F483240
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 845 | 322 | 1690 | 279 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100047286|Ga0070711_1000472862 |
| Length | 308 |
| Sequence | MTTATAEATAEGPPARAPLVRRKPPAPVRRRRFLIGVANHSVLIFFAVLFLAPFMFIVLTSLMTNQQALSADFWPHPFRWSNFTDVFSKSPFWRWGVNSLIYSSLATLGLLLSSIPVAYALSKLRWRGRDVVFIVVIVALMLPPQVSVIPVYVMWSKLGDALGIHFIGNLSPLIIPNWFGDAFSIFLLRQFFLTIPEEYLDAARVDGCGEFKILATVVPRLAKPAIVAVAIFSILYTFSDFFLPLLYVGDAPNSWTLSIGLSEFRSLHQVQWNLTMAATVLVMLPVIIIFFLAQKAFVEGVTLTGVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 67 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 104 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 108 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 110 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 112 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 170 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 172 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 173 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 174 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 175 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 176 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 177 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 181 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 182 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 190 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 191 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 196 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 197 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 199 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 200 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 201 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 204 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 205 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 206 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 210 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 211 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 212 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 213 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 214 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 215 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 216 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 217 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 218 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 219 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 220 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 221 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 222 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 225 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 280 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 281 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 282 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 283 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 284 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 285 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 286 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 287 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 288 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 289 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 290 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 291 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 292 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 293 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 294 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.41 |
| Metatranscriptomes | 0.59 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.24 |
| Nodule | 0 |
| Rhizoplane | 9.82 |
| Rhizosphere | 89.47 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100047286 | 3300005439 | Bacteria | 2937 |
| 2 | JGI25406J46586_10001832 | 3300003203 | Bacteria | 9973 |
| 3 | JGI25406J46586_10014010 | 3300003203 | Bacteria | 3421 |
| 4 | Ga0070658_10008431 | 3300005327 | Bacteria | 8289 |
| 5 | Ga0070658_10084037 | 3300005327 | Bacteria | 2617 |
| 6 | Ga0070676_10068924 | 3300005328 | Bacteria | 2119 |
| 7 | Ga0070683_100002420 | 3300005329 | Bacteria | 14837 |
| 8 | Ga0070683_100083484 | 3300005329 | Bacteria | 2992 |
| 9 | Ga0070683_100104839 | 3300005329 | Bacteria | 2665 |
| 10 | Ga0070683_100181371 | 3300005329 | Bacteria | 1998 |
| 11 | Ga0070683_100238883 | 3300005329 | Bacteria | 1728 |
| 12 | Ga0070683_100363826 | 3300005329 | Bacteria | 1378 |
| 13 | Ga0070683_100416792 | 3300005329 | Bacteria | 1281 |
| 14 | Ga0070683_100604116 | 3300005329 | Bacteria | 1050 |
| 15 | Ga0070690_100034703 | 3300005330 | Bacteria | 3162 |
| 16 | Ga0070666_10158998 | 3300005335 | Bacteria | 1579 |
| 17 | Ga0070680_100004396 | 3300005336 | Bacteria | 10609 |
| 18 | Ga0070680_100020246 | 3300005336 | Bacteria | 5280 |
| 19 | Ga0070680_100221354 | 3300005336 | Bacteria | 1598 |
| 20 | Ga0070680_100230705 | 3300005336 | Bacteria | 1563 |
| 21 | Ga0070680_100319147 | 3300005336 | Bacteria | 1319 |
| 22 | Ga0070680_100333899 | 3300005336 | Bacteria | 1287 |
| 23 | Ga0070682_100156638 | 3300005337 | Bacteria | 1569 |
| 24 | Ga0068868_100174357 | 3300005338 | Bacteria | 1781 |
| 25 | Ga0070660_100000770 | 3300005339 | Bacteria | 21264 |
| 26 | Ga0070660_100011620 | 3300005339 | Bacteria | 6267 |
| 27 | Ga0070660_100024445 | 3300005339 | Bacteria | 4480 |
| 28 | Ga0070660_100037086 | 3300005339 | Bacteria | 3695 |
| 29 | Ga0070660_100069774 | 3300005339 | Bacteria | 2741 |
| 30 | Ga0070660_100380891 | 3300005339 | Bacteria | 1164 |
| 31 | Ga0070691_10042563 | 3300005341 | Bacteria | 2150 |
| 32 | Ga0070661_100014016 | 3300005344 | Bacteria | 5637 |
| 33 | Ga0070661_100026378 | 3300005344 | Bacteria | 4178 |
| 34 | Ga0070661_100263596 | 3300005344 | Bacteria | 1333 |
| 35 | Ga0070692_10008214 | 3300005345 | Bacteria | 4645 |
| 36 | Ga0070668_100008922 | 3300005347 | Bacteria | 7442 |
| 37 | Ga0070668_100133863 | 3300005347 | Bacteria | 1991 |
| 38 | Ga0070669_100070685 | 3300005353 | Bacteria | 2581 |
| 39 | Ga0070675_100161375 | 3300005354 | Bacteria | 1928 |
| 40 | Ga0070671_100097851 | 3300005355 | Bacteria | 2461 |
| 41 | Ga0070671_100112828 | 3300005355 | Bacteria | 2284 |
| 42 | Ga0070674_100093944 | 3300005356 | Bacteria | 2171 |
| 43 | Ga0070674_100160271 | 3300005356 | Bacteria | 1706 |
| 44 | Ga0070674_100166125 | 3300005356 | Bacteria | 1678 |
| 45 | Ga0070673_100046656 | 3300005364 | Bacteria | 3367 |
| 46 | Ga0070688_100007315 | 3300005365 | Bacteria | 5947 |
| 47 | Ga0070659_100005233 | 3300005366 | Bacteria | 9306 |
| 48 | Ga0070659_100166388 | 3300005366 | Bacteria | 1804 |
| 49 | Ga0070659_100183126 | 3300005366 | Bacteria | 1720 |
| 50 | Ga0070659_100199694 | 3300005366 | Bacteria | 1646 |
| 51 | Ga0070659_100256665 | 3300005366 | Bacteria | 1450 |
| 52 | Ga0070667_100219758 | 3300005367 | Bacteria | 1691 |
| 53 | Ga0070667_100298991 | 3300005367 | Bacteria | 1449 |
| 54 | Ga0070709_10120470 | 3300005434 | Bacteria | 1778 |
| 55 | Ga0070714_100048652 | 3300005435 | Bacteria | 3606 |
| 56 | Ga0070714_100073677 | 3300005435 | Bacteria | 2959 |
| 57 | Ga0070714_100174409 | 3300005435 | Bacteria | 1953 |
| 58 | Ga0070714_100218784 | 3300005435 | Bacteria | 1749 |
| 59 | Ga0070714_100267155 | 3300005435 | Bacteria | 1585 |
| 60 | Ga0070713_100028734 | 3300005436 | Bacteria | 4394 |
| 61 | Ga0070713_100056914 | 3300005436 | Bacteria | 3253 |
| 62 | Ga0070710_10258156 | 3300005437 | Bacteria | 1123 |
| 63 | Ga0070710_10387967 | 3300005437 | Bacteria | 933 |
| 64 | Ga0070711_100003846 | 3300005439 | Bacteria | 8812 |
| 65 | Ga0070711_100030939 | 3300005439 | Bacteria | 3549 |
| 66 | Ga0070705_100004640 | 3300005440 | Bacteria | 6691 |
| 67 | Ga0070700_100000794 | 3300005441 | Bacteria | 15506 |
| 68 | Ga0070700_100005756 | 3300005441 | Bacteria | 6577 |
| 69 | Ga0070694_100006557 | 3300005444 | Bacteria | 7071 |
| 70 | Ga0070694_100144727 | 3300005444 | Bacteria | 1730 |
| 71 | Ga0070708_100003130 | 3300005445 | Bacteria | 12880 |
| 72 | Ga0070663_100226884 | 3300005455 | Bacteria | 1469 |
| 73 | Ga0070678_100042479 | 3300005456 | Bacteria | 3231 |
| 74 | Ga0070678_100433884 | 3300005456 | Bacteria | 1148 |
| 75 | Ga0070681_10001129 | 3300005458 | Bacteria | 22933 |
| 76 | Ga0070681_10011904 | 3300005458 | Bacteria | 8626 |
| 77 | Ga0070681_10014817 | 3300005458 | Bacteria | 7754 |
| 78 | Ga0070681_10021437 | 3300005458 | Bacteria | 6479 |
| 79 | Ga0070681_10070369 | 3300005458 | Bacteria | 3464 |
| 80 | Ga0070681_10153591 | 3300005458 | Bacteria | 2227 |
| 81 | Ga0068867_100044955 | 3300005459 | Bacteria | 3237 |
| 82 | Ga0068867_100092962 | 3300005459 | Bacteria | 2291 |
| 83 | Ga0068867_100106640 | 3300005459 | Bacteria | 2147 |
| 84 | Ga0068867_100144497 | 3300005459 | Bacteria | 1863 |
| 85 | Ga0068867_100193944 | 3300005459 | Bacteria | 1622 |
| 86 | Ga0070685_10001659 | 3300005466 | Bacteria | 11702 |
| 87 | Ga0070706_100002074 | 3300005467 | Bacteria | 20447 |
| 88 | Ga0070706_100341685 | 3300005467 | Bacteria | 1396 |
| 89 | Ga0070707_100005619 | 3300005468 | Bacteria | 11722 |
| 90 | Ga0070698_100030900 | 3300005471 | Bacteria | 5554 |
| 91 | Ga0070699_100002657 | 3300005518 | Bacteria | 15965 |
| 92 | Ga0070699_100039172 | 3300005518 | Bacteria | 4104 |
| 93 | Ga0070679_100010930 | 3300005530 | Bacteria | 8626 |
| 94 | Ga0070679_100013896 | 3300005530 | Bacteria | 7714 |
| 95 | Ga0070679_100023167 | 3300005530 | Bacteria | 6076 |
| 96 | Ga0070679_100073580 | 3300005530 | Bacteria | 3408 |
| 97 | Ga0070679_100163648 | 3300005530 | Bacteria | 2198 |
| 98 | Ga0070679_100286358 | 3300005530 | Bacteria | 1599 |
| 99 | Ga0070679_100380820 | 3300005530 | Bacteria | 1358 |
| 100 | Ga0070684_100011742 | 3300005535 | Bacteria | 6986 |
| 101 | Ga0070684_100106364 | 3300005535 | Bacteria | 2511 |
| 102 | Ga0070684_100316754 | 3300005535 | Bacteria | 1433 |
| 103 | Ga0070684_100368380 | 3300005535 | Bacteria | 1323 |
| 104 | Ga0070672_100022209 | 3300005543 | Bacteria | 4655 |
| 105 | Ga0070672_100067021 | 3300005543 | Bacteria | 2844 |
| 106 | Ga0070672_100222329 | 3300005543 | Bacteria | 1584 |
| 107 | Ga0070686_100003788 | 3300005544 | Bacteria | 8320 |
| 108 | Ga0070686_100010694 | 3300005544 | Bacteria | 5187 |
| 109 | Ga0070686_100127113 | 3300005544 | Bacteria | 1758 |
| 110 | Ga0070686_100243771 | 3300005544 | Bacteria | 1310 |
| 111 | Ga0070695_100008132 | 3300005545 | Bacteria | 6216 |
| 112 | Ga0070696_100032230 | 3300005546 | Bacteria | 3595 |
| 113 | Ga0070696_100136607 | 3300005546 | Bacteria | 1788 |
| 114 | Ga0070696_100341798 | 3300005546 | Bacteria | 1157 |
| 115 | Ga0070665_100017089 | 3300005548 | Bacteria | 7277 |
| 116 | Ga0070665_100122039 | 3300005548 | Bacteria | 2607 |
| 117 | Ga0068855_100016898 | 3300005563 | Bacteria | 8775 |
| 118 | Ga0068855_100026525 | 3300005563 | Bacteria | 6931 |
| 119 | Ga0068855_100064288 | 3300005563 | Bacteria | 4279 |
| 120 | Ga0068855_100083857 | 3300005563 | Bacteria | 3692 |
| 121 | Ga0068855_100168778 | 3300005563 | Bacteria | 2479 |
| 122 | Ga0068855_100207692 | 3300005563 | Bacteria | 2202 |
| 123 | Ga0068855_100383358 | 3300005563 | Bacteria | 1543 |
| 124 | Ga0068857_100022389 | 3300005577 | Bacteria | 5559 |
| 125 | Ga0068854_100016749 | 3300005578 | Bacteria | 4891 |
| 126 | Ga0068856_100217965 | 3300005614 | Bacteria | 1923 |
| 127 | Ga0068856_100302352 | 3300005614 | Bacteria | 1617 |
| 128 | Ga0070702_100007834 | 3300005615 | Bacteria | 5136 |
| 129 | Ga0070702_100043046 | 3300005615 | Bacteria | 2542 |
| 130 | Ga0070702_100150196 | 3300005615 | Bacteria | 1494 |
| 131 | Ga0068852_100054346 | 3300005616 | Bacteria | 3451 |
| 132 | Ga0068852_100263876 | 3300005616 | Bacteria | 1654 |
| 133 | Ga0068852_100298368 | 3300005616 | Bacteria | 1559 |
| 134 | Ga0068859_100380480 | 3300005617 | Bacteria | 1507 |
| 135 | Ga0068866_10001477 | 3300005718 | Bacteria | 10015 |
| 136 | Ga0068866_10217522 | 3300005718 | Bacteria | 1151 |
| 137 | Ga0068861_100066250 | 3300005719 | Bacteria | 2784 |
| 138 | Ga0068861_100084175 | 3300005719 | Bacteria | 2497 |
| 139 | Ga0068861_100087041 | 3300005719 | Bacteria | 2457 |
| 140 | Ga0068861_100140308 | 3300005719 | Bacteria | 1972 |
| 141 | Ga0068870_10007137 | 3300005840 | Bacteria | 4969 |
| 142 | Ga0068870_10074055 | 3300005840 | Bacteria | 1865 |
| 143 | Ga0068858_100048669 | 3300005842 | Bacteria | 3926 |
| 144 | Ga0068858_100269930 | 3300005842 | Bacteria | 1619 |
| 145 | Ga0068860_100051952 | 3300005843 | Bacteria | 3899 |
| 146 | Ga0068860_100131640 | 3300005843 | Bacteria | 2401 |
| 147 | Ga0068862_100073795 | 3300005844 | Bacteria | 2949 |
| 148 | Ga0081455_10031698 | 3300005937 | Bacteria | 4776 |
| 149 | Ga0081455_10059896 | 3300005937 | Bacteria | 3212 |
| 150 | Ga0081455_10117197 | 3300005937 | Bacteria | 2105 |
| 151 | Ga0081455_10122145 | 3300005937 | Bacteria | 2051 |
| 152 | Ga0081455_10206413 | 3300005937 | Bacteria | 1467 |
| 153 | Ga0081455_10279167 | 3300005937 | Bacteria | 1207 |
| 154 | Ga0081540_1004573 | 3300005983 | Bacteria | 10479 |
| 155 | Ga0081540_1009927 | 3300005983 | Bacteria | 6492 |
| 156 | Ga0081540_1013732 | 3300005983 | Bacteria | 5249 |
| 157 | Ga0081540_1083758 | 3300005983 | Bacteria | 1425 |
| 158 | Ga0081539_10000171 | 3300005985 | Bacteria | 152572 |
| 159 | Ga0081539_10000599 | 3300005985 | Bacteria | 73432 |
| 160 | Ga0081539_10001044 | 3300005985 | Bacteria | 50691 |
| 161 | Ga0081539_10002263 | 3300005985 | Bacteria | 27975 |
| 162 | Ga0081539_10007528 | 3300005985 | Bacteria | 9869 |
| 163 | Ga0070717_10013308 | 3300006028 | Bacteria | 6300 |
| 164 | Ga0070717_10023875 | 3300006028 | Bacteria | 4851 |
| 165 | Ga0070717_10224313 | 3300006028 | Bacteria | 1653 |
| 166 | Ga0075365_10064645 | 3300006038 | Bacteria | 2451 |
| 167 | Ga0075432_10016943 | 3300006058 | Bacteria | 2487 |
| 168 | Ga0075432_10044126 | 3300006058 | Bacteria | 1563 |
| 169 | Ga0070715_10003385 | 3300006163 | Bacteria | 5057 |
| 170 | Ga0070716_100100965 | 3300006173 | Bacteria | 1768 |
| 171 | Ga0070712_100024354 | 3300006175 | Bacteria | 4010 |
| 172 | Ga0070712_100036082 | 3300006175 | Bacteria | 3361 |
| 173 | Ga0070712_100298236 | 3300006175 | Bacteria | 1304 |
| 174 | Ga0097621_100013143 | 3300006237 | Bacteria | 6158 |
| 175 | Ga0097621_100507560 | 3300006237 | Bacteria | 1093 |
| 176 | Ga0068871_100043994 | 3300006358 | Bacteria | 3589 |
| 177 | Ga0075428_100045891 | 3300006844 | Bacteria | 4800 |
| 178 | Ga0075428_100227056 | 3300006844 | Bacteria | 2015 |
| 179 | Ga0075431_100010688 | 3300006847 | Bacteria | 9223 |
| 180 | Ga0075431_100132697 | 3300006847 | Bacteria | 2568 |
| 181 | Ga0075433_10066369 | 3300006852 | Bacteria | 3166 |
| 182 | Ga0075434_100019457 | 3300006871 | Bacteria | 6572 |
| 183 | Ga0075434_100220040 | 3300006871 | Bacteria | 1918 |
| 184 | Ga0075429_100268360 | 3300006880 | Bacteria | 1494 |
| 185 | Ga0068865_100135514 | 3300006881 | Bacteria | 1850 |
| 186 | Ga0068865_100210968 | 3300006881 | Bacteria | 1513 |
| 187 | Ga0097620_100380460 | 3300006931 | Bacteria | 1507 |
| 188 | Ga0075435_100076760 | 3300007076 | Bacteria | 2738 |
| 189 | Ga0111539_10004337 | 3300009094 | Bacteria | 18563 |
| 190 | Ga0111539_10006713 | 3300009094 | Bacteria | 14817 |
| 191 | Ga0111539_10011536 | 3300009094 | Bacteria | 11088 |
| 192 | Ga0111539_10024559 | 3300009094 | Bacteria | 7393 |
| 193 | Ga0111539_10072897 | 3300009094 | Bacteria | 4049 |
| 194 | Ga0111539_10407900 | 3300009094 | Bacteria | 1583 |
| 195 | Ga0105245_10004691 | 3300009098 | Bacteria | 12082 |
| 196 | Ga0105245_10015878 | 3300009098 | Bacteria | 6561 |
| 197 | Ga0105245_10096890 | 3300009098 | Bacteria | 2723 |
| 198 | Ga0105245_10206787 | 3300009098 | Bacteria | 1887 |
| 199 | Ga0105245_10220077 | 3300009098 | Bacteria | 1831 |
| 200 | Ga0105247_10289026 | 3300009101 | Bacteria | 1133 |
| 201 | Ga0114129_10007588 | 3300009147 | Bacteria | 15442 |
| 202 | Ga0114129_10110556 | 3300009147 | Bacteria | 3793 |
| 203 | Ga0105243_10002631 | 3300009148 | Bacteria | 14925 |
| 204 | Ga0105243_10083632 | 3300009148 | Bacteria | 2611 |
| 205 | Ga0105243_10189962 | 3300009148 | Bacteria | 1793 |
| 206 | Ga0105243_10330077 | 3300009148 | Bacteria | 1393 |
| 207 | Ga0105241_10120178 | 3300009174 | Bacteria | 2114 |
| 208 | Ga0105241_10153700 | 3300009174 | Bacteria | 1885 |
| 209 | Ga0105242_10496654 | 3300009176 | Bacteria | 1160 |
| 210 | Ga0105242_10641589 | 3300009176 | Bacteria | 1031 |
| 211 | Ga0105248_10131898 | 3300009177 | Bacteria | 2819 |
| 212 | Ga0105248_10146102 | 3300009177 | Bacteria | 2668 |
| 213 | Ga0105248_10171402 | 3300009177 | Bacteria | 2446 |
| 214 | Ga0105248_10603275 | 3300009177 | Bacteria | 1239 |
| 215 | Ga0105248_10790083 | 3300009177 | Bacteria | 1071 |
| 216 | Ga0105237_10026571 | 3300009545 | Bacteria | 5916 |
| 217 | Ga0105237_10175500 | 3300009545 | Bacteria | 2143 |
| 218 | Ga0105237_10177379 | 3300009545 | Bacteria | 2131 |
| 219 | Ga0105237_10252625 | 3300009545 | Bacteria | 1765 |
| 220 | Ga0105238_10360531 | 3300009551 | Bacteria | 1443 |
| 221 | Ga0105238_10657223 | 3300009551 | Bacteria | 1059 |
| 222 | Ga0105249_10034628 | 3300009553 | Bacteria | 4577 |
| 223 | Ga0105249_10063431 | 3300009553 | Bacteria | 3395 |
| 224 | Ga0105249_10092313 | 3300009553 | Bacteria | 2834 |
| 225 | Ga0105249_10121569 | 3300009553 | Bacteria | 2482 |
| 226 | Ga0105249_10257113 | 3300009553 | Bacteria | 1734 |
| 227 | Ga0105239_10010075 | 3300010375 | Bacteria | 10594 |
| 228 | Ga0105239_10020559 | 3300010375 | Bacteria | 7282 |
| 229 | Ga0105239_10279707 | 3300010375 | Bacteria | 1878 |
| 230 | Ga0105239_10368264 | 3300010375 | Bacteria | 1624 |
| 231 | Ga0105239_10476976 | 3300010375 | Bacteria | 1417 |
| 232 | Ga0105246_10002634 | 3300011119 | Bacteria | 10866 |
| 233 | Ga0105246_10011385 | 3300011119 | Bacteria | 5522 |
| 234 | Ga0105246_10253463 | 3300011119 | Bacteria | 1398 |
| 235 | Ga0105246_10448057 | 3300011119 | Bacteria | 1084 |
| 236 | Ga0157373_10011332 | 3300013100 | Bacteria | 6556 |
| 237 | Ga0157370_10017041 | 3300013104 | Bacteria | 7342 |
| 238 | Ga0157369_10012087 | 3300013105 | Bacteria | 9802 |
| 239 | Ga0157369_10014522 | 3300013105 | Bacteria | 8886 |
| 240 | Ga0157369_10016084 | 3300013105 | Bacteria | 8418 |
| 241 | Ga0157369_10116687 | 3300013105 | Bacteria | 2834 |
| 242 | Ga0157369_10182901 | 3300013105 | Bacteria | 2205 |
| 243 | Ga0157374_10013221 | 3300013296 | Bacteria | 7200 |
| 244 | Ga0157374_10042769 | 3300013296 | Bacteria | 4181 |
| 245 | Ga0157378_10022794 | 3300013297 | Bacteria | 5512 |
| 246 | Ga0157378_10394093 | 3300013297 | Bacteria | 1363 |
| 247 | Ga0157378_10406167 | 3300013297 | Bacteria | 1343 |
| 248 | Ga0157378_10585056 | 3300013297 | Bacteria | 1126 |
| 249 | Ga0163162_10000727 | 3300013306 | Bacteria | 30540 |
| 250 | Ga0163162_10059208 | 3300013306 | Bacteria | 3862 |
| 251 | Ga0163162_10196269 | 3300013306 | Bacteria | 2147 |
| 252 | Ga0157372_10071822 | 3300013307 | Bacteria | 3899 |
| 253 | Ga0157372_10107265 | 3300013307 | Bacteria | 3196 |
| 254 | Ga0157372_10452250 | 3300013307 | Bacteria | 1497 |
| 255 | Ga0157372_10582716 | 3300013307 | Bacteria | 1304 |
| 256 | Ga0157372_10754279 | 3300013307 | Bacteria | 1131 |
| 257 | Ga0157375_10004690 | 3300013308 | Bacteria | 11892 |
| 258 | Ga0157375_10020575 | 3300013308 | Bacteria | 6031 |
| 259 | Ga0157375_10050206 | 3300013308 | Bacteria | 4091 |
| 260 | Ga0157375_10234816 | 3300013308 | Bacteria | 1993 |
| 261 | Ga0157375_10564637 | 3300013308 | Bacteria | 1299 |
| 262 | Ga0163163_10064167 | 3300014325 | Bacteria | 3644 |
| 263 | Ga0163163_10115837 | 3300014325 | Bacteria | 2711 |
| 264 | Ga0163163_10740487 | 3300014325 | Bacteria | 1046 |
| 265 | Ga0157380_10023482 | 3300014326 | Bacteria | 4651 |
| 266 | Ga0157380_10083186 | 3300014326 | Bacteria | 2621 |
| 267 | Ga0157380_10352711 | 3300014326 | Bacteria | 1377 |
| 268 | Ga0157380_10456147 | 3300014326 | Bacteria | 1229 |
| 269 | Ga0182008_10008697 | 3300014497 | Bacteria | 5522 |
| 270 | Ga0157377_10000397 | 3300014745 | Bacteria | 18835 |
| 271 | Ga0157377_10057739 | 3300014745 | Bacteria | 2208 |
| 272 | Ga0157379_10073145 | 3300014968 | Bacteria | 3068 |
| 273 | Ga0157379_10670188 | 3300014968 | Bacteria | 972 |
| 274 | Ga0157376_10473361 | 3300014969 | Bacteria | 1226 |
| 275 | Ga0182006_1014567 | 3300015261 | Bacteria | 3386 |
| 276 | Ga0163161_10178856 | 3300017792 | Bacteria | 1625 |
| 277 | Ga0197907_10808555 | 3300020069 | Bacteria | 1012 |
| 278 | Ga0206356_10063198 | 3300020070 | Bacteria | 1869 |
| 279 | Ga0206354_10930277 | 3300020081 | Bacteria | 1110 |
| 280 | Ga0206354_11001608 | 3300020081 | Bacteria | 1036 |
| 281 | Ga0206353_11446920 | 3300020082 | Bacteria | 4207 |
| 282 | Ga0207653_10021129 | 3300025885 | Bacteria | 2064 |
| 283 | Ga0207692_10157062 | 3300025898 | Bacteria | 1308 |
| 284 | Ga0207692_10174634 | 3300025898 | Bacteria | 1248 |
| 285 | Ga0207642_10002810 | 3300025899 | Bacteria | 5431 |
| 286 | Ga0207642_10153862 | 3300025899 | Bacteria | 1227 |
| 287 | Ga0207688_10023433 | 3300025901 | Bacteria | 3380 |
| 288 | Ga0207688_10034346 | 3300025901 | Bacteria | 2808 |
| 289 | Ga0207688_10268335 | 3300025901 | Bacteria | 1037 |
| 290 | Ga0207685_10108594 | 3300025905 | Bacteria | 1199 |
| 291 | Ga0207699_10063328 | 3300025906 | Bacteria | 2233 |
| 292 | Ga0207699_10073048 | 3300025906 | Bacteria | 2103 |
| 293 | Ga0207699_10250010 | 3300025906 | Bacteria | 1221 |
| 294 | Ga0207643_10003011 | 3300025908 | Bacteria | 9085 |
| 295 | Ga0207643_10011792 | 3300025908 | Bacteria | 4717 |
| 296 | Ga0207705_10010634 | 3300025909 | Bacteria | 6684 |
| 297 | Ga0207705_10020310 | 3300025909 | Bacteria | 4749 |
| 298 | Ga0207705_10138742 | 3300025909 | Bacteria | 1814 |
| 299 | Ga0207684_10023508 | 3300025910 | Bacteria | 5263 |
| 300 | Ga0207684_10224485 | 3300025910 | Bacteria | 1621 |
| 301 | Ga0207684_10397640 | 3300025910 | Bacteria | 1185 |
| 302 | Ga0207707_10008550 | 3300025912 | Bacteria | 8875 |
| 303 | Ga0207707_10008778 | 3300025912 | Bacteria | 8771 |
| 304 | Ga0207707_10040674 | 3300025912 | Bacteria | 4060 |
| 305 | Ga0207707_10087625 | 3300025912 | Bacteria | 2720 |
| 306 | Ga0207695_10186005 | 3300025913 | Bacteria | 1996 |
| 307 | Ga0207695_10236293 | 3300025913 | Bacteria | 1730 |
| 308 | Ga0207695_10353740 | 3300025913 | Bacteria | 1356 |
| 309 | Ga0207671_10141963 | 3300025914 | Bacteria | 1851 |
| 310 | Ga0207693_10000347 | 3300025915 | Bacteria | 42728 |
| 311 | Ga0207693_10087510 | 3300025915 | Bacteria | 2441 |
| 312 | Ga0207660_10003765 | 3300025917 | Bacteria | 9879 |
| 313 | Ga0207660_10044988 | 3300025917 | Bacteria | 3108 |
| 314 | Ga0207660_10155231 | 3300025917 | Bacteria | 1761 |
| 315 | Ga0207660_10292052 | 3300025917 | Bacteria | 1296 |
| 316 | Ga0207657_10000319 | 3300025919 | Bacteria | 51044 |
| 317 | Ga0207657_10000416 | 3300025919 | Bacteria | 45222 |
| 318 | Ga0207657_10001085 | 3300025919 | Bacteria | 28819 |
| 319 | Ga0207657_10011244 | 3300025919 | Bacteria | 8893 |
| 320 | Ga0207657_10019514 | 3300025919 | Bacteria | 6435 |
| 321 | Ga0207657_10021028 | 3300025919 | Bacteria | 6152 |
| 322 | Ga0207657_10087191 | 3300025919 | Bacteria | 2611 |
| 323 | Ga0207649_10059815 | 3300025920 | Bacteria | 2392 |
| 324 | Ga0207652_10016020 | 3300025921 | Bacteria | 6112 |
| 325 | Ga0207652_10052239 | 3300025921 | Bacteria | 3507 |
| 326 | Ga0207652_10066938 | 3300025921 | Bacteria | 3114 |
| 327 | Ga0207652_10086342 | 3300025921 | Bacteria | 2751 |
| 328 | Ga0207652_10137774 | 3300025921 | Bacteria | 2180 |
| 329 | Ga0207652_10198568 | 3300025921 | Bacteria | 1805 |
| 330 | Ga0207652_10372048 | 3300025921 | Bacteria | 1290 |
| 331 | Ga0207652_10390792 | 3300025921 | Bacteria | 1255 |
| 332 | Ga0207646_10014823 | 3300025922 | Bacteria | 7385 |
| 333 | Ga0207646_10590868 | 3300025922 | Bacteria | 997 |
| 334 | Ga0207681_10523125 | 3300025923 | Bacteria | 974 |
| 335 | Ga0207687_10023008 | 3300025927 | Bacteria | 4150 |
| 336 | Ga0207687_10064274 | 3300025927 | Bacteria | 2601 |
| 337 | Ga0207687_10071146 | 3300025927 | Bacteria | 2485 |
| 338 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 339 | Ga0207700_10109810 | 3300025928 | Bacteria | 2217 |
| 340 | Ga0207664_10004622 | 3300025929 | Bacteria | 9335 |
| 341 | Ga0207664_10046674 | 3300025929 | Bacteria | 3401 |
| 342 | Ga0207664_10152679 | 3300025929 | Bacteria | 1963 |
| 343 | Ga0207664_10267244 | 3300025929 | Bacteria | 1497 |
| 344 | Ga0207664_10429836 | 3300025929 | Bacteria | 1177 |
| 345 | Ga0207644_10315986 | 3300025931 | Bacteria | 1262 |
| 346 | Ga0207690_10111663 | 3300025932 | Bacteria | 1970 |
| 347 | Ga0207690_10266865 | 3300025932 | Bacteria | 1328 |
| 348 | Ga0207706_10022500 | 3300025933 | Bacteria | 5656 |
| 349 | Ga0207706_10213428 | 3300025933 | Bacteria | 1691 |
| 350 | Ga0207686_10005993 | 3300025934 | Bacteria | 6524 |
| 351 | Ga0207686_10394806 | 3300025934 | Bacteria | 1052 |
| 352 | Ga0207709_10001627 | 3300025935 | Bacteria | 15281 |
| 353 | Ga0207709_10052675 | 3300025935 | Bacteria | 2501 |
| 354 | Ga0207709_10060392 | 3300025935 | Bacteria | 2363 |
| 355 | Ga0207669_10002197 | 3300025937 | Bacteria | 8290 |
| 356 | Ga0207669_10050770 | 3300025937 | Bacteria | 2482 |
| 357 | Ga0207669_10185451 | 3300025937 | Bacteria | 1496 |
| 358 | Ga0207669_10291037 | 3300025937 | Bacteria | 1237 |
| 359 | Ga0207704_10096970 | 3300025938 | Bacteria | 1954 |
| 360 | Ga0207704_10194509 | 3300025938 | Bacteria | 1478 |
| 361 | Ga0207704_10253029 | 3300025938 | Bacteria | 1323 |
| 362 | Ga0207665_10099394 | 3300025939 | Bacteria | 2029 |
| 363 | Ga0207691_10022775 | 3300025940 | Bacteria | 5906 |
| 364 | Ga0207689_10038149 | 3300025942 | Bacteria | 3981 |
| 365 | Ga0207661_10025532 | 3300025944 | Bacteria | 4492 |
| 366 | Ga0207661_10027782 | 3300025944 | Bacteria | 4326 |
| 367 | Ga0207661_10115531 | 3300025944 | Bacteria | 2277 |
| 368 | Ga0207661_10207847 | 3300025944 | Bacteria | 1724 |
| 369 | Ga0207661_10246698 | 3300025944 | Bacteria | 1586 |
| 370 | Ga0207679_10114516 | 3300025945 | Bacteria | 2135 |
| 371 | Ga0207679_10334653 | 3300025945 | Bacteria | 1315 |
| 372 | Ga0207667_10054323 | 3300025949 | Bacteria | 4213 |
| 373 | Ga0207667_10125085 | 3300025949 | Bacteria | 2648 |
| 374 | Ga0207667_10221788 | 3300025949 | Bacteria | 1937 |
| 375 | Ga0207667_10298543 | 3300025949 | Bacteria | 1646 |
| 376 | Ga0207667_10390631 | 3300025949 | Bacteria | 1417 |
| 377 | Ga0207651_10044454 | 3300025960 | Bacteria | 2973 |
| 378 | Ga0207712_10007054 | 3300025961 | Bacteria | 7088 |
| 379 | Ga0207712_10034038 | 3300025961 | Bacteria | 3449 |
| 380 | Ga0207668_10028482 | 3300025972 | Bacteria | 3653 |
| 381 | Ga0207668_10054453 | 3300025972 | Bacteria | 2777 |
| 382 | Ga0207668_10129837 | 3300025972 | Bacteria | 1923 |
| 383 | Ga0207640_10338395 | 3300025981 | Bacteria | 1204 |
| 384 | Ga0207640_10462078 | 3300025981 | Bacteria | 1049 |
| 385 | Ga0207658_10345856 | 3300025986 | Bacteria | 1294 |
| 386 | Ga0207677_10261861 | 3300026023 | Bacteria | 1410 |
| 387 | Ga0207639_10220745 | 3300026041 | Bacteria | 1637 |
| 388 | Ga0207678_10036097 | 3300026067 | Bacteria | 4302 |
| 389 | Ga0207678_10108182 | 3300026067 | Bacteria | 2372 |
| 390 | Ga0207678_10108285 | 3300026067 | Bacteria | 2371 |
| 391 | Ga0207678_10248558 | 3300026067 | Bacteria | 1523 |
| 392 | Ga0207678_10257717 | 3300026067 | Bacteria | 1494 |
| 393 | Ga0207678_10433683 | 3300026067 | Bacteria | 1141 |
| 394 | Ga0207708_10001000 | 3300026075 | Bacteria | 21172 |
| 395 | Ga0207708_10014047 | 3300026075 | Bacteria | 5983 |
| 396 | Ga0207708_10092177 | 3300026075 | Bacteria | 2337 |
| 397 | Ga0207702_10061850 | 3300026078 | Bacteria | 3195 |
| 398 | Ga0207702_10113624 | 3300026078 | Bacteria | 2412 |
| 399 | Ga0207702_10265782 | 3300026078 | Bacteria | 1617 |
| 400 | Ga0207641_10405002 | 3300026088 | Bacteria | 1311 |
| 401 | Ga0207648_10000191 | 3300026089 | Bacteria | 64436 |
| 402 | Ga0207648_10018603 | 3300026089 | Bacteria | 6287 |
| 403 | Ga0207648_10205050 | 3300026089 | Bacteria | 1750 |
| 404 | Ga0207648_10236209 | 3300026089 | Bacteria | 1627 |
| 405 | Ga0207674_10010377 | 3300026116 | Bacteria | 10555 |
| 406 | Ga0207674_10031297 | 3300026116 | Bacteria | 5590 |
| 407 | Ga0207674_10154580 | 3300026116 | Bacteria | 2249 |
| 408 | Ga0207674_10252546 | 3300026116 | Bacteria | 1710 |
| 409 | Ga0207674_10294180 | 3300026116 | Bacteria | 1572 |
| 410 | Ga0207675_100002866 | 3300026118 | Bacteria | 16968 |
| 411 | Ga0207675_100007801 | 3300026118 | Bacteria | 10098 |
| 412 | Ga0207675_100077713 | 3300026118 | Bacteria | 3110 |
| 413 | Ga0207683_10005339 | 3300026121 | Bacteria | 11024 |
| 414 | Ga0207683_10009882 | 3300026121 | Bacteria | 8136 |
| 415 | Ga0207683_10108659 | 3300026121 | Bacteria | 2482 |
| 416 | Ga0207698_10037000 | 3300026142 | Bacteria | 3590 |
| 417 | Ga0209998_10023854 | 3300027717 | Bacteria | 1325 |
| 418 | Ga0207428_10001543 | 3300027907 | Bacteria | 24104 |
| 419 | Ga0207428_10025320 | 3300027907 | Bacteria | 4966 |
| 420 | Ga0207428_10056799 | 3300027907 | Bacteria | 3109 |
| 421 | Ga0207428_10196088 | 3300027907 | Bacteria | 1521 |
| 422 | Ga0268266_10135972 | 3300028379 | Bacteria | 2202 |
| 423 | Ga0268266_10141656 | 3300028379 | Bacteria | 2158 |
| 424 | Ga0268265_10074221 | 3300028380 | Bacteria | 2660 |
| 425 | Ga0268264_10096869 | 3300028381 | Bacteria | 2556 |
| 426 | Ga0265337_1009232 | 3300028556 | Bacteria | 3534 |
| 427 | Ga0265338_10004154 | 3300028800 | Bacteria | 19785 |
| 428 | Ga0265338_10038872 | 3300028800 | Bacteria | 4499 |
| 429 | Ga0265338_10172758 | 3300028800 | Bacteria | 1655 |
| 430 | Ga0265320_10017109 | 3300031240 | Bacteria | 4038 |
| 431 | Ga0265339_10011110 | 3300031249 | Bacteria | 5559 |
| 432 | Ga0265331_10045085 | 3300031250 | Bacteria | 2129 |
| 433 | Ga0265327_10018798 | 3300031251 | Bacteria | 4270 |
| 434 | Ga0265316_10095404 | 3300031344 | Bacteria | 2265 |
| 435 | Ga0307408_100181473 | 3300031548 | Bacteria | 1688 |
| 436 | Ga0265313_10050377 | 3300031595 | Bacteria | 1998 |
| 437 | Ga0265313_10063519 | 3300031595 | Bacteria | 1721 |
| 438 | Ga0265314_10091205 | 3300031711 | Bacteria | 1983 |
| 439 | Ga0265342_10019172 | 3300031712 | Bacteria | 4413 |
| 440 | Ga0307405_10048894 | 3300031731 | Bacteria | 2611 |
| 441 | Ga0307405_10278822 | 3300031731 | Bacteria | 1257 |
| 442 | Ga0307410_10043423 | 3300031852 | Bacteria | 2979 |
| 443 | Ga0307410_10141104 | 3300031852 | Bacteria | 1783 |
| 444 | Ga0307406_10004278 | 3300031901 | Bacteria | 7769 |
| 445 | Ga0307406_10047851 | 3300031901 | Bacteria | 2697 |
| 446 | Ga0307406_10177701 | 3300031901 | Bacteria | 1547 |
| 447 | Ga0307407_10069508 | 3300031903 | Bacteria | 2090 |
| 448 | Ga0307407_10328968 | 3300031903 | Bacteria | 1075 |
| 449 | Ga0307409_100023790 | 3300031995 | Bacteria | 4255 |
| 450 | Ga0307409_100024413 | 3300031995 | Bacteria | 4216 |
| 451 | Ga0307409_100077172 | 3300031995 | Bacteria | 2675 |
| 452 | Ga0307409_100407852 | 3300031995 | Bacteria | 1300 |
| 453 | Ga0307416_100024830 | 3300032002 | Bacteria | 4382 |
| 454 | Ga0307416_100048872 | 3300032002 | Bacteria | 3359 |
| 455 | Ga0307416_100052647 | 3300032002 | Bacteria | 3261 |
| 456 | Ga0307411_10027835 | 3300032005 | Bacteria | 3427 |
| 457 | Ga0307415_100002779 | 3300032126 | Bacteria | 8762 |
| 458 | Ga0307415_100008265 | 3300032126 | Bacteria | 5759 |
| 459 | Ga0307415_100011040 | 3300032126 | Bacteria | 5147 |
| 460 | Ga0373936_0065054 | 3300035113 | Bacteria | 1495 |
| 461 | Ga0373941_0021420 | 3300035115 | Bacteria | 1824 |
| 462 | Ga0373945_0016417 | 3300035116 | Bacteria | 2497 |
| 463 | Ga0373945_0055529 | 3300035116 | Bacteria | 1467 |
| 464 | Ga0373960_0014406 | 3300035121 | Bacteria | 2003 |
| 465 | Ga0373943_0015187 | 3300035170 | Bacteria | 3495 |
| 466 | Ga0373946_0032563 | 3300035171 | Bacteria | 2094 |
| 467 | Ga0373955_0043435 | 3300035172 | Bacteria | 2418 |
| 468 | Ga0373931_0030581 | 3300035691 | Bacteria | 2773 |
| 469 | Ga0373947_0004583 | 3300035725 | Bacteria | 8111 |
| 470 | Ga0373947_0156257 | 3300035725 | Bacteria | 1472 |
| 471 | Ga0373937_0010608 | 3300036401 | Bacteria | 8050 |
| 472 | Ga0373925_0008549 | 3300037068 | Bacteria | 7460 |
| 473 | Ga0395899_0001266 | 3300037312 | Bacteria | 21971 |
| 474 | Ga0395899_0003558 | 3300037312 | Bacteria | 12338 |
| 475 | Ga0395899_0004161 | 3300037312 | Bacteria | 11365 |
| 476 | Ga0395899_0004681 | 3300037312 | Bacteria | 10678 |
| 477 | Ga0395899_0007083 | 3300037312 | Bacteria | 8679 |
| 478 | Ga0395899_0011255 | 3300037312 | Bacteria | 6854 |
| 479 | Ga0395899_0016475 | 3300037312 | Bacteria | 5636 |
| 480 | Ga0395899_0021751 | 3300037312 | Bacteria | 4865 |
| 481 | Ga0395899_0066605 | 3300037312 | Bacteria | 2644 |
| 482 | Ga0395899_0080894 | 3300037312 | Bacteria | 2364 |
| 483 | Ga0395899_0096631 | 3300037312 | Bacteria | 2136 |
| 484 | Ga0395899_0111703 | 3300037312 | Bacteria | 1964 |
| 485 | Ga0395899_0125560 | 3300037312 | Bacteria | 1835 |
| 486 | Ga0395900_0001348 | 3300037418 | Bacteria | 29694 |
| 487 | Ga0395900_0002880 | 3300037418 | Bacteria | 18747 |
| 488 | Ga0395900_0005507 | 3300037418 | Bacteria | 13251 |
| 489 | Ga0395900_0007933 | 3300037418 | Bacteria | 10927 |
| 490 | Ga0395900_0008749 | 3300037418 | Bacteria | 10399 |
| 491 | Ga0395900_0009564 | 3300037418 | Bacteria | 9939 |
| 492 | Ga0395900_0009887 | 3300037418 | Bacteria | 9769 |
| 493 | Ga0395900_0037178 | 3300037418 | Bacteria | 5021 |
| 494 | Ga0395900_0055428 | 3300037418 | Bacteria | 4082 |
| 495 | Ga0395900_0097511 | 3300037418 | Bacteria | 3020 |
| 496 | Ga0395900_0115405 | 3300037418 | Bacteria | 2755 |
| 497 | Ga0395900_0117300 | 3300037418 | Bacteria | 2731 |
| 498 | Ga0395900_0142794 | 3300037418 | Bacteria | 2450 |
| 499 | Ga0395900_0193733 | 3300037418 | Bacteria | 2060 |
| 500 | Ga0395900_0220007 | 3300037418 | Bacteria | 1914 |
| 501 | Ga0395900_0276919 | 3300037418 | Bacteria | 1671 |
| 502 | Ga0395900_0338834 | 3300037418 | Bacteria | 1480 |
| 503 | Ga0395900_0526291 | 3300037418 | Bacteria | 1129 |
| 504 | Ga0395900_0604304 | 3300037418 | Bacteria | 1037 |
| 505 | Ga0395898_0002653 | 3300037466 | Bacteria | 20795 |
| 506 | Ga0395898_0004125 | 3300037466 | Bacteria | 15933 |
| 507 | Ga0395898_0005273 | 3300037466 | Bacteria | 13973 |
| 508 | Ga0395898_0007310 | 3300037466 | Bacteria | 11724 |
| 509 | Ga0395898_0024274 | 3300037466 | Bacteria | 6115 |
| 510 | Ga0395898_0025891 | 3300037466 | Bacteria | 5906 |
| 511 | Ga0395898_0027148 | 3300037466 | Bacteria | 5750 |
| 512 | Ga0395898_0030119 | 3300037466 | Bacteria | 5432 |
| 513 | Ga0395898_0057405 | 3300037466 | Bacteria | 3793 |
| 514 | Ga0395898_0064574 | 3300037466 | Bacteria | 3550 |
| 515 | Ga0395898_0066706 | 3300037466 | Bacteria | 3485 |
| 516 | Ga0395898_0093743 | 3300037466 | Bacteria | 2885 |
| 517 | Ga0395898_0097865 | 3300037466 | Bacteria | 2817 |
| 518 | Ga0395898_0100736 | 3300037466 | Bacteria | 2774 |
| 519 | Ga0395898_0229843 | 3300037466 | Bacteria | 1769 |
| 520 | Ga0395898_0229911 | 3300037466 | Bacteria | 1769 |
| 521 | Ga0395898_0230948 | 3300037466 | Bacteria | 1764 |
| 522 | Ga0395898_0243197 | 3300037466 | Bacteria | 1716 |
| 523 | Ga0395898_0391429 | 3300037466 | Bacteria | 1325 |
| 524 | Ga0395898_0446584 | 3300037466 | Bacteria | 1232 |
| 525 | Ga0395905_0001663 | 3300037471 | Bacteria | 26274 |
| 526 | Ga0395905_0003200 | 3300037471 | Bacteria | 17633 |
| 527 | Ga0395905_0003387 | 3300037471 | Bacteria | 17074 |
| 528 | Ga0395905_0007458 | 3300037471 | Bacteria | 10877 |
| 529 | Ga0395905_0010757 | 3300037471 | Bacteria | 8871 |
| 530 | Ga0395905_0026203 | 3300037471 | Bacteria | 5498 |
| 531 | Ga0395905_0027536 | 3300037471 | Bacteria | 5360 |
| 532 | Ga0395905_0045804 | 3300037471 | Bacteria | 4103 |
| 533 | Ga0395905_0049383 | 3300037471 | Bacteria | 3942 |
| 534 | Ga0395905_0053766 | 3300037471 | Bacteria | 3768 |
| 535 | Ga0395905_0064123 | 3300037471 | Bacteria | 3437 |
| 536 | Ga0395905_0072686 | 3300037471 | Bacteria | 3224 |
| 537 | Ga0395905_0093956 | 3300037471 | Bacteria | 2813 |
| 538 | Ga0395905_0104855 | 3300037471 | Bacteria | 2654 |
| 539 | Ga0395905_0106646 | 3300037471 | Bacteria | 2630 |
| 540 | Ga0395905_0184394 | 3300037471 | Bacteria | 1959 |
| 541 | Ga0395905_0188297 | 3300037471 | Bacteria | 1937 |
| 542 | Ga0395905_0276685 | 3300037471 | Bacteria | 1564 |
| 543 | Ga0395905_0394312 | 3300037471 | Bacteria | 1279 |
| 544 | Ga0395905_0425004 | 3300037471 | Bacteria | 1225 |
| 545 | Ga0395901_0000586 | 3300038443 | Bacteria | 42347 |
| 546 | Ga0395901_0003540 | 3300038443 | Bacteria | 15740 |
| 547 | Ga0395901_0003604 | 3300038443 | Bacteria | 15622 |
| 548 | Ga0395901_0006305 | 3300038443 | Bacteria | 12015 |
| 549 | Ga0395901_0007207 | 3300038443 | Bacteria | 11214 |
| 550 | Ga0395901_0009439 | 3300038443 | Bacteria | 9898 |
| 551 | Ga0395901_0009719 | 3300038443 | Bacteria | 9753 |
| 552 | Ga0395901_0009868 | 3300038443 | Bacteria | 9675 |
| 553 | Ga0395901_0023204 | 3300038443 | Bacteria | 6360 |
| 554 | Ga0395901_0032949 | 3300038443 | Bacteria | 5345 |
| 555 | Ga0395901_0047176 | 3300038443 | Bacteria | 4473 |
| 556 | Ga0395901_0068533 | 3300038443 | Bacteria | 3696 |
| 557 | Ga0395901_0084404 | 3300038443 | Bacteria | 3319 |
| 558 | Ga0395901_0111912 | 3300038443 | Bacteria | 2867 |
| 559 | Ga0395901_0147819 | 3300038443 | Bacteria | 2469 |
| 560 | Ga0395901_0170941 | 3300038443 | Bacteria | 2280 |
| 561 | Ga0395901_0208442 | 3300038443 | Bacteria | 2046 |
| 562 | Ga0395901_0217540 | 3300038443 | Bacteria | 1997 |
| 563 | Ga0395901_0221824 | 3300038443 | Bacteria | 1976 |
| 564 | Ga0395901_0225647 | 3300038443 | Bacteria | 1957 |
| 565 | Ga0395901_0231833 | 3300038443 | Bacteria | 1927 |
| 566 | Ga0395901_0254347 | 3300038443 | Bacteria | 1829 |
| 567 | Ga0395901_0370669 | 3300038443 | Bacteria | 1475 |
| 568 | Ga0395901_0417923 | 3300038443 | Bacteria | 1375 |
| 569 | Ga0395901_0600554 | 3300038443 | Bacteria | 1110 |
| 570 | Ga0436365_0699127 | 3300039437 | Bacteria | 1044 |
| 571 | Ga0436365_0827282 | 3300039437 | Bacteria | 3905 |
| 572 | Ga0439438_036318 | 3300041405 | Bacteria | 1292 |
| 573 | Ga0451800_0905413 | 3300041459 | Bacteria | 2255 |
| 574 | Ga0451802_0273766 | 3300041460 | Bacteria | 1471 |
| 575 | Ga0451804_0328232 | 3300041463 | Bacteria | 2161 |
| 576 | Ga0451833_1219700 | 3300041491 | Bacteria | 1752 |
| 577 | Ga0451855_0246350 | 3300041511 | Bacteria | 2193 |
| 578 | Ga0439450_045267 | 3300042008 | Bacteria | 1033 |
| 579 | Ga0450902_017588 | 3300042137 | Bacteria | 1169 |
| 580 | Ga0439446_0016294 | 3300042156 | Bacteria | 2069 |
| 581 | Ga0439434_0006961 | 3300042435 | Bacteria | 3304 |
| 582 | Ga0466965_0055070 | 3300044683 | Bacteria | 1979 |
| 583 | Ga0466966_0072596 | 3300044684 | Bacteria | 2154 |
| 584 | Ga0466961_0009296 | 3300044693 | Bacteria | 6258 |
| 585 | Ga0466961_0024352 | 3300044693 | Bacteria | 3894 |
| 586 | Ga0466961_0107049 | 3300044693 | Bacteria | 1760 |
| 587 | Ga0466963_0014601 | 3300044694 | Bacteria | 4847 |
| 588 | Ga0466963_0019939 | 3300044694 | Bacteria | 4213 |
| 589 | Ga0466963_0030139 | 3300044694 | Bacteria | 3498 |
| 590 | Ga0466963_0168380 | 3300044694 | Bacteria | 1527 |
| 591 | Ga0466963_0203887 | 3300044694 | Bacteria | 1383 |
| 592 | Ga0466963_0448504 | 3300044694 | Bacteria | 910 |
| 593 | Ga0466964_0036685 | 3300044706 | Bacteria | 1967 |
| 594 | Ga0466964_0052804 | 3300044706 | Bacteria | 1671 |
| 595 | Ga0466964_0085332 | 3300044706 | Bacteria | 1363 |
| 596 | Ga0466971_0004028 | 3300044719 | Bacteria | 6322 |
| 597 | Ga0466970_0247306 | 3300044765 | Bacteria | 999 |
| 598 | Ga0466957_0085726 | 3300044842 | Bacteria | 1967 |
| 599 | Ga0466957_0099516 | 3300044842 | Bacteria | 1831 |
| 600 | Ga0466957_0283285 | 3300044842 | Bacteria | 1110 |
| 601 | Ga0466960_0070111 | 3300044901 | Bacteria | 1743 |
| 602 | Ga0466959_0081856 | 3300045049 | Bacteria | 2326 |
| 603 | Ga0466959_0201253 | 3300045049 | Bacteria | 1386 |
| 604 | Ga0466959_0203940 | 3300045049 | Bacteria | 1376 |
| 605 | Ga0451576_0113890 | 3300045051 | Bacteria | 2815 |
| 606 | Ga0451576_0247879 | 3300045051 | Bacteria | 1861 |
| 607 | Ga0466958_0011177 | 3300045836 | Bacteria | 5050 |
| 608 | Ga0466958_0091634 | 3300045836 | Bacteria | 1882 |
| 609 | Ga0466958_0094708 | 3300045836 | Bacteria | 1850 |
| 610 | Ga0466967_0002495 | 3300045976 | Bacteria | 11488 |
| 611 | Ga0466967_0006058 | 3300045976 | Bacteria | 8500 |
| 612 | Ga0466967_0006201 | 3300045976 | Bacteria | 8424 |
| 613 | Ga0466967_0011534 | 3300045976 | Bacteria | 6702 |
| 614 | Ga0466967_0017574 | 3300045976 | Bacteria | 5684 |
| 615 | Ga0466967_0029145 | 3300045976 | Bacteria | 4616 |
| 616 | Ga0466967_0029275 | 3300045976 | Bacteria | 4607 |
| 617 | Ga0466967_0031632 | 3300045976 | Bacteria | 4457 |
| 618 | Ga0466967_0046836 | 3300045976 | Bacteria | 3767 |
| 619 | Ga0466967_0050336 | 3300045976 | Bacteria | 3647 |
| 620 | Ga0466967_0051287 | 3300045976 | Bacteria | 3615 |
| 621 | Ga0466967_0061999 | 3300045976 | Bacteria | 3318 |
| 622 | Ga0466967_0062376 | 3300045976 | Bacteria | 3308 |
| 623 | Ga0466967_0078979 | 3300045976 | Bacteria | 2965 |
| 624 | Ga0466967_0111641 | 3300045976 | Bacteria | 2512 |
| 625 | Ga0466967_0127505 | 3300045976 | Bacteria | 2358 |
| 626 | Ga0466967_0137643 | 3300045976 | Bacteria | 2272 |
| 627 | Ga0466967_0221326 | 3300045976 | Bacteria | 1799 |
| 628 | Ga0466967_0227390 | 3300045976 | Bacteria | 1775 |
| 629 | Ga0495603_0013786 | 3300046455 | Bacteria | 4891 |
| 630 | Ga0495603_0077999 | 3300046455 | Bacteria | 1943 |
| 631 | Ga0495629_0155020 | 3300046459 | Bacteria | 1592 |
| 632 | Ga0495641_0013421 | 3300046461 | Bacteria | 4504 |
| 633 | Ga0495651_0080817 | 3300046462 | Bacteria | 2454 |
| 634 | Ga0495651_0124055 | 3300046462 | Bacteria | 1893 |
| 635 | Ga0495653_0022058 | 3300046463 | Bacteria | 5154 |
| 636 | Ga0495653_0026787 | 3300046463 | Bacteria | 4620 |
| 637 | Ga0495653_0107193 | 3300046463 | Bacteria | 2014 |
| 638 | Ga0495653_0154562 | 3300046463 | Bacteria | 1599 |
| 639 | Ga0495582_0046268 | 3300046473 | Bacteria | 2396 |
| 640 | Ga0495582_0088514 | 3300046473 | Bacteria | 1725 |
| 641 | Ga0495605_0080301 | 3300046474 | Bacteria | 1527 |
| 642 | Ga0495605_0093271 | 3300046474 | Bacteria | 1393 |
| 643 | Ga0495639_0040287 | 3300046475 | Bacteria | 2101 |
| 644 | Ga0495662_0043673 | 3300046476 | Bacteria | 2164 |
| 645 | Ga0495664_0083276 | 3300046477 | Bacteria | 1920 |
| 646 | Ga0495664_0109456 | 3300046477 | Bacteria | 1667 |
| 647 | Ga0495584_0018509 | 3300046491 | Bacteria | 3540 |
| 648 | Ga0495584_0038899 | 3300046491 | Bacteria | 2404 |
| 649 | Ga0495584_0087332 | 3300046491 | Bacteria | 1572 |
| 650 | Ga0495584_0093174 | 3300046491 | Bacteria | 1520 |
| 651 | Ga0495585_0120728 | 3300046492 | Bacteria | 1387 |
| 652 | Ga0495594_0013181 | 3300046499 | Bacteria | 4312 |
| 653 | Ga0495596_0044454 | 3300046500 | Bacteria | 1748 |
| 654 | Ga0495607_0055830 | 3300046501 | Bacteria | 2270 |
| 655 | Ga0495608_0017419 | 3300046511 | Bacteria | 4968 |
| 656 | Ga0495608_0108066 | 3300046511 | Bacteria | 1789 |
| 657 | Ga0495628_0091053 | 3300046516 | Bacteria | 2361 |
| 658 | Ga0495628_0223530 | 3300046516 | Bacteria | 1413 |
| 659 | Ga0495630_0012767 | 3300046517 | Bacteria | 6104 |
| 660 | Ga0495630_0016294 | 3300046517 | Bacteria | 5430 |
| 661 | Ga0495630_0019249 | 3300046517 | Bacteria | 5017 |
| 662 | Ga0495632_0229004 | 3300046519 | Bacteria | 839 |
| 663 | Ga0495663_0029069 | 3300046525 | Bacteria | 1630 |
| 664 | Ga0495663_0035183 | 3300046525 | Bacteria | 1503 |
| 665 | Ga0495666_0089017 | 3300046526 | Bacteria | 1458 |
| 666 | Ga0495642_0028305 | 3300046528 | Bacteria | 2232 |
| 667 | Ga0495652_0133196 | 3300046529 | Bacteria | 1964 |
| 668 | Ga0495652_0378296 | 3300046529 | Bacteria | 1008 |
| 669 | Ga0495640_0008659 | 3300046533 | Bacteria | 7975 |
| 670 | Ga0495587_0051342 | 3300046536 | Bacteria | 2438 |
| 671 | Ga0495587_0238048 | 3300046536 | Bacteria | 1024 |
| 672 | Ga0495645_0129593 | 3300046543 | Bacteria | 1769 |
| 673 | Ga0495667_0137170 | 3300046559 | Bacteria | 1577 |
| 674 | Ga0495667_0139825 | 3300046559 | Bacteria | 1560 |
| 675 | Ga0495656_0023526 | 3300046615 | Bacteria | 2425 |
| 676 | Ga0495656_0050142 | 3300046615 | Bacteria | 1781 |
| 677 | Ga0495656_0083309 | 3300046615 | Bacteria | 1448 |
| 678 | Ga0495656_0147475 | 3300046615 | Bacteria | 1134 |
| 679 | Ga0495588_0062300 | 3300046674 | Bacteria | 1933 |
| 680 | Ga0495657_0040636 | 3300046675 | Bacteria | 3188 |
| 681 | Ga0495657_0145883 | 3300046675 | Bacteria | 1472 |
| 682 | Ga0495599_0203513 | 3300046678 | Bacteria | 1216 |
| 683 | Ga0495623_0112182 | 3300046679 | Bacteria | 1651 |
| 684 | Ga0495647_0009277 | 3300046681 | Bacteria | 3328 |
| 685 | Ga0495658_0013979 | 3300046683 | Bacteria | 4093 |
| 686 | Ga0495658_0059511 | 3300046683 | Bacteria | 2188 |
| 687 | Ga0495658_0422738 | 3300046683 | Bacteria | 850 |
| 688 | Ga0495624_0229851 | 3300046690 | Bacteria | 1124 |
| 689 | Ga0495670_0111366 | 3300046691 | Bacteria | 1417 |
| 690 | Ga0495670_0175901 | 3300046691 | Bacteria | 1128 |
| 691 | Ga0495589_0020912 | 3300046794 | Bacteria | 3344 |
| 692 | Ga0495589_0062407 | 3300046794 | Bacteria | 1828 |
| 693 | Ga0495589_0087278 | 3300046794 | Bacteria | 1515 |
| 694 | Ga0495600_0065451 | 3300046809 | Bacteria | 2376 |
| 695 | Ga0495600_0087156 | 3300046809 | Bacteria | 2037 |
| 696 | Ga0495660_0116427 | 3300046810 | Bacteria | 1358 |
| 697 | Ga0495581_0011338 | 3300047315 | Bacteria | 5157 |
| 698 | Ga0495581_0013850 | 3300047315 | Bacteria | 4674 |
| 699 | Ga0495604_0053733 | 3300047317 | Bacteria | 3111 |
| 700 | Ga0495636_0101090 | 3300047318 | Bacteria | 1261 |
| 701 | Ga0495674_0007910 | 3300047319 | Bacteria | 10146 |
| 702 | Ga0495674_0231641 | 3300047319 | Bacteria | 1524 |
| 703 | Ga0495676_0119126 | 3300047321 | Bacteria | 1923 |
| 704 | Ga0495680_0014370 | 3300047322 | Bacteria | 6859 |
| 705 | Ga0495680_0076564 | 3300047322 | Bacteria | 2536 |
| 706 | Ga0495677_0006684 | 3300047445 | Bacteria | 4343 |
| 707 | Ga0495684_0021576 | 3300047471 | Bacteria | 4958 |
| 708 | Ga0495684_0091667 | 3300047471 | Bacteria | 2302 |
| 709 | Ga0495684_0182938 | 3300047471 | Bacteria | 1553 |
| 710 | Ga0495602_0049683 | 3300048088 | Bacteria | 3754 |
| 711 | Ga0495602_0166243 | 3300048088 | Bacteria | 1717 |
| 712 | Ga0495602_0319068 | 3300048088 | Bacteria | 1131 |
| 713 | Ga0495615_0004322 | 3300048090 | Bacteria | 2473 |
| 714 | Ga0495626_0123483 | 3300048091 | Bacteria | 1111 |
| 715 | Ga0496100_0188630 | 3300048903 | Bacteria | 1495 |
| 716 | Ga0496100_0238674 | 3300048903 | Bacteria | 1340 |
| 717 | Ga0496101_0037297 | 3300048904 | Bacteria | 3447 |
| 718 | Ga0496101_0047528 | 3300048904 | Bacteria | 3081 |
| 719 | Ga0496101_0058951 | 3300048904 | Bacteria | 2782 |
| 720 | Ga0496102_0071377 | 3300048905 | Bacteria | 3188 |
| 721 | Ga0496102_0073079 | 3300048905 | Bacteria | 3152 |
| 722 | Ga0496102_0097136 | 3300048905 | Bacteria | 2732 |
| 723 | Ga0496102_0124545 | 3300048905 | Bacteria | 2408 |
| 724 | Ga0496102_0141916 | 3300048905 | Bacteria | 2253 |
| 725 | Ga0496102_0392260 | 3300048905 | Bacteria | 1306 |
| 726 | Ga0496102_0675834 | 3300048905 | Bacteria | 956 |
| 727 | Ga0496103_0058387 | 3300048906 | Bacteria | 2397 |
| 728 | Ga0496103_0160267 | 3300048906 | Bacteria | 1443 |
| 729 | Ga0496104_0022964 | 3300048907 | Bacteria | 5733 |
| 730 | Ga0496104_0024820 | 3300048907 | Bacteria | 5519 |
| 731 | Ga0496104_0060194 | 3300048907 | Bacteria | 3597 |
| 732 | Ga0496104_0060499 | 3300048907 | Bacteria | 3588 |
| 733 | Ga0496104_0088604 | 3300048907 | Bacteria | 2956 |
| 734 | Ga0496104_0379462 | 3300048907 | Bacteria | 1326 |
| 735 | Ga0496105_0008202 | 3300048908 | Bacteria | 8120 |
| 736 | Ga0496105_0020362 | 3300048908 | Bacteria | 5360 |
| 737 | Ga0496105_0157088 | 3300048908 | Bacteria | 1867 |
| 738 | Ga0496105_0157106 | 3300048908 | Bacteria | 1867 |
| 739 | Ga0496105_0300316 | 3300048908 | Bacteria | 1291 |
| 740 | Ga0496106_0064603 | 3300048909 | Bacteria | 2784 |
| 741 | Ga0496106_0112195 | 3300048909 | Bacteria | 2124 |
| 742 | Ga0496106_0113873 | 3300048909 | Bacteria | 2109 |
| 743 | Ga0496107_0010819 | 3300048910 | Bacteria | 6348 |
| 744 | Ga0496107_0079795 | 3300048910 | Bacteria | 2386 |
| 745 | Ga0496107_0172793 | 3300048910 | Bacteria | 1604 |
| 746 | Ga0496107_0194400 | 3300048910 | Bacteria | 1508 |
| 747 | Ga0496108_0020117 | 3300048911 | Bacteria | 5485 |
| 748 | Ga0496108_0023140 | 3300048911 | Bacteria | 5110 |
| 749 | Ga0496108_0052733 | 3300048911 | Bacteria | 3410 |
| 750 | Ga0496108_0053340 | 3300048911 | Bacteria | 3391 |
| 751 | Ga0496108_0063890 | 3300048911 | Bacteria | 3100 |
| 752 | Ga0496109_0004131 | 3300048912 | Bacteria | 12127 |
| 753 | Ga0496109_0005768 | 3300048912 | Bacteria | 10359 |
| 754 | Ga0496109_0014523 | 3300048912 | Bacteria | 6850 |
| 755 | Ga0496109_0046788 | 3300048912 | Bacteria | 3930 |
| 756 | Ga0496109_0082884 | 3300048912 | Bacteria | 2957 |
| 757 | Ga0496109_0365259 | 3300048912 | Bacteria | 1363 |
| 758 | Ga0496109_0664287 | 3300048912 | Bacteria | 979 |
| 759 | Ga0496110_0003642 | 3300048913 | Bacteria | 11851 |
| 760 | Ga0496110_0006944 | 3300048913 | Bacteria | 9006 |
| 761 | Ga0496110_0028786 | 3300048913 | Bacteria | 4775 |
| 762 | Ga0496110_0055957 | 3300048913 | Bacteria | 3471 |
| 763 | Ga0496110_0063656 | 3300048913 | Bacteria | 3259 |
| 764 | Ga0496110_0099833 | 3300048913 | Bacteria | 2602 |
| 765 | Ga0496110_0263151 | 3300048913 | Bacteria | 1570 |
| 766 | Ga0496110_0328126 | 3300048913 | Bacteria | 1394 |
| 767 | Ga0496111_0004522 | 3300048914 | Bacteria | 8799 |
| 768 | Ga0496111_0025847 | 3300048914 | Bacteria | 4143 |
| 769 | Ga0496111_0044597 | 3300048914 | Bacteria | 3188 |
| 770 | Ga0496111_0047066 | 3300048914 | Bacteria | 3106 |
| 771 | Ga0496111_0088714 | 3300048914 | Bacteria | 2265 |
| 772 | Ga0496111_0095247 | 3300048914 | Bacteria | 2184 |
| 773 | Ga0496112_0001605 | 3300048915 | Bacteria | 17482 |
| 774 | Ga0496112_0003712 | 3300048915 | Bacteria | 12743 |
| 775 | Ga0496112_0022299 | 3300048915 | Bacteria | 6033 |
| 776 | Ga0496112_0051985 | 3300048915 | Bacteria | 4020 |
| 777 | Ga0496112_0182796 | 3300048915 | Bacteria | 2060 |
| 778 | Ga0496112_0193214 | 3300048915 | Bacteria | 1996 |
| 779 | Ga0496112_0254261 | 3300048915 | Bacteria | 1707 |
| 780 | Ga0496112_0290058 | 3300048915 | Bacteria | 1582 |
| 781 | Ga0496112_0652628 | 3300048915 | Bacteria | 982 |
| 782 | Ga0496113_0017352 | 3300048916 | Bacteria | 4995 |
| 783 | Ga0496113_0043212 | 3300048916 | Bacteria | 3334 |
| 784 | Ga0496113_0065007 | 3300048916 | Bacteria | 2760 |
| 785 | Ga0496113_0069007 | 3300048916 | Bacteria | 2684 |
| 786 | Ga0496113_0078716 | 3300048916 | Bacteria | 2522 |
| 787 | Ga0496113_0102361 | 3300048916 | Bacteria | 2221 |
| 788 | Ga0496113_0177777 | 3300048916 | Bacteria | 1687 |
| 789 | Ga0496113_0209900 | 3300048916 | Bacteria | 1550 |
| 790 | Ga0496114_0007197 | 3300048917 | Bacteria | 8782 |
| 791 | Ga0496114_0039314 | 3300048917 | Bacteria | 3914 |
| 792 | Ga0496114_0144381 | 3300048917 | Bacteria | 2062 |
| 793 | Ga0496115_0059815 | 3300048918 | Bacteria | 3069 |
| 794 | Ga0496115_0098573 | 3300048918 | Bacteria | 2394 |
| 795 | Ga0501034_0012999 | 3300049571 | Bacteria | 8582 |
| 796 | Ga0501040_0277153 | 3300049576 | Bacteria | 1198 |
| 797 | Ga0501043_0240851 | 3300049579 | Bacteria | 1395 |
| 798 | Ga0501067_0001545 | 3300049583 | Bacteria | 12553 |
| 799 | Ga0501067_0002196 | 3300049583 | Bacteria | 10773 |
| 800 | Ga0501067_0020565 | 3300049583 | Bacteria | 3653 |
| 801 | Ga0501067_0031978 | 3300049583 | Bacteria | 2919 |
| 802 | Ga0501068_0230921 | 3300049584 | Bacteria | 1177 |
| 803 | Ga0501069_0002312 | 3300049585 | Bacteria | 9623 |
| 804 | Ga0501069_0025983 | 3300049585 | Bacteria | 3205 |
| 805 | Ga0501069_0123209 | 3300049585 | Bacteria | 1481 |
| 806 | Ga0501070_0010496 | 3300049586 | Bacteria | 7833 |
| 807 | Ga0501071_0636778 | 3300049587 | Bacteria | 820 |
| 808 | Ga0501072_0253039 | 3300049588 | Bacteria | 1403 |
| 809 | Ga0501073_0053687 | 3300049589 | Bacteria | 2821 |
| 810 | Ga0501074_0016273 | 3300049590 | Bacteria | 5400 |
| 811 | Ga0501079_0182966 | 3300049741 | Bacteria | 1636 |
| 812 | Ga0501080_0001603 | 3300049742 | Bacteria | 19211 |
| 813 | Ga0501081_0214424 | 3300049743 | Bacteria | 1399 |
| 814 | nmdc:mga0yw44_347187_c1 | 3300050492 | Bacteria | 999 |
| 815 | nmdc:mga05p37_48479_c1 | 3300050507 | Bacteria | 5224 |
| 816 | nmdc:mga05p37_87024_c1 | 3300050507 | Bacteria | 3851 |
| 817 | nmdc:mga09592_107540_c1 | 3300050508 | Bacteria | 2392 |
| 818 | nmdc:mga0qj67_300121_c1 | 3300050509 | Bacteria | 1301 |
| 819 | nmdc:mga06r32_72812_c1 | 3300050510 | Bacteria | 3327 |
| 820 | nmdc:mga08y16_11279_c1 | 3300050511 | Bacteria | 9389 |
| 821 | nmdc:mga08y16_149358_c1 | 3300050511 | Bacteria | 2429 |
| 822 | nmdc:mga08y16_219208_c1 | 3300050511 | Bacteria | 1970 |
| 823 | nmdc:mga08y16_21966_c1 | 3300050511 | Bacteria | 6736 |
| 824 | nmdc:mga08y16_32373_c1 | 3300050511 | Bacteria | 5498 |
| 825 | nmdc:mga08y16_324440_c1 | 3300050511 | Bacteria | 1585 |
| 826 | nmdc:mga08y16_37953_c1 | 3300050511 | Bacteria | 5057 |
| 827 | nmdc:mga0n895_132129_c1 | 3300050512 | Bacteria | 2522 |
| 828 | nmdc:mga0n895_24837_c1 | 3300050512 | Bacteria | 5654 |
| 829 | nmdc:mga0n895_531165_c1 | 3300050512 | Bacteria | 1183 |
| 830 | nmdc:mga0n895_610569_c1 | 3300050512 | Bacteria | 1092 |
| 831 | nmdc:mga0n895_76454_c1 | 3300050512 | Bacteria | 3329 |
| 832 | nmdc:mga0n895_96375_c1 | 3300050512 | Bacteria | 2963 |
| 833 | nmdc:mga0rr50_110784_c1 | 3300050513 | Bacteria | 2172 |
| 834 | nmdc:mga0rr50_5908_c1 | 3300050513 | Bacteria | 7365 |
| 835 | nmdc:mga08x19_138168_c1 | 3300050514 | Bacteria | 1644 |
| 836 | nmdc:mga08x19_14136_c1 | 3300050514 | Bacteria | 4837 |
| 837 | nmdc:mga0a205_26423_c1 | 3300050515 | Bacteria | 5536 |
| 838 | nmdc:mga0a205_361064_c1 | 3300050515 | Bacteria | 1319 |
| 839 | Ga0495601_0007206 | 3300053077 | Bacteria | 6524 |
| 840 | Ga0495601_0092311 | 3300053077 | Bacteria | 1950 |
| 841 | Ga0495655_0013200 | 3300053083 | Bacteria | 1704 |
| 842 | Ga0495595_0030209 | 3300053084 | Bacteria | 2429 |
| 843 | Ga0466962_0007948 | 3300061719 | Bacteria | 5088 |
| 844 | Ga0466962_0067051 | 3300061719 | Bacteria | 1713 |
| 845 | Ga0530510_0204072 | 3300061734 | Bacteria | 1469 |
| 846 | Ga0070711_100047286 | |||
| 847 | JGI25406J46586_10001832 | |||
| 848 | JGI25406J46586_10014010 | |||
| 849 | Ga0070658_10008431 | |||
| 850 | Ga0070658_10084037 | |||
| 851 | Ga0070676_10068924 | |||
| 852 | Ga0070683_100002420 | |||
| 853 | Ga0070683_100083484 | |||
| 854 | Ga0070683_100104839 | |||
| 855 | Ga0070683_100181371 | |||
| 856 | Ga0070683_100238883 | |||
| 857 | Ga0070683_100363826 | |||
| 858 | Ga0070683_100416792 | |||
| 859 | Ga0070683_100604116 | |||
| 860 | Ga0070690_100034703 | |||
| 861 | Ga0070666_10158998 | |||
| 862 | Ga0070680_100004396 | |||
| 863 | Ga0070680_100020246 | |||
| 864 | Ga0070680_100221354 | |||
| 865 | Ga0070680_100230705 | |||
| 866 | Ga0070680_100319147 | |||
| 867 | Ga0070680_100333899 | |||
| 868 | Ga0070682_100156638 | |||
| 869 | Ga0068868_100174357 | |||
| 870 | Ga0070660_100000770 | |||
| 871 | Ga0070660_100011620 | |||
| 872 | Ga0070660_100024445 | |||
| 873 | Ga0070660_100037086 | |||
| 874 | Ga0070660_100069774 | |||
| 875 | Ga0070660_100380891 | |||
| 876 | Ga0070691_10042563 | |||
| 877 | Ga0070661_100014016 | |||
| 878 | Ga0070661_100026378 | |||
| 879 | Ga0070661_100263596 | |||
| 880 | Ga0070692_10008214 | |||
| 881 | Ga0070668_100008922 | |||
| 882 | Ga0070668_100133863 | |||
| 883 | Ga0070669_100070685 | |||
| 884 | Ga0070675_100161375 | |||
| 885 | Ga0070671_100097851 | |||
| 886 | Ga0070671_100112828 | |||
| 887 | Ga0070674_100093944 | |||
| 888 | Ga0070674_100160271 | |||
| 889 | Ga0070674_100166125 | |||
| 890 | Ga0070673_100046656 | |||
| 891 | Ga0070688_100007315 | |||
| 892 | Ga0070659_100005233 | |||
| 893 | Ga0070659_100166388 | |||
| 894 | Ga0070659_100183126 | |||
| 895 | Ga0070659_100199694 | |||
| 896 | Ga0070659_100256665 | |||
| 897 | Ga0070667_100219758 | |||
| 898 | Ga0070667_100298991 | |||
| 899 | Ga0070709_10120470 | |||
| 900 | Ga0070714_100048652 | |||
| 901 | Ga0070714_100073677 | |||
| 902 | Ga0070714_100174409 | |||
| 903 | Ga0070714_100218784 | |||
| 904 | Ga0070714_100267155 | |||
| 905 | Ga0070713_100028734 | |||
| 906 | Ga0070713_100056914 | |||
| 907 | Ga0070710_10258156 | |||
| 908 | Ga0070710_10387967 | |||
| 909 | Ga0070711_100003846 | |||
| 910 | Ga0070711_100030939 | |||
| 911 | Ga0070705_100004640 | |||
| 912 | Ga0070700_100000794 | |||
| 913 | Ga0070700_100005756 | |||
| 914 | Ga0070694_100006557 | |||
| 915 | Ga0070694_100144727 | |||
| 916 | Ga0070708_100003130 | |||
| 917 | Ga0070663_100226884 | |||
| 918 | Ga0070678_100042479 | |||
| 919 | Ga0070678_100433884 | |||
| 920 | Ga0070681_10001129 | |||
| 921 | Ga0070681_10011904 | |||
| 922 | Ga0070681_10014817 | |||
| 923 | Ga0070681_10021437 | |||
| 924 | Ga0070681_10070369 | |||
| 925 | Ga0070681_10153591 | |||
| 926 | Ga0068867_100044955 | |||
| 927 | Ga0068867_100092962 | |||
| 928 | Ga0068867_100106640 | |||
| 929 | Ga0068867_100144497 | |||
| 930 | Ga0068867_100193944 | |||
| 931 | Ga0070685_10001659 | |||
| 932 | Ga0070706_100002074 | |||
| 933 | Ga0070706_100341685 | |||
| 934 | Ga0070707_100005619 | |||
| 935 | Ga0070698_100030900 | |||
| 936 | Ga0070699_100002657 | |||
| 937 | Ga0070699_100039172 | |||
| 938 | Ga0070679_100010930 | |||
| 939 | Ga0070679_100013896 | |||
| 940 | Ga0070679_100023167 | |||
| 941 | Ga0070679_100073580 | |||
| 942 | Ga0070679_100163648 | |||
| 943 | Ga0070679_100286358 | |||
| 944 | Ga0070679_100380820 | |||
| 945 | Ga0070684_100011742 | |||
| 946 | Ga0070684_100106364 | |||
| 947 | Ga0070684_100316754 | |||
| 948 | Ga0070684_100368380 | |||
| 949 | Ga0070672_100022209 | |||
| 950 | Ga0070672_100067021 | |||
| 951 | Ga0070672_100222329 | |||
| 952 | Ga0070686_100003788 | |||
| 953 | Ga0070686_100010694 | |||
| 954 | Ga0070686_100127113 | |||
| 955 | Ga0070686_100243771 | |||
| 956 | Ga0070695_100008132 | |||
| 957 | Ga0070696_100032230 | |||
| 958 | Ga0070696_100136607 | |||
| 959 | Ga0070696_100341798 | |||
| 960 | Ga0070665_100017089 | |||
| 961 | Ga0070665_100122039 | |||
| 962 | Ga0068855_100016898 | |||
| 963 | Ga0068855_100026525 | |||
| 964 | Ga0068855_100064288 | |||
| 965 | Ga0068855_100083857 | |||
| 966 | Ga0068855_100168778 | |||
| 967 | Ga0068855_100207692 | |||
| 968 | Ga0068855_100383358 | |||
| 969 | Ga0068857_100022389 | |||
| 970 | Ga0068854_100016749 | |||
| 971 | Ga0068856_100217965 | |||
| 972 | Ga0068856_100302352 | |||
| 973 | Ga0070702_100007834 | |||
| 974 | Ga0070702_100043046 | |||
| 975 | Ga0070702_100150196 | |||
| 976 | Ga0068852_100054346 | |||
| 977 | Ga0068852_100263876 | |||
| 978 | Ga0068852_100298368 | |||
| 979 | Ga0068859_100380480 | |||
| 980 | Ga0068866_10001477 | |||
| 981 | Ga0068866_10217522 | |||
| 982 | Ga0068861_100066250 | |||
| 983 | Ga0068861_100084175 | |||
| 984 | Ga0068861_100087041 | |||
| 985 | Ga0068861_100140308 | |||
| 986 | Ga0068870_10007137 | |||
| 987 | Ga0068870_10074055 | |||
| 988 | Ga0068858_100048669 | |||
| 989 | Ga0068858_100269930 | |||
| 990 | Ga0068860_100051952 | |||
| 991 | Ga0068860_100131640 | |||
| 992 | Ga0068862_100073795 | |||
| 993 | Ga0081455_10031698 | |||
| 994 | Ga0081455_10059896 | |||
| 995 | Ga0081455_10117197 | |||
| 996 | Ga0081455_10122145 | |||
| 997 | Ga0081455_10206413 | |||
| 998 | Ga0081455_10279167 | |||
| 999 | Ga0081540_1004573 | |||
| 1000 | Ga0081540_1009927 | |||
| 1001 | Ga0081540_1013732 | |||
| 1002 | Ga0081540_1083758 | |||
| 1003 | Ga0081539_10000171 | |||
| 1004 | Ga0081539_10000599 | |||
| 1005 | Ga0081539_10001044 | |||
| 1006 | Ga0081539_10002263 | |||
| 1007 | Ga0081539_10007528 | |||
| 1008 | Ga0070717_10013308 | |||
| 1009 | Ga0070717_10023875 | |||
| 1010 | Ga0070717_10224313 | |||
| 1011 | Ga0075365_10064645 | |||
| 1012 | Ga0075432_10016943 | |||
| 1013 | Ga0075432_10044126 | |||
| 1014 | Ga0070715_10003385 | |||
| 1015 | Ga0070716_100100965 | |||
| 1016 | Ga0070712_100024354 | |||
| 1017 | Ga0070712_100036082 | |||
| 1018 | Ga0070712_100298236 | |||
| 1019 | Ga0097621_100013143 | |||
| 1020 | Ga0097621_100507560 | |||
| 1021 | Ga0068871_100043994 | |||
| 1022 | Ga0075428_100045891 | |||
| 1023 | Ga0075428_100227056 | |||
| 1024 | Ga0075431_100010688 | |||
| 1025 | Ga0075431_100132697 | |||
| 1026 | Ga0075433_10066369 | |||
| 1027 | Ga0075434_100019457 | |||
| 1028 | Ga0075434_100220040 | |||
| 1029 | Ga0075429_100268360 | |||
| 1030 | Ga0068865_100135514 | |||
| 1031 | Ga0068865_100210968 | |||
| 1032 | Ga0097620_100380460 | |||
| 1033 | Ga0075435_100076760 | |||
| 1034 | Ga0111539_10004337 | |||
| 1035 | Ga0111539_10006713 | |||
| 1036 | Ga0111539_10011536 | |||
| 1037 | Ga0111539_10024559 | |||
| 1038 | Ga0111539_10072897 | |||
| 1039 | Ga0111539_10407900 | |||
| 1040 | Ga0105245_10004691 | |||
| 1041 | Ga0105245_10015878 | |||
| 1042 | Ga0105245_10096890 | |||
| 1043 | Ga0105245_10206787 | |||
| 1044 | Ga0105245_10220077 | |||
| 1045 | Ga0105247_10289026 | |||
| 1046 | Ga0114129_10007588 | |||
| 1047 | Ga0114129_10110556 | |||
| 1048 | Ga0105243_10002631 | |||
| 1049 | Ga0105243_10083632 | |||
| 1050 | Ga0105243_10189962 | |||
| 1051 | Ga0105243_10330077 | |||
| 1052 | Ga0105241_10120178 | |||
| 1053 | Ga0105241_10153700 | |||
| 1054 | Ga0105242_10496654 | |||
| 1055 | Ga0105242_10641589 | |||
| 1056 | Ga0105248_10131898 | |||
| 1057 | Ga0105248_10146102 | |||
| 1058 | Ga0105248_10171402 | |||
| 1059 | Ga0105248_10603275 | |||
| 1060 | Ga0105248_10790083 | |||
| 1061 | Ga0105237_10026571 | |||
| 1062 | Ga0105237_10175500 | |||
| 1063 | Ga0105237_10177379 | |||
| 1064 | Ga0105237_10252625 | |||
| 1065 | Ga0105238_10360531 | |||
| 1066 | Ga0105238_10657223 | |||
| 1067 | Ga0105249_10034628 | |||
| 1068 | Ga0105249_10063431 | |||
| 1069 | Ga0105249_10092313 | |||
| 1070 | Ga0105249_10121569 | |||
| 1071 | Ga0105249_10257113 | |||
| 1072 | Ga0105239_10010075 | |||
| 1073 | Ga0105239_10020559 | |||
| 1074 | Ga0105239_10279707 | |||
| 1075 | Ga0105239_10368264 | |||
| 1076 | Ga0105239_10476976 | |||
| 1077 | Ga0105246_10002634 | |||
| 1078 | Ga0105246_10011385 | |||
| 1079 | Ga0105246_10253463 | |||
| 1080 | Ga0105246_10448057 | |||
| 1081 | Ga0157373_10011332 | |||
| 1082 | Ga0157370_10017041 | |||
| 1083 | Ga0157369_10012087 | |||
| 1084 | Ga0157369_10014522 | |||
| 1085 | Ga0157369_10016084 | |||
| 1086 | Ga0157369_10116687 | |||
| 1087 | Ga0157369_10182901 | |||
| 1088 | Ga0157374_10013221 | |||
| 1089 | Ga0157374_10042769 | |||
| 1090 | Ga0157378_10022794 | |||
| 1091 | Ga0157378_10394093 | |||
| 1092 | Ga0157378_10406167 | |||
| 1093 | Ga0157378_10585056 | |||
| 1094 | Ga0163162_10000727 | |||
| 1095 | Ga0163162_10059208 | |||
| 1096 | Ga0163162_10196269 | |||
| 1097 | Ga0157372_10071822 | |||
| 1098 | Ga0157372_10107265 | |||
| 1099 | Ga0157372_10452250 | |||
| 1100 | Ga0157372_10582716 | |||
| 1101 | Ga0157372_10754279 | |||
| 1102 | Ga0157375_10004690 | |||
| 1103 | Ga0157375_10020575 | |||
| 1104 | Ga0157375_10050206 | |||
| 1105 | Ga0157375_10234816 | |||
| 1106 | Ga0157375_10564637 | |||
| 1107 | Ga0163163_10064167 | |||
| 1108 | Ga0163163_10115837 | |||
| 1109 | Ga0163163_10740487 | |||
| 1110 | Ga0157380_10023482 | |||
| 1111 | Ga0157380_10083186 | |||
| 1112 | Ga0157380_10352711 | |||
| 1113 | Ga0157380_10456147 | |||
| 1114 | Ga0182008_10008697 | |||
| 1115 | Ga0157377_10000397 | |||
| 1116 | Ga0157377_10057739 | |||
| 1117 | Ga0157379_10073145 | |||
| 1118 | Ga0157379_10670188 | |||
| 1119 | Ga0157376_10473361 | |||
| 1120 | Ga0182006_1014567 | |||
| 1121 | Ga0163161_10178856 | |||
| 1122 | Ga0197907_10808555 | |||
| 1123 | Ga0206356_10063198 | |||
| 1124 | Ga0206354_10930277 | |||
| 1125 | Ga0206354_11001608 | |||
| 1126 | Ga0206353_11446920 | |||
| 1127 | Ga0207653_10021129 | |||
| 1128 | Ga0207692_10157062 | |||
| 1129 | Ga0207692_10174634 | |||
| 1130 | Ga0207642_10002810 | |||
| 1131 | Ga0207642_10153862 | |||
| 1132 | Ga0207688_10023433 | |||
| 1133 | Ga0207688_10034346 | |||
| 1134 | Ga0207688_10268335 | |||
| 1135 | Ga0207685_10108594 | |||
| 1136 | Ga0207699_10063328 | |||
| 1137 | Ga0207699_10073048 | |||
| 1138 | Ga0207699_10250010 | |||
| 1139 | Ga0207643_10003011 | |||
| 1140 | Ga0207643_10011792 | |||
| 1141 | Ga0207705_10010634 | |||
| 1142 | Ga0207705_10020310 | |||
| 1143 | Ga0207705_10138742 | |||
| 1144 | Ga0207684_10023508 | |||
| 1145 | Ga0207684_10224485 | |||
| 1146 | Ga0207684_10397640 | |||
| 1147 | Ga0207707_10008550 | |||
| 1148 | Ga0207707_10008778 | |||
| 1149 | Ga0207707_10040674 | |||
| 1150 | Ga0207707_10087625 | |||
| 1151 | Ga0207695_10186005 | |||
| 1152 | Ga0207695_10236293 | |||
| 1153 | Ga0207695_10353740 | |||
| 1154 | Ga0207671_10141963 | |||
| 1155 | Ga0207693_10000347 | |||
| 1156 | Ga0207693_10087510 | |||
| 1157 | Ga0207660_10003765 | |||
| 1158 | Ga0207660_10044988 | |||
| 1159 | Ga0207660_10155231 | |||
| 1160 | Ga0207660_10292052 | |||
| 1161 | Ga0207657_10000319 | |||
| 1162 | Ga0207657_10000416 | |||
| 1163 | Ga0207657_10001085 | |||
| 1164 | Ga0207657_10011244 | |||
| 1165 | Ga0207657_10019514 | |||
| 1166 | Ga0207657_10021028 | |||
| 1167 | Ga0207657_10087191 | |||
| 1168 | Ga0207649_10059815 | |||
| 1169 | Ga0207652_10016020 | |||
| 1170 | Ga0207652_10052239 | |||
| 1171 | Ga0207652_10066938 | |||
| 1172 | Ga0207652_10086342 | |||
| 1173 | Ga0207652_10137774 | |||
| 1174 | Ga0207652_10198568 | |||
| 1175 | Ga0207652_10372048 | |||
| 1176 | Ga0207652_10390792 | |||
| 1177 | Ga0207646_10014823 | |||
| 1178 | Ga0207646_10590868 | |||
| 1179 | Ga0207681_10523125 | |||
| 1180 | Ga0207687_10023008 | |||
| 1181 | Ga0207687_10064274 | |||
| 1182 | Ga0207687_10071146 | |||
| 1183 | Ga0207700_10000004 | |||
| 1184 | Ga0207700_10109810 | |||
| 1185 | Ga0207664_10004622 | |||
| 1186 | Ga0207664_10046674 | |||
| 1187 | Ga0207664_10152679 | |||
| 1188 | Ga0207664_10267244 | |||
| 1189 | Ga0207664_10429836 | |||
| 1190 | Ga0207644_10315986 | |||
| 1191 | Ga0207690_10111663 | |||
| 1192 | Ga0207690_10266865 | |||
| 1193 | Ga0207706_10022500 | |||
| 1194 | Ga0207706_10213428 | |||
| 1195 | Ga0207686_10005993 | |||
| 1196 | Ga0207686_10394806 | |||
| 1197 | Ga0207709_10001627 | |||
| 1198 | Ga0207709_10052675 | |||
| 1199 | Ga0207709_10060392 | |||
| 1200 | Ga0207669_10002197 | |||
| 1201 | Ga0207669_10050770 | |||
| 1202 | Ga0207669_10185451 | |||
| 1203 | Ga0207669_10291037 | |||
| 1204 | Ga0207704_10096970 | |||
| 1205 | Ga0207704_10194509 | |||
| 1206 | Ga0207704_10253029 | |||
| 1207 | Ga0207665_10099394 | |||
| 1208 | Ga0207691_10022775 | |||
| 1209 | Ga0207689_10038149 | |||
| 1210 | Ga0207661_10025532 | |||
| 1211 | Ga0207661_10027782 | |||
| 1212 | Ga0207661_10115531 | |||
| 1213 | Ga0207661_10207847 | |||
| 1214 | Ga0207661_10246698 | |||
| 1215 | Ga0207679_10114516 | |||
| 1216 | Ga0207679_10334653 | |||
| 1217 | Ga0207667_10054323 | |||
| 1218 | Ga0207667_10125085 | |||
| 1219 | Ga0207667_10221788 | |||
| 1220 | Ga0207667_10298543 | |||
| 1221 | Ga0207667_10390631 | |||
| 1222 | Ga0207651_10044454 | |||
| 1223 | Ga0207712_10007054 | |||
| 1224 | Ga0207712_10034038 | |||
| 1225 | Ga0207668_10028482 | |||
| 1226 | Ga0207668_10054453 | |||
| 1227 | Ga0207668_10129837 | |||
| 1228 | Ga0207640_10338395 | |||
| 1229 | Ga0207640_10462078 | |||
| 1230 | Ga0207658_10345856 | |||
| 1231 | Ga0207677_10261861 | |||
| 1232 | Ga0207639_10220745 | |||
| 1233 | Ga0207678_10036097 | |||
| 1234 | Ga0207678_10108182 | |||
| 1235 | Ga0207678_10108285 | |||
| 1236 | Ga0207678_10248558 | |||
| 1237 | Ga0207678_10257717 | |||
| 1238 | Ga0207678_10433683 | |||
| 1239 | Ga0207708_10001000 | |||
| 1240 | Ga0207708_10014047 | |||
| 1241 | Ga0207708_10092177 | |||
| 1242 | Ga0207702_10061850 | |||
| 1243 | Ga0207702_10113624 | |||
| 1244 | Ga0207702_10265782 | |||
| 1245 | Ga0207641_10405002 | |||
| 1246 | Ga0207648_10000191 | |||
| 1247 | Ga0207648_10018603 | |||
| 1248 | Ga0207648_10205050 | |||
| 1249 | Ga0207648_10236209 | |||
| 1250 | Ga0207674_10010377 | |||
| 1251 | Ga0207674_10031297 | |||
| 1252 | Ga0207674_10154580 | |||
| 1253 | Ga0207674_10252546 | |||
| 1254 | Ga0207674_10294180 | |||
| 1255 | Ga0207675_100002866 | |||
| 1256 | Ga0207675_100007801 | |||
| 1257 | Ga0207675_100077713 | |||
| 1258 | Ga0207683_10005339 | |||
| 1259 | Ga0207683_10009882 | |||
| 1260 | Ga0207683_10108659 | |||
| 1261 | Ga0207698_10037000 | |||
| 1262 | Ga0209998_10023854 | |||
| 1263 | Ga0207428_10001543 | |||
| 1264 | Ga0207428_10025320 | |||
| 1265 | Ga0207428_10056799 | |||
| 1266 | Ga0207428_10196088 | |||
| 1267 | Ga0268266_10135972 | |||
| 1268 | Ga0268266_10141656 | |||
| 1269 | Ga0268265_10074221 | |||
| 1270 | Ga0268264_10096869 | |||
| 1271 | Ga0265337_1009232 | |||
| 1272 | Ga0265338_10004154 | |||
| 1273 | Ga0265338_10038872 | |||
| 1274 | Ga0265338_10172758 | |||
| 1275 | Ga0265320_10017109 | |||
| 1276 | Ga0265339_10011110 | |||
| 1277 | Ga0265331_10045085 | |||
| 1278 | Ga0265327_10018798 | |||
| 1279 | Ga0265316_10095404 | |||
| 1280 | Ga0307408_100181473 | |||
| 1281 | Ga0265313_10050377 | |||
| 1282 | Ga0265313_10063519 | |||
| 1283 | Ga0265314_10091205 | |||
| 1284 | Ga0265342_10019172 | |||
| 1285 | Ga0307405_10048894 | |||
| 1286 | Ga0307405_10278822 | |||
| 1287 | Ga0307410_10043423 | |||
| 1288 | Ga0307410_10141104 | |||
| 1289 | Ga0307406_10004278 | |||
| 1290 | Ga0307406_10047851 | |||
| 1291 | Ga0307406_10177701 | |||
| 1292 | Ga0307407_10069508 | |||
| 1293 | Ga0307407_10328968 | |||
| 1294 | Ga0307409_100023790 | |||
| 1295 | Ga0307409_100024413 | |||
| 1296 | Ga0307409_100077172 | |||
| 1297 | Ga0307409_100407852 | |||
| 1298 | Ga0307416_100024830 | |||
| 1299 | Ga0307416_100048872 | |||
| 1300 | Ga0307416_100052647 | |||
| 1301 | Ga0307411_10027835 | |||
| 1302 | Ga0307415_100002779 | |||
| 1303 | Ga0307415_100008265 | |||
| 1304 | Ga0307415_100011040 | |||
| 1305 | Ga0373936_0065054 | |||
| 1306 | Ga0373941_0021420 | |||
| 1307 | Ga0373945_0016417 | |||
| 1308 | Ga0373945_0055529 | |||
| 1309 | Ga0373960_0014406 | |||
| 1310 | Ga0373943_0015187 | |||
| 1311 | Ga0373946_0032563 | |||
| 1312 | Ga0373955_0043435 | |||
| 1313 | Ga0373931_0030581 | |||
| 1314 | Ga0373947_0004583 | |||
| 1315 | Ga0373947_0156257 | |||
| 1316 | Ga0373937_0010608 | |||
| 1317 | Ga0373925_0008549 | |||
| 1318 | Ga0395899_0001266 | |||
| 1319 | Ga0395899_0003558 | |||
| 1320 | Ga0395899_0004161 | |||
| 1321 | Ga0395899_0004681 | |||
| 1322 | Ga0395899_0007083 | |||
| 1323 | Ga0395899_0011255 | |||
| 1324 | Ga0395899_0016475 | |||
| 1325 | Ga0395899_0021751 | |||
| 1326 | Ga0395899_0066605 | |||
| 1327 | Ga0395899_0080894 | |||
| 1328 | Ga0395899_0096631 | |||
| 1329 | Ga0395899_0111703 | |||
| 1330 | Ga0395899_0125560 | |||
| 1331 | Ga0395900_0001348 | |||
| 1332 | Ga0395900_0002880 | |||
| 1333 | Ga0395900_0005507 | |||
| 1334 | Ga0395900_0007933 | |||
| 1335 | Ga0395900_0008749 | |||
| 1336 | Ga0395900_0009564 | |||
| 1337 | Ga0395900_0009887 | |||
| 1338 | Ga0395900_0037178 | |||
| 1339 | Ga0395900_0055428 | |||
| 1340 | Ga0395900_0097511 | |||
| 1341 | Ga0395900_0115405 | |||
| 1342 | Ga0395900_0117300 | |||
| 1343 | Ga0395900_0142794 | |||
| 1344 | Ga0395900_0193733 | |||
| 1345 | Ga0395900_0220007 | |||
| 1346 | Ga0395900_0276919 | |||
| 1347 | Ga0395900_0338834 | |||
| 1348 | Ga0395900_0526291 | |||
| 1349 | Ga0395900_0604304 | |||
| 1350 | Ga0395898_0002653 | |||
| 1351 | Ga0395898_0004125 | |||
| 1352 | Ga0395898_0005273 | |||
| 1353 | Ga0395898_0007310 | |||
| 1354 | Ga0395898_0024274 | |||
| 1355 | Ga0395898_0025891 | |||
| 1356 | Ga0395898_0027148 | |||
| 1357 | Ga0395898_0030119 | |||
| 1358 | Ga0395898_0057405 | |||
| 1359 | Ga0395898_0064574 | |||
| 1360 | Ga0395898_0066706 | |||
| 1361 | Ga0395898_0093743 | |||
| 1362 | Ga0395898_0097865 | |||
| 1363 | Ga0395898_0100736 | |||
| 1364 | Ga0395898_0229843 | |||
| 1365 | Ga0395898_0229911 | |||
| 1366 | Ga0395898_0230948 | |||
| 1367 | Ga0395898_0243197 | |||
| 1368 | Ga0395898_0391429 | |||
| 1369 | Ga0395898_0446584 | |||
| 1370 | Ga0395905_0001663 | |||
| 1371 | Ga0395905_0003200 | |||
| 1372 | Ga0395905_0003387 | |||
| 1373 | Ga0395905_0007458 | |||
| 1374 | Ga0395905_0010757 | |||
| 1375 | Ga0395905_0026203 | |||
| 1376 | Ga0395905_0027536 | |||
| 1377 | Ga0395905_0045804 | |||
| 1378 | Ga0395905_0049383 | |||
| 1379 | Ga0395905_0053766 | |||
| 1380 | Ga0395905_0064123 | |||
| 1381 | Ga0395905_0072686 | |||
| 1382 | Ga0395905_0093956 | |||
| 1383 | Ga0395905_0104855 | |||
| 1384 | Ga0395905_0106646 | |||
| 1385 | Ga0395905_0184394 | |||
| 1386 | Ga0395905_0188297 | |||
| 1387 | Ga0395905_0276685 | |||
| 1388 | Ga0395905_0394312 | |||
| 1389 | Ga0395905_0425004 | |||
| 1390 | Ga0395901_0000586 | |||
| 1391 | Ga0395901_0003540 | |||
| 1392 | Ga0395901_0003604 | |||
| 1393 | Ga0395901_0006305 | |||
| 1394 | Ga0395901_0007207 | |||
| 1395 | Ga0395901_0009439 | |||
| 1396 | Ga0395901_0009719 | |||
| 1397 | Ga0395901_0009868 | |||
| 1398 | Ga0395901_0023204 | |||
| 1399 | Ga0395901_0032949 | |||
| 1400 | Ga0395901_0047176 | |||
| 1401 | Ga0395901_0068533 | |||
| 1402 | Ga0395901_0084404 | |||
| 1403 | Ga0395901_0111912 | |||
| 1404 | Ga0395901_0147819 | |||
| 1405 | Ga0395901_0170941 | |||
| 1406 | Ga0395901_0208442 | |||
| 1407 | Ga0395901_0217540 | |||
| 1408 | Ga0395901_0221824 | |||
| 1409 | Ga0395901_0225647 | |||
| 1410 | Ga0395901_0231833 | |||
| 1411 | Ga0395901_0254347 | |||
| 1412 | Ga0395901_0370669 | |||
| 1413 | Ga0395901_0417923 | |||
| 1414 | Ga0395901_0600554 | |||
| 1415 | Ga0436365_0699127 | |||
| 1416 | Ga0436365_0827282 | |||
| 1417 | Ga0439438_036318 | |||
| 1418 | Ga0451800_0905413 | |||
| 1419 | Ga0451802_0273766 | |||
| 1420 | Ga0451804_0328232 | |||
| 1421 | Ga0451833_1219700 | |||
| 1422 | Ga0451855_0246350 | |||
| 1423 | Ga0439450_045267 | |||
| 1424 | Ga0450902_017588 | |||
| 1425 | Ga0439446_0016294 | |||
| 1426 | Ga0439434_0006961 | |||
| 1427 | Ga0466965_0055070 | |||
| 1428 | Ga0466966_0072596 | |||
| 1429 | Ga0466961_0009296 | |||
| 1430 | Ga0466961_0024352 | |||
| 1431 | Ga0466961_0107049 | |||
| 1432 | Ga0466963_0014601 | |||
| 1433 | Ga0466963_0019939 | |||
| 1434 | Ga0466963_0030139 | |||
| 1435 | Ga0466963_0168380 | |||
| 1436 | Ga0466963_0203887 | |||
| 1437 | Ga0466963_0448504 | |||
| 1438 | Ga0466964_0036685 | |||
| 1439 | Ga0466964_0052804 | |||
| 1440 | Ga0466964_0085332 | |||
| 1441 | Ga0466971_0004028 | |||
| 1442 | Ga0466970_0247306 | |||
| 1443 | Ga0466957_0085726 | |||
| 1444 | Ga0466957_0099516 | |||
| 1445 | Ga0466957_0283285 | |||
| 1446 | Ga0466960_0070111 | |||
| 1447 | Ga0466959_0081856 | |||
| 1448 | Ga0466959_0201253 | |||
| 1449 | Ga0466959_0203940 | |||
| 1450 | Ga0451576_0113890 | |||
| 1451 | Ga0451576_0247879 | |||
| 1452 | Ga0466958_0011177 | |||
| 1453 | Ga0466958_0091634 | |||
| 1454 | Ga0466958_0094708 | |||
| 1455 | Ga0466967_0002495 | |||
| 1456 | Ga0466967_0006058 | |||
| 1457 | Ga0466967_0006201 | |||
| 1458 | Ga0466967_0011534 | |||
| 1459 | Ga0466967_0017574 | |||
| 1460 | Ga0466967_0029145 | |||
| 1461 | Ga0466967_0029275 | |||
| 1462 | Ga0466967_0031632 | |||
| 1463 | Ga0466967_0046836 | |||
| 1464 | Ga0466967_0050336 | |||
| 1465 | Ga0466967_0051287 | |||
| 1466 | Ga0466967_0061999 | |||
| 1467 | Ga0466967_0062376 | |||
| 1468 | Ga0466967_0078979 | |||
| 1469 | Ga0466967_0111641 | |||
| 1470 | Ga0466967_0127505 | |||
| 1471 | Ga0466967_0137643 | |||
| 1472 | Ga0466967_0221326 | |||
| 1473 | Ga0466967_0227390 | |||
| 1474 | Ga0495603_0013786 | |||
| 1475 | Ga0495603_0077999 | |||
| 1476 | Ga0495629_0155020 | |||
| 1477 | Ga0495641_0013421 | |||
| 1478 | Ga0495651_0080817 | |||
| 1479 | Ga0495651_0124055 | |||
| 1480 | Ga0495653_0022058 | |||
| 1481 | Ga0495653_0026787 | |||
| 1482 | Ga0495653_0107193 | |||
| 1483 | Ga0495653_0154562 | |||
| 1484 | Ga0495582_0046268 | |||
| 1485 | Ga0495582_0088514 | |||
| 1486 | Ga0495605_0080301 | |||
| 1487 | Ga0495605_0093271 | |||
| 1488 | Ga0495639_0040287 | |||
| 1489 | Ga0495662_0043673 | |||
| 1490 | Ga0495664_0083276 | |||
| 1491 | Ga0495664_0109456 | |||
| 1492 | Ga0495584_0018509 | |||
| 1493 | Ga0495584_0038899 | |||
| 1494 | Ga0495584_0087332 | |||
| 1495 | Ga0495584_0093174 | |||
| 1496 | Ga0495585_0120728 | |||
| 1497 | Ga0495594_0013181 | |||
| 1498 | Ga0495596_0044454 | |||
| 1499 | Ga0495607_0055830 | |||
| 1500 | Ga0495608_0017419 | |||
| 1501 | Ga0495608_0108066 | |||
| 1502 | Ga0495628_0091053 | |||
| 1503 | Ga0495628_0223530 | |||
| 1504 | Ga0495630_0012767 | |||
| 1505 | Ga0495630_0016294 | |||
| 1506 | Ga0495630_0019249 | |||
| 1507 | Ga0495632_0229004 | |||
| 1508 | Ga0495663_0029069 | |||
| 1509 | Ga0495663_0035183 | |||
| 1510 | Ga0495666_0089017 | |||
| 1511 | Ga0495642_0028305 | |||
| 1512 | Ga0495652_0133196 | |||
| 1513 | Ga0495652_0378296 | |||
| 1514 | Ga0495640_0008659 | |||
| 1515 | Ga0495587_0051342 | |||
| 1516 | Ga0495587_0238048 | |||
| 1517 | Ga0495645_0129593 | |||
| 1518 | Ga0495667_0137170 | |||
| 1519 | Ga0495667_0139825 | |||
| 1520 | Ga0495656_0023526 | |||
| 1521 | Ga0495656_0050142 | |||
| 1522 | Ga0495656_0083309 | |||
| 1523 | Ga0495656_0147475 | |||
| 1524 | Ga0495588_0062300 | |||
| 1525 | Ga0495657_0040636 | |||
| 1526 | Ga0495657_0145883 | |||
| 1527 | Ga0495599_0203513 | |||
| 1528 | Ga0495623_0112182 | |||
| 1529 | Ga0495647_0009277 | |||
| 1530 | Ga0495658_0013979 | |||
| 1531 | Ga0495658_0059511 | |||
| 1532 | Ga0495658_0422738 | |||
| 1533 | Ga0495624_0229851 | |||
| 1534 | Ga0495670_0111366 | |||
| 1535 | Ga0495670_0175901 | |||
| 1536 | Ga0495589_0020912 | |||
| 1537 | Ga0495589_0062407 | |||
| 1538 | Ga0495589_0087278 | |||
| 1539 | Ga0495600_0065451 | |||
| 1540 | Ga0495600_0087156 | |||
| 1541 | Ga0495660_0116427 | |||
| 1542 | Ga0495581_0011338 | |||
| 1543 | Ga0495581_0013850 | |||
| 1544 | Ga0495604_0053733 | |||
| 1545 | Ga0495636_0101090 | |||
| 1546 | Ga0495674_0007910 | |||
| 1547 | Ga0495674_0231641 | |||
| 1548 | Ga0495676_0119126 | |||
| 1549 | Ga0495680_0014370 | |||
| 1550 | Ga0495680_0076564 | |||
| 1551 | Ga0495677_0006684 | |||
| 1552 | Ga0495684_0021576 | |||
| 1553 | Ga0495684_0091667 | |||
| 1554 | Ga0495684_0182938 | |||
| 1555 | Ga0495602_0049683 | |||
| 1556 | Ga0495602_0166243 | |||
| 1557 | Ga0495602_0319068 | |||
| 1558 | Ga0495615_0004322 | |||
| 1559 | Ga0495626_0123483 | |||
| 1560 | Ga0496100_0188630 | |||
| 1561 | Ga0496100_0238674 | |||
| 1562 | Ga0496101_0037297 | |||
| 1563 | Ga0496101_0047528 | |||
| 1564 | Ga0496101_0058951 | |||
| 1565 | Ga0496102_0071377 | |||
| 1566 | Ga0496102_0073079 | |||
| 1567 | Ga0496102_0097136 | |||
| 1568 | Ga0496102_0124545 | |||
| 1569 | Ga0496102_0141916 | |||
| 1570 | Ga0496102_0392260 | |||
| 1571 | Ga0496102_0675834 | |||
| 1572 | Ga0496103_0058387 | |||
| 1573 | Ga0496103_0160267 | |||
| 1574 | Ga0496104_0022964 | |||
| 1575 | Ga0496104_0024820 | |||
| 1576 | Ga0496104_0060194 | |||
| 1577 | Ga0496104_0060499 | |||
| 1578 | Ga0496104_0088604 | |||
| 1579 | Ga0496104_0379462 | |||
| 1580 | Ga0496105_0008202 | |||
| 1581 | Ga0496105_0020362 | |||
| 1582 | Ga0496105_0157088 | |||
| 1583 | Ga0496105_0157106 | |||
| 1584 | Ga0496105_0300316 | |||
| 1585 | Ga0496106_0064603 | |||
| 1586 | Ga0496106_0112195 | |||
| 1587 | Ga0496106_0113873 | |||
| 1588 | Ga0496107_0010819 | |||
| 1589 | Ga0496107_0079795 | |||
| 1590 | Ga0496107_0172793 | |||
| 1591 | Ga0496107_0194400 | |||
| 1592 | Ga0496108_0020117 | |||
| 1593 | Ga0496108_0023140 | |||
| 1594 | Ga0496108_0052733 | |||
| 1595 | Ga0496108_0053340 | |||
| 1596 | Ga0496108_0063890 | |||
| 1597 | Ga0496109_0004131 | |||
| 1598 | Ga0496109_0005768 | |||
| 1599 | Ga0496109_0014523 | |||
| 1600 | Ga0496109_0046788 | |||
| 1601 | Ga0496109_0082884 | |||
| 1602 | Ga0496109_0365259 | |||
| 1603 | Ga0496109_0664287 | |||
| 1604 | Ga0496110_0003642 | |||
| 1605 | Ga0496110_0006944 | |||
| 1606 | Ga0496110_0028786 | |||
| 1607 | Ga0496110_0055957 | |||
| 1608 | Ga0496110_0063656 | |||
| 1609 | Ga0496110_0099833 | |||
| 1610 | Ga0496110_0263151 | |||
| 1611 | Ga0496110_0328126 | |||
| 1612 | Ga0496111_0004522 | |||
| 1613 | Ga0496111_0025847 | |||
| 1614 | Ga0496111_0044597 | |||
| 1615 | Ga0496111_0047066 | |||
| 1616 | Ga0496111_0088714 | |||
| 1617 | Ga0496111_0095247 | |||
| 1618 | Ga0496112_0001605 | |||
| 1619 | Ga0496112_0003712 | |||
| 1620 | Ga0496112_0022299 | |||
| 1621 | Ga0496112_0051985 | |||
| 1622 | Ga0496112_0182796 | |||
| 1623 | Ga0496112_0193214 | |||
| 1624 | Ga0496112_0254261 | |||
| 1625 | Ga0496112_0290058 | |||
| 1626 | Ga0496112_0652628 | |||
| 1627 | Ga0496113_0017352 | |||
| 1628 | Ga0496113_0043212 | |||
| 1629 | Ga0496113_0065007 | |||
| 1630 | Ga0496113_0069007 | |||
| 1631 | Ga0496113_0078716 | |||
| 1632 | Ga0496113_0102361 | |||
| 1633 | Ga0496113_0177777 | |||
| 1634 | Ga0496113_0209900 | |||
| 1635 | Ga0496114_0007197 | |||
| 1636 | Ga0496114_0039314 | |||
| 1637 | Ga0496114_0144381 | |||
| 1638 | Ga0496115_0059815 | |||
| 1639 | Ga0496115_0098573 | |||
| 1640 | Ga0501034_0012999 | |||
| 1641 | Ga0501040_0277153 | |||
| 1642 | Ga0501043_0240851 | |||
| 1643 | Ga0501067_0001545 | |||
| 1644 | Ga0501067_0002196 | |||
| 1645 | Ga0501067_0020565 | |||
| 1646 | Ga0501067_0031978 | |||
| 1647 | Ga0501068_0230921 | |||
| 1648 | Ga0501069_0002312 | |||
| 1649 | Ga0501069_0025983 | |||
| 1650 | Ga0501069_0123209 | |||
| 1651 | Ga0501070_0010496 | |||
| 1652 | Ga0501071_0636778 | |||
| 1653 | Ga0501072_0253039 | |||
| 1654 | Ga0501073_0053687 | |||
| 1655 | Ga0501074_0016273 | |||
| 1656 | Ga0501079_0182966 | |||
| 1657 | Ga0501080_0001603 | |||
| 1658 | Ga0501081_0214424 | |||
| 1659 | nmdc:mga0yw44_347187_c1 | |||
| 1660 | nmdc:mga05p37_48479_c1 | |||
| 1661 | nmdc:mga05p37_87024_c1 | |||
| 1662 | nmdc:mga09592_107540_c1 | |||
| 1663 | nmdc:mga0qj67_300121_c1 | |||
| 1664 | nmdc:mga06r32_72812_c1 | |||
| 1665 | nmdc:mga08y16_11279_c1 | |||
| 1666 | nmdc:mga08y16_149358_c1 | |||
| 1667 | nmdc:mga08y16_219208_c1 | |||
| 1668 | nmdc:mga08y16_21966_c1 | |||
| 1669 | nmdc:mga08y16_32373_c1 | |||
| 1670 | nmdc:mga08y16_324440_c1 | |||
| 1671 | nmdc:mga08y16_37953_c1 | |||
| 1672 | nmdc:mga0n895_132129_c1 | |||
| 1673 | nmdc:mga0n895_24837_c1 | |||
| 1674 | nmdc:mga0n895_531165_c1 | |||
| 1675 | nmdc:mga0n895_610569_c1 | |||
| 1676 | nmdc:mga0n895_76454_c1 | |||
| 1677 | nmdc:mga0n895_96375_c1 | |||
| 1678 | nmdc:mga0rr50_110784_c1 | |||
| 1679 | nmdc:mga0rr50_5908_c1 | |||
| 1680 | nmdc:mga08x19_138168_c1 | |||
| 1681 | nmdc:mga08x19_14136_c1 | |||
| 1682 | nmdc:mga0a205_26423_c1 | |||
| 1683 | nmdc:mga0a205_361064_c1 | |||
| 1684 | Ga0495601_0007206 | |||
| 1685 | Ga0495601_0092311 | |||
| 1686 | Ga0495655_0013200 | |||
| 1687 | Ga0495595_0030209 | |||
| 1688 | Ga0466962_0007948 | |||
| 1689 | Ga0466962_0067051 | |||
| 1690 | Ga0530510_0204072 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
107
303
0.82
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4jbw-assembly2.cif.gz_I | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.9011 | 15 | 256 |
| 8hpn-assembly1.cif.gz_B | lpqy-sugabc in state 3 | 0.859 | 12 | 259 |
| 2r6g-assembly1.cif.gz_G | the crystal structure of the e. coli maltose transporter | 0.8458 | 15 | 268 |
| 3rlf-assembly1.cif.gz_G | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.841 | 15 | 268 |
| 4jbw-assembly2.cif.gz_H | crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc | 0.8377 | 45 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53483_6_271_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9527 | 12 | 258 | 1.10.3720.10 |
| af_P77716_1_267_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9328 | 15 | 254 | 1.10.3720.10 |
| af_L7N652_1_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9243 | 12 | 258 | 1.10.3720.10 |
| af_I6Y1U3_2_266_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9243 | 12 | 258 | 1.10.3720.10 |
| af_P10906_2_274_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9024 | 15 | 258 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K1DWC6-F1-model_v4 | ABC transporter permease subunit | 0.9641 | 12 | 260 |
GO:0005886
GO:0055085 |
| AF-X1DBW1-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9585 | 12 | 208 |
GO:0005886
GO:0055085 |
| AF-A0A1A2URG5-F1-model_v4 | Sugar ABC transporter permease | 0.9573 | 12 | 253 |
GO:0005886
GO:0055085 |
| AF-A0A7K0MKI9-F1-model_v4 | ABC transporter permease subunit | 0.9557 | 12 | 228 |
GO:0005886
GO:0055085 |
| AF-A0A4Q3YL27-F1-model_v4 | sn-glycerol-3-phosphate transport system permease protein UgpE | 0.9556 | 12 | 220 |
GO:0005886
GO:0055085 |