463 | Bacteria | 3555 |
| 584 | Ga0495653_0075850 | 3300046463 | Bacteria | 2501 |
| 585 | Ga0495653_0152584 | 3300046463 | Bacteria | 1612 |
| 586 | Ga0495653_0164620 | 3300046463 | Bacteria | 1536 |
| 587 | Ga0495650_0033554 | 3300046471 | Bacteria | 2283 |
| 588 | Ga0495580_0096547 | 3300046472 | Bacteria | 2055 |
| 589 | Ga0495580_0148277 | 3300046472 | Bacteria | 1625 |
| 590 | Ga0495582_0055659 | 3300046473 | Bacteria | 2180 |
| 591 | Ga0495582_0121551 | 3300046473 | Bacteria | 1471 |
| 592 | Ga0495639_0022652 | 3300046475 | Bacteria | 2756 |
| 593 | Ga0495639_0034799 | 3300046475 | Bacteria | 2253 |
| 594 | Ga0495662_0033868 | 3300046476 | Bacteria | 2467 |
| 595 | Ga0495662_0036992 | 3300046476 | Bacteria | 2356 |
| 596 | Ga0495664_0030006 | 3300046477 | Bacteria | 3183 |
| 597 | Ga0495664_0118222 | 3300046477 | Bacteria | 1602 |
| 598 | Ga0495585_0085287 | 3300046492 | Bacteria | 1707 |
| 599 | Ga0495594_0126442 | 3300046499 | Bacteria | 1446 |
| 600 | Ga0495606_0136304 | 3300046507 | Bacteria | 1453 |
| 601 | Ga0495608_0058694 | 3300046511 | Bacteria | 2536 |
| 602 | Ga0495610_0022436 | 3300046512 | Bacteria | 3453 |
| 603 | Ga0495620_0053656 | 3300046515 | Bacteria | 1706 |
| 604 | Ga0495628_0082475 | 3300046516 | Bacteria | 2497 |
| 605 | Ga0495628_0169762 | 3300046516 | Bacteria | 1654 |
| 606 | Ga0495630_0056928 | 3300046517 | Bacteria | 2929 |
| 607 | Ga0495630_0089703 | 3300046517 | Bacteria | 2322 |
| 608 | Ga0495631_0038480 | 3300046518 | Bacteria | 2126 |
| 609 | Ga0495632_0000197 | 3300046519 | Bacteria | 61171 |
| 610 | Ga0495643_0001792 | 3300046522 | Bacteria | 18380 |
| 611 | Ga0495643_0029016 | 3300046522 | Bacteria | 3097 |
| 612 | Ga0495643_0081049 | 3300046522 | Bacteria | 1688 |
| 613 | Ga0495644_0046480 | 3300046523 | Bacteria | 1631 |
| 614 | Ga0495644_0063299 | 3300046523 | Bacteria | 1390 |
| 615 | Ga0495648_0031243 | 3300046524 | Bacteria | 3509 |
| 616 | Ga0495648_0080148 | 3300046524 | Bacteria | 1861 |
| 617 | Ga0495666_0026364 | 3300046526 | Bacteria | 2865 |
| 618 | Ga0495652_0121963 | 3300046529 | Bacteria | 2077 |
| 619 | Ga0495652_0156056 | 3300046529 | Bacteria | 1777 |
| 620 | Ga0495652_0207471 | 3300046529 | Bacteria | 1482 |
| 621 | Ga0495665_0098671 | 3300046531 | Bacteria | 1533 |
| 622 | Ga0495665_0118812 | 3300046531 | Bacteria | 1385 |
| 623 | Ga0495640_0064393 | 3300046533 | Bacteria | 2479 |
| 624 | Ga0495587_0049964 | 3300046536 | Bacteria | 2474 |
| 625 | Ga0495598_0017047 | 3300046537 | Bacteria | 1866 |
| 626 | Ga0495645_0042142 | 3300046543 | Bacteria | 3328 |
| 627 | Ga0495622_0049263 | 3300046557 | Bacteria | 1955 |
| 628 | Ga0495622_0078687 | 3300046557 | Bacteria | 1518 |
| 629 | Ga0495667_0146909 | 3300046559 | Bacteria | 1518 |
| 630 | Ga0495667_0159799 | 3300046559 | Bacteria | 1449 |
| 631 | Ga0495634_0137675 | 3300046642 | Bacteria | 1552 |
| 632 | Ga0495611_0085065 | 3300046648 | Bacteria | 1458 |
| 633 | Ga0495611_0085153 | 3300046648 | Bacteria | 1457 |
| 634 | Ga0495625_0071534 | 3300046660 | Bacteria | 2434 |
| 635 | Ga0495625_0137776 | 3300046660 | Bacteria | 1648 |
| 636 | Ga0495635_0044022 | 3300046663 | Bacteria | 3079 |
| 637 | Ga0495635_0101179 | 3300046663 | Bacteria | 1969 |
| 638 | Ga0495635_0154080 | 3300046663 | Bacteria | 1564 |
| 639 | Ga0495659_0013897 | 3300046664 | Bacteria | 2627 |
| 640 | Ga0495659_0050684 | 3300046664 | Bacteria | 1510 |
| 641 | Ga0495588_0017251 | 3300046674 | Bacteria | 3501 |
| 642 | Ga0495588_0044169 | 3300046674 | Bacteria | 2281 |
| 643 | Ga0495657_0034436 | 3300046675 | Bacteria | 3517 |
| 644 | Ga0495657_0089375 | 3300046675 | Bacteria | 1979 |
| 645 | Ga0495657_0152955 | 3300046675 | Bacteria | 1431 |
| 646 | Ga0495599_0049369 | 3300046678 | Bacteria | 2637 |
| 647 | Ga0495646_0116768 | 3300046680 | Bacteria | 1513 |
| 648 | Ga0495647_0033369 | 3300046681 | Bacteria | 1923 |
| 649 | Ga0495647_0061842 | 3300046681 | Bacteria | 1479 |
| 650 | Ga0495658_0052601 | 3300046683 | Bacteria | 2310 |
| 651 | Ga0495658_0083019 | 3300046683 | Bacteria | 1883 |
| 652 | Ga0495669_0000800 | 3300046684 | Bacteria | 13438 |
| 653 | Ga0495669_0031310 | 3300046684 | Bacteria | 2336 |
| 654 | Ga0495613_0184921 | 3300046689 | Bacteria | 1474 |
| 655 | Ga0495613_0190992 | 3300046689 | Bacteria | 1447 |
| 656 | Ga0495624_0061056 | 3300046690 | Bacteria | 2362 |
| 657 | Ga0495624_0123652 | 3300046690 | Bacteria | 1588 |
| 658 | Ga0495670_0084117 | 3300046691 | Bacteria | 1623 |
| 659 | Ga0495670_0105787 | 3300046691 | Bacteria | 1453 |
| 660 | Ga0495671_0029158 | 3300046692 | Bacteria | 2836 |
| 661 | Ga0495600_0092576 | 3300046809 | Bacteria | 1972 |
| 662 | Ga0495600_0122604 | 3300046809 | Bacteria | 1690 |
| 663 | Ga0495600_0131858 | 3300046809 | Bacteria | 1624 |
| 664 | Ga0495600_0139002 | 3300046809 | Bacteria | 1576 |
| 665 | Ga0495660_0101557 | 3300046810 | Bacteria | 1480 |
| 666 | Ga0495581_0103120 | 3300047315 | Bacteria | 1657 |
| 667 | Ga0495604_0165521 | 3300047317 | Bacteria | 1559 |
| 668 | Ga0495674_0107142 | 3300047319 | Bacteria | 2372 |
| 669 | Ga0495674_0109700 | 3300047319 | Bacteria | 2340 |
| 670 | Ga0495676_0084880 | 3300047321 | Bacteria | 2387 |
| 671 | Ga0495676_0101013 | 3300047321 | Bacteria | 2134 |
| 672 | Ga0495676_0208588 | 3300047321 | Bacteria | 1353 |
| 673 | Ga0495680_0083539 | 3300047322 | Bacteria | 2407 |
| 674 | Ga0495680_0148507 | 3300047322 | Bacteria | 1710 |
| 675 | Ga0495680_0176318 | 3300047322 | Bacteria | 1545 |
| 676 | Ga0495687_060558 | 3300047443 | Bacteria | 1561 |
| 677 | Ga0495687_064363 | 3300047443 | Bacteria | 1497 |
| 678 | Ga0495675_0127018 | 3300047444 | Bacteria | 1586 |
| 679 | Ga0495675_0147534 | 3300047444 | Bacteria | 1455 |
| 680 | Ga0495673_0059141 | 3300047469 | Bacteria | 1648 |
| 681 | Ga0495681_0073090 | 3300047470 | Bacteria | 1549 |
| 682 | Ga0495684_0053308 | 3300047471 | Bacteria | 3086 |
| 683 | Ga0495684_0076602 | 3300047471 | Bacteria | 2540 |
| 684 | Ga0495684_0194384 | 3300047471 | Bacteria | 1498 |
| 685 | Ga0495686_0140956 | 3300047472 | Bacteria | 1422 |
| 686 | Ga0495593_0042093 | 3300047673 | Bacteria | 2453 |
| 687 | Ga0495593_0071503 | 3300047673 | Bacteria | 1801 |
| 688 | Ga0495602_0198497 | 3300048088 | Bacteria | 1532 |
| 689 | Ga0495602_0230358 | 3300048088 | Bacteria | 1392 |
| 690 | Ga0495614_0028999 | 3300048089 | Bacteria | 2382 |
| 691 | Ga0495615_0003431 | 3300048090 | Bacteria | 2654 |
| 692 | Ga0496100_0132809 | 3300048903 | Bacteria | 1755 |
| 693 | Ga0496100_0173304 | 3300048903 | Bacteria | 1555 |
| 694 | Ga0496101_0044356 | 3300048904 | Bacteria | 3182 |
| 695 | Ga0496101_0053700 | 3300048904 | Bacteria | 2908 |
| 696 | Ga0496101_0081595 | 3300048904 | Bacteria | 2392 |
| 697 | Ga0496102_0000922 | 3300048905 | Bacteria | 27690 |
| 698 | Ga0496102_0130010 | 3300048905 | Bacteria | 2356 |
| 699 | Ga0496102_0190555 | 3300048905 | Bacteria | 1932 |
| 700 | Ga0496102_0253713 | 3300048905 | Bacteria | 1658 |
| 701 | Ga0496103_0015879 | 3300048906 | Bacteria | 4489 |
| 702 | Ga0496103_0059647 | 3300048906 | Bacteria | 2370 |
| 703 | Ga0496103_0178256 | 3300048906 | Bacteria | 1365 |
| 704 | Ga0496105_0164027 | 3300048908 | Bacteria | 1823 |
| 705 | Ga0496106_0082465 | 3300048909 | Bacteria | 2471 |
| 706 | Ga0496106_0086902 | 3300048909 | Bacteria | 2409 |
| 707 | Ga0496106_0087230 | 3300048909 | Bacteria | 2404 |
| 708 | Ga0496106_0207260 | 3300048909 | Bacteria | 1561 |
| 709 | Ga0496106_0240782 | 3300048909 | Bacteria | 1445 |
| 710 | Ga0496107_0065729 | 3300048910 | Bacteria | 2630 |
| 711 | Ga0496107_0166280 | 3300048910 | Bacteria | 1635 |
| 712 | Ga0496108_0228807 | 3300048911 | Bacteria | 1616 |
| 713 | Ga0496108_0239393 | 3300048911 | Bacteria | 1578 |
| 714 | Ga0496109_0128465 | 3300048912 | Bacteria | 2364 |
| 715 | Ga0496109_0175049 | 3300048912 | Bacteria | 2014 |
| 716 | Ga0496109_0222178 | 3300048912 | Bacteria | 1776 |
| 717 | Ga0496109_0284131 | 3300048912 | Bacteria | 1559 |
| 718 | Ga0496110_0048354 | 3300048913 | Bacteria | 3728 |
| 719 | Ga0496110_0310775 | 3300048913 | Bacteria | 1435 |
| 720 | Ga0496111_0158576 | 3300048914 | Bacteria | 1679 |
| 721 | Ga0496111_0193391 | 3300048914 | Bacteria | 1512 |
| 722 | Ga0496112_0160912 | 3300048915 | Bacteria | 2211 |
| 723 | Ga0496112_0365930 | 3300048915 | Bacteria | 1383 |
| 724 | Ga0496113_0088035 | 3300048916 | Bacteria | 2388 |
| 725 | Ga0496113_0175436 | 3300048916 | Bacteria | 1698 |
| 726 | Ga0496114_0154733 | 3300048917 | Bacteria | 1990 |
| 727 | Ga0496114_0225302 | 3300048917 | Bacteria | 1646 |
| 728 | Ga0496114_0230409 | 3300048917 | Bacteria | 1627 |
| 729 | Ga0496115_0256244 | 3300048918 | Bacteria | 1439 |
| 730 | Ga0496115_0258769 | 3300048918 | Bacteria | 1431 |
| 731 | Ga0496117_0114862 | 3300048920 | Bacteria | 1667 |
| 732 | Ga0496118_0001907 | 3300048921 | Bacteria | 29679 |
| 733 | Ga0496118_0125911 | 3300048921 | Bacteria | 1658 |
| 734 | Ga0496118_0138711 | 3300048921 | Bacteria | 1546 |
| 735 | Ga0496120_0118214 | 3300048923 | Bacteria | 1374 |
| 736 | Ga0496121_0049894 | 3300048924 | Bacteria | 3542 |
| 737 | Ga0496121_0091682 | 3300048924 | Bacteria | 2371 |
| 738 | Ga0496121_0156808 | 3300048924 | Bacteria | 1669 |
| 739 | Ga0496122_0045753 | 3300048925 | Bacteria | 3397 |
| 740 | Ga0496122_0076516 | 3300048925 | Bacteria | 2354 |
| 741 | Ga0496124_0011484 | 3300048927 | Bacteria | 8849 |
| 742 | Ga0496124_0099989 | 3300048927 | Bacteria | 2351 |
| 743 | Ga0496124_0192395 | 3300048927 | Bacteria | 1559 |
| 744 | Ga0496125_0027565 | 3300048928 | Bacteria | 5148 |
| 745 | Ga0496125_0155316 | 3300048928 | Bacteria | 1564 |
| 746 | Ga0496126_0156427 | 3300048929 | Bacteria | 1950 |
| 747 | Ga0496126_0216133 | 3300048929 | Bacteria | 1612 |
| 748 | Ga0496126_0231832 | 3300048929 | Bacteria | 1546 |
| 749 | Ga0495682_0066457 | 3300049460 | Bacteria | 1300 |
| 750 | Ga0501298_009010 | 3300049521 | Bacteria | 1688 |
| 751 | Ga0501067_0124183 | 3300049583 | Bacteria | 1437 |
| 752 | Ga0501069_0067935 | 3300049585 | Bacteria | 1994 |
| 753 | Ga0501202_016120 | 3300049652 | Bacteria | 1446 |
| 754 | Ga0501251_002082 | 3300049681 | Bacteria | 1913 |
| 755 | Ga0501256_002896 | 3300049685 | Bacteria | 1392 |
| 756 | Ga0501261_005675 | 3300049690 | Bacteria | 1575 |
| 757 | Ga0501270_002546 | 3300049767 | Bacteria | 1878 |
| 758 | Ga0501274_001853 | 3300049771 | Bacteria | 1627 |
| 759 | Ga0501283_007359 | 3300049779 | Bacteria | 1565 |
| 760 | Ga0501212_008581 | 3300049851 | Bacteria | 1424 |
| 761 | nmdc:mga0yw44_55892_c1 | 3300050492 | Bacteria | 2402 |
| 762 | nmdc:mga06z11_112326_c1 | 3300050494 | Bacteria | 1510 |
| 763 | nmdc:mga09592_230577_c1 | 3300050508 | Bacteria | 1604 |
| 764 | nmdc:mga0qj67_215564_c1 | 3300050509 | Bacteria | 1559 |
| 765 | nmdc:mga06r32_346185_c1 | 3300050510 | Bacteria | 1471 |
| 766 | nmdc:mga06r32_410551_c1 | 3300050510 | Bacteria | 1336 |
| 767 | nmdc:mga08y16_367692_c1 | 3300050511 | Bacteria | 1476 |
| 768 | nmdc:mga0n895_239331_c1 | 3300050512 | Bacteria | 1842 |
| 769 | nmdc:mga0a205_278902_c1 | 3300050515 | Bacteria | 1547 |
| 770 | Ga0495601_0061605 | 3300053077 | Bacteria | 2381 |
| 771 | Ga0495601_0149888 | 3300053077 | Bacteria | 1522 |
| 772 | Ga0495612_0018353 | 3300053078 | Bacteria | 2802 |
| 773 | Ga0495612_0028499 | 3300053078 | Bacteria | 2248 |
| 774 | Ga0495612_0051758 | 3300053078 | Bacteria | 1688 |
| 775 | Ga0495595_0056635 | 3300053084 | Bacteria | 1827 |
| 776 | Ga0495595_0058030 | 3300053084 | Bacteria | 1806 |
| 777 | Ga0495595_0077883 | 3300053084 | Bacteria | 1575 |
| 778 | Ga0495595_0097014 | 3300053084 | Bacteria | 1419 |
| 779 | Ga0495619_0045573 | 3300053085 | Bacteria | 2881 |
| 780 | Ga0495619_0068938 | 3300053085 | Bacteria | 2363 |
| 781 | Ga0495619_0169054 | 3300053085 | Bacteria | 1511 |
| 782 | Ga0500643_025450 | 3300053087 | Bacteria | 1866 |
| 783 | Ga0500643_038715 | 3300053087 | Bacteria | 1412 |
| 784 | Ga0500644_0007640 | 3300053088 | Bacteria | 2823 |
| 785 | Ga0500646_0036700 | 3300053090 | Bacteria | 1366 |
| 786 | Ga0500651_0117140 | 3300053093 | Bacteria | 1620 |
| 787 | Ga0500650_0075685 | 3300053098 | Bacteria | 1573 |
| 788 | Ga0500556_0055432 | 3300053104 | Bacteria | 1445 |
| 789 | Ga0500557_006154 | 3300053105 | Bacteria | 2689 |
| 790 | Ga0500569_030015 | 3300053109 | Bacteria | 1518 |
| 791 | Ga0500572_009025 | 3300053111 | Bacteria | 2346 |
| 792 | Ga0500607_045741 | 3300053121 | Bacteria | 2348 |
| 793 | Ga0500614_006776 | 3300053123 | Bacteria | 2409 |
| 794 | Ga0500621_061250 | 3300053126 | Bacteria | 1520 |
| 795 | Ga0500623_070094 | 3300053127 | Bacteria | 1703 |
| 796 | Ga0500642_0007763 | 3300053130 | Bacteria | 3624 |
| 797 | Ga0500642_0083304 | 3300053130 | Bacteria | 1471 |
| 798 | Ga0500655_014483 | 3300053133 | Bacteria | 1443 |
| 799 | Ga0500577_0071150 | 3300053142 | Bacteria | 1364 |
| 800 | Ga0500579_086417 | 3300053143 | Bacteria | 1720 |
| 801 | Ga0500588_0021253 | 3300053146 | Bacteria | 1750 |
| 802 | Ga0500589_029248 | 3300053147 | Bacteria | 2561 |
| 803 | Ga0500590_000843 | 3300053148 | Bacteria | 11533 |
| 804 | Ga0500616_0001524 | 3300053153 | Bacteria | 21828 |
| 805 | Ga0500622_0041976 | 3300053156 | Bacteria | 2378 |
| 806 | Ga0500622_0067414 | 3300053156 | Bacteria | 1815 |
| 807 | Ga0500627_0020083 | 3300053158 | Bacteria | 2674 |
| 808 | Ga0500611_006389 | 3300053727 | Bacteria | 1714 |
| 809 | Ga0500611_009506 | 3300053727 | Bacteria | 1543 |
| 810 | Ga0500656_002341 | 3300053732 | Bacteria | 1709 |
| 811 | Ga0501084_0282406 | 3300054114 | Bacteria | 1402 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044901 | Ga0466960_0108304 | Ga0466960_0108304_170_1393 | 348 |
| 2 | 3300048910 | Ga0496107_0065729 | Ga0496107_0065729_371_1573 | 371 |
| 3 | 3300050510 | nmdc:mga06r32_410551_c1 | nmdc:mga06r32_410551_c1_105_1310 | 372 |
| 4 | 3300039438 | Ga0436360_0894651 | Ga0436360_0894651_216_1460 | 378 |
| 5 | 3300031731 | Ga0307405_10136463 | Ga0307405_101364632 | 381 |
| 6 | 3300032002 | Ga0307416_100314051 | Ga0307416_1003140511 | 381 |
| 7 | 3300005844 | Ga0068862_100370799 | Ga0068862_1003707992 | 383 |
| 8 | 3300044735 | Ga0466968_0027393 | Ga0466968_0027393_1000_2238 | 383 |
| 9 | 3300005547 | Ga0070693_100174684 | Ga0070693_1001746841 | 384 |
| 10 | 3300011119 | Ga0105246_10113862 | Ga0105246_101138622 | 384 |
| 11 | 3300026023 | Ga0207677_10253259 | Ga0207677_102532591 | 384 |
| 12 | 3300046507 | Ga0495606_0136304 | Ga0495606_0136304_63_1316 | 384 |
| 13 | 3300005338 | Ga0068868_100188958 | Ga0068868_1001889582 | 385 |
| 14 | 3300005347 | Ga0070668_100169321 | Ga0070668_1001693211 | 385 |
| 15 | 3300005356 | Ga0070674_100108253 | Ga0070674_1001082531 | 385 |
| 16 | 3300005367 | Ga0070667_100214681 | Ga0070667_1002146812 | 385 |
| 17 | 3300005436 | Ga0070713_100279025 | Ga0070713_1002790251 | 385 |
| 18 | 3300005456 | Ga0070678_100166193 | Ga0070678_1001661931 | 385 |
| 19 | 3300005544 | Ga0070686_100166420 | Ga0070686_1001664201 | 385 |
| 20 | 3300005718 | Ga0068866_10094407 | Ga0068866_100944072 | 385 |
| 21 | 3300005719 | Ga0068861_100209678 | Ga0068861_1002096782 | 385 |
| 22 | 3300006881 | Ga0068865_100166182 | Ga0068865_1001661821 | 385 |
| 23 | 3300009011 | Ga0105251_10028297 | Ga0105251_100282973 | 385 |
| 24 | 3300009101 | Ga0105247_10150533 | Ga0105247_101505331 | 385 |
| 25 | 3300009174 | Ga0105241_10222877 | Ga0105241_102228771 | 385 |
| 26 | 3300011119 | Ga0105246_10254240 | Ga0105246_102542401 | 385 |
| 27 | 3300013297 | Ga0157378_10143919 | Ga0157378_101439191 | 385 |
| 28 | 3300014968 | Ga0157379_10164985 | Ga0157379_101649852 | 385 |
| 29 | 3300014969 | Ga0157376_10251513 | Ga0157376_102515132 | 385 |
| 30 | 3300025735 | Ga0207713_1060450 | Ga0207713_10604501 | 385 |
| 31 | 3300025905 | Ga0207685_10069084 | Ga0207685_100690841 | 385 |
| 32 | 3300025911 | Ga0207654_10150907 | Ga0207654_101509071 | 385 |
| 33 | 3300025931 | Ga0207644_10176541 | Ga0207644_101765411 | 385 |
| 34 | 3300025933 | Ga0207706_10062748 | Ga0207706_100627481 | 385 |
| 35 | 3300026116 | Ga0207674_10271371 | Ga0207674_102713712 | 385 |
| 36 | 3300026121 | Ga0207683_10216598 | Ga0207683_102165981 | 385 |
| 37 | 3300048905 | Ga0496102_0253713 | Ga0496102_0253713_204_1415 | 385 |
| 38 | 3300048906 | Ga0496103_0178256 | Ga0496103_0178256_115_1326 | 385 |
| 39 | 3300048908 | Ga0496105_0164027 | Ga0496105_0164027_12_1193 | 385 |
| 40 | 3300048909 | Ga0496106_0082465 | Ga0496106_0082465_117_1328 | 385 |
| 41 | 3300048910 | Ga0496107_0166280 | Ga0496107_0166280_354_1565 | 385 |
| 42 | 3300048911 | Ga0496108_0228807 | Ga0496108_0228807_191_1372 | 385 |
| 43 | 3300048914 | Ga0496111_0193391 | Ga0496111_0193391_10_1191 | 385 |
| 44 | 3300048915 | Ga0496112_0160912 | Ga0496112_0160912_261_1442 | 385 |
| 45 | 3300048916 | Ga0496113_0088035 | Ga0496113_0088035_84_1265 | 385 |
| 46 | 3300048917 | Ga0496114_0230409 | Ga0496114_0230409_107_1318 | 385 |
| 47 | 3300048918 | Ga0496115_0258769 | Ga0496115_0258769_102_1313 | 385 |
| 48 | iso_pu_bacteria | 2842357229 | 2842362840 | 385 |
| 49 | 3300021441 | Ga0213871_10021369 | Ga0213871_100213691 | 386 |
| 50 | iso_pu_bacteria | 2617270742 | 2617386805 | 386 |
| 51 | iso_pu_bacteria | 2791355263 | 2793338925 | 386 |
| 52 | 3300006186 | Ga0075369_10024761 | Ga0075369_100247612 | 387 |
| 53 | 3300009553 | Ga0105249_10135759 | Ga0105249_101357591 | 387 |
| 54 | 3300021384 | Ga0213876_10061079 | Ga0213876_100610792 | 387 |
| 55 | 3300025961 | Ga0207712_10155207 | Ga0207712_101552072 | 387 |
| 56 | 3300035171 | Ga0373946_0045710 | Ga0373946_0045710_83_1282 | 387 |
| 57 | 3300035692 | Ga0373935_0171448 | Ga0373935_0171448_207_1406 | 387 |
| 58 | 3300035725 | Ga0373947_0110499 | Ga0373947_0110499_68_1267 | 387 |
| 59 | 3300037068 | Ga0373925_0226506 | Ga0373925_0226506_221_1420 | 387 |
| 60 | 3300037466 | Ga0395898_0252085 | Ga0395898_0252085_434_1642 | 387 |
| 61 | 3300037853 | Ga0436364_1239479 | Ga0436364_1239479_352_1683 | 387 |
| 62 | 3300039437 | Ga0436365_0422968 | Ga0436365_0422968_494_1825 | 387 |
| 63 | 3300039438 | Ga0436360_0148117 | Ga0436360_0148117_1090_2421 | 387 |
| 64 | 3300039450 | Ga0436363_1149058 | Ga0436363_1149058_4006_5337 | 387 |
| 65 | 3300046512 | Ga0495610_0022436 | Ga0495610_0022436_474_1679 | 387 |
| 66 | 3300046660 | Ga0495625_0071534 | Ga0495625_0071534_297_1499 | 387 |
| 67 | 3300047321 | Ga0495676_0208588 | Ga0495676_0208588_68_1267 | 387 |
| 68 | 3300048904 | Ga0496101_0081595 | Ga0496101_0081595_629_1948 | 387 |
| 69 | 3300048917 | Ga0496114_0154733 | Ga0496114_0154733_166_1485 | 387 |
| 70 | 3300053109 | Ga0500569_030015 | Ga0500569_030015_50_1252 | 387 |
| 71 | iso_pu_bacteria | 2513237137 | 2513864403 | 387 |
| 72 | iso_pu_bacteria | 2545555834 | 2545676560 | 387 |
| 73 | 3300005338 | Ga0068868_100201610 | Ga0068868_1002016101 | 388 |
| 74 | 3300005341 | Ga0070691_10086774 | Ga0070691_100867741 | 388 |
| 75 | 3300005344 | Ga0070661_100068827 | Ga0070661_1000688272 | 388 |
| 76 | 3300005441 | Ga0070700_100166167 | Ga0070700_1001661671 | 388 |
| 77 | 3300005456 | Ga0070678_100260467 | Ga0070678_1002604671 | 388 |
| 78 | 3300005548 | Ga0070665_100311494 | Ga0070665_1003114942 | 388 |
| 79 | 3300005564 | Ga0070664_100038370 | Ga0070664_1000383703 | 388 |
| 80 | 3300005615 | Ga0070702_100157089 | Ga0070702_1001570891 | 388 |
| 81 | 3300005843 | Ga0068860_100090744 | Ga0068860_1000907441 | 388 |
| 82 | 3300012480 | Ga0157346_1000434 | Ga0157346_10004342 | 388 |
| 83 | 3300012513 | Ga0157326_1003224 | Ga0157326_10032241 | 388 |
| 84 | 3300013296 | Ga0157374_10305477 | Ga0157374_103054771 | 388 |
| 85 | 3300014326 | Ga0157380_10324302 | Ga0157380_103243021 | 388 |
| 86 | 3300024227 | Ga0228598_1017406 | Ga0228598_10174061 | 388 |
| 87 | 3300025901 | Ga0207688_10091350 | Ga0207688_100913501 | 388 |
| 88 | 3300025910 | Ga0207684_10121641 | Ga0207684_101216411 | 388 |
| 89 | 3300025925 | Ga0207650_10248628 | Ga0207650_102486281 | 388 |
| 90 | 3300025933 | Ga0207706_10052391 | Ga0207706_100523912 | 388 |
| 91 | 3300025939 | Ga0207665_10101688 | Ga0207665_101016882 | 388 |
| 92 | 3300025940 | Ga0207691_10145990 | Ga0207691_101459903 | 388 |
| 93 | 3300025942 | Ga0207689_10035246 | Ga0207689_100352461 | 388 |
| 94 | 3300026023 | Ga0207677_10091831 | Ga0207677_100918313 | 388 |
| 95 | 3300026067 | Ga0207678_10064579 | Ga0207678_100645791 | 388 |
| 96 | 3300026067 | Ga0207678_10219621 | Ga0207678_102196211 | 388 |
| 97 | 3300026075 | Ga0207708_10053639 | Ga0207708_100536392 | 388 |
| 98 | 3300026121 | Ga0207683_10141143 | Ga0207683_101411431 | 388 |
| 99 | 3300028381 | Ga0268264_10121962 | Ga0268264_101219623 | 388 |
| 100 | 3300028381 | Ga0268264_10384610 | Ga0268264_103846101 | 388 |
| 101 | 3300028786 | Ga0307517_10158121 | Ga0307517_101581211 | 388 |
| 102 | 3300028786 | Ga0307517_10162880 | Ga0307517_101628801 | 388 |
| 103 | 3300028794 | Ga0307515_10238113 | Ga0307515_102381132 | 388 |
| 104 | 3300028794 | Ga0307515_10261552 | Ga0307515_102615522 | 388 |
| 105 | 3300030522 | Ga0307512_10078909 | Ga0307512_100789094 | 388 |
| 106 | 3300031456 | Ga0307513_10225373 | Ga0307513_102253731 | 388 |
| 107 | 3300031507 | Ga0307509_10262469 | Ga0307509_102624692 | 388 |
| 108 | 3300031548 | Ga0307408_100247957 | Ga0307408_1002479571 | 388 |
| 109 | 3300031665 | Ga0316575_10054395 | Ga0316575_100543952 | 388 |
| 110 | 3300031691 | Ga0316579_10088354 | Ga0316579_100883541 | 388 |
| 111 | 3300031730 | Ga0307516_10257976 | Ga0307516_102579761 | 388 |
| 112 | 3300032133 | Ga0316583_10024088 | Ga0316583_100240882 | 388 |
| 113 | 3300032133 | Ga0316583_10044883 | Ga0316583_100448832 | 388 |
| 114 | 3300033180 | Ga0307510_10229246 | Ga0307510_102292461 | 388 |
| 115 | 3300035084 | Ga0373928_0005341 | Ga0373928_0005341_1043_2245 | 388 |
| 116 | 3300035114 | Ga0373939_0028664 | Ga0373939_0028664_84_1286 | 388 |
| 117 | 3300035115 | Ga0373941_0010267 | Ga0373941_0010267_1119_2321 | 388 |
| 118 | 3300035207 | Ga0373942_0014057 | Ga0373942_0014057_99_1301 | 388 |
| 119 | 3300035241 | Ga0373961_0021039 | Ga0373961_0021039_150_1352 | 388 |
| 120 | 3300035691 | Ga0373931_0041894 | Ga0373931_0041894_78_1280 | 388 |
| 121 | 3300036647 | Ga0316582_0061508 | Ga0316582_0061508_1046_2248 | 388 |
| 122 | 3300037312 | Ga0395899_0163493 | Ga0395899_0163493_192_1394 | 388 |
| 123 | 3300037466 | Ga0395898_0317804 | Ga0395898_0317804_169_1422 | 388 |
| 124 | 3300046463 | Ga0495653_0164620 | Ga0495653_0164620_162_1364 | 388 |
| 125 | 3300046472 | Ga0495580_0096547 | Ga0495580_0096547_440_1642 | 388 |
| 126 | 3300046492 | Ga0495585_0085287 | Ga0495585_0085287_200_1453 | 388 |
| 127 | 3300046523 | Ga0495644_0046480 | Ga0495644_0046480_204_1457 | 388 |
| 128 | 3300046529 | Ga0495652_0156056 | Ga0495652_0156056_407_1609 | 388 |
| 129 | 3300046531 | Ga0495665_0118812 | Ga0495665_0118812_20_1222 | 388 |
| 130 | 3300046648 | Ga0495611_0085153 | Ga0495611_0085153_209_1420 | 388 |
| 131 | 3300046660 | Ga0495625_0137776 | Ga0495625_0137776_270_1481 | 388 |
| 132 | 3300046675 | Ga0495657_0089375 | Ga0495657_0089375_546_1748 | 388 |
| 133 | 3300046691 | Ga0495670_0105787 | Ga0495670_0105787_120_1373 | 388 |
| 134 | 3300046809 | Ga0495600_0122604 | Ga0495600_0122604_260_1462 | 388 |
| 135 | 3300046810 | Ga0495660_0101557 | Ga0495660_0101557_135_1388 | 388 |
| 136 | 3300047317 | Ga0495604_0165521 | Ga0495604_0165521_116_1318 | 388 |
| 137 | 3300047322 | Ga0495680_0148507 | Ga0495680_0148507_265_1467 | 388 |
| 138 | 3300047471 | Ga0495684_0053308 | Ga0495684_0053308_228_1430 | 388 |
| 139 | 3300048088 | Ga0495602_0230358 | Ga0495602_0230358_176_1378 | 388 |
| 140 | 3300048903 | Ga0496100_0173304 | Ga0496100_0173304_68_1270 | 388 |
| 141 | 3300048912 | Ga0496109_0128465 | Ga0496109_0128465_1130_2332 | 388 |
| 142 | 3300048918 | Ga0496115_0256244 | Ga0496115_0256244_202_1404 | 388 |
| 143 | 3300053078 | Ga0495612_0051758 | Ga0495612_0051758_302_1504 | 388 |
| 144 | 3300053084 | Ga0495595_0077883 | Ga0495595_0077883_288_1490 | 388 |
| 145 | 3300053085 | Ga0495619_0169054 | Ga0495619_0169054_170_1372 | 388 |
| 146 | 3300053087 | Ga0500643_038715 | Ga0500643_038715_35_1246 | 388 |
| 147 | 3300053098 | Ga0500650_0075685 | Ga0500650_0075685_78_1289 | 388 |
| 148 | 3300053104 | Ga0500556_0055432 | Ga0500556_0055432_72_1283 | 388 |
| 149 | 3300053105 | Ga0500557_006154 | Ga0500557_006154_1086_2297 | 388 |
| 150 | 3300053126 | Ga0500621_061250 | Ga0500621_061250_149_1360 | 388 |
| 151 | 3300053127 | Ga0500623_070094 | Ga0500623_070094_219_1430 | 388 |
| 152 | 3300053130 | Ga0500642_0007763 | Ga0500642_0007763_2246_3457 | 388 |
| 153 | 3300053133 | Ga0500655_014483 | Ga0500655_014483_77_1288 | 388 |
| 154 | 3300053142 | Ga0500577_0071150 | Ga0500577_0071150_93_1304 | 388 |
| 155 | 3300053143 | Ga0500579_086417 | Ga0500579_086417_432_1643 | 388 |
| 156 | 3300053146 | Ga0500588_0021253 | Ga0500588_0021253_347_1558 | 388 |
| 157 | 3300053147 | Ga0500589_029248 | Ga0500589_029248_918_2129 | 388 |
| 158 | 3300053156 | Ga0500622_0067414 | Ga0500622_0067414_294_1505 | 388 |
| 159 | 3300053158 | Ga0500627_0020083 | Ga0500627_0020083_1200_2411 | 388 |
| 160 | 3300053727 | Ga0500611_009506 | Ga0500611_009506_156_1367 | 388 |
| 161 | 3300053732 | Ga0500656_002341 | Ga0500656_002341_128_1339 | 388 |
| 162 | 3300054114 | Ga0501084_0282406 | Ga0501084_0282406_128_1330 | 388 |
| 163 | iso_pu_bacteria | 2511231052 | 2511501325 | 388 |
| 164 | iso_pu_bacteria | 2551306090 | 2551719840 | 388 |
| 165 | iso_pu_bacteria | 2582581299 | 2585231560 | 388 |
| 166 | iso_pu_bacteria | 2615840626 | 2616307564 | 388 |
| 167 | iso_pu_bacteria | 2615840626 | 2616313165 | 388 |
| 168 | iso_pu_bacteria | 2738541293 | 2738805977 | 388 |
| 169 | iso_pu_bacteria | 2738541293 | 2738805978 | 388 |
| 170 | iso_pu_bacteria | 2775506901 | 2776266251 | 388 |
| 171 | iso_pu_bacteria | 2842482326 | 2842488126 | 388 |
| 172 | iso_pu_bacteria | 2882632389 | 2882640125 | 388 |
| 173 | iso_pu_bacteria | 2916000859 | 2916002139 | 388 |
| 174 | iso_pu_bacteria | 2919709256 | 2919713434 | 388 |
| 175 | iso_pu_bacteria | 2924179722 | 2924180965 | 388 |
| 176 | iso_pu_bacteria | 2924186466 | 2924192210 | 388 |
| 177 | iso_pu_bacteria | 2957422303 | 2957425896 | 388 |
| 178 | iso_pu_bacteria | 2957505466 | 2957512035 | 388 |
| 179 | iso_pu_bacteria | 2970095765 | 2970098059 | 388 |
| 180 | iso_pu_bacteria | 3004167301 | 3004171916 | 388 |
| 181 | iso_pu_bacteria | 3004167301 | 3004175375 | 388 |
| 182 | iso_pu_bacteria | 3004334049 | 3004336564 | 388 |
| 183 | iso_pu_bacteria | 3004334049 | 3004337252 | 388 |
| 184 | iso_pu_bacteria | 3004334049 | 3004340010 | 388 |
| 185 | iso_pu_bacteria | 3004334049 | 3004341836 | 388 |
| 186 | iso_pu_bacteria | 3005409236 | 3005415714 | 388 |
| 187 | 3300001977 | JGI24746J21847_1001879 | JGI24746J21847_10018794 | 389 |
| 188 | 3300001978 | JGI24747J21853_1001883 | JGI24747J21853_10018832 | 389 |
| 189 | 3300001979 | JGI24740J21852_10037640 | JGI24740J21852_100376401 | 389 |
| 190 | 3300001989 | JGI24739J22299_10042476 | JGI24739J22299_100424761 | 389 |
| 191 | 3300001990 | JGI24737J22298_10017182 | JGI24737J22298_100171821 | 389 |
| 192 | 3300002067 | JGI24735J21928_10037285 | JGI24735J21928_100372851 | 389 |
| 193 | 3300002073 | JGI24745J21846_1000203 | JGI24745J21846_10002035 | 389 |
| 194 | 3300002074 | JGI24748J21848_1005704 | JGI24748J21848_10057041 | 389 |
| 195 | 3300002075 | JGI24738J21930_10017496 | JGI24738J21930_100174961 | 389 |
| 196 | 3300002155 | JGI24033J26618_1005009 | JGI24033J26618_10050091 | 389 |
| 197 | 3300002239 | JGI24034J26672_10009517 | JGI24034J26672_100095171 | 389 |
| 198 | 3300002244 | JGI24742J22300_10004357 | JGI24742J22300_100043571 | 389 |
| 199 | 3300005327 | Ga0070658_10182003 | Ga0070658_101820032 | 389 |
| 200 | 3300005328 | Ga0070676_10054127 | Ga0070676_100541271 | 389 |
| 201 | 3300005329 | Ga0070683_100180692 | Ga0070683_1001806921 | 389 |
| 202 | 3300005337 | Ga0070682_100164057 | Ga0070682_1001640571 | 389 |
| 203 | 3300005338 | Ga0068868_100273182 | Ga0068868_1002731821 | 389 |
| 204 | 3300005339 | Ga0070660_100088303 | Ga0070660_1000883033 | 389 |
| 205 | 3300005340 | Ga0070689_100063783 | Ga0070689_1000637832 | 389 |
| 206 | 3300005341 | Ga0070691_10041218 | Ga0070691_100412181 | 389 |
| 207 | 3300005343 | Ga0070687_100019531 | Ga0070687_1000195313 | 389 |
| 208 | 3300005345 | Ga0070692_10093763 | Ga0070692_100937631 | 389 |
| 209 | 3300005353 | Ga0070669_100112871 | Ga0070669_1001128711 | 389 |
| 210 | 3300005354 | Ga0070675_100095890 | Ga0070675_1000958903 | 389 |
| 211 | 3300005355 | Ga0070671_100246375 | Ga0070671_1002463751 | 389 |
| 212 | 3300005356 | Ga0070674_100230033 | Ga0070674_1002300331 | 389 |
| 213 | 3300005364 | Ga0070673_100177665 | Ga0070673_1001776651 | 389 |
| 214 | 3300005366 | Ga0070659_100048751 | Ga0070659_1000487513 | 389 |
| 215 | 3300005367 | Ga0070667_100101591 | Ga0070667_1001015914 | 389 |
| 216 | 3300005438 | Ga0070701_10134740 | Ga0070701_101347401 | 389 |
| 217 | 3300005440 | Ga0070705_100036978 | Ga0070705_1000369782 | 389 |
| 218 | 3300005455 | Ga0070663_100083886 | Ga0070663_1000838862 | 389 |
| 219 | 3300005456 | Ga0070678_100188657 | Ga0070678_1001886571 | 389 |
| 220 | 3300005457 | Ga0070662_100074978 | Ga0070662_1000749781 | 389 |
| 221 | 3300005539 | Ga0068853_100031591 | Ga0068853_1000315915 | 389 |
| 222 | 3300005544 | Ga0070686_100058700 | Ga0070686_1000587003 | 389 |
| 223 | 3300005548 | Ga0070665_100227421 | Ga0070665_1002274211 | 389 |
| 224 | 3300005549 | Ga0070704_100199922 | Ga0070704_1001999221 | 389 |
| 225 | 3300005578 | Ga0068854_100054545 | Ga0068854_1000545454 | 389 |
| 226 | 3300005614 | Ga0068856_100246075 | Ga0068856_1002460752 | 389 |
| 227 | 3300005616 | Ga0068852_100108598 | Ga0068852_1001085982 | 389 |
| 228 | 3300005618 | Ga0068864_100128989 | Ga0068864_1001289893 | 389 |
| 229 | 3300005719 | Ga0068861_100282730 | Ga0068861_1002827301 | 389 |
| 230 | 3300005834 | Ga0068851_10034196 | Ga0068851_100341962 | 389 |
| 231 | 3300005840 | Ga0068870_10123606 | Ga0068870_101236062 | 389 |
| 232 | 3300005841 | Ga0068863_100194373 | Ga0068863_1001943731 | 389 |
| 233 | 3300005842 | Ga0068858_100128867 | Ga0068858_1001288673 | 389 |
| 234 | 3300005843 | Ga0068860_100149670 | Ga0068860_1001496702 | 389 |
| 235 | 3300005844 | Ga0068862_100228977 | Ga0068862_1002289772 | 389 |
| 236 | 3300006358 | Ga0068871_100199051 | Ga0068871_1001990512 | 389 |
| 237 | 3300009092 | Ga0105250_10041120 | Ga0105250_100411202 | 389 |
| 238 | 3300009093 | Ga0105240_10295080 | Ga0105240_102950802 | 389 |
| 239 | 3300009101 | Ga0105247_10118728 | Ga0105247_101187282 | 389 |
| 240 | 3300009176 | Ga0105242_10116637 | Ga0105242_101166372 | 389 |
| 241 | 3300009177 | Ga0105248_10416183 | Ga0105248_104161832 | 389 |
| 242 | 3300009545 | Ga0105237_10305888 | Ga0105237_103058881 | 389 |
| 243 | 3300009551 | Ga0105238_10175469 | Ga0105238_101754692 | 389 |
| 244 | 3300009553 | Ga0105249_10047410 | Ga0105249_100474101 | 389 |
| 245 | 3300010375 | Ga0105239_10340666 | Ga0105239_103406662 | 389 |
| 246 | 3300011119 | Ga0105246_10032799 | Ga0105246_100327993 | 389 |
| 247 | 3300013102 | Ga0157371_10113596 | Ga0157371_101135962 | 389 |
| 248 | 3300013306 | Ga0163162_10336394 | Ga0163162_103363942 | 389 |
| 249 | 3300014326 | Ga0157380_10278421 | Ga0157380_102784211 | 389 |
| 250 | 3300014745 | Ga0157377_10068544 | Ga0157377_100685441 | 389 |
| 251 | 3300014968 | Ga0157379_10063705 | Ga0157379_100637053 | 389 |
| 252 | 3300014969 | Ga0157376_10145642 | Ga0157376_101456421 | 389 |
| 253 | 3300025321 | Ga0207656_10081977 | Ga0207656_100819771 | 389 |
| 254 | 3300025711 | Ga0207696_1031544 | Ga0207696_10315441 | 389 |
| 255 | 3300025728 | Ga0207655_1064872 | Ga0207655_10648721 | 389 |
| 256 | 3300025893 | Ga0207682_10008521 | Ga0207682_100085214 | 389 |
| 257 | 3300025899 | Ga0207642_10113707 | Ga0207642_101137071 | 389 |
| 258 | 3300025900 | Ga0207710_10032775 | Ga0207710_100327753 | 389 |
| 259 | 3300025903 | Ga0207680_10176474 | Ga0207680_101764741 | 389 |
| 260 | 3300025907 | Ga0207645_10046984 | Ga0207645_100469843 | 389 |
| 261 | 3300025918 | Ga0207662_10013371 | Ga0207662_100133716 | 389 |
| 262 | 3300025923 | Ga0207681_10214187 | Ga0207681_102141871 | 389 |
| 263 | 3300025924 | Ga0207694_10239001 | Ga0207694_102390011 | 389 |
| 264 | 3300025926 | Ga0207659_10212501 | Ga0207659_102125011 | 389 |
| 265 | 3300025927 | Ga0207687_10175879 | Ga0207687_101758791 | 389 |
| 266 | 3300025931 | Ga0207644_10293787 | Ga0207644_102937871 | 389 |
| 267 | 3300025934 | Ga0207686_10194181 | Ga0207686_101941811 | 389 |
| 268 | 3300025935 | Ga0207709_10175405 | Ga0207709_101754051 | 389 |
| 269 | 3300025938 | Ga0207704_10063944 | Ga0207704_100639442 | 389 |
| 270 | 3300025941 | Ga0207711_10292412 | Ga0207711_102924122 | 389 |
| 271 | 3300025961 | Ga0207712_10196062 | Ga0207712_101960622 | 389 |
| 272 | 3300025972 | Ga0207668_10236841 | Ga0207668_102368411 | 389 |
| 273 | 3300025981 | Ga0207640_10214025 | Ga0207640_102140251 | 389 |
| 274 | 3300025986 | Ga0207658_10184405 | Ga0207658_101844052 | 389 |
| 275 | 3300026023 | Ga0207677_10077830 | Ga0207677_100778301 | 389 |
| 276 | 3300026035 | Ga0207703_10280410 | Ga0207703_102804101 | 389 |
| 277 | 3300026041 | Ga0207639_10270885 | Ga0207639_102708851 | 389 |
| 278 | 3300026067 | Ga0207678_10109189 | Ga0207678_101091893 | 389 |
| 279 | 3300026078 | Ga0207702_10329893 | Ga0207702_103298932 | 389 |
| 280 | 3300026088 | Ga0207641_10320114 | Ga0207641_103201141 | 389 |
| 281 | 3300026095 | Ga0207676_10141604 | Ga0207676_101416042 | 389 |
| 282 | 3300026142 | Ga0207698_10065520 | Ga0207698_100655202 | 389 |
| 283 | 3300028379 | Ga0268266_10242374 | Ga0268266_102423741 | 389 |
| 284 | 3300028380 | Ga0268265_10254523 | Ga0268265_102545231 | 389 |
| 285 | 3300028381 | Ga0268264_10308467 | Ga0268264_103084671 | 389 |
| 286 | 3300046684 | Ga0495669_0000800 | Ga0495669_0000800_12056_13261 | 389 |
| 287 | 3300048904 | Ga0496101_0053700 | Ga0496101_0053700_966_2162 | 389 |
| 288 | 3300048906 | Ga0496103_0059647 | Ga0496103_0059647_174_1370 | 389 |
| 289 | 3300048909 | Ga0496106_0087230 | Ga0496106_0087230_296_1492 | 389 |
| 290 | 3300048912 | Ga0496109_0175049 | Ga0496109_0175049_82_1278 | 389 |
| 291 | 3300048913 | Ga0496110_0310775 | Ga0496110_0310775_65_1261 | 389 |
| 292 | 3300048917 | Ga0496114_0225302 | Ga0496114_0225302_178_1374 | 389 |
| 293 | 3300005937 | Ga0081455_10059299 | Ga0081455_100592992 | 390 |
| 294 | 3300009093 | Ga0105240_10000308 | Ga0105240_1000030822 | 390 |
| 295 | 3300009545 | Ga0105237_10000931 | Ga0105237_1000093112 | 390 |
| 296 | 3300010375 | Ga0105239_10000535 | Ga0105239_1000053539 | 390 |
| 297 | 3300013104 | Ga0157370_10000481 | Ga0157370_1000048122 | 390 |
| 298 | 3300015262 | Ga0182007_10002448 | Ga0182007_100024482 | 390 |
| 299 | 3300025223 | Ga0207672_1001902 | Ga0207672_10019021 | 390 |
| 300 | 3300031548 | Ga0307408_100314248 | Ga0307408_1003142481 | 390 |
| 301 | 3300032004 | Ga0307414_10234584 | Ga0307414_102345842 | 390 |
| 302 | 3300046515 | Ga0495620_0053656 | Ga0495620_0053656_35_1252 | 390 |
| 303 | 3300046518 | Ga0495631_0038480 | Ga0495631_0038480_782_1990 | 390 |
| 304 | 3300046537 | Ga0495598_0017047 | Ga0495598_0017047_560_1777 | 390 |
| 305 | 3300048904 | Ga0496101_0044356 | Ga0496101_0044356_826_2175 | 390 |
| 306 | 3300048905 | Ga0496102_0000922 | Ga0496102_0000922_24562_25911 | 390 |
| 307 | 3300048906 | Ga0496103_0015879 | Ga0496103_0015879_1749_3098 | 390 |
| 308 | 3300048921 | Ga0496118_0001907 | Ga0496118_0001907_24925_26274 | 390 |
| 309 | 3300048928 | Ga0496125_0027565 | Ga0496125_0027565_1843_3192 | 390 |
| 310 | 3300048929 | Ga0496126_0156427 | Ga0496126_0156427_158_1507 | 390 |
| 311 | 3300049583 | Ga0501067_0124183 | Ga0501067_0124183_139_1359 | 390 |
| 312 | 3300053156 | Ga0500622_0041976 | Ga0500622_0041976_155_1345 | 390 |
| 313 | 3300001977 | JGI24746J21847_1009752 | JGI24746J21847_10097521 | 391 |
| 314 | 3300001990 | JGI24737J22298_10040661 | JGI24737J22298_100406611 | 391 |
| 315 | 3300001991 | JGI24743J22301_10013955 | JGI24743J22301_100139551 | 391 |
| 316 | 3300002073 | JGI24745J21846_1005085 | JGI24745J21846_10050851 | 391 |
| 317 | 3300002075 | JGI24738J21930_10019204 | JGI24738J21930_100192041 | 391 |
| 318 | 3300002077 | JGI24744J21845_10017361 | JGI24744J21845_100173611 | 391 |
| 319 | 3300002155 | JGI24033J26618_1005234 | JGI24033J26618_10052341 | 391 |
| 320 | 3300002239 | JGI24034J26672_10008959 | JGI24034J26672_100089591 | 391 |
| 321 | 3300002244 | JGI24742J22300_10004598 | JGI24742J22300_100045981 | 391 |
| 322 | 3300002459 | JGI24751J29686_10003347 | JGI24751J29686_100033471 | 391 |
| 323 | 3300005290 | Ga0065712_10018815 | Ga0065712_100188151 | 391 |
| 324 | 3300005293 | Ga0065715_10120700 | Ga0065715_101207003 | 391 |
| 325 | 3300005329 | Ga0070683_100276702 | Ga0070683_1002767021 | 391 |
| 326 | 3300005354 | Ga0070675_100052472 | Ga0070675_1000524722 | 391 |
| 327 | 3300005356 | Ga0070674_100105965 | Ga0070674_1001059653 | 391 |
| 328 | 3300005364 | Ga0070673_100182447 | Ga0070673_1001824472 | 391 |
| 329 | 3300005440 | Ga0070705_100039412 | Ga0070705_1000394122 | 391 |
| 330 | 3300005455 | Ga0070663_100258308 | Ga0070663_1002583081 | 391 |
| 331 | 3300005457 | Ga0070662_100173135 | Ga0070662_1001731352 | 391 |
| 332 | 3300005459 | Ga0068867_100187981 | Ga0068867_1001879812 | 391 |
| 333 | 3300005535 | Ga0070684_100137781 | Ga0070684_1001377813 | 391 |
| 334 | 3300005535 | Ga0070684_100169739 | Ga0070684_1001697392 | 391 |
| 335 | 3300005546 | Ga0070696_100219634 | Ga0070696_1002196341 | 391 |
| 336 | 3300005577 | Ga0068857_100245008 | Ga0068857_1002450081 | 391 |
| 337 | 3300005578 | Ga0068854_100229178 | Ga0068854_1002291781 | 391 |
| 338 | 3300005614 | Ga0068856_100239726 | Ga0068856_1002397262 | 391 |
| 339 | 3300005615 | Ga0070702_100090131 | Ga0070702_1000901311 | 391 |
| 340 | 3300005616 | Ga0068852_100182843 | Ga0068852_1001828431 | 391 |
| 341 | 3300005718 | Ga0068866_10111203 | Ga0068866_101112031 | 391 |
| 342 | 3300005718 | Ga0068866_10144059 | Ga0068866_101440591 | 391 |
| 343 | 3300005718 | Ga0068866_10173595 | Ga0068866_101735951 | 391 |
| 344 | 3300005843 | Ga0068860_100203207 | Ga0068860_1002032072 | 391 |
| 345 | 3300006871 | Ga0075434_100338023 | Ga0075434_1003380232 | 391 |
| 346 | 3300006880 | Ga0075429_100237943 | Ga0075429_1002379431 | 391 |
| 347 | 3300006914 | Ga0075436_100037047 | Ga0075436_1000370474 | 391 |
| 348 | 3300007076 | Ga0075435_100215460 | Ga0075435_1002154602 | 391 |
| 349 | 3300009093 | Ga0105240_10266717 | Ga0105240_102667172 | 391 |
| 350 | 3300009098 | Ga0105245_10109986 | Ga0105245_101099861 | 391 |
| 351 | 3300009098 | Ga0105245_10282682 | Ga0105245_102826821 | 391 |
| 352 | 3300009098 | Ga0105245_10286936 | Ga0105245_102869361 | 391 |
| 353 | 3300009177 | Ga0105248_10102143 | Ga0105248_101021432 | 391 |
| 354 | 3300009553 | Ga0105249_10155248 | Ga0105249_101552481 | 391 |
| 355 | 3300009553 | Ga0105249_10176321 | Ga0105249_101763213 | 391 |
| 356 | 3300011119 | Ga0105246_10148400 | Ga0105246_101484002 | 391 |
| 357 | 3300013100 | Ga0157373_10188625 | Ga0157373_101886252 | 391 |
| 358 | 3300013102 | Ga0157371_10057231 | Ga0157371_100572313 | 391 |
| 359 | 3300013306 | Ga0163162_10206598 | Ga0163162_102065981 | 391 |
| 360 | 3300013307 | Ga0157372_10549251 | Ga0157372_105492511 | 391 |
| 361 | 3300014326 | Ga0157380_10097019 | Ga0157380_100970191 | 391 |
| 362 | 3300014497 | Ga0182008_10064832 | Ga0182008_100648322 | 391 |
| 363 | 3300025271 | Ga0207666_1004706 | Ga0207666_10047062 | 391 |
| 364 | 3300025290 | Ga0207673_1002108 | Ga0207673_10021082 | 391 |
| 365 | 3300025315 | Ga0207697_10018927 | Ga0207697_100189274 | 391 |
| 366 | 3300025899 | Ga0207642_10065310 | Ga0207642_100653101 | 391 |
| 367 | 3300025899 | Ga0207642_10078292 | Ga0207642_100782921 | 391 |
| 368 | 3300025901 | Ga0207688_10018361 | Ga0207688_100183613 | 391 |
| 369 | 3300025901 | Ga0207688_10034576 | Ga0207688_100345762 | 391 |
| 370 | 3300025904 | Ga0207647_10100121 | Ga0207647_101001211 | 391 |
| 371 | 3300025907 | Ga0207645_10064768 | Ga0207645_100647683 | 391 |
| 372 | 3300025908 | Ga0207643_10120175 | Ga0207643_101201751 | 391 |
| 373 | 3300025913 | Ga0207695_10364776 | Ga0207695_103647761 | 391 |
| 374 | 3300025917 | Ga0207660_10232043 | Ga0207660_102320431 | 391 |
| 375 | 3300025918 | Ga0207662_10057318 | Ga0207662_100573183 | 391 |
| 376 | 3300025919 | Ga0207657_10067535 | Ga0207657_100675353 | 391 |
| 377 | 3300025920 | Ga0207649_10039631 | Ga0207649_100396312 | 391 |
| 378 | 3300025923 | Ga0207681_10233510 | Ga0207681_102335101 | 391 |
| 379 | 3300025925 | Ga0207650_10094429 | Ga0207650_100944291 | 391 |
| 380 | 3300025926 | Ga0207659_10237755 | Ga0207659_102377551 | 391 |
| 381 | 3300025933 | Ga0207706_10051587 | Ga0207706_100515873 | 391 |
| 382 | 3300025933 | Ga0207706_10087799 | Ga0207706_100877994 | 391 |
| 383 | 3300025935 | Ga0207709_10195720 | Ga0207709_101957201 | 391 |
| 384 | 3300025937 | Ga0207669_10204042 | Ga0207669_102040421 | 391 |
| 385 | 3300025940 | Ga0207691_10121420 | Ga0207691_101214202 | 391 |
| 386 | 3300025942 | Ga0207689_10067675 | Ga0207689_100676751 | 391 |
| 387 | 3300025942 | Ga0207689_10068141 | Ga0207689_100681414 | 391 |
| 388 | 3300025944 | Ga0207661_10271556 | Ga0207661_102715561 | 391 |
| 389 | 3300025944 | Ga0207661_10287175 | Ga0207661_102871751 | 391 |
| 390 | 3300025945 | Ga0207679_10242350 | Ga0207679_102423501 | 391 |
| 391 | 3300025960 | Ga0207651_10217384 | Ga0207651_102173841 | 391 |
| 392 | 3300025961 | Ga0207712_10191246 | Ga0207712_101912461 | 391 |
| 393 | 3300025961 | Ga0207712_10241668 | Ga0207712_102416681 | 391 |
| 394 | 3300025972 | Ga0207668_10251502 | Ga0207668_102515021 | 391 |
| 395 | 3300025981 | Ga0207640_10218912 | Ga0207640_102189121 | 391 |
| 396 | 3300026035 | Ga0207703_10303758 | Ga0207703_103037581 | 391 |
| 397 | 3300026067 | Ga0207678_10044268 | Ga0207678_100442683 | 391 |
| 398 | 3300026067 | Ga0207678_10059527 | Ga0207678_100595272 | 391 |
| 399 | 3300026075 | Ga0207708_10045868 | Ga0207708_100458681 | 391 |
| 400 | 3300026075 | Ga0207708_10082010 | Ga0207708_100820102 | 391 |
| 401 | 3300026075 | Ga0207708_10113657 | Ga0207708_101136571 | 391 |
| 402 | 3300026088 | Ga0207641_10294581 | Ga0207641_102945811 | 391 |
| 403 | 3300026089 | Ga0207648_10129458 | Ga0207648_101294582 | 391 |
| 404 | 3300026089 | Ga0207648_10146339 | Ga0207648_101463392 | 391 |
| 405 | 3300026095 | Ga0207676_10246588 | Ga0207676_102465881 | 391 |
| 406 | 3300026095 | Ga0207676_10252292 | Ga0207676_102522921 | 391 |
| 407 | 3300026121 | Ga0207683_10076955 | Ga0207683_100769551 | 391 |
| 408 | 3300027907 | Ga0207428_10207642 | Ga0207428_102076421 | 391 |
| 409 | 3300028380 | Ga0268265_10294379 | Ga0268265_102943791 | 391 |
| 410 | 3300031665 | Ga0316575_10010037 | Ga0316575_100100372 | 391 |
| 411 | 3300031691 | Ga0316579_10059565 | Ga0316579_100595652 | 391 |
| 412 | 3300031727 | Ga0316576_10050140 | Ga0316576_100501403 | 391 |
| 413 | 3300031728 | Ga0316578_10030994 | Ga0316578_100309941 | 391 |
| 414 | 3300031733 | Ga0316577_10042126 | Ga0316577_100421264 | 391 |
| 415 | 3300032133 | Ga0316583_10013438 | Ga0316583_100134381 | 391 |
| 416 | 3300032137 | Ga0316585_10017297 | Ga0316585_100172973 | 391 |
| 417 | 3300032139 | Ga0316580_10005200 | Ga0316580_100052002 | 391 |
| 418 | 3300034816 | Ga0373930_0010223 | Ga0373930_0010223_320_1522 | 391 |
| 419 | 3300034817 | Ga0373948_0002181 | Ga0373948_0002181_1485_2687 | 391 |
| 420 | 3300034818 | Ga0373950_0009520 | Ga0373950_0009520_170_1372 | 391 |
| 421 | 3300034818 | Ga0373950_0012048 | Ga0373950_0012048_96_1364 | 391 |
| 422 | 3300034819 | Ga0373958_0011236 | Ga0373958_0011236_268_1470 | 391 |
| 423 | 3300034820 | Ga0373959_0003787 | Ga0373959_0003787_458_1660 | 391 |
| 424 | 3300034957 | Ga0373938_0015854 | Ga0373938_0015854_172_1374 | 391 |
| 425 | 3300035083 | Ga0373926_0049853 | Ga0373926_0049853_205_1407 | 391 |
| 426 | 3300035084 | Ga0373928_0006474 | Ga0373928_0006474_43_1245 | 391 |
| 427 | 3300035086 | Ga0373934_0062852 | Ga0373934_0062852_163_1365 | 391 |
| 428 | 3300035088 | Ga0373940_0015337 | Ga0373940_0015337_503_1771 | 391 |
| 429 | 3300035088 | Ga0373940_0028238 | Ga0373940_0028238_35_1237 | 391 |
| 430 | 3300035089 | Ga0373944_0012435 | Ga0373944_0012435_961_2163 | 391 |
| 431 | 3300035090 | Ga0373949_0004601 | Ga0373949_0004601_202_1404 | 391 |
| 432 | 3300035111 | Ga0373923_0015651 | Ga0373923_0015651_202_1404 | 391 |
| 433 | 3300035113 | Ga0373936_0070207 | Ga0373936_0070207_72_1274 | 391 |
| 434 | 3300035115 | Ga0373941_0009046 | Ga0373941_0009046_92_1294 | 391 |
| 435 | 3300035116 | Ga0373945_0046229 | Ga0373945_0046229_297_1499 | 391 |
| 436 | 3300035117 | Ga0373953_0044256 | Ga0373953_0044256_493_1695 | 391 |
| 437 | 3300035118 | Ga0373954_0089587 | Ga0373954_0089587_174_1376 | 391 |
| 438 | 3300035119 | Ga0373956_0036984 | Ga0373956_0036984_224_1426 | 391 |
| 439 | 3300035120 | Ga0373957_0043032 | Ga0373957_0043032_267_1469 | 391 |
| 440 | 3300035170 | Ga0373943_0039207 | Ga0373943_0039207_159_1361 | 391 |
| 441 | 3300035171 | Ga0373946_0072989 | Ga0373946_0072989_179_1381 | 391 |
| 442 | 3300035172 | Ga0373955_0108375 | Ga0373955_0108375_193_1395 | 391 |
| 443 | 3300035207 | Ga0373942_0012635 | Ga0373942_0012635_315_1517 | 391 |
| 444 | 3300035207 | Ga0373942_0027947 | Ga0373942_0027947_88_1356 | 391 |
| 445 | 3300035242 | Ga0373962_0030931 | Ga0373962_0030931_193_1395 | 391 |
| 446 | 3300035398 | Ga0316574_0031946 | Ga0316574_0031946_219_1460 | 391 |
| 447 | 3300035410 | Ga0373924_0070424 | Ga0373924_0070424_102_1304 | 391 |
| 448 | 3300035691 | Ga0373931_0008147 | Ga0373931_0008147_3634_4836 | 391 |
| 449 | 3300035691 | Ga0373931_0042527 | Ga0373931_0042527_91_1359 | 391 |
| 450 | 3300035692 | Ga0373935_0037418 | Ga0373935_0037418_851_2053 | 391 |
| 451 | 3300035695 | Ga0373927_0092326 | Ga0373927_0092326_589_1791 | 391 |
| 452 | 3300035724 | Ga0373933_0135460 | Ga0373933_0135460_243_1445 | 391 |
| 453 | 3300035725 | Ga0373947_0176269 | Ga0373947_0176269_155_1357 | 391 |
| 454 | 3300036401 | Ga0373937_0283911 | Ga0373937_0283911_274_1476 | 391 |
| 455 | 3300036647 | Ga0316582_0015441 | Ga0316582_0015441_2974_4215 | 391 |
| 456 | 3300036712 | Ga0316584_0016275 | Ga0316584_0016275_3974_5215 | 391 |
| 457 | 3300037068 | Ga0373925_0092348 | Ga0373925_0092348_900_2102 | 391 |
| 458 | 3300037588 | Ga0316581_0012173 | Ga0316581_0012173_1018_2259 | 391 |
| 459 | 3300042008 | Ga0439450_023567 | Ga0439450_023567_45_1277 | 391 |
| 460 | 3300044694 | Ga0466963_0213314 | Ga0466963_0213314_119_1321 | 391 |
| 461 | 3300045976 | Ga0466967_0454943 | Ga0466967_0454943_14_1216 | 391 |
| 462 | 3300046455 | Ga0495603_0046950 | Ga0495603_0046950_682_1884 | 391 |
| 463 | 3300046459 | Ga0495629_0121008 | Ga0495629_0121008_458_1660 | 391 |
| 464 | 3300046461 | Ga0495641_0025950 | Ga0495641_0025950_747_1949 | 391 |
| 465 | 3300046463 | Ga0495653_0152584 | Ga0495653_0152584_248_1450 | 391 |
| 466 | 3300046472 | Ga0495580_0148277 | Ga0495580_0148277_286_1488 | 391 |
| 467 | 3300046473 | Ga0495582_0121551 | Ga0495582_0121551_179_1381 | 391 |
| 468 | 3300046475 | Ga0495639_0034799 | Ga0495639_0034799_632_1834 | 391 |
| 469 | 3300046476 | Ga0495662_0036992 | Ga0495662_0036992_984_2186 | 391 |
| 470 | 3300046477 | Ga0495664_0118222 | Ga0495664_0118222_199_1401 | 391 |
| 471 | 3300046499 | Ga0495594_0126442 | Ga0495594_0126442_80_1282 | 391 |
| 472 | 3300046517 | Ga0495630_0089703 | Ga0495630_0089703_71_1273 | 391 |
| 473 | 3300046523 | Ga0495644_0063299 | Ga0495644_0063299_73_1314 | 391 |
| 474 | 3300046526 | Ga0495666_0026364 | Ga0495666_0026364_281_1483 | 391 |
| 475 | 3300046531 | Ga0495665_0098671 | Ga0495665_0098671_88_1290 | 391 |
| 476 | 3300046533 | Ga0495640_0064393 | Ga0495640_0064393_1089_2291 | 391 |
| 477 | 3300046557 | Ga0495622_0049263 | Ga0495622_0049263_572_1774 | 391 |
| 478 | 3300046559 | Ga0495667_0146909 | Ga0495667_0146909_198_1400 | 391 |
| 479 | 3300046642 | Ga0495634_0137675 | Ga0495634_0137675_134_1336 | 391 |
| 480 | 3300046663 | Ga0495635_0154080 | Ga0495635_0154080_189_1391 | 391 |
| 481 | 3300046674 | Ga0495588_0044169 | Ga0495588_0044169_906_2108 | 391 |
| 482 | 3300046681 | Ga0495647_0033369 | Ga0495647_0033369_358_1560 | 391 |
| 483 | 3300046683 | Ga0495658_0052601 | Ga0495658_0052601_1032_2234 | 391 |
| 484 | 3300046689 | Ga0495613_0184921 | Ga0495613_0184921_182_1384 | 391 |
| 485 | 3300046690 | Ga0495624_0123652 | Ga0495624_0123652_198_1400 | 391 |
| 486 | 3300046809 | Ga0495600_0139002 | Ga0495600_0139002_109_1311 | 391 |
| 487 | 3300047315 | Ga0495581_0103120 | Ga0495581_0103120_380_1582 | 391 |
| 488 | 3300047319 | Ga0495674_0107142 | Ga0495674_0107142_1138_2340 | 391 |
| 489 | 3300047321 | Ga0495676_0101013 | Ga0495676_0101013_848_2050 | 391 |
| 490 | 3300047322 | Ga0495680_0176318 | Ga0495680_0176318_216_1418 | 391 |
| 491 | 3300047444 | Ga0495675_0147534 | Ga0495675_0147534_75_1409 | 391 |
| 492 | 3300047471 | Ga0495684_0194384 | Ga0495684_0194384_212_1414 | 391 |
| 493 | 3300047673 | Ga0495593_0071503 | Ga0495593_0071503_231_1433 | 391 |
| 494 | 3300048089 | Ga0495614_0028999 | Ga0495614_0028999_169_1371 | 391 |
| 495 | 3300048903 | Ga0496100_0132809 | Ga0496100_0132809_333_1535 | 391 |
| 496 | 3300048905 | Ga0496102_0130010 | Ga0496102_0130010_20_1354 | 391 |
| 497 | 3300048909 | Ga0496106_0207260 | Ga0496106_0207260_201_1535 | 391 |
| 498 | 3300048909 | Ga0496106_0240782 | Ga0496106_0240782_83_1285 | 391 |
| 499 | 3300048911 | Ga0496108_0239393 | Ga0496108_0239393_163_1497 | 391 |
| 500 | 3300048912 | Ga0496109_0222178 | Ga0496109_0222178_180_1514 | 391 |
| 501 | 3300048912 | Ga0496109_0284131 | Ga0496109_0284131_159_1361 | 391 |
| 502 | 3300048913 | Ga0496110_0048354 | Ga0496110_0048354_1583_2785 | 391 |
| 503 | 3300048914 | Ga0496111_0158576 | Ga0496111_0158576_263_1465 | 391 |
| 504 | 3300048915 | Ga0496112_0365930 | Ga0496112_0365930_163_1365 | 391 |
| 505 | 3300049585 | Ga0501069_0067935 | Ga0501069_0067935_324_1529 | 391 |
| 506 | 3300050508 | nmdc:mga09592_230577_c1 | nmdc:mga09592_230577_c1_252_1454 | 391 |
| 507 | 3300050511 | nmdc:mga08y16_367692_c1 | nmdc:mga08y16_367692_c1_100_1302 | 391 |
| 508 | 3300050512 | nmdc:mga0n895_239331_c1 | nmdc:mga0n895_239331_c1_247_1449 | 391 |
| 509 | 3300050515 | nmdc:mga0a205_278902_c1 | nmdc:mga0a205_278902_c1_268_1470 | 391 |
| 510 | 3300053077 | Ga0495601_0149888 | Ga0495601_0149888_243_1445 | 391 |
| 511 | 3300053078 | Ga0495612_0018353 | Ga0495612_0018353_987_2255 | 391 |
| 512 | 3300053078 | Ga0495612_0028499 | Ga0495612_0028499_205_1407 | 391 |
| 513 | 3300053084 | Ga0495595_0056635 | Ga0495595_0056635_81_1349 | 391 |
| 514 | 3300053084 | Ga0495595_0058030 | Ga0495595_0058030_333_1535 | 391 |
| 515 | 3300053085 | Ga0495619_0068938 | Ga0495619_0068938_205_1407 | 391 |
| 516 | 3300001904 | JGI24736J21556_1003726 | JGI24736J21556_10037264 | 392 |
| 517 | 3300001979 | JGI24740J21852_10013036 | JGI24740J21852_100130361 | 392 |
| 518 | 3300001979 | JGI24740J21852_10017173 | JGI24740J21852_100171732 | 392 |
| 519 | 3300001989 | JGI24739J22299_10011398 | JGI24739J22299_100113985 | 392 |
| 520 | 3300001989 | JGI24739J22299_10029983 | JGI24739J22299_100299832 | 392 |
| 521 | 3300001990 | JGI24737J22298_10038737 | JGI24737J22298_100387371 | 392 |
| 522 | 3300001990 | JGI24737J22298_10040074 | JGI24737J22298_100400741 | 392 |
| 523 | 3300002067 | JGI24735J21928_10035465 | JGI24735J21928_100354651 | 392 |
| 524 | 3300002074 | JGI24748J21848_1002255 | JGI24748J21848_10022552 | 392 |
| 525 | 3300002074 | JGI24748J21848_1004189 | JGI24748J21848_10041892 | 392 |
| 526 | 3300002075 | JGI24738J21930_10006727 | JGI24738J21930_100067271 | 392 |
| 527 | 3300002075 | JGI24738J21930_10006766 | JGI24738J21930_100067661 | 392 |
| 528 | 3300002239 | JGI24034J26672_10002275 | JGI24034J26672_100022751 | 392 |
| 529 | 3300002239 | JGI24034J26672_10005082 | JGI24034J26672_100050823 | 392 |
| 530 | 3300002737 | JGI25162J39368_1005355 | JGI25162J39368_10053553 | 392 |
| 531 | 3300002773 | JGI25152J39213_1015316 | JGI25152J39213_10153161 | 392 |
| 532 | 3300002774 | JGI25150J39212_1012362 | JGI25150J39212_10123621 | 392 |
| 533 | 3300003187 | JGI25151J46595_10046711 | JGI25151J46595_100467111 | 392 |
| 534 | 3300003214 | JGI25165J46597_1004612 | JGI25165J46597_10046124 | 392 |
| 535 | 3300003215 | JGI25153J46596_10038275 | JGI25153J46596_100382751 | 392 |
| 536 | 3300003659 | JGI25404J52841_10019148 | JGI25404J52841_100191481 | 392 |
| 537 | 3300003752 | Ga0055539_1003335 | Ga0055539_10033353 | 392 |
| 538 | 3300003752 | Ga0055539_1003349 | Ga0055539_10033491 | 392 |
| 539 | 3300003771 | Ga0055526_1027249 | Ga0055526_10272492 | 392 |
| 540 | 3300005341 | Ga0070691_10026813 | Ga0070691_100268134 | 392 |
| 541 | 3300005344 | Ga0070661_100130118 | Ga0070661_1001301181 | 392 |
| 542 | 3300005347 | Ga0070668_100159071 | Ga0070668_1001590712 | 392 |
| 543 | 3300005367 | Ga0070667_100088281 | Ga0070667_1000882812 | 392 |
| 544 | 3300005437 | Ga0070710_10029533 | Ga0070710_100295332 | 392 |
| 545 | 3300005457 | Ga0070662_100145049 | Ga0070662_1001450491 | 392 |
| 546 | 3300005539 | Ga0068853_100161980 | Ga0068853_1001619802 | 392 |
| 547 | 3300005539 | Ga0068853_100326430 | Ga0068853_1003264301 | 392 |
| 548 | 3300005545 | Ga0070695_100145334 | Ga0070695_1001453341 | 392 |
| 549 | 3300005548 | Ga0070665_100372587 | Ga0070665_1003725871 | 392 |
| 550 | 3300005563 | Ga0068855_100340528 | Ga0068855_1003405282 | 392 |
| 551 | 3300005563 | Ga0068855_100442922 | Ga0068855_1004429221 | 392 |
| 552 | 3300005577 | Ga0068857_100077096 | Ga0068857_1000770963 | 392 |
| 553 | 3300005578 | Ga0068854_100076483 | Ga0068854_1000764832 | 392 |
| 554 | 3300005578 | Ga0068854_100185699 | Ga0068854_1001856992 | 392 |
| 555 | 3300005578 | Ga0068854_100211915 | Ga0068854_1002119152 | 392 |
| 556 | 3300005614 | Ga0068856_100384796 | Ga0068856_1003847961 | 392 |
| 557 | 3300005616 | Ga0068852_100259703 | Ga0068852_1002597032 | 392 |
| 558 | 3300005616 | Ga0068852_100360744 | Ga0068852_1003607441 | 392 |
| 559 | 3300005834 | Ga0068851_10061010 | Ga0068851_100610102 | 392 |
| 560 | 3300005834 | Ga0068851_10115337 | Ga0068851_101153371 | 392 |
| 561 | 3300005843 | Ga0068860_100309675 | Ga0068860_1003096751 | 392 |
| 562 | 3300005937 | Ga0081455_10097017 | Ga0081455_100970171 | 392 |
| 563 | 3300005981 | Ga0081538_10025935 | Ga0081538_100259354 | 392 |
| 564 | 3300005983 | Ga0081540_1029113 | Ga0081540_10291133 | 392 |
| 565 | 3300006038 | Ga0075365_10065192 | Ga0075365_100651923 | 392 |
| 566 | 3300006846 | Ga0075430_100155278 | Ga0075430_1001552782 | 392 |
| 567 | 3300007265 | Ga0099794_10066792 | Ga0099794_100667922 | 392 |
| 568 | 3300009011 | Ga0105251_10088488 | Ga0105251_100884881 | 392 |
| 569 | 3300009093 | Ga0105240_10459403 | Ga0105240_104594031 | 392 |
| 570 | 3300009174 | Ga0105241_10282350 | Ga0105241_102823501 | 392 |
| 571 | 3300009177 | Ga0105248_10066968 | Ga0105248_100669683 | 392 |
| 572 | 3300009545 | Ga0105237_10377046 | Ga0105237_103770461 | 392 |
| 573 | 3300009545 | Ga0105237_10377990 | Ga0105237_103779901 | 392 |
| 574 | 3300009551 | Ga0105238_10033243 | Ga0105238_100332434 | 392 |
| 575 | 3300009551 | Ga0105238_10370664 | Ga0105238_103706641 | 392 |
| 576 | 3300009553 | Ga0105249_10029672 | Ga0105249_100296721 | 392 |
| 577 | 3300010375 | Ga0105239_10405500 | Ga0105239_104055001 | 392 |
| 578 | 3300010375 | Ga0105239_10476291 | Ga0105239_104762911 | 392 |
| 579 | 3300013100 | Ga0157373_10057003 | Ga0157373_100570034 | 392 |
| 580 | 3300013102 | Ga0157371_10207790 | Ga0157371_102077901 | 392 |
| 581 | 3300013104 | Ga0157370_10184762 | Ga0157370_101847622 | 392 |
| 582 | 3300013105 | Ga0157369_10304516 | Ga0157369_103045161 | 392 |
| 583 | 3300013307 | Ga0157372_10255388 | Ga0157372_102553882 | 392 |
| 584 | 3300017792 | Ga0163161_10110263 | Ga0163161_101102632 | 392 |
| 585 | 3300017792 | Ga0163161_10223205 | Ga0163161_102232051 | 392 |
| 586 | 3300021377 | Ga0213874_10026637 | Ga0213874_100266371 | 392 |
| 587 | 3300021384 | Ga0213876_10039350 | Ga0213876_100393502 | 392 |
| 588 | 3300021388 | Ga0213875_10035242 | Ga0213875_100352421 | 392 |
| 589 | 3300021388 | Ga0213875_10091052 | Ga0213875_100910521 | 392 |
| 590 | 3300025233 | Ga0209437_102208 | Ga0209437_1022084 | 392 |
| 591 | 3300025246 | Ga0209646_1003033 | Ga0209646_10030332 | 392 |
| 592 | 3300025253 | Ga0209677_100188 | Ga0209677_10018853 | 392 |
| 593 | 3300025253 | Ga0209677_111076 | Ga0209677_1110761 | 392 |
| 594 | 3300025261 | Ga0209233_1023826 | Ga0209233_10238261 | 392 |
| 595 | 3300025261 | Ga0209233_1026373 | Ga0209233_10263731 | 392 |
| 596 | 3300025273 | Ga0209673_1020412 | Ga0209673_10204123 | 392 |
| 597 | 3300025291 | Ga0209675_1017841 | Ga0209675_10178411 | 392 |
| 598 | 3300025295 | Ga0209564_1009330 | Ga0209564_10093303 | 392 |
| 599 | 3300025299 | Ga0209256_1018117 | Ga0209256_10181171 | 392 |
| 600 | 3300025321 | Ga0207656_10019888 | Ga0207656_100198881 | 392 |
| 601 | 3300025735 | Ga0207713_1008718 | Ga0207713_10087184 | 392 |
| 602 | 3300025904 | Ga0207647_10044628 | Ga0207647_100446284 | 392 |
| 603 | 3300025911 | Ga0207654_10167603 | Ga0207654_101676031 | 392 |
| 604 | 3300025913 | Ga0207695_10326818 | Ga0207695_103268181 | 392 |
| 605 | 3300025914 | Ga0207671_10006891 | Ga0207671_100068916 | 392 |
| 606 | 3300025914 | Ga0207671_10239936 | Ga0207671_102399361 | 392 |
| 607 | 3300025914 | Ga0207671_10242248 | Ga0207671_102422481 | 392 |
| 608 | 3300025920 | Ga0207649_10150955 | Ga0207649_101509551 | 392 |
| 609 | 3300025923 | Ga0207681_10151217 | Ga0207681_101512172 | 392 |
| 610 | 3300025924 | Ga0207694_10261335 | Ga0207694_102613351 | 392 |
| 611 | 3300025933 | Ga0207706_10052960 | Ga0207706_100529607 | 392 |
| 612 | 3300025941 | Ga0207711_10073795 | Ga0207711_100737953 | 392 |
| 613 | 3300025949 | Ga0207667_10319500 | Ga0207667_103195001 | 392 |
| 614 | 3300025949 | Ga0207667_10406565 | Ga0207667_104065651 | 392 |
| 615 | 3300025961 | Ga0207712_10017722 | Ga0207712_100177222 | 392 |
| 616 | 3300025972 | Ga0207668_10248053 | Ga0207668_102480531 | 392 |
| 617 | 3300025981 | Ga0207640_10057504 | Ga0207640_100575043 | 392 |
| 618 | 3300025981 | Ga0207640_10208569 | Ga0207640_102085691 | 392 |
| 619 | 3300025986 | Ga0207658_10242884 | Ga0207658_102428842 | 392 |
| 620 | 3300026041 | Ga0207639_10102542 | Ga0207639_101025422 | 392 |
| 621 | 3300026041 | Ga0207639_10240596 | Ga0207639_102405961 | 392 |
| 622 | 3300026078 | Ga0207702_10345511 | Ga0207702_103455111 | 392 |
| 623 | 3300026116 | Ga0207674_10034570 | Ga0207674_100345706 | 392 |
| 624 | 3300026142 | Ga0207698_10051504 | Ga0207698_100515041 | 392 |
| 625 | 3300026142 | Ga0207698_10334838 | Ga0207698_103348381 | 392 |
| 626 | 3300028379 | Ga0268266_10183783 | Ga0268266_101837831 | 392 |
| 627 | 3300031731 | Ga0307405_10056244 | Ga0307405_100562443 | 392 |
| 628 | 3300031731 | Ga0307405_10086883 | Ga0307405_100868832 | 392 |
| 629 | 3300031824 | Ga0307413_10057187 | Ga0307413_100571871 | 392 |
| 630 | 3300031852 | Ga0307410_10216579 | Ga0307410_102165791 | 392 |
| 631 | 3300031852 | Ga0307410_10224597 | Ga0307410_102245971 | 392 |
| 632 | 3300031901 | Ga0307406_10143715 | Ga0307406_101437151 | 392 |
| 633 | 3300031903 | Ga0307407_10044636 | Ga0307407_100446362 | 392 |
| 634 | 3300031903 | Ga0307407_10160545 | Ga0307407_101605451 | 392 |
| 635 | 3300031911 | Ga0307412_10143976 | Ga0307412_101439761 | 392 |
| 636 | 3300031911 | Ga0307412_10177747 | Ga0307412_101777472 | 392 |
| 637 | 3300031911 | Ga0307412_10283114 | Ga0307412_102831141 | 392 |
| 638 | 3300031995 | Ga0307409_100280983 | Ga0307409_1002809831 | 392 |
| 639 | 3300031995 | Ga0307409_100304378 | Ga0307409_1003043781 | 392 |
| 640 | 3300032002 | Ga0307416_100256260 | Ga0307416_1002562602 | 392 |
| 641 | 3300032002 | Ga0307416_100288686 | Ga0307416_1002886862 | 392 |
| 642 | 3300032004 | Ga0307414_10100285 | Ga0307414_101002852 | 392 |
| 643 | 3300032004 | Ga0307414_10206720 | Ga0307414_102067201 | 392 |
| 644 | 3300032005 | Ga0307411_10098287 | Ga0307411_100982872 | 392 |
| 645 | 3300032126 | Ga0307415_100229999 | Ga0307415_1002299991 | 392 |
| 646 | 3300032126 | Ga0307415_100238026 | Ga0307415_1002380261 | 392 |
| 647 | 3300035111 | Ga0373923_0025794 | Ga0373923_0025794_169_1374 | 392 |
| 648 | 3300035113 | Ga0373936_0020407 | Ga0373936_0020407_1216_2421 | 392 |
| 649 | 3300035117 | Ga0373953_0063118 | Ga0373953_0063118_93_1298 | 392 |
| 650 | 3300035118 | Ga0373954_0089071 | Ga0373954_0089071_183_1388 | 392 |
| 651 | 3300035119 | Ga0373956_0067958 | Ga0373956_0067958_77_1282 | 392 |
| 652 | 3300035120 | Ga0373957_0018967 | Ga0373957_0018967_1080_2285 | 392 |
| 653 | 3300035172 | Ga0373955_0114869 | Ga0373955_0114869_74_1279 | 392 |
| 654 | 3300035410 | Ga0373924_0014650 | Ga0373924_0014650_1588_2793 | 392 |
| 655 | 3300035692 | Ga0373935_0092120 | Ga0373935_0092120_710_1915 | 392 |
| 656 | 3300035724 | Ga0373933_0113942 | Ga0373933_0113942_181_1386 | 392 |
| 657 | 3300037068 | Ga0373925_0245852 | Ga0373925_0245852_218_1423 | 392 |
| 658 | 3300037588 | Ga0316581_0034990 | Ga0316581_0034990_155_1351 | 392 |
| 659 | 3300037853 | Ga0436364_0200835 | Ga0436364_0200835_1874_3106 | 392 |
| 660 | 3300037853 | Ga0436364_1218439 | Ga0436364_1218439_201_1466 | 392 |
| 661 | 3300039438 | Ga0436360_0084886 | Ga0436360_0084886_1136_2368 | 392 |
| 662 | 3300039450 | Ga0436363_0261507 | Ga0436363_0261507_2889_4154 | 392 |
| 663 | 3300039450 | Ga0436363_0277506 | Ga0436363_0277506_153_1487 | 392 |
| 664 | 3300039450 | Ga0436363_1611071 | Ga0436363_1611071_170_1438 | 392 |
| 665 | 3300041404 | Ga0439436_0023562 | Ga0439436_0023562_191_1387 | 392 |
| 666 | 3300041405 | Ga0439438_029343 | Ga0439438_029343_149_1345 | 392 |
| 667 | 3300041406 | Ga0439439_0007978 | Ga0439439_0007978_467_1663 | 392 |
| 668 | 3300041406 | Ga0439439_0013190 | Ga0439439_0013190_683_1957 | 392 |
| 669 | 3300041410 | Ga0439461_0018148 | Ga0439461_0018148_34_1230 | 392 |
| 670 | 3300041411 | Ga0439466_0012851 | Ga0439466_0012851_1707_2903 | 392 |
| 671 | 3300041411 | Ga0439466_0023393 | Ga0439466_0023393_182_1456 | 392 |
| 672 | 3300041413 | Ga0439465_0023758 | Ga0439465_0023758_316_1590 | 392 |
| 673 | 3300041413 | Ga0439465_0026088 | Ga0439465_0026088_182_1378 | 392 |
| 674 | 3300041997 | Ga0439431_0007448 | Ga0439431_0007448_892_2088 | 392 |
| 675 | 3300041999 | Ga0439433_0007590 | Ga0439433_0007590_172_1368 | 392 |
| 676 | 3300042002 | Ga0439442_004918 | Ga0439442_004918_1331_2527 | 392 |
| 677 | 3300042004 | Ga0439445_0011925 | Ga0439445_0011925_683_1879 | 392 |
| 678 | 3300042006 | Ga0439432_019040 | Ga0439432_019040_404_1600 | 392 |
| 679 | 3300042006 | Ga0439432_032108 | Ga0439432_032108_378_1652 | 392 |
| 680 | 3300042007 | Ga0439449_0015464 | Ga0439449_0015464_659_1855 | 392 |
| 681 | 3300042007 | Ga0439449_0036471 | Ga0439449_0036471_113_1387 | 392 |
| 682 | 3300042010 | Ga0439452_026401 | Ga0439452_026401_156_1352 | 392 |
| 683 | 3300042014 | Ga0439457_007919 | Ga0439457_007919_210_1406 | 392 |
| 684 | 3300042015 | Ga0439462_0003810 | Ga0439462_0003810_1692_2888 | 392 |
| 685 | 3300042015 | Ga0439462_0008518 | Ga0439462_0008518_1213_2487 | 392 |
| 686 | 3300042435 | Ga0439434_0006142 | Ga0439434_0006142_1956_3152 | 392 |
| 687 | 3300042461 | Ga0439460_0018984 | Ga0439460_0018984_536_1810 | 392 |
| 688 | 3300044684 | Ga0466966_0132662 | Ga0466966_0132662_112_1455 | 392 |
| 689 | 3300044693 | Ga0466961_0111097 | Ga0466961_0111097_95_1438 | 392 |
| 690 | 3300044694 | Ga0466963_0167964 | Ga0466963_0167964_112_1455 | 392 |
| 691 | 3300044719 | Ga0466971_0051724 | Ga0466971_0051724_122_1465 | 392 |
| 692 | 3300044735 | Ga0466968_0027291 | Ga0466968_0027291_892_2235 | 392 |
| 693 | 3300044842 | Ga0466957_0041443 | Ga0466957_0041443_1278_2621 | 392 |
| 694 | 3300044842 | Ga0466957_0111884 | Ga0466957_0111884_360_1634 | 392 |
| 695 | 3300044901 | Ga0466960_0085078 | Ga0466960_0085078_82_1356 | 392 |
| 696 | 3300045049 | Ga0466959_0145808 | Ga0466959_0145808_273_1616 | 392 |
| 697 | 3300045836 | Ga0466958_0047629 | Ga0466958_0047629_1289_2563 | 392 |
| 698 | 3300045836 | Ga0466958_0080462 | Ga0466958_0080462_508_1851 | 392 |
| 699 | 3300045976 | Ga0466967_0105079 | Ga0466967_0105079_389_1663 | 392 |
| 700 | 3300045976 | Ga0466967_0175043 | Ga0466967_0175043_146_1420 | 392 |
| 701 | 3300045976 | Ga0466967_0214140 | Ga0466967_0214140_264_1607 | 392 |
| 702 | 3300046452 | Ga0495617_026608 | Ga0495617_026608_258_1454 | 392 |
| 703 | 3300046453 | Ga0495627_015591 | Ga0495627_015591_396_1592 | 392 |
| 704 | 3300046453 | Ga0495627_040731 | Ga0495627_040731_163_1359 | 392 |
| 705 | 3300046454 | Ga0495592_0074302 | Ga0495592_0074302_1080_2294 | 392 |
| 706 | 3300046454 | Ga0495592_0173871 | Ga0495592_0173871_90_1295 | 392 |
| 707 | 3300046459 | Ga0495629_0161252 | Ga0495629_0161252_53_1267 | 392 |
| 708 | 3300046460 | Ga0495638_0093551 | Ga0495638_0093551_416_1612 | 392 |
| 709 | 3300046462 | Ga0495651_0077744 | Ga0495651_0077744_1107_2312 | 392 |
| 710 | 3300046463 | Ga0495653_0042189 | Ga0495653_0042189_1545_2750 | 392 |
| 711 | 3300046463 | Ga0495653_0075850 | Ga0495653_0075850_1094_2308 | 392 |
| 712 | 3300046471 | Ga0495650_0033554 | Ga0495650_0033554_428_1624 | 392 |
| 713 | 3300046473 | Ga0495582_0055659 | Ga0495582_0055659_586_1800 | 392 |
| 714 | 3300046475 | Ga0495639_0022652 | Ga0495639_0022652_1323_2537 | 392 |
| 715 | 3300046476 | Ga0495662_0033868 | Ga0495662_0033868_172_1386 | 392 |
| 716 | 3300046477 | Ga0495664_0030006 | Ga0495664_0030006_1559_2773 | 392 |
| 717 | 3300046511 | Ga0495608_0058694 | Ga0495608_0058694_275_1480 | 392 |
| 718 | 3300046516 | Ga0495628_0082475 | Ga0495628_0082475_334_1539 | 392 |
| 719 | 3300046516 | Ga0495628_0169762 | Ga0495628_0169762_147_1352 | 392 |
| 720 | 3300046517 | Ga0495630_0056928 | Ga0495630_0056928_1384_2598 | 392 |
| 721 | 3300046519 | Ga0495632_0000197 | Ga0495632_0000197_36140_37354 | 392 |
| 722 | 3300046522 | Ga0495643_0001792 | Ga0495643_0001792_280_1476 | 392 |
| 723 | 3300046522 | Ga0495643_0029016 | Ga0495643_0029016_1026_2222 | 392 |
| 724 | 3300046522 | Ga0495643_0081049 | Ga0495643_0081049_140_1336 | 392 |
| 725 | 3300046524 | Ga0495648_0031243 | Ga0495648_0031243_180_1376 | 392 |
| 726 | 3300046524 | Ga0495648_0080148 | Ga0495648_0080148_235_1431 | 392 |
| 727 | 3300046529 | Ga0495652_0121963 | Ga0495652_0121963_676_1890 | 392 |
| 728 | 3300046529 | Ga0495652_0207471 | Ga0495652_0207471_257_1462 | 392 |
| 729 | 3300046536 | Ga0495587_0049964 | Ga0495587_0049964_1108_2313 | 392 |
| 730 | 3300046543 | Ga0495645_0042142 | Ga0495645_0042142_129_1334 | 392 |
| 731 | 3300046557 | Ga0495622_0078687 | Ga0495622_0078687_149_1345 | 392 |
| 732 | 3300046559 | Ga0495667_0159799 | Ga0495667_0159799_167_1372 | 392 |
| 733 | 3300046648 | Ga0495611_0085065 | Ga0495611_0085065_169_1365 | 392 |
| 734 | 3300046663 | Ga0495635_0044022 | Ga0495635_0044022_1625_2830 | 392 |
| 735 | 3300046663 | Ga0495635_0101179 | Ga0495635_0101179_490_1704 | 392 |
| 736 | 3300046664 | Ga0495659_0013897 | Ga0495659_0013897_390_1586 | 392 |
| 737 | 3300046664 | Ga0495659_0050684 | Ga0495659_0050684_277_1473 | 392 |
| 738 | 3300046674 | Ga0495588_0017251 | Ga0495588_0017251_1436_2650 | 392 |
| 739 | 3300046675 | Ga0495657_0034436 | Ga0495657_0034436_986_2182 | 392 |
| 740 | 3300046675 | Ga0495657_0152955 | Ga0495657_0152955_120_1325 | 392 |
| 741 | 3300046678 | Ga0495599_0049369 | Ga0495599_0049369_1310_2515 | 392 |
| 742 | 3300046680 | Ga0495646_0116768 | Ga0495646_0116768_78_1292 | 392 |
| 743 | 3300046681 | Ga0495647_0061842 | Ga0495647_0061842_195_1409 | 392 |
| 744 | 3300046683 | Ga0495658_0083019 | Ga0495658_0083019_165_1379 | 392 |
| 745 | 3300046684 | Ga0495669_0031310 | Ga0495669_0031310_48_1244 | 392 |
| 746 | 3300046689 | Ga0495613_0190992 | Ga0495613_0190992_161_1375 | 392 |
| 747 | 3300046690 | Ga0495624_0061056 | Ga0495624_0061056_1090_2304 | 392 |
| 748 | 3300046691 | Ga0495670_0084117 | Ga0495670_0084117_254_1450 | 392 |
| 749 | 3300046692 | Ga0495671_0029158 | Ga0495671_0029158_1173_2369 | 392 |
| 750 | 3300046809 | Ga0495600_0092576 | Ga0495600_0092576_155_1369 | 392 |
| 751 | 3300046809 | Ga0495600_0131858 | Ga0495600_0131858_346_1551 | 392 |
| 752 | 3300047319 | Ga0495674_0109700 | Ga0495674_0109700_965_2179 | 392 |
| 753 | 3300047321 | Ga0495676_0084880 | Ga0495676_0084880_983_2197 | 392 |
| 754 | 3300047322 | Ga0495680_0083539 | Ga0495680_0083539_1130_2335 | 392 |
| 755 | 3300047443 | Ga0495687_060558 | Ga0495687_060558_190_1386 | 392 |
| 756 | 3300047443 | Ga0495687_064363 | Ga0495687_064363_111_1307 | 392 |
| 757 | 3300047444 | Ga0495675_0127018 | Ga0495675_0127018_219_1424 | 392 |
| 758 | 3300047469 | Ga0495673_0059141 | Ga0495673_0059141_381_1577 | 392 |
| 759 | 3300047470 | Ga0495681_0073090 | Ga0495681_0073090_187_1383 | 392 |
| 760 | 3300047471 | Ga0495684_0076602 | Ga0495684_0076602_1254_2459 | 392 |
| 761 | 3300047472 | Ga0495686_0140956 | Ga0495686_0140956_68_1264 | 392 |
| 762 | 3300047673 | Ga0495593_0042093 | Ga0495593_0042093_520_1734 | 392 |
| 763 | 3300048088 | Ga0495602_0198497 | Ga0495602_0198497_157_1362 | 392 |
| 764 | 3300048090 | Ga0495615_0003431 | Ga0495615_0003431_1236_2432 | 392 |
| 765 | 3300048905 | Ga0496102_0190555 | Ga0496102_0190555_215_1411 | 392 |
| 766 | 3300048909 | Ga0496106_0086902 | Ga0496106_0086902_416_1612 | 392 |
| 767 | 3300048916 | Ga0496113_0175436 | Ga0496113_0175436_387_1583 | 392 |
| 768 | 3300048920 | Ga0496117_0114862 | Ga0496117_0114862_282_1496 | 392 |
| 769 | 3300048921 | Ga0496118_0125911 | Ga0496118_0125911_243_1439 | 392 |
| 770 | 3300048921 | Ga0496118_0138711 | Ga0496118_0138711_51_1265 | 392 |
| 771 | 3300048923 | Ga0496120_0118214 | Ga0496120_0118214_160_1356 | 392 |
| 772 | 3300048924 | Ga0496121_0049894 | Ga0496121_0049894_1309_2505 | 392 |
| 773 | 3300048924 | Ga0496121_0091682 | Ga0496121_0091682_999_2213 | 392 |
| 774 | 3300048924 | Ga0496121_0156808 | Ga0496121_0156808_394_1590 | 392 |
| 775 | 3300048925 | Ga0496122_0045753 | Ga0496122_0045753_2154_3350 | 392 |
| 776 | 3300048925 | Ga0496122_0076516 | Ga0496122_0076516_283_1479 | 392 |
| 777 | 3300048927 | Ga0496124_0011484 | Ga0496124_0011484_7367_8563 | 392 |
| 778 | 3300048927 | Ga0496124_0099989 | Ga0496124_0099989_680_1885 | 392 |
| 779 | 3300048927 | Ga0496124_0192395 | Ga0496124_0192395_210_1406 | 392 |
| 780 | 3300048928 | Ga0496125_0155316 | Ga0496125_0155316_174_1370 | 392 |
| 781 | 3300048929 | Ga0496126_0216133 | Ga0496126_0216133_124_1329 | 392 |
| 782 | 3300048929 | Ga0496126_0231832 | Ga0496126_0231832_161_1375 | 392 |
| 783 | 3300049460 | Ga0495682_0066457 | Ga0495682_0066457_80_1276 | 392 |
| 784 | 3300049521 | Ga0501298_009010 | Ga0501298_009010_339_1613 | 392 |
| 785 | 3300049652 | Ga0501202_016120 | Ga0501202_016120_107_1381 | 392 |
| 786 | 3300049681 | Ga0501251_002082 | Ga0501251_002082_424_1698 | 392 |
| 787 | 3300049685 | Ga0501256_002896 | Ga0501256_002896_27_1301 | 392 |
| 788 | 3300049690 | Ga0501261_005675 | Ga0501261_005675_71_1345 | 392 |
| 789 | 3300049767 | Ga0501270_002546 | Ga0501270_002546_535_1809 | 392 |
| 790 | 3300049771 | Ga0501274_001853 | Ga0501274_001853_282_1556 | 392 |
| 791 | 3300049779 | Ga0501283_007359 | Ga0501283_007359_70_1344 | 392 |
| 792 | 3300049851 | Ga0501212_008581 | Ga0501212_008581_35_1309 | 392 |
| 793 | 3300050492 | nmdc:mga0yw44_55892_c1 | nmdc:mga0yw44_55892_c1_185_1381 | 392 |
| 794 | 3300050494 | nmdc:mga06z11_112326_c1 | nmdc:mga06z11_112326_c1_81_1355 | 392 |
| 795 | 3300050509 | nmdc:mga0qj67_215564_c1 | nmdc:mga0qj67_215564_c1_101_1438 | 392 |
| 796 | 3300050510 | nmdc:mga06r32_346185_c1 | nmdc:mga06r32_346185_c1_50_1387 | 392 |
| 797 | 3300053077 | Ga0495601_0061605 | Ga0495601_0061605_185_1399 | 392 |
| 798 | 3300053084 | Ga0495595_0097014 | Ga0495595_0097014_56_1261 | 392 |
| 799 | 3300053085 | Ga0495619_0045573 | Ga0495619_0045573_1005_2219 | 392 |
| 800 | 3300053087 | Ga0500643_025450 | Ga0500643_025450_518_1714 | 392 |
| 801 | 3300053088 | Ga0500644_0007640 | Ga0500644_0007640_1205_2401 | 392 |
| 802 | 3300053090 | Ga0500646_0036700 | Ga0500646_0036700_111_1307 | 392 |
| 803 | 3300053093 | Ga0500651_0117140 | Ga0500651_0117140_153_1499 | 392 |
| 804 | 3300053111 | Ga0500572_009025 | Ga0500572_009025_1056_2252 | 392 |
| 805 | 3300053121 | Ga0500607_045741 | Ga0500607_045741_66_1280 | 392 |
| 806 | 3300053123 | Ga0500614_006776 | Ga0500614_006776_204_1418 | 392 |
| 807 | 3300053130 | Ga0500642_0083304 | Ga0500642_0083304_198_1394 | 392 |
| 808 | 3300053148 | Ga0500590_000843 | Ga0500590_000843_1478_2674 | 392 |
| 809 | 3300053153 | Ga0500616_0001524 | Ga0500616_0001524_8685_9899 | 392 |
| 810 | 3300053727 | Ga0500611_006389 | Ga0500611_006389_417_1613 | 392 |
| 811 | iso_pu_bacteria | 2511231052 | 2511498566 | 392 |
| 812 | iso_pu_bacteria | 2511231052 | 2511503405 | 392 |
| 813 | iso_pu_bacteria | 637000159 | 637078064 | 392 |
| 814 | iso_pu_bacteria | 641228493 | 641336581 | 392 |
| 815 | iso_pu_bacteria | 641228493 | 641336671 | 392 |
| 816 | iso_pu_bacteria | 8016557553 | 8016559513 | 392 |
| 817 | 3300001904 | JGI24736J21556_1001629 | JGI24736J21556_10016293 | 399 |
| 818 | 3300001979 | JGI24740J21852_10009422 | JGI24740J21852_100094222 | 399 |
| 819 | 3300001989 | JGI24739J22299_10006299 | JGI24739J22299_100062994 | 399 |
| 820 | 3300001990 | JGI24737J22298_10008340 | JGI24737J22298_100083403 | 399 |
| 821 | 3300002067 | JGI24735J21928_10008586 | JGI24735J21928_100085863 | 399 |
| 822 | 3300002075 | JGI24738J21930_10007872 | JGI24738J21930_100078723 | 399 |
| 823 | 3300005329 | Ga0070683_100050969 | Ga0070683_1000509694 | 399 |
| 824 | 3300005339 | Ga0070660_100036157 | Ga0070660_1000361574 | 399 |
| 825 | 3300005344 | Ga0070661_100009928 | Ga0070661_1000099286 | 399 |
| 826 | 3300005366 | Ga0070659_100023370 | Ga0070659_1000233703 | 399 |
| 827 | 3300005455 | Ga0070663_100007527 | Ga0070663_1000075274 | 399 |
| 828 | 3300005564 | Ga0070664_100068047 | Ga0070664_1000680475 | 399 |
| 829 | 3300005578 | Ga0068854_100120330 | Ga0068854_1001203302 | 399 |
| 830 | 3300025321 | Ga0207656_10026497 | Ga0207656_100264971 | 399 |
| 831 | 3300025904 | Ga0207647_10013300 | Ga0207647_100133005 | 399 |
| 832 | 3300025909 | Ga0207705_10010107 | Ga0207705_100101076 | 399 |
| 833 | 3300025911 | Ga0207654_10004912 | Ga0207654_100049125 | 399 |
| 834 | 3300025913 | Ga0207695_10269459 | Ga0207695_102694591 | 399 |
| 835 | 3300025914 | Ga0207671_10014260 | Ga0207671_100142602 | 399 |
| 836 | 3300025919 | Ga0207657_10006357 | Ga0207657_100063574 | 399 |
| 837 | 3300025920 | Ga0207649_10028417 | Ga0207649_100284172 | 399 |
| 838 | 3300025924 | Ga0207694_10009301 | Ga0207694_100093013 | 399 |
| 839 | 3300025932 | Ga0207690_10057463 | Ga0207690_100574632 | 399 |
| 840 | 3300025949 | Ga0207667_10004045 | Ga0207667_1000404517 | 399 |
| 841 | 3300025981 | Ga0207640_10016415 | Ga0207640_100164152 | 399 |
| 842 | 3300026041 | Ga0207639_10012416 | Ga0207639_100124166 | 399 |
| 843 | 3300026067 | Ga0207678_10016055 | Ga0207678_100160554 | 399 |
| 844 | 3300026078 | Ga0207702_10074173 | Ga0207702_100741732 | 399 |
| 845 | 3300026116 | Ga0207674_10004418 | Ga0207674_100044184 | 399 |
| 846 | 3300026142 | Ga0207698_10003339 | Ga0207698_1000333911 | 399 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1mus-assembly1.cif.gz_A-2 | crystal structure of tn5 transposase complexed with resolved outside end dna | 0.6435 | 62 | 388 |
| 1muh-assembly1.cif.gz_A-2 | crystal structure of tn5 transposase complexed with transposon end dna | 0.641 | 62 | 382 |
| 4dm0-assembly1.cif.gz_A-2 | tn5 transposase: 20mer outside end 2 mn complex | 0.6374 | 62 | 382 |
| 3ecp-assembly1.cif.gz_A-2 | crystal structure of tn5 transposase complexed with 5' phosphorylated transposon end dna | 0.6335 | 62 | 379 |
| 3bbj-assembly1.cif.gz_A | crystal structure of a putative thioesterase ii (tfu_2367) from thermobifida fusca yx at 2.45 a resolution | 0.6317 | 271 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9H3E2_504_632_3.30.1520.10 | Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain | 0.686 | 276 | 320 | 3.30.1520.10 |
| 5cz1D00 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.6502 | 97 | 224 | 3.30.420.10 |
| 1musA02 | Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 | 0.6214 | 79 | 350 | 3.90.350.10 |
| 1b7eA01 | Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 | 0.6111 | 79 | 346 | 3.90.350.10 |
| 1musA02 | Alpha Beta;Alpha-Beta Complex;Transposase Inhibitor Protein From Tn5; Chain A, domain 1;Transposase Inhibitor Protein From Tn5; Chain A, domain 1 | 0.6043 | 79 | 350 | 3.90.350.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R5PUL5-F1-model_v4 | IS701 family transposase | 0.9848 | 185 | 336 |
|
| AF-A0A1R3U2G8-F1-model_v4 | FOG: Transposase | 0.9691 | 213 | 384 |
|
| AF-A0A158S804-F1-model_v4 | Transposase | 0.9589 | 138 | 342 |
|
| AF-A0A252B1I9-F1-model_v4 | Transposase | 0.9563 | 171 | 390 |
GO:0003677
GO:0004803 GO:0006313 |
| AF-A0A4R5PUL5-F1-model_v4 | IS701 family transposase | 0.9538 | 185 | 336 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar