F483240

General Info

Members Datasets Scaffolds Average Seq Length
845 322 1690 279

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100047286|Ga0070711_1000472862
Length 308
Sequence MTTATAEATAEGPPARAPLVRRKPPAPVRRRRFLIGVANHSVLIFFAVLFLAPFMFIVLTSLMTNQQALSADFWPHPFRWSNFTDVFSKSPFWRWGVNSLIYSSLATLGLLLSSIPVAYALSKLRWRGRDVVFIVVIVALMLPPQVSVIPVYVMWSKLGDALGIHFIGNLSPLIIPNWFGDAFSIFLLRQFFLTIPEEYLDAARVDGCGEFKILATVVPRLAKPAIVAVAIFSILYTFSDFFLPLLYVGDAPNSWTLSIGLSEFRSLHQVQWNLTMAATVLVMLPVIIIFFLAQKAFVEGVTLTGVKG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
170 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
177 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
182 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
185 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
186 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
187 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
190 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
191 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
196 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
197 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
200 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
201 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
204 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
205 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
209 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
210 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
211 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
212 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
213 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
214 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
215 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
216 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
217 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
218 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
219 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
220 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
221 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
222 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
225 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
229 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
230 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
231 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
232 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
233 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
234 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
235 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
236 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
237 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
238 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
239 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
243 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
244 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
245 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
246 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
247 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
248 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
249 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
250 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
251 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
252 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
253 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
262 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
263 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
264 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
265 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
266 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
267 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
268 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
269 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
270 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
276 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
279 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
280 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
281 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
304 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
305 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
306 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
307 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
308 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
313 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
314 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
315 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
316 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
317 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
318 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
319 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.24
Nodule 0
Rhizoplane 9.82
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100047286 3300005439 Bacteria 2937
2 JGI25406J46586_10001832 3300003203 Bacteria 9973
3 JGI25406J46586_10014010 3300003203 Bacteria 3421
4 Ga0070658_10008431 3300005327 Bacteria 8289
5 Ga0070658_10084037 3300005327 Bacteria 2617
6 Ga0070676_10068924 3300005328 Bacteria 2119
7 Ga0070683_100002420 3300005329 Bacteria 14837
8 Ga0070683_100083484 3300005329 Bacteria 2992
9 Ga0070683_100104839 3300005329 Bacteria 2665
10 Ga0070683_100181371 3300005329 Bacteria 1998
11 Ga0070683_100238883 3300005329 Bacteria 1728
12 Ga0070683_100363826 3300005329 Bacteria 1378
13 Ga0070683_100416792 3300005329 Bacteria 1281
14 Ga0070683_100604116 3300005329 Bacteria 1050
15 Ga0070690_100034703 3300005330 Bacteria 3162
16 Ga0070666_10158998 3300005335 Bacteria 1579
17 Ga0070680_100004396 3300005336 Bacteria 10609
18 Ga0070680_100020246 3300005336 Bacteria 5280
19 Ga0070680_100221354 3300005336 Bacteria 1598
20 Ga0070680_100230705 3300005336 Bacteria 1563
21 Ga0070680_100319147 3300005336 Bacteria 1319
22 Ga0070680_100333899 3300005336 Bacteria 1287
23 Ga0070682_100156638 3300005337 Bacteria 1569
24 Ga0068868_100174357 3300005338 Bacteria 1781
25 Ga0070660_100000770 3300005339 Bacteria 21264
26 Ga0070660_100011620 3300005339 Bacteria 6267
27 Ga0070660_100024445 3300005339 Bacteria 4480
28 Ga0070660_100037086 3300005339 Bacteria 3695
29 Ga0070660_100069774 3300005339 Bacteria 2741
30 Ga0070660_100380891 3300005339 Bacteria 1164
31 Ga0070691_10042563 3300005341 Bacteria 2150
32 Ga0070661_100014016 3300005344 Bacteria 5637
33 Ga0070661_100026378 3300005344 Bacteria 4178
34 Ga0070661_100263596 3300005344 Bacteria 1333
35 Ga0070692_10008214 3300005345 Bacteria 4645
36 Ga0070668_100008922 3300005347 Bacteria 7442
37 Ga0070668_100133863 3300005347 Bacteria 1991
38 Ga0070669_100070685 3300005353 Bacteria 2581
39 Ga0070675_100161375 3300005354 Bacteria 1928
40 Ga0070671_100097851 3300005355 Bacteria 2461
41 Ga0070671_100112828 3300005355 Bacteria 2284
42 Ga0070674_100093944 3300005356 Bacteria 2171
43 Ga0070674_100160271 3300005356 Bacteria 1706
44 Ga0070674_100166125 3300005356 Bacteria 1678
45 Ga0070673_100046656 3300005364 Bacteria 3367
46 Ga0070688_100007315 3300005365 Bacteria 5947
47 Ga0070659_100005233 3300005366 Bacteria 9306
48 Ga0070659_100166388 3300005366 Bacteria 1804
49 Ga0070659_100183126 3300005366 Bacteria 1720
50 Ga0070659_100199694 3300005366 Bacteria 1646
51 Ga0070659_100256665 3300005366 Bacteria 1450
52 Ga0070667_100219758 3300005367 Bacteria 1691
53 Ga0070667_100298991 3300005367 Bacteria 1449
54 Ga0070709_10120470 3300005434 Bacteria 1778
55 Ga0070714_100048652 3300005435 Bacteria 3606
56 Ga0070714_100073677 3300005435 Bacteria 2959
57 Ga0070714_100174409 3300005435 Bacteria 1953
58 Ga0070714_100218784 3300005435 Bacteria 1749
59 Ga0070714_100267155 3300005435 Bacteria 1585
60 Ga0070713_100028734 3300005436 Bacteria 4394
61 Ga0070713_100056914 3300005436 Bacteria 3253
62 Ga0070710_10258156 3300005437 Bacteria 1123
63 Ga0070710_10387967 3300005437 Bacteria 933
64 Ga0070711_100003846 3300005439 Bacteria 8812
65 Ga0070711_100030939 3300005439 Bacteria 3549
66 Ga0070705_100004640 3300005440 Bacteria 6691
67 Ga0070700_100000794 3300005441 Bacteria 15506
68 Ga0070700_100005756 3300005441 Bacteria 6577
69 Ga0070694_100006557 3300005444 Bacteria 7071
70 Ga0070694_100144727 3300005444 Bacteria 1730
71 Ga0070708_100003130 3300005445 Bacteria 12880
72 Ga0070663_100226884 3300005455 Bacteria 1469
73 Ga0070678_100042479 3300005456 Bacteria 3231
74 Ga0070678_100433884 3300005456 Bacteria 1148
75 Ga0070681_10001129 3300005458 Bacteria 22933
76 Ga0070681_10011904 3300005458 Bacteria 8626
77 Ga0070681_10014817 3300005458 Bacteria 7754
78 Ga0070681_10021437 3300005458 Bacteria 6479
79 Ga0070681_10070369 3300005458 Bacteria 3464
80 Ga0070681_10153591 3300005458 Bacteria 2227
81 Ga0068867_100044955 3300005459 Bacteria 3237
82 Ga0068867_100092962 3300005459 Bacteria 2291
83 Ga0068867_100106640 3300005459 Bacteria 2147
84 Ga0068867_100144497 3300005459 Bacteria 1863
85 Ga0068867_100193944 3300005459 Bacteria 1622
86 Ga0070685_10001659 3300005466 Bacteria 11702
87 Ga0070706_100002074 3300005467 Bacteria 20447
88 Ga0070706_100341685 3300005467 Bacteria 1396
89 Ga0070707_100005619 3300005468 Bacteria 11722
90 Ga0070698_100030900 3300005471 Bacteria 5554
91 Ga0070699_100002657 3300005518 Bacteria 15965
92 Ga0070699_100039172 3300005518 Bacteria 4104
93 Ga0070679_100010930 3300005530 Bacteria 8626
94 Ga0070679_100013896 3300005530 Bacteria 7714
95 Ga0070679_100023167 3300005530 Bacteria 6076
96 Ga0070679_100073580 3300005530 Bacteria 3408
97 Ga0070679_100163648 3300005530 Bacteria 2198
98 Ga0070679_100286358 3300005530 Bacteria 1599
99 Ga0070679_100380820 3300005530 Bacteria 1358
100 Ga0070684_100011742 3300005535 Bacteria 6986
101 Ga0070684_100106364 3300005535 Bacteria 2511
102 Ga0070684_100316754 3300005535 Bacteria 1433
103 Ga0070684_100368380 3300005535 Bacteria 1323
104 Ga0070672_100022209 3300005543 Bacteria 4655
105 Ga0070672_100067021 3300005543 Bacteria 2844
106 Ga0070672_100222329 3300005543 Bacteria 1584
107 Ga0070686_100003788 3300005544 Bacteria 8320
108 Ga0070686_100010694 3300005544 Bacteria 5187
109 Ga0070686_100127113 3300005544 Bacteria 1758
110 Ga0070686_100243771 3300005544 Bacteria 1310
111 Ga0070695_100008132 3300005545 Bacteria 6216
112 Ga0070696_100032230 3300005546 Bacteria 3595
113 Ga0070696_100136607 3300005546 Bacteria 1788
114 Ga0070696_100341798 3300005546 Bacteria 1157
115 Ga0070665_100017089 3300005548 Bacteria 7277
116 Ga0070665_100122039 3300005548 Bacteria 2607
117 Ga0068855_100016898 3300005563 Bacteria 8775
118 Ga0068855_100026525 3300005563 Bacteria 6931
119 Ga0068855_100064288 3300005563 Bacteria 4279
120 Ga0068855_100083857 3300005563 Bacteria 3692
121 Ga0068855_100168778 3300005563 Bacteria 2479
122 Ga0068855_100207692 3300005563 Bacteria 2202
123 Ga0068855_100383358 3300005563 Bacteria 1543
124 Ga0068857_100022389 3300005577 Bacteria 5559
125 Ga0068854_100016749 3300005578 Bacteria 4891
126 Ga0068856_100217965 3300005614 Bacteria 1923
127 Ga0068856_100302352 3300005614 Bacteria 1617
128 Ga0070702_100007834 3300005615 Bacteria 5136
129 Ga0070702_100043046 3300005615 Bacteria 2542
130 Ga0070702_100150196 3300005615 Bacteria 1494
131 Ga0068852_100054346 3300005616 Bacteria 3451
132 Ga0068852_100263876 3300005616 Bacteria 1654
133 Ga0068852_100298368 3300005616 Bacteria 1559
134 Ga0068859_100380480 3300005617 Bacteria 1507
135 Ga0068866_10001477 3300005718 Bacteria 10015
136 Ga0068866_10217522 3300005718 Bacteria 1151
137 Ga0068861_100066250 3300005719 Bacteria 2784
138 Ga0068861_100084175 3300005719 Bacteria 2497
139 Ga0068861_100087041 3300005719 Bacteria 2457
140 Ga0068861_100140308 3300005719 Bacteria 1972
141 Ga0068870_10007137 3300005840 Bacteria 4969
142 Ga0068870_10074055 3300005840 Bacteria 1865
143 Ga0068858_100048669 3300005842 Bacteria 3926
144 Ga0068858_100269930 3300005842 Bacteria 1619
145 Ga0068860_100051952 3300005843 Bacteria 3899
146 Ga0068860_100131640 3300005843 Bacteria 2401
147 Ga0068862_100073795 3300005844 Bacteria 2949
148 Ga0081455_10031698 3300005937 Bacteria 4776
149 Ga0081455_10059896 3300005937 Bacteria 3212
150 Ga0081455_10117197 3300005937 Bacteria 2105
151 Ga0081455_10122145 3300005937 Bacteria 2051
152 Ga0081455_10206413 3300005937 Bacteria 1467
153 Ga0081455_10279167 3300005937 Bacteria 1207
154 Ga0081540_1004573 3300005983 Bacteria 10479
155 Ga0081540_1009927 3300005983 Bacteria 6492
156 Ga0081540_1013732 3300005983 Bacteria 5249
157 Ga0081540_1083758 3300005983 Bacteria 1425
158 Ga0081539_10000171 3300005985 Bacteria 152572
159 Ga0081539_10000599 3300005985 Bacteria 73432
160 Ga0081539_10001044 3300005985 Bacteria 50691
161 Ga0081539_10002263 3300005985 Bacteria 27975
162 Ga0081539_10007528 3300005985 Bacteria 9869
163 Ga0070717_10013308 3300006028 Bacteria 6300
164 Ga0070717_10023875 3300006028 Bacteria 4851
165 Ga0070717_10224313 3300006028 Bacteria 1653
166 Ga0075365_10064645 3300006038 Bacteria 2451
167 Ga0075432_10016943 3300006058 Bacteria 2487
168 Ga0075432_10044126 3300006058 Bacteria 1563
169 Ga0070715_10003385 3300006163 Bacteria 5057
170 Ga0070716_100100965 3300006173 Bacteria 1768
171 Ga0070712_100024354 3300006175 Bacteria 4010
172 Ga0070712_100036082 3300006175 Bacteria 3361
173 Ga0070712_100298236 3300006175 Bacteria 1304
174 Ga0097621_100013143 3300006237 Bacteria 6158
175 Ga0097621_100507560 3300006237 Bacteria 1093
176 Ga0068871_100043994 3300006358 Bacteria 3589
177 Ga0075428_100045891 3300006844 Bacteria 4800
178 Ga0075428_100227056 3300006844 Bacteria 2015
179 Ga0075431_100010688 3300006847 Bacteria 9223
180 Ga0075431_100132697 3300006847 Bacteria 2568
181 Ga0075433_10066369 3300006852 Bacteria 3166
182 Ga0075434_100019457 3300006871 Bacteria 6572
183 Ga0075434_100220040 3300006871 Bacteria 1918
184 Ga0075429_100268360 3300006880 Bacteria 1494
185 Ga0068865_100135514 3300006881 Bacteria 1850
186 Ga0068865_100210968 3300006881 Bacteria 1513
187 Ga0097620_100380460 3300006931 Bacteria 1507
188 Ga0075435_100076760 3300007076 Bacteria 2738
189 Ga0111539_10004337 3300009094 Bacteria 18563
190 Ga0111539_10006713 3300009094 Bacteria 14817
191 Ga0111539_10011536 3300009094 Bacteria 11088
192 Ga0111539_10024559 3300009094 Bacteria 7393
193 Ga0111539_10072897 3300009094 Bacteria 4049
194 Ga0111539_10407900 3300009094 Bacteria 1583
195 Ga0105245_10004691 3300009098 Bacteria 12082
196 Ga0105245_10015878 3300009098 Bacteria 6561
197 Ga0105245_10096890 3300009098 Bacteria 2723
198 Ga0105245_10206787 3300009098 Bacteria 1887
199 Ga0105245_10220077 3300009098 Bacteria 1831
200 Ga0105247_10289026 3300009101 Bacteria 1133
201 Ga0114129_10007588 3300009147 Bacteria 15442
202 Ga0114129_10110556 3300009147 Bacteria 3793
203 Ga0105243_10002631 3300009148 Bacteria 14925
204 Ga0105243_10083632 3300009148 Bacteria 2611
205 Ga0105243_10189962 3300009148 Bacteria 1793
206 Ga0105243_10330077 3300009148 Bacteria 1393
207 Ga0105241_10120178 3300009174 Bacteria 2114
208 Ga0105241_10153700 3300009174 Bacteria 1885
209 Ga0105242_10496654 3300009176 Bacteria 1160
210 Ga0105242_10641589 3300009176 Bacteria 1031
211 Ga0105248_10131898 3300009177 Bacteria 2819
212 Ga0105248_10146102 3300009177 Bacteria 2668
213 Ga0105248_10171402 3300009177 Bacteria 2446
214 Ga0105248_10603275 3300009177 Bacteria 1239
215 Ga0105248_10790083 3300009177 Bacteria 1071
216 Ga0105237_10026571 3300009545 Bacteria 5916
217 Ga0105237_10175500 3300009545 Bacteria 2143
218 Ga0105237_10177379 3300009545 Bacteria 2131
219 Ga0105237_10252625 3300009545 Bacteria 1765
220 Ga0105238_10360531 3300009551 Bacteria 1443
221 Ga0105238_10657223 3300009551 Bacteria 1059
222 Ga0105249_10034628 3300009553 Bacteria 4577
223 Ga0105249_10063431 3300009553 Bacteria 3395
224 Ga0105249_10092313 3300009553 Bacteria 2834
225 Ga0105249_10121569 3300009553 Bacteria 2482
226 Ga0105249_10257113 3300009553 Bacteria 1734
227 Ga0105239_10010075 3300010375 Bacteria 10594
228 Ga0105239_10020559 3300010375 Bacteria 7282
229 Ga0105239_10279707 3300010375 Bacteria 1878
230 Ga0105239_10368264 3300010375 Bacteria 1624
231 Ga0105239_10476976 3300010375 Bacteria 1417
232 Ga0105246_10002634 3300011119 Bacteria 10866
233 Ga0105246_10011385 3300011119 Bacteria 5522
234 Ga0105246_10253463 3300011119 Bacteria 1398
235 Ga0105246_10448057 3300011119 Bacteria 1084
236 Ga0157373_10011332 3300013100 Bacteria 6556
237 Ga0157370_10017041 3300013104 Bacteria 7342
238 Ga0157369_10012087 3300013105 Bacteria 9802
239 Ga0157369_10014522 3300013105 Bacteria 8886
240 Ga0157369_10016084 3300013105 Bacteria 8418
241 Ga0157369_10116687 3300013105 Bacteria 2834
242 Ga0157369_10182901 3300013105 Bacteria 2205
243 Ga0157374_10013221 3300013296 Bacteria 7200
244 Ga0157374_10042769 3300013296 Bacteria 4181
245 Ga0157378_10022794 3300013297 Bacteria 5512
246 Ga0157378_10394093 3300013297 Bacteria 1363
247 Ga0157378_10406167 3300013297 Bacteria 1343
248 Ga0157378_10585056 3300013297 Bacteria 1126
249 Ga0163162_10000727 3300013306 Bacteria 30540
250 Ga0163162_10059208 3300013306 Bacteria 3862
251 Ga0163162_10196269 3300013306 Bacteria 2147
252 Ga0157372_10071822 3300013307 Bacteria 3899
253 Ga0157372_10107265 3300013307 Bacteria 3196
254 Ga0157372_10452250 3300013307 Bacteria 1497
255 Ga0157372_10582716 3300013307 Bacteria 1304
256 Ga0157372_10754279 3300013307 Bacteria 1131
257 Ga0157375_10004690 3300013308 Bacteria 11892
258 Ga0157375_10020575 3300013308 Bacteria 6031
259 Ga0157375_10050206 3300013308 Bacteria 4091
260 Ga0157375_10234816 3300013308 Bacteria 1993
261 Ga0157375_10564637 3300013308 Bacteria 1299
262 Ga0163163_10064167 3300014325 Bacteria 3644
263 Ga0163163_10115837 3300014325 Bacteria 2711
264 Ga0163163_10740487 3300014325 Bacteria 1046
265 Ga0157380_10023482 3300014326 Bacteria 4651
266 Ga0157380_10083186 3300014326 Bacteria 2621
267 Ga0157380_10352711 3300014326 Bacteria 1377
268 Ga0157380_10456147 3300014326 Bacteria 1229
269 Ga0182008_10008697 3300014497 Bacteria 5522
270 Ga0157377_10000397 3300014745 Bacteria 18835
271 Ga0157377_10057739 3300014745 Bacteria 2208
272 Ga0157379_10073145 3300014968 Bacteria 3068
273 Ga0157379_10670188 3300014968 Bacteria 972
274 Ga0157376_10473361 3300014969 Bacteria 1226
275 Ga0182006_1014567 3300015261 Bacteria 3386
276 Ga0163161_10178856 3300017792 Bacteria 1625
277 Ga0197907_10808555 3300020069 Bacteria 1012
278 Ga0206356_10063198 3300020070 Bacteria 1869
279 Ga0206354_10930277 3300020081 Bacteria 1110
280 Ga0206354_11001608 3300020081 Bacteria 1036
281 Ga0206353_11446920 3300020082 Bacteria 4207
282 Ga0207653_10021129 3300025885 Bacteria 2064
283 Ga0207692_10157062 3300025898 Bacteria 1308
284 Ga0207692_10174634 3300025898 Bacteria 1248
285 Ga0207642_10002810 3300025899 Bacteria 5431
286 Ga0207642_10153862 3300025899 Bacteria 1227
287 Ga0207688_10023433 3300025901 Bacteria 3380
288 Ga0207688_10034346 3300025901 Bacteria 2808
289 Ga0207688_10268335 3300025901 Bacteria 1037
290 Ga0207685_10108594 3300025905 Bacteria 1199
291 Ga0207699_10063328 3300025906 Bacteria 2233
292 Ga0207699_10073048 3300025906 Bacteria 2103
293 Ga0207699_10250010 3300025906 Bacteria 1221
294 Ga0207643_10003011 3300025908 Bacteria 9085
295 Ga0207643_10011792 3300025908 Bacteria 4717
296 Ga0207705_10010634 3300025909 Bacteria 6684
297 Ga0207705_10020310 3300025909 Bacteria 4749
298 Ga0207705_10138742 3300025909 Bacteria 1814
299 Ga0207684_10023508 3300025910 Bacteria 5263
300 Ga0207684_10224485 3300025910 Bacteria 1621
301 Ga0207684_10397640 3300025910 Bacteria 1185
302 Ga0207707_10008550 3300025912 Bacteria 8875
303 Ga0207707_10008778 3300025912 Bacteria 8771
304 Ga0207707_10040674 3300025912 Bacteria 4060
305 Ga0207707_10087625 3300025912 Bacteria 2720
306 Ga0207695_10186005 3300025913 Bacteria 1996
307 Ga0207695_10236293 3300025913 Bacteria 1730
308 Ga0207695_10353740 3300025913 Bacteria 1356
309 Ga0207671_10141963 3300025914 Bacteria 1851
310 Ga0207693_10000347 3300025915 Bacteria 42728
311 Ga0207693_10087510 3300025915 Bacteria 2441
312 Ga0207660_10003765 3300025917 Bacteria 9879
313 Ga0207660_10044988 3300025917 Bacteria 3108
314 Ga0207660_10155231 3300025917 Bacteria 1761
315 Ga0207660_10292052 3300025917 Bacteria 1296
316 Ga0207657_10000319 3300025919 Bacteria 51044
317 Ga0207657_10000416 3300025919 Bacteria 45222
318 Ga0207657_10001085 3300025919 Bacteria 28819
319 Ga0207657_10011244 3300025919 Bacteria 8893
320 Ga0207657_10019514 3300025919 Bacteria 6435
321 Ga0207657_10021028 3300025919 Bacteria 6152
322 Ga0207657_10087191 3300025919 Bacteria 2611
323 Ga0207649_10059815 3300025920 Bacteria 2392
324 Ga0207652_10016020 3300025921 Bacteria 6112
325 Ga0207652_10052239 3300025921 Bacteria 3507
326 Ga0207652_10066938 3300025921 Bacteria 3114
327 Ga0207652_10086342 3300025921 Bacteria 2751
328 Ga0207652_10137774 3300025921 Bacteria 2180
329 Ga0207652_10198568 3300025921 Bacteria 1805
330 Ga0207652_10372048 3300025921 Bacteria 1290
331 Ga0207652_10390792 3300025921 Bacteria 1255
332 Ga0207646_10014823 3300025922 Bacteria 7385
333 Ga0207646_10590868 3300025922 Bacteria 997
334 Ga0207681_10523125 3300025923 Bacteria 974
335 Ga0207687_10023008 3300025927 Bacteria 4150
336 Ga0207687_10064274 3300025927 Bacteria 2601
337 Ga0207687_10071146 3300025927 Bacteria 2485
338 Ga0207700_10000004 3300025928 Bacteria 443409
339 Ga0207700_10109810 3300025928 Bacteria 2217
340 Ga0207664_10004622 3300025929 Bacteria 9335
341 Ga0207664_10046674 3300025929 Bacteria 3401
342 Ga0207664_10152679 3300025929 Bacteria 1963
343 Ga0207664_10267244 3300025929 Bacteria 1497
344 Ga0207664_10429836 3300025929 Bacteria 1177
345 Ga0207644_10315986 3300025931 Bacteria 1262
346 Ga0207690_10111663 3300025932 Bacteria 1970
347 Ga0207690_10266865 3300025932 Bacteria 1328
348 Ga0207706_10022500 3300025933 Bacteria 5656
349 Ga0207706_10213428 3300025933 Bacteria 1691
350 Ga0207686_10005993 3300025934 Bacteria 6524
351 Ga0207686_10394806 3300025934 Bacteria 1052
352 Ga0207709_10001627 3300025935 Bacteria 15281
353 Ga0207709_10052675 3300025935 Bacteria 2501
354 Ga0207709_10060392 3300025935 Bacteria 2363
355 Ga0207669_10002197 3300025937 Bacteria 8290
356 Ga0207669_10050770 3300025937 Bacteria 2482
357 Ga0207669_10185451 3300025937 Bacteria 1496
358 Ga0207669_10291037 3300025937 Bacteria 1237
359 Ga0207704_10096970 3300025938 Bacteria 1954
360 Ga0207704_10194509 3300025938 Bacteria 1478
361 Ga0207704_10253029 3300025938 Bacteria 1323
362 Ga0207665_10099394 3300025939 Bacteria 2029
363 Ga0207691_10022775 3300025940 Bacteria 5906
364 Ga0207689_10038149 3300025942 Bacteria 3981
365 Ga0207661_10025532 3300025944 Bacteria 4492
366 Ga0207661_10027782 3300025944 Bacteria 4326
367 Ga0207661_10115531 3300025944 Bacteria 2277
368 Ga0207661_10207847 3300025944 Bacteria 1724
369 Ga0207661_10246698 3300025944 Bacteria 1586
370 Ga0207679_10114516 3300025945 Bacteria 2135
371 Ga0207679_10334653 3300025945 Bacteria 1315
372 Ga0207667_10054323 3300025949 Bacteria 4213
373 Ga0207667_10125085 3300025949 Bacteria 2648
374 Ga0207667_10221788 3300025949 Bacteria 1937
375 Ga0207667_10298543 3300025949 Bacteria 1646
376 Ga0207667_10390631 3300025949 Bacteria 1417
377 Ga0207651_10044454 3300025960 Bacteria 2973
378 Ga0207712_10007054 3300025961 Bacteria 7088
379 Ga0207712_10034038 3300025961 Bacteria 3449
380 Ga0207668_10028482 3300025972 Bacteria 3653
381 Ga0207668_10054453 3300025972 Bacteria 2777
382 Ga0207668_10129837 3300025972 Bacteria 1923
383 Ga0207640_10338395 3300025981 Bacteria 1204
384 Ga0207640_10462078 3300025981 Bacteria 1049
385 Ga0207658_10345856 3300025986 Bacteria 1294
386 Ga0207677_10261861 3300026023 Bacteria 1410
387 Ga0207639_10220745 3300026041 Bacteria 1637
388 Ga0207678_10036097 3300026067 Bacteria 4302
389 Ga0207678_10108182 3300026067 Bacteria 2372
390 Ga0207678_10108285 3300026067 Bacteria 2371
391 Ga0207678_10248558 3300026067 Bacteria 1523
392 Ga0207678_10257717 3300026067 Bacteria 1494
393 Ga0207678_10433683 3300026067 Bacteria 1141
394 Ga0207708_10001000 3300026075 Bacteria 21172
395 Ga0207708_10014047 3300026075 Bacteria 5983
396 Ga0207708_10092177 3300026075 Bacteria 2337
397 Ga0207702_10061850 3300026078 Bacteria 3195
398 Ga0207702_10113624 3300026078 Bacteria 2412
399 Ga0207702_10265782 3300026078 Bacteria 1617
400 Ga0207641_10405002 3300026088 Bacteria 1311
401 Ga0207648_10000191 3300026089 Bacteria 64436
402 Ga0207648_10018603 3300026089 Bacteria 6287
403 Ga0207648_10205050 3300026089 Bacteria 1750
404 Ga0207648_10236209 3300026089 Bacteria 1627
405 Ga0207674_10010377 3300026116 Bacteria 10555
406 Ga0207674_10031297 3300026116 Bacteria 5590
407 Ga0207674_10154580 3300026116 Bacteria 2249
408 Ga0207674_10252546 3300026116 Bacteria 1710
409 Ga0207674_10294180 3300026116 Bacteria 1572
410 Ga0207675_100002866 3300026118 Bacteria 16968
411 Ga0207675_100007801 3300026118 Bacteria 10098
412 Ga0207675_100077713 3300026118 Bacteria 3110
413 Ga0207683_10005339 3300026121 Bacteria 11024
414 Ga0207683_10009882 3300026121 Bacteria 8136
415 Ga0207683_10108659 3300026121 Bacteria 2482
416 Ga0207698_10037000 3300026142 Bacteria 3590
417 Ga0209998_10023854 3300027717 Bacteria 1325
418 Ga0207428_10001543 3300027907 Bacteria 24104
419 Ga0207428_10025320 3300027907 Bacteria 4966
420 Ga0207428_10056799 3300027907 Bacteria 3109
421 Ga0207428_10196088 3300027907 Bacteria 1521
422 Ga0268266_10135972 3300028379 Bacteria 2202
423 Ga0268266_10141656 3300028379 Bacteria 2158
424 Ga0268265_10074221 3300028380 Bacteria 2660
425 Ga0268264_10096869 3300028381 Bacteria 2556
426 Ga0265337_1009232 3300028556 Bacteria 3534
427 Ga0265338_10004154 3300028800 Bacteria 19785
428 Ga0265338_10038872 3300028800 Bacteria 4499
429 Ga0265338_10172758 3300028800 Bacteria 1655
430 Ga0265320_10017109 3300031240 Bacteria 4038
431 Ga0265339_10011110 3300031249 Bacteria 5559
432 Ga0265331_10045085 3300031250 Bacteria 2129
433 Ga0265327_10018798 3300031251 Bacteria 4270
434 Ga0265316_10095404 3300031344 Bacteria 2265
435 Ga0307408_100181473 3300031548 Bacteria 1688
436 Ga0265313_10050377 3300031595 Bacteria 1998
437 Ga0265313_10063519 3300031595 Bacteria 1721
438 Ga0265314_10091205 3300031711 Bacteria 1983
439 Ga0265342_10019172 3300031712 Bacteria 4413
440 Ga0307405_10048894 3300031731 Bacteria 2611
441 Ga0307405_10278822 3300031731 Bacteria 1257
442 Ga0307410_10043423 3300031852 Bacteria 2979
443 Ga0307410_10141104 3300031852 Bacteria 1783
444 Ga0307406_10004278 3300031901 Bacteria 7769
445 Ga0307406_10047851 3300031901 Bacteria 2697
446 Ga0307406_10177701 3300031901 Bacteria 1547
447 Ga0307407_10069508 3300031903 Bacteria 2090
448 Ga0307407_10328968 3300031903 Bacteria 1075
449 Ga0307409_100023790 3300031995 Bacteria 4255
450 Ga0307409_100024413 3300031995 Bacteria 4216
451 Ga0307409_100077172 3300031995 Bacteria 2675
452 Ga0307409_100407852 3300031995 Bacteria 1300
453 Ga0307416_100024830 3300032002 Bacteria 4382
454 Ga0307416_100048872 3300032002 Bacteria 3359
455 Ga0307416_100052647 3300032002 Bacteria 3261
456 Ga0307411_10027835 3300032005 Bacteria 3427
457 Ga0307415_100002779 3300032126 Bacteria 8762
458 Ga0307415_100008265 3300032126 Bacteria 5759
459 Ga0307415_100011040 3300032126 Bacteria 5147
460 Ga0373936_0065054 3300035113 Bacteria 1495
461 Ga0373941_0021420 3300035115 Bacteria 1824
462 Ga0373945_0016417 3300035116 Bacteria 2497
463 Ga0373945_0055529 3300035116 Bacteria 1467
464 Ga0373960_0014406 3300035121 Bacteria 2003
465 Ga0373943_0015187 3300035170 Bacteria 3495
466 Ga0373946_0032563 3300035171 Bacteria 2094
467 Ga0373955_0043435 3300035172 Bacteria 2418
468 Ga0373931_0030581 3300035691 Bacteria 2773
469 Ga0373947_0004583 3300035725 Bacteria 8111
470 Ga0373947_0156257 3300035725 Bacteria 1472
471 Ga0373937_0010608 3300036401 Bacteria 8050
472 Ga0373925_0008549 3300037068 Bacteria 7460
473 Ga0395899_0001266 3300037312 Bacteria 21971
474 Ga0395899_0003558 3300037312 Bacteria 12338
475 Ga0395899_0004161 3300037312 Bacteria 11365
476 Ga0395899_0004681 3300037312 Bacteria 10678
477 Ga0395899_0007083 3300037312 Bacteria 8679
478 Ga0395899_0011255 3300037312 Bacteria 6854
479 Ga0395899_0016475 3300037312 Bacteria 5636
480 Ga0395899_0021751 3300037312 Bacteria 4865
481 Ga0395899_0066605 3300037312 Bacteria 2644
482 Ga0395899_0080894 3300037312 Bacteria 2364
483 Ga0395899_0096631 3300037312 Bacteria 2136
484 Ga0395899_0111703 3300037312 Bacteria 1964
485 Ga0395899_0125560 3300037312 Bacteria 1835
486 Ga0395900_0001348 3300037418 Bacteria 29694
487 Ga0395900_0002880 3300037418 Bacteria 18747
488 Ga0395900_0005507 3300037418 Bacteria 13251
489 Ga0395900_0007933 3300037418 Bacteria 10927
490 Ga0395900_0008749 3300037418 Bacteria 10399
491 Ga0395900_0009564 3300037418 Bacteria 9939
492 Ga0395900_0009887 3300037418 Bacteria 9769
493 Ga0395900_0037178 3300037418 Bacteria 5021
494 Ga0395900_0055428 3300037418 Bacteria 4082
495 Ga0395900_0097511 3300037418 Bacteria 3020
496 Ga0395900_0115405 3300037418 Bacteria 2755
497 Ga0395900_0117300 3300037418 Bacteria 2731
498 Ga0395900_0142794 3300037418 Bacteria 2450
499 Ga0395900_0193733 3300037418 Bacteria 2060
500 Ga0395900_0220007 3300037418 Bacteria 1914
501 Ga0395900_0276919 3300037418 Bacteria 1671
502 Ga0395900_0338834 3300037418 Bacteria 1480
503 Ga0395900_0526291 3300037418 Bacteria 1129
504 Ga0395900_0604304 3300037418 Bacteria 1037
505 Ga0395898_0002653 3300037466 Bacteria 20795
506 Ga0395898_0004125 3300037466 Bacteria 15933
507 Ga0395898_0005273 3300037466 Bacteria 13973
508 Ga0395898_0007310 3300037466 Bacteria 11724
509 Ga0395898_0024274 3300037466 Bacteria 6115
510 Ga0395898_0025891 3300037466 Bacteria 5906
511 Ga0395898_0027148 3300037466 Bacteria 5750
512 Ga0395898_0030119 3300037466 Bacteria 5432
513 Ga0395898_0057405 3300037466 Bacteria 3793
514 Ga0395898_0064574 3300037466 Bacteria 3550
515 Ga0395898_0066706 3300037466 Bacteria 3485
516 Ga0395898_0093743 3300037466 Bacteria 2885
517 Ga0395898_0097865 3300037466 Bacteria 2817
518 Ga0395898_0100736 3300037466 Bacteria 2774
519 Ga0395898_0229843 3300037466 Bacteria 1769
520 Ga0395898_0229911 3300037466 Bacteria 1769
521 Ga0395898_0230948 3300037466 Bacteria 1764
522 Ga0395898_0243197 3300037466 Bacteria 1716
523 Ga0395898_0391429 3300037466 Bacteria 1325
524 Ga0395898_0446584 3300037466 Bacteria 1232
525 Ga0395905_0001663 3300037471 Bacteria 26274
526 Ga0395905_0003200 3300037471 Bacteria 17633
527 Ga0395905_0003387 3300037471 Bacteria 17074
528 Ga0395905_0007458 3300037471 Bacteria 10877
529 Ga0395905_0010757 3300037471 Bacteria 8871
530 Ga0395905_0026203 3300037471 Bacteria 5498
531 Ga0395905_0027536 3300037471 Bacteria 5360
532 Ga0395905_0045804 3300037471 Bacteria 4103
533 Ga0395905_0049383 3300037471 Bacteria 3942
534 Ga0395905_0053766 3300037471 Bacteria 3768
535 Ga0395905_0064123 3300037471 Bacteria 3437
536 Ga0395905_0072686 3300037471 Bacteria 3224
537 Ga0395905_0093956 3300037471 Bacteria 2813
538 Ga0395905_0104855 3300037471 Bacteria 2654
539 Ga0395905_0106646 3300037471 Bacteria 2630
540 Ga0395905_0184394 3300037471 Bacteria 1959
541 Ga0395905_0188297 3300037471 Bacteria 1937
542 Ga0395905_0276685 3300037471 Bacteria 1564
543 Ga0395905_0394312 3300037471 Bacteria 1279
544 Ga0395905_0425004 3300037471 Bacteria 1225
545 Ga0395901_0000586 3300038443 Bacteria 42347
546 Ga0395901_0003540 3300038443 Bacteria 15740
547 Ga0395901_0003604 3300038443 Bacteria 15622
548 Ga0395901_0006305 3300038443 Bacteria 12015
549 Ga0395901_0007207 3300038443 Bacteria 11214
550 Ga0395901_0009439 3300038443 Bacteria 9898
551 Ga0395901_0009719 3300038443 Bacteria 9753
552 Ga0395901_0009868 3300038443 Bacteria 9675
553 Ga0395901_0023204 3300038443 Bacteria 6360
554 Ga0395901_0032949 3300038443 Bacteria 5345
555 Ga0395901_0047176 3300038443 Bacteria 4473
556 Ga0395901_0068533 3300038443 Bacteria 3696
557 Ga0395901_0084404 3300038443 Bacteria 3319
558 Ga0395901_0111912 3300038443 Bacteria 2867
559 Ga0395901_0147819 3300038443 Bacteria 2469
560 Ga0395901_0170941 3300038443 Bacteria 2280
561 Ga0395901_0208442 3300038443 Bacteria 2046
562 Ga0395901_0217540 3300038443 Bacteria 1997
563 Ga0395901_0221824 3300038443 Bacteria 1976
564 Ga0395901_0225647 3300038443 Bacteria 1957
565 Ga0395901_0231833 3300038443 Bacteria 1927
566 Ga0395901_0254347 3300038443 Bacteria 1829
567 Ga0395901_0370669 3300038443 Bacteria 1475
568 Ga0395901_0417923 3300038443 Bacteria 1375
569 Ga0395901_0600554 3300038443 Bacteria 1110
570 Ga0436365_0699127 3300039437 Bacteria 1044
571 Ga0436365_0827282 3300039437 Bacteria 3905
572 Ga0439438_036318 3300041405 Bacteria 1292
573 Ga0451800_0905413 3300041459 Bacteria 2255
574 Ga0451802_0273766 3300041460 Bacteria 1471
575 Ga0451804_0328232 3300041463 Bacteria 2161
576 Ga0451833_1219700 3300041491 Bacteria 1752
577 Ga0451855_0246350 3300041511 Bacteria 2193
578 Ga0439450_045267 3300042008 Bacteria 1033
579 Ga0450902_017588 3300042137 Bacteria 1169
580 Ga0439446_0016294 3300042156 Bacteria 2069
581 Ga0439434_0006961 3300042435 Bacteria 3304
582 Ga0466965_0055070 3300044683 Bacteria 1979
583 Ga0466966_0072596 3300044684 Bacteria 2154
584 Ga0466961_0009296 3300044693 Bacteria 6258
585 Ga0466961_0024352 3300044693 Bacteria 3894
586 Ga0466961_0107049 3300044693 Bacteria 1760
587 Ga0466963_0014601 3300044694 Bacteria 4847
588 Ga0466963_0019939 3300044694 Bacteria 4213
589 Ga0466963_0030139 3300044694 Bacteria 3498
590 Ga0466963_0168380 3300044694 Bacteria 1527
591 Ga0466963_0203887 3300044694 Bacteria 1383
592 Ga0466963_0448504 3300044694 Bacteria 910
593 Ga0466964_0036685 3300044706 Bacteria 1967
594 Ga0466964_0052804 3300044706 Bacteria 1671
595 Ga0466964_0085332 3300044706 Bacteria 1363
596 Ga0466971_0004028 3300044719 Bacteria 6322
597 Ga0466970_0247306 3300044765 Bacteria 999
598 Ga0466957_0085726 3300044842 Bacteria 1967
599 Ga0466957_0099516 3300044842 Bacteria 1831
600 Ga0466957_0283285 3300044842 Bacteria 1110
601 Ga0466960_0070111 3300044901 Bacteria 1743
602 Ga0466959_0081856 3300045049 Bacteria 2326
603 Ga0466959_0201253 3300045049 Bacteria 1386
604 Ga0466959_0203940 3300045049 Bacteria 1376
605 Ga0451576_0113890 3300045051 Bacteria 2815
606 Ga0451576_0247879 3300045051 Bacteria 1861
607 Ga0466958_0011177 3300045836 Bacteria 5050
608 Ga0466958_0091634 3300045836 Bacteria 1882
609 Ga0466958_0094708 3300045836 Bacteria 1850
610 Ga0466967_0002495 3300045976 Bacteria 11488
611 Ga0466967_0006058 3300045976 Bacteria 8500
612 Ga0466967_0006201 3300045976 Bacteria 8424
613 Ga0466967_0011534 3300045976 Bacteria 6702
614 Ga0466967_0017574 3300045976 Bacteria 5684
615 Ga0466967_0029145 3300045976 Bacteria 4616
616 Ga0466967_0029275 3300045976 Bacteria 4607
617 Ga0466967_0031632 3300045976 Bacteria 4457
618 Ga0466967_0046836 3300045976 Bacteria 3767
619 Ga0466967_0050336 3300045976 Bacteria 3647
620 Ga0466967_0051287 3300045976 Bacteria 3615
621 Ga0466967_0061999 3300045976 Bacteria 3318
622 Ga0466967_0062376 3300045976 Bacteria 3308
623 Ga0466967_0078979 3300045976 Bacteria 2965
624 Ga0466967_0111641 3300045976 Bacteria 2512
625 Ga0466967_0127505 3300045976 Bacteria 2358
626 Ga0466967_0137643 3300045976 Bacteria 2272
627 Ga0466967_0221326 3300045976 Bacteria 1799
628 Ga0466967_0227390 3300045976 Bacteria 1775
629 Ga0495603_0013786 3300046455 Bacteria 4891
630 Ga0495603_0077999 3300046455 Bacteria 1943
631 Ga0495629_0155020 3300046459 Bacteria 1592
632 Ga0495641_0013421 3300046461 Bacteria 4504
633 Ga0495651_0080817 3300046462 Bacteria 2454
634 Ga0495651_0124055 3300046462 Bacteria 1893
635 Ga0495653_0022058 3300046463 Bacteria 5154
636 Ga0495653_0026787 3300046463 Bacteria 4620
637 Ga0495653_0107193 3300046463 Bacteria 2014
638 Ga0495653_0154562 3300046463 Bacteria 1599
639 Ga0495582_0046268 3300046473 Bacteria 2396
640 Ga0495582_0088514 3300046473 Bacteria 1725
641 Ga0495605_0080301 3300046474 Bacteria 1527
642 Ga0495605_0093271 3300046474 Bacteria 1393
643 Ga0495639_0040287 3300046475 Bacteria 2101
644 Ga0495662_0043673 3300046476 Bacteria 2164
645 Ga0495664_0083276 3300046477 Bacteria 1920
646 Ga0495664_0109456 3300046477 Bacteria 1667
647 Ga0495584_0018509 3300046491 Bacteria 3540
648 Ga0495584_0038899 3300046491 Bacteria 2404
649 Ga0495584_0087332 3300046491 Bacteria 1572
650 Ga0495584_0093174 3300046491 Bacteria 1520
651 Ga0495585_0120728 3300046492 Bacteria 1387
652 Ga0495594_0013181 3300046499 Bacteria 4312
653 Ga0495596_0044454 3300046500 Bacteria 1748
654 Ga0495607_0055830 3300046501 Bacteria 2270
655 Ga0495608_0017419 3300046511 Bacteria 4968
656 Ga0495608_0108066 3300046511 Bacteria 1789
657 Ga0495628_0091053 3300046516 Bacteria 2361
658 Ga0495628_0223530 3300046516 Bacteria 1413
659 Ga0495630_0012767 3300046517 Bacteria 6104
660 Ga0495630_0016294 3300046517 Bacteria 5430
661 Ga0495630_0019249 3300046517 Bacteria 5017
662 Ga0495632_0229004 3300046519 Bacteria 839
663 Ga0495663_0029069 3300046525 Bacteria 1630
664 Ga0495663_0035183 3300046525 Bacteria 1503
665 Ga0495666_0089017 3300046526 Bacteria 1458
666 Ga0495642_0028305 3300046528 Bacteria 2232
667 Ga0495652_0133196 3300046529 Bacteria 1964
668 Ga0495652_0378296 3300046529 Bacteria 1008
669 Ga0495640_0008659 3300046533 Bacteria 7975
670 Ga0495587_0051342 3300046536 Bacteria 2438
671 Ga0495587_0238048 3300046536 Bacteria 1024
672 Ga0495645_0129593 3300046543 Bacteria 1769
673 Ga0495667_0137170 3300046559 Bacteria 1577
674 Ga0495667_0139825 3300046559 Bacteria 1560
675 Ga0495656_0023526 3300046615 Bacteria 2425
676 Ga0495656_0050142 3300046615 Bacteria 1781
677 Ga0495656_0083309 3300046615 Bacteria 1448
678 Ga0495656_0147475 3300046615 Bacteria 1134
679 Ga0495588_0062300 3300046674 Bacteria 1933
680 Ga0495657_0040636 3300046675 Bacteria 3188
681 Ga0495657_0145883 3300046675 Bacteria 1472
682 Ga0495599_0203513 3300046678 Bacteria 1216
683 Ga0495623_0112182 3300046679 Bacteria 1651
684 Ga0495647_0009277 3300046681 Bacteria 3328
685 Ga0495658_0013979 3300046683 Bacteria 4093
686 Ga0495658_0059511 3300046683 Bacteria 2188
687 Ga0495658_0422738 3300046683 Bacteria 850
688 Ga0495624_0229851 3300046690 Bacteria 1124
689 Ga0495670_0111366 3300046691 Bacteria 1417
690 Ga0495670_0175901 3300046691 Bacteria 1128
691 Ga0495589_0020912 3300046794 Bacteria 3344
692 Ga0495589_0062407 3300046794 Bacteria 1828
693 Ga0495589_0087278 3300046794 Bacteria 1515
694 Ga0495600_0065451 3300046809 Bacteria 2376
695 Ga0495600_0087156 3300046809 Bacteria 2037
696 Ga0495660_0116427 3300046810 Bacteria 1358
697 Ga0495581_0011338 3300047315 Bacteria 5157
698 Ga0495581_0013850 3300047315 Bacteria 4674
699 Ga0495604_0053733 3300047317 Bacteria 3111
700 Ga0495636_0101090 3300047318 Bacteria 1261
701 Ga0495674_0007910 3300047319 Bacteria 10146
702 Ga0495674_0231641 3300047319 Bacteria 1524
703 Ga0495676_0119126 3300047321 Bacteria 1923
704 Ga0495680_0014370 3300047322 Bacteria 6859
705 Ga0495680_0076564 3300047322 Bacteria 2536
706 Ga0495677_0006684 3300047445 Bacteria 4343
707 Ga0495684_0021576 3300047471 Bacteria 4958
708 Ga0495684_0091667 3300047471 Bacteria 2302
709 Ga0495684_0182938 3300047471 Bacteria 1553
710 Ga0495602_0049683 3300048088 Bacteria 3754
711 Ga0495602_0166243 3300048088 Bacteria 1717
712 Ga0495602_0319068 3300048088 Bacteria 1131
713 Ga0495615_0004322 3300048090 Bacteria 2473
714 Ga0495626_0123483 3300048091 Bacteria 1111
715 Ga0496100_0188630 3300048903 Bacteria 1495
716 Ga0496100_0238674 3300048903 Bacteria 1340
717 Ga0496101_0037297 3300048904 Bacteria 3447
718 Ga0496101_0047528 3300048904 Bacteria 3081
719 Ga0496101_0058951 3300048904 Bacteria 2782
720 Ga0496102_0071377 3300048905 Bacteria 3188
721 Ga0496102_0073079 3300048905 Bacteria 3152
722 Ga0496102_0097136 3300048905 Bacteria 2732
723 Ga0496102_0124545 3300048905 Bacteria 2408
724 Ga0496102_0141916 3300048905 Bacteria 2253
725 Ga0496102_0392260 3300048905 Bacteria 1306
726 Ga0496102_0675834 3300048905 Bacteria 956
727 Ga0496103_0058387 3300048906 Bacteria 2397
728 Ga0496103_0160267 3300048906 Bacteria 1443
729 Ga0496104_0022964 3300048907 Bacteria 5733
730 Ga0496104_0024820 3300048907 Bacteria 5519
731 Ga0496104_0060194 3300048907 Bacteria 3597
732 Ga0496104_0060499 3300048907 Bacteria 3588
733 Ga0496104_0088604 3300048907 Bacteria 2956
734 Ga0496104_0379462 3300048907 Bacteria 1326
735 Ga0496105_0008202 3300048908 Bacteria 8120
736 Ga0496105_0020362 3300048908 Bacteria 5360
737 Ga0496105_0157088 3300048908 Bacteria 1867
738 Ga0496105_0157106 3300048908 Bacteria 1867
739 Ga0496105_0300316 3300048908 Bacteria 1291
740 Ga0496106_0064603 3300048909 Bacteria 2784
741 Ga0496106_0112195 3300048909 Bacteria 2124
742 Ga0496106_0113873 3300048909 Bacteria 2109
743 Ga0496107_0010819 3300048910 Bacteria 6348
744 Ga0496107_0079795 3300048910 Bacteria 2386
745 Ga0496107_0172793 3300048910 Bacteria 1604
746 Ga0496107_0194400 3300048910 Bacteria 1508
747 Ga0496108_0020117 3300048911 Bacteria 5485
748 Ga0496108_0023140 3300048911 Bacteria 5110
749 Ga0496108_0052733 3300048911 Bacteria 3410
750 Ga0496108_0053340 3300048911 Bacteria 3391
751 Ga0496108_0063890 3300048911 Bacteria 3100
752 Ga0496109_0004131 3300048912 Bacteria 12127
753 Ga0496109_0005768 3300048912 Bacteria 10359
754 Ga0496109_0014523 3300048912 Bacteria 6850
755 Ga0496109_0046788 3300048912 Bacteria 3930
756 Ga0496109_0082884 3300048912 Bacteria 2957
757 Ga0496109_0365259 3300048912 Bacteria 1363
758 Ga0496109_0664287 3300048912 Bacteria 979
759 Ga0496110_0003642 3300048913 Bacteria 11851
760 Ga0496110_0006944 3300048913 Bacteria 9006
761 Ga0496110_0028786 3300048913 Bacteria 4775
762 Ga0496110_0055957 3300048913 Bacteria 3471
763 Ga0496110_0063656 3300048913 Bacteria 3259
764 Ga0496110_0099833 3300048913 Bacteria 2602
765 Ga0496110_0263151 3300048913 Bacteria 1570
766 Ga0496110_0328126 3300048913 Bacteria 1394
767 Ga0496111_0004522 3300048914 Bacteria 8799
768 Ga0496111_0025847 3300048914 Bacteria 4143
769 Ga0496111_0044597 3300048914 Bacteria 3188
770 Ga0496111_0047066 3300048914 Bacteria 3106
771 Ga0496111_0088714 3300048914 Bacteria 2265
772 Ga0496111_0095247 3300048914 Bacteria 2184
773 Ga0496112_0001605 3300048915 Bacteria 17482
774 Ga0496112_0003712 3300048915 Bacteria 12743
775 Ga0496112_0022299 3300048915 Bacteria 6033
776 Ga0496112_0051985 3300048915 Bacteria 4020
777 Ga0496112_0182796 3300048915 Bacteria 2060
778 Ga0496112_0193214 3300048915 Bacteria 1996
779 Ga0496112_0254261 3300048915 Bacteria 1707
780 Ga0496112_0290058 3300048915 Bacteria 1582
781 Ga0496112_0652628 3300048915 Bacteria 982
782 Ga0496113_0017352 3300048916 Bacteria 4995
783 Ga0496113_0043212 3300048916 Bacteria 3334
784 Ga0496113_0065007 3300048916 Bacteria 2760
785 Ga0496113_0069007 3300048916 Bacteria 2684
786 Ga0496113_0078716 3300048916 Bacteria 2522
787 Ga0496113_0102361 3300048916 Bacteria 2221
788 Ga0496113_0177777 3300048916 Bacteria 1687
789 Ga0496113_0209900 3300048916 Bacteria 1550
790 Ga0496114_0007197 3300048917 Bacteria 8782
791 Ga0496114_0039314 3300048917 Bacteria 3914
792 Ga0496114_0144381 3300048917 Bacteria 2062
793 Ga0496115_0059815 3300048918 Bacteria 3069
794 Ga0496115_0098573 3300048918 Bacteria 2394
795 Ga0501034_0012999 3300049571 Bacteria 8582
796 Ga0501040_0277153 3300049576 Bacteria 1198
797 Ga0501043_0240851 3300049579 Bacteria 1395
798 Ga0501067_0001545 3300049583 Bacteria 12553
799 Ga0501067_0002196 3300049583 Bacteria 10773
800 Ga0501067_0020565 3300049583 Bacteria 3653
801 Ga0501067_0031978 3300049583 Bacteria 2919
802 Ga0501068_0230921 3300049584 Bacteria 1177
803 Ga0501069_0002312 3300049585 Bacteria 9623
804 Ga0501069_0025983 3300049585 Bacteria 3205
805 Ga0501069_0123209 3300049585 Bacteria 1481
806 Ga0501070_0010496 3300049586 Bacteria 7833
807 Ga0501071_0636778 3300049587 Bacteria 820
808 Ga0501072_0253039 3300049588 Bacteria 1403
809 Ga0501073_0053687 3300049589 Bacteria 2821
810 Ga0501074_0016273 3300049590 Bacteria 5400
811 Ga0501079_0182966 3300049741 Bacteria 1636
812 Ga0501080_0001603 3300049742 Bacteria 19211
813 Ga0501081_0214424 3300049743 Bacteria 1399
814 nmdc:mga0yw44_347187_c1 3300050492 Bacteria 999
815 nmdc:mga05p37_48479_c1 3300050507 Bacteria 5224
816 nmdc:mga05p37_87024_c1 3300050507 Bacteria 3851
817 nmdc:mga09592_107540_c1 3300050508 Bacteria 2392
818 nmdc:mga0qj67_300121_c1 3300050509 Bacteria 1301
819 nmdc:mga06r32_72812_c1 3300050510 Bacteria 3327
820 nmdc:mga08y16_11279_c1 3300050511 Bacteria 9389
821 nmdc:mga08y16_149358_c1 3300050511 Bacteria 2429
822 nmdc:mga08y16_219208_c1 3300050511 Bacteria 1970
823 nmdc:mga08y16_21966_c1 3300050511 Bacteria 6736
824 nmdc:mga08y16_32373_c1 3300050511 Bacteria 5498
825 nmdc:mga08y16_324440_c1 3300050511 Bacteria 1585
826 nmdc:mga08y16_37953_c1 3300050511 Bacteria 5057
827 nmdc:mga0n895_132129_c1 3300050512 Bacteria 2522
828 nmdc:mga0n895_24837_c1 3300050512 Bacteria 5654
829 nmdc:mga0n895_531165_c1 3300050512 Bacteria 1183
830 nmdc:mga0n895_610569_c1 3300050512 Bacteria 1092
831 nmdc:mga0n895_76454_c1 3300050512 Bacteria 3329
832 nmdc:mga0n895_96375_c1 3300050512 Bacteria 2963
833 nmdc:mga0rr50_110784_c1 3300050513 Bacteria 2172
834 nmdc:mga0rr50_5908_c1 3300050513 Bacteria 7365
835 nmdc:mga08x19_138168_c1 3300050514 Bacteria 1644
836 nmdc:mga08x19_14136_c1 3300050514 Bacteria 4837
837 nmdc:mga0a205_26423_c1 3300050515 Bacteria 5536
838 nmdc:mga0a205_361064_c1 3300050515 Bacteria 1319
839 Ga0495601_0007206 3300053077 Bacteria 6524
840 Ga0495601_0092311 3300053077 Bacteria 1950
841 Ga0495655_0013200 3300053083 Bacteria 1704
842 Ga0495595_0030209 3300053084 Bacteria 2429
843 Ga0466962_0007948 3300061719 Bacteria 5088
844 Ga0466962_0067051 3300061719 Bacteria 1713
845 Ga0530510_0204072 3300061734 Bacteria 1469
846 Ga0070711_100047286
847 JGI25406J46586_10001832
848 JGI25406J46586_10014010
849 Ga0070658_10008431
850 Ga0070658_10084037
851 Ga0070676_10068924
852 Ga0070683_100002420
853 Ga0070683_100083484
854 Ga0070683_100104839
855 Ga0070683_100181371
856 Ga0070683_100238883
857 Ga0070683_100363826
858 Ga0070683_100416792
859 Ga0070683_100604116
860 Ga0070690_100034703
861 Ga0070666_10158998
862 Ga0070680_100004396
863 Ga0070680_100020246
864 Ga0070680_100221354
865 Ga0070680_100230705
866 Ga0070680_100319147
867 Ga0070680_100333899
868 Ga0070682_100156638
869 Ga0068868_100174357
870 Ga0070660_100000770
871 Ga0070660_100011620
872 Ga0070660_100024445
873 Ga0070660_100037086
874 Ga0070660_100069774
875 Ga0070660_100380891
876 Ga0070691_10042563
877 Ga0070661_100014016
878 Ga0070661_100026378
879 Ga0070661_100263596
880 Ga0070692_10008214
881 Ga0070668_100008922
882 Ga0070668_100133863
883 Ga0070669_100070685
884 Ga0070675_100161375
885 Ga0070671_100097851
886 Ga0070671_100112828
887 Ga0070674_100093944
888 Ga0070674_100160271
889 Ga0070674_100166125
890 Ga0070673_100046656
891 Ga0070688_100007315
892 Ga0070659_100005233
893 Ga0070659_100166388
894 Ga0070659_100183126
895 Ga0070659_100199694
896 Ga0070659_100256665
897 Ga0070667_100219758
898 Ga0070667_100298991
899 Ga0070709_10120470
900 Ga0070714_100048652
901 Ga0070714_100073677
902 Ga0070714_100174409
903 Ga0070714_100218784
904 Ga0070714_100267155
905 Ga0070713_100028734
906 Ga0070713_100056914
907 Ga0070710_10258156
908 Ga0070710_10387967
909 Ga0070711_100003846
910 Ga0070711_100030939
911 Ga0070705_100004640
912 Ga0070700_100000794
913 Ga0070700_100005756
914 Ga0070694_100006557
915 Ga0070694_100144727
916 Ga0070708_100003130
917 Ga0070663_100226884
918 Ga0070678_100042479
919 Ga0070678_100433884
920 Ga0070681_10001129
921 Ga0070681_10011904
922 Ga0070681_10014817
923 Ga0070681_10021437
924 Ga0070681_10070369
925 Ga0070681_10153591
926 Ga0068867_100044955
927 Ga0068867_100092962
928 Ga0068867_100106640
929 Ga0068867_100144497
930 Ga0068867_100193944
931 Ga0070685_10001659
932 Ga0070706_100002074
933 Ga0070706_100341685
934 Ga0070707_100005619
935 Ga0070698_100030900
936 Ga0070699_100002657
937 Ga0070699_100039172
938 Ga0070679_100010930
939 Ga0070679_100013896
940 Ga0070679_100023167
941 Ga0070679_100073580
942 Ga0070679_100163648
943 Ga0070679_100286358
944 Ga0070679_100380820
945 Ga0070684_100011742
946 Ga0070684_100106364
947 Ga0070684_100316754
948 Ga0070684_100368380
949 Ga0070672_100022209
950 Ga0070672_100067021
951 Ga0070672_100222329
952 Ga0070686_100003788
953 Ga0070686_100010694
954 Ga0070686_100127113
955 Ga0070686_100243771
956 Ga0070695_100008132
957 Ga0070696_100032230
958 Ga0070696_100136607
959 Ga0070696_100341798
960 Ga0070665_100017089
961 Ga0070665_100122039
962 Ga0068855_100016898
963 Ga0068855_100026525
964 Ga0068855_100064288
965 Ga0068855_100083857
966 Ga0068855_100168778
967 Ga0068855_100207692
968 Ga0068855_100383358
969 Ga0068857_100022389
970 Ga0068854_100016749
971 Ga0068856_100217965
972 Ga0068856_100302352
973 Ga0070702_100007834
974 Ga0070702_100043046
975 Ga0070702_100150196
976 Ga0068852_100054346
977 Ga0068852_100263876
978 Ga0068852_100298368
979 Ga0068859_100380480
980 Ga0068866_10001477
981 Ga0068866_10217522
982 Ga0068861_100066250
983 Ga0068861_100084175
984 Ga0068861_100087041
985 Ga0068861_100140308
986 Ga0068870_10007137
987 Ga0068870_10074055
988 Ga0068858_100048669
989 Ga0068858_100269930
990 Ga0068860_100051952
991 Ga0068860_100131640
992 Ga0068862_100073795
993 Ga0081455_10031698
994 Ga0081455_10059896
995 Ga0081455_10117197
996 Ga0081455_10122145
997 Ga0081455_10206413
998 Ga0081455_10279167
999 Ga0081540_1004573
1000 Ga0081540_1009927
1001 Ga0081540_1013732
1002 Ga0081540_1083758
1003 Ga0081539_10000171
1004 Ga0081539_10000599
1005 Ga0081539_10001044
1006 Ga0081539_10002263
1007 Ga0081539_10007528
1008 Ga0070717_10013308
1009 Ga0070717_10023875
1010 Ga0070717_10224313
1011 Ga0075365_10064645
1012 Ga0075432_10016943
1013 Ga0075432_10044126
1014 Ga0070715_10003385
1015 Ga0070716_100100965
1016 Ga0070712_100024354
1017 Ga0070712_100036082
1018 Ga0070712_100298236
1019 Ga0097621_100013143
1020 Ga0097621_100507560
1021 Ga0068871_100043994
1022 Ga0075428_100045891
1023 Ga0075428_100227056
1024 Ga0075431_100010688
1025 Ga0075431_100132697
1026 Ga0075433_10066369
1027 Ga0075434_100019457
1028 Ga0075434_100220040
1029 Ga0075429_100268360
1030 Ga0068865_100135514
1031 Ga0068865_100210968
1032 Ga0097620_100380460
1033 Ga0075435_100076760
1034 Ga0111539_10004337
1035 Ga0111539_10006713
1036 Ga0111539_10011536
1037 Ga0111539_10024559
1038 Ga0111539_10072897
1039 Ga0111539_10407900
1040 Ga0105245_10004691
1041 Ga0105245_10015878
1042 Ga0105245_10096890
1043 Ga0105245_10206787
1044 Ga0105245_10220077
1045 Ga0105247_10289026
1046 Ga0114129_10007588
1047 Ga0114129_10110556
1048 Ga0105243_10002631
1049 Ga0105243_10083632
1050 Ga0105243_10189962
1051 Ga0105243_10330077
1052 Ga0105241_10120178
1053 Ga0105241_10153700
1054 Ga0105242_10496654
1055 Ga0105242_10641589
1056 Ga0105248_10131898
1057 Ga0105248_10146102
1058 Ga0105248_10171402
1059 Ga0105248_10603275
1060 Ga0105248_10790083
1061 Ga0105237_10026571
1062 Ga0105237_10175500
1063 Ga0105237_10177379
1064 Ga0105237_10252625
1065 Ga0105238_10360531
1066 Ga0105238_10657223
1067 Ga0105249_10034628
1068 Ga0105249_10063431
1069 Ga0105249_10092313
1070 Ga0105249_10121569
1071 Ga0105249_10257113
1072 Ga0105239_10010075
1073 Ga0105239_10020559
1074 Ga0105239_10279707
1075 Ga0105239_10368264
1076 Ga0105239_10476976
1077 Ga0105246_10002634
1078 Ga0105246_10011385
1079 Ga0105246_10253463
1080 Ga0105246_10448057
1081 Ga0157373_10011332
1082 Ga0157370_10017041
1083 Ga0157369_10012087
1084 Ga0157369_10014522
1085 Ga0157369_10016084
1086 Ga0157369_10116687
1087 Ga0157369_10182901
1088 Ga0157374_10013221
1089 Ga0157374_10042769
1090 Ga0157378_10022794
1091 Ga0157378_10394093
1092 Ga0157378_10406167
1093 Ga0157378_10585056
1094 Ga0163162_10000727
1095 Ga0163162_10059208
1096 Ga0163162_10196269
1097 Ga0157372_10071822
1098 Ga0157372_10107265
1099 Ga0157372_10452250
1100 Ga0157372_10582716
1101 Ga0157372_10754279
1102 Ga0157375_10004690
1103 Ga0157375_10020575
1104 Ga0157375_10050206
1105 Ga0157375_10234816
1106 Ga0157375_10564637
1107 Ga0163163_10064167
1108 Ga0163163_10115837
1109 Ga0163163_10740487
1110 Ga0157380_10023482
1111 Ga0157380_10083186
1112 Ga0157380_10352711
1113 Ga0157380_10456147
1114 Ga0182008_10008697
1115 Ga0157377_10000397
1116 Ga0157377_10057739
1117 Ga0157379_10073145
1118 Ga0157379_10670188
1119 Ga0157376_10473361
1120 Ga0182006_1014567
1121 Ga0163161_10178856
1122 Ga0197907_10808555
1123 Ga0206356_10063198
1124 Ga0206354_10930277
1125 Ga0206354_11001608
1126 Ga0206353_11446920
1127 Ga0207653_10021129
1128 Ga0207692_10157062
1129 Ga0207692_10174634
1130 Ga0207642_10002810
1131 Ga0207642_10153862
1132 Ga0207688_10023433
1133 Ga0207688_10034346
1134 Ga0207688_10268335
1135 Ga0207685_10108594
1136 Ga0207699_10063328
1137 Ga0207699_10073048
1138 Ga0207699_10250010
1139 Ga0207643_10003011
1140 Ga0207643_10011792
1141 Ga0207705_10010634
1142 Ga0207705_10020310
1143 Ga0207705_10138742
1144 Ga0207684_10023508
1145 Ga0207684_10224485
1146 Ga0207684_10397640
1147 Ga0207707_10008550
1148 Ga0207707_10008778
1149 Ga0207707_10040674
1150 Ga0207707_10087625
1151 Ga0207695_10186005
1152 Ga0207695_10236293
1153 Ga0207695_10353740
1154 Ga0207671_10141963
1155 Ga0207693_10000347
1156 Ga0207693_10087510
1157 Ga0207660_10003765
1158 Ga0207660_10044988
1159 Ga0207660_10155231
1160 Ga0207660_10292052
1161 Ga0207657_10000319
1162 Ga0207657_10000416
1163 Ga0207657_10001085
1164 Ga0207657_10011244
1165 Ga0207657_10019514
1166 Ga0207657_10021028
1167 Ga0207657_10087191
1168 Ga0207649_10059815
1169 Ga0207652_10016020
1170 Ga0207652_10052239
1171 Ga0207652_10066938
1172 Ga0207652_10086342
1173 Ga0207652_10137774
1174 Ga0207652_10198568
1175 Ga0207652_10372048
1176 Ga0207652_10390792
1177 Ga0207646_10014823
1178 Ga0207646_10590868
1179 Ga0207681_10523125
1180 Ga0207687_10023008
1181 Ga0207687_10064274
1182 Ga0207687_10071146
1183 Ga0207700_10000004
1184 Ga0207700_10109810
1185 Ga0207664_10004622
1186 Ga0207664_10046674
1187 Ga0207664_10152679
1188 Ga0207664_10267244
1189 Ga0207664_10429836
1190 Ga0207644_10315986
1191 Ga0207690_10111663
1192 Ga0207690_10266865
1193 Ga0207706_10022500
1194 Ga0207706_10213428
1195 Ga0207686_10005993
1196 Ga0207686_10394806
1197 Ga0207709_10001627
1198 Ga0207709_10052675
1199 Ga0207709_10060392
1200 Ga0207669_10002197
1201 Ga0207669_10050770
1202 Ga0207669_10185451
1203 Ga0207669_10291037
1204 Ga0207704_10096970
1205 Ga0207704_10194509
1206 Ga0207704_10253029
1207 Ga0207665_10099394
1208 Ga0207691_10022775
1209 Ga0207689_10038149
1210 Ga0207661_10025532
1211 Ga0207661_10027782
1212 Ga0207661_10115531
1213 Ga0207661_10207847
1214 Ga0207661_10246698
1215 Ga0207679_10114516
1216 Ga0207679_10334653
1217 Ga0207667_10054323
1218 Ga0207667_10125085
1219 Ga0207667_10221788
1220 Ga0207667_10298543
1221 Ga0207667_10390631
1222 Ga0207651_10044454
1223 Ga0207712_10007054
1224 Ga0207712_10034038
1225 Ga0207668_10028482
1226 Ga0207668_10054453
1227 Ga0207668_10129837
1228 Ga0207640_10338395
1229 Ga0207640_10462078
1230 Ga0207658_10345856
1231 Ga0207677_10261861
1232 Ga0207639_10220745
1233 Ga0207678_10036097
1234 Ga0207678_10108182
1235 Ga0207678_10108285
1236 Ga0207678_10248558
1237 Ga0207678_10257717
1238 Ga0207678_10433683
1239 Ga0207708_10001000
1240 Ga0207708_10014047
1241 Ga0207708_10092177
1242 Ga0207702_10061850
1243 Ga0207702_10113624
1244 Ga0207702_10265782
1245 Ga0207641_10405002
1246 Ga0207648_10000191
1247 Ga0207648_10018603
1248 Ga0207648_10205050
1249 Ga0207648_10236209
1250 Ga0207674_10010377
1251 Ga0207674_10031297
1252 Ga0207674_10154580
1253 Ga0207674_10252546
1254 Ga0207674_10294180
1255 Ga0207675_100002866
1256 Ga0207675_100007801
1257 Ga0207675_100077713
1258 Ga0207683_10005339
1259 Ga0207683_10009882
1260 Ga0207683_10108659
1261 Ga0207698_10037000
1262 Ga0209998_10023854
1263 Ga0207428_10001543
1264 Ga0207428_10025320
1265 Ga0207428_10056799
1266 Ga0207428_10196088
1267 Ga0268266_10135972
1268 Ga0268266_10141656
1269 Ga0268265_10074221
1270 Ga0268264_10096869
1271 Ga0265337_1009232
1272 Ga0265338_10004154
1273 Ga0265338_10038872
1274 Ga0265338_10172758
1275 Ga0265320_10017109
1276 Ga0265339_10011110
1277 Ga0265331_10045085
1278 Ga0265327_10018798
1279 Ga0265316_10095404
1280 Ga0307408_100181473
1281 Ga0265313_10050377
1282 Ga0265313_10063519
1283 Ga0265314_10091205
1284 Ga0265342_10019172
1285 Ga0307405_10048894
1286 Ga0307405_10278822
1287 Ga0307410_10043423
1288 Ga0307410_10141104
1289 Ga0307406_10004278
1290 Ga0307406_10047851
1291 Ga0307406_10177701
1292 Ga0307407_10069508
1293 Ga0307407_10328968
1294 Ga0307409_100023790
1295 Ga0307409_100024413
1296 Ga0307409_100077172
1297 Ga0307409_100407852
1298 Ga0307416_100024830
1299 Ga0307416_100048872
1300 Ga0307416_100052647
1301 Ga0307411_10027835
1302 Ga0307415_100002779
1303 Ga0307415_100008265
1304 Ga0307415_100011040
1305 Ga0373936_0065054
1306 Ga0373941_0021420
1307 Ga0373945_0016417
1308 Ga0373945_0055529
1309 Ga0373960_0014406
1310 Ga0373943_0015187
1311 Ga0373946_0032563
1312 Ga0373955_0043435
1313 Ga0373931_0030581
1314 Ga0373947_0004583
1315 Ga0373947_0156257
1316 Ga0373937_0010608
1317 Ga0373925_0008549
1318 Ga0395899_0001266
1319 Ga0395899_0003558
1320 Ga0395899_0004161
1321 Ga0395899_0004681
1322 Ga0395899_0007083
1323 Ga0395899_0011255
1324 Ga0395899_0016475
1325 Ga0395899_0021751
1326 Ga0395899_0066605
1327 Ga0395899_0080894
1328 Ga0395899_0096631
1329 Ga0395899_0111703
1330 Ga0395899_0125560
1331 Ga0395900_0001348
1332 Ga0395900_0002880
1333 Ga0395900_0005507
1334 Ga0395900_0007933
1335 Ga0395900_0008749
1336 Ga0395900_0009564
1337 Ga0395900_0009887
1338 Ga0395900_0037178
1339 Ga0395900_0055428
1340 Ga0395900_0097511
1341 Ga0395900_0115405
1342 Ga0395900_0117300
1343 Ga0395900_0142794
1344 Ga0395900_0193733
1345 Ga0395900_0220007
1346 Ga0395900_0276919
1347 Ga0395900_0338834
1348 Ga0395900_0526291
1349 Ga0395900_0604304
1350 Ga0395898_0002653
1351 Ga0395898_0004125
1352 Ga0395898_0005273
1353 Ga0395898_0007310
1354 Ga0395898_0024274
1355 Ga0395898_0025891
1356 Ga0395898_0027148
1357 Ga0395898_0030119
1358 Ga0395898_0057405
1359 Ga0395898_0064574
1360 Ga0395898_0066706
1361 Ga0395898_0093743
1362 Ga0395898_0097865
1363 Ga0395898_0100736
1364 Ga0395898_0229843
1365 Ga0395898_0229911
1366 Ga0395898_0230948
1367 Ga0395898_0243197
1368 Ga0395898_0391429
1369 Ga0395898_0446584
1370 Ga0395905_0001663
1371 Ga0395905_0003200
1372 Ga0395905_0003387
1373 Ga0395905_0007458
1374 Ga0395905_0010757
1375 Ga0395905_0026203
1376 Ga0395905_0027536
1377 Ga0395905_0045804
1378 Ga0395905_0049383
1379 Ga0395905_0053766
1380 Ga0395905_0064123
1381 Ga0395905_0072686
1382 Ga0395905_0093956
1383 Ga0395905_0104855
1384 Ga0395905_0106646
1385 Ga0395905_0184394
1386 Ga0395905_0188297
1387 Ga0395905_0276685
1388 Ga0395905_0394312
1389 Ga0395905_0425004
1390 Ga0395901_0000586
1391 Ga0395901_0003540
1392 Ga0395901_0003604
1393 Ga0395901_0006305
1394 Ga0395901_0007207
1395 Ga0395901_0009439
1396 Ga0395901_0009719
1397 Ga0395901_0009868
1398 Ga0395901_0023204
1399 Ga0395901_0032949
1400 Ga0395901_0047176
1401 Ga0395901_0068533
1402 Ga0395901_0084404
1403 Ga0395901_0111912
1404 Ga0395901_0147819
1405 Ga0395901_0170941
1406 Ga0395901_0208442
1407 Ga0395901_0217540
1408 Ga0395901_0221824
1409 Ga0395901_0225647
1410 Ga0395901_0231833
1411 Ga0395901_0254347
1412 Ga0395901_0370669
1413 Ga0395901_0417923
1414 Ga0395901_0600554
1415 Ga0436365_0699127
1416 Ga0436365_0827282
1417 Ga0439438_036318
1418 Ga0451800_0905413
1419 Ga0451802_0273766
1420 Ga0451804_0328232
1421 Ga0451833_1219700
1422 Ga0451855_0246350
1423 Ga0439450_045267
1424 Ga0450902_017588
1425 Ga0439446_0016294
1426 Ga0439434_0006961
1427 Ga0466965_0055070
1428 Ga0466966_0072596
1429 Ga0466961_0009296
1430 Ga0466961_0024352
1431 Ga0466961_0107049
1432 Ga0466963_0014601
1433 Ga0466963_0019939
1434 Ga0466963_0030139
1435 Ga0466963_0168380
1436 Ga0466963_0203887
1437 Ga0466963_0448504
1438 Ga0466964_0036685
1439 Ga0466964_0052804
1440 Ga0466964_0085332
1441 Ga0466971_0004028
1442 Ga0466970_0247306
1443 Ga0466957_0085726
1444 Ga0466957_0099516
1445 Ga0466957_0283285
1446 Ga0466960_0070111
1447 Ga0466959_0081856
1448 Ga0466959_0201253
1449 Ga0466959_0203940
1450 Ga0451576_0113890
1451 Ga0451576_0247879
1452 Ga0466958_0011177
1453 Ga0466958_0091634
1454 Ga0466958_0094708
1455 Ga0466967_0002495
1456 Ga0466967_0006058
1457 Ga0466967_0006201
1458 Ga0466967_0011534
1459 Ga0466967_0017574
1460 Ga0466967_0029145
1461 Ga0466967_0029275
1462 Ga0466967_0031632
1463 Ga0466967_0046836
1464 Ga0466967_0050336
1465 Ga0466967_0051287
1466 Ga0466967_0061999
1467 Ga0466967_0062376
1468 Ga0466967_0078979
1469 Ga0466967_0111641
1470 Ga0466967_0127505
1471 Ga0466967_0137643
1472 Ga0466967_0221326
1473 Ga0466967_0227390
1474 Ga0495603_0013786
1475 Ga0495603_0077999
1476 Ga0495629_0155020
1477 Ga0495641_0013421
1478 Ga0495651_0080817
1479 Ga0495651_0124055
1480 Ga0495653_0022058
1481 Ga0495653_0026787
1482 Ga0495653_0107193
1483 Ga0495653_0154562
1484 Ga0495582_0046268
1485 Ga0495582_0088514
1486 Ga0495605_0080301
1487 Ga0495605_0093271
1488 Ga0495639_0040287
1489 Ga0495662_0043673
1490 Ga0495664_0083276
1491 Ga0495664_0109456
1492 Ga0495584_0018509
1493 Ga0495584_0038899
1494 Ga0495584_0087332
1495 Ga0495584_0093174
1496 Ga0495585_0120728
1497 Ga0495594_0013181
1498 Ga0495596_0044454
1499 Ga0495607_0055830
1500 Ga0495608_0017419
1501 Ga0495608_0108066
1502 Ga0495628_0091053
1503 Ga0495628_0223530
1504 Ga0495630_0012767
1505 Ga0495630_0016294
1506 Ga0495630_0019249
1507 Ga0495632_0229004
1508 Ga0495663_0029069
1509 Ga0495663_0035183
1510 Ga0495666_0089017
1511 Ga0495642_0028305
1512 Ga0495652_0133196
1513 Ga0495652_0378296
1514 Ga0495640_0008659
1515 Ga0495587_0051342
1516 Ga0495587_0238048
1517 Ga0495645_0129593
1518 Ga0495667_0137170
1519 Ga0495667_0139825
1520 Ga0495656_0023526
1521 Ga0495656_0050142
1522 Ga0495656_0083309
1523 Ga0495656_0147475
1524 Ga0495588_0062300
1525 Ga0495657_0040636
1526 Ga0495657_0145883
1527 Ga0495599_0203513
1528 Ga0495623_0112182
1529 Ga0495647_0009277
1530 Ga0495658_0013979
1531 Ga0495658_0059511
1532 Ga0495658_0422738
1533 Ga0495624_0229851
1534 Ga0495670_0111366
1535 Ga0495670_0175901
1536 Ga0495589_0020912
1537 Ga0495589_0062407
1538 Ga0495589_0087278
1539 Ga0495600_0065451
1540 Ga0495600_0087156
1541 Ga0495660_0116427
1542 Ga0495581_0011338
1543 Ga0495581_0013850
1544 Ga0495604_0053733
1545 Ga0495636_0101090
1546 Ga0495674_0007910
1547 Ga0495674_0231641
1548 Ga0495676_0119126
1549 Ga0495680_0014370
1550 Ga0495680_0076564
1551 Ga0495677_0006684
1552 Ga0495684_0021576
1553 Ga0495684_0091667
1554 Ga0495684_0182938
1555 Ga0495602_0049683
1556 Ga0495602_0166243
1557 Ga0495602_0319068
1558 Ga0495615_0004322
1559 Ga0495626_0123483
1560 Ga0496100_0188630
1561 Ga0496100_0238674
1562 Ga0496101_0037297
1563 Ga0496101_0047528
1564 Ga0496101_0058951
1565 Ga0496102_0071377
1566 Ga0496102_0073079
1567 Ga0496102_0097136
1568 Ga0496102_0124545
1569 Ga0496102_0141916
1570 Ga0496102_0392260
1571 Ga0496102_0675834
1572 Ga0496103_0058387
1573 Ga0496103_0160267
1574 Ga0496104_0022964
1575 Ga0496104_0024820
1576 Ga0496104_0060194
1577 Ga0496104_0060499
1578 Ga0496104_0088604
1579 Ga0496104_0379462
1580 Ga0496105_0008202
1581 Ga0496105_0020362
1582 Ga0496105_0157088
1583 Ga0496105_0157106
1584 Ga0496105_0300316
1585 Ga0496106_0064603
1586 Ga0496106_0112195
1587 Ga0496106_0113873
1588 Ga0496107_0010819
1589 Ga0496107_0079795
1590 Ga0496107_0172793
1591 Ga0496107_0194400
1592 Ga0496108_0020117
1593 Ga0496108_0023140
1594 Ga0496108_0052733
1595 Ga0496108_0053340
1596 Ga0496108_0063890
1597 Ga0496109_0004131
1598 Ga0496109_0005768
1599 Ga0496109_0014523
1600 Ga0496109_0046788
1601 Ga0496109_0082884
1602 Ga0496109_0365259
1603 Ga0496109_0664287
1604 Ga0496110_0003642
1605 Ga0496110_0006944
1606 Ga0496110_0028786
1607 Ga0496110_0055957
1608 Ga0496110_0063656
1609 Ga0496110_0099833
1610 Ga0496110_0263151
1611 Ga0496110_0328126
1612 Ga0496111_0004522
1613 Ga0496111_0025847
1614 Ga0496111_0044597
1615 Ga0496111_0047066
1616 Ga0496111_0088714
1617 Ga0496111_0095247
1618 Ga0496112_0001605
1619 Ga0496112_0003712
1620 Ga0496112_0022299
1621 Ga0496112_0051985
1622 Ga0496112_0182796
1623 Ga0496112_0193214
1624 Ga0496112_0254261
1625 Ga0496112_0290058
1626 Ga0496112_0652628
1627 Ga0496113_0017352
1628 Ga0496113_0043212
1629 Ga0496113_0065007
1630 Ga0496113_0069007
1631 Ga0496113_0078716
1632 Ga0496113_0102361
1633 Ga0496113_0177777
1634 Ga0496113_0209900
1635 Ga0496114_0007197
1636 Ga0496114_0039314
1637 Ga0496114_0144381
1638 Ga0496115_0059815
1639 Ga0496115_0098573
1640 Ga0501034_0012999
1641 Ga0501040_0277153
1642 Ga0501043_0240851
1643 Ga0501067_0001545
1644 Ga0501067_0002196
1645 Ga0501067_0020565
1646 Ga0501067_0031978
1647 Ga0501068_0230921
1648 Ga0501069_0002312
1649 Ga0501069_0025983
1650 Ga0501069_0123209
1651 Ga0501070_0010496
1652 Ga0501071_0636778
1653 Ga0501072_0253039
1654 Ga0501073_0053687
1655 Ga0501074_0016273
1656 Ga0501079_0182966
1657 Ga0501080_0001603
1658 Ga0501081_0214424
1659 nmdc:mga0yw44_347187_c1
1660 nmdc:mga05p37_48479_c1
1661 nmdc:mga05p37_87024_c1
1662 nmdc:mga09592_107540_c1
1663 nmdc:mga0qj67_300121_c1
1664 nmdc:mga06r32_72812_c1
1665 nmdc:mga08y16_11279_c1
1666 nmdc:mga08y16_149358_c1
1667 nmdc:mga08y16_219208_c1
1668 nmdc:mga08y16_21966_c1
1669 nmdc:mga08y16_32373_c1
1670 nmdc:mga08y16_324440_c1
1671 nmdc:mga08y16_37953_c1
1672 nmdc:mga0n895_132129_c1
1673 nmdc:mga0n895_24837_c1
1674 nmdc:mga0n895_531165_c1
1675 nmdc:mga0n895_610569_c1
1676 nmdc:mga0n895_76454_c1
1677 nmdc:mga0n895_96375_c1
1678 nmdc:mga0rr50_110784_c1
1679 nmdc:mga0rr50_5908_c1
1680 nmdc:mga08x19_138168_c1
1681 nmdc:mga08x19_14136_c1
1682 nmdc:mga0a205_26423_c1
1683 nmdc:mga0a205_361064_c1
1684 Ga0495601_0007206
1685 Ga0495601_0092311
1686 Ga0495655_0013200
1687 Ga0495595_0030209
1688 Ga0466962_0007948
1689 Ga0466962_0067051
1690 Ga0530510_0204072

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

107

303

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.9011 15 256
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.859 12 259
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8458 15 268
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.841 15 268
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.8377 45 256
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9527 12 258 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9328 15 254 1.10.3720.10
af_L7N652_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9243 12 258 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9243 12 258 1.10.3720.10
af_P10906_2_274_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9024 15 258 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7K1DWC6-F1-model_v4 ABC transporter permease subunit 0.9641 12 260 GO:0005886
GO:0055085
AF-X1DBW1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9585 12 208 GO:0005886
GO:0055085
AF-A0A1A2URG5-F1-model_v4 Sugar ABC transporter permease 0.9573 12 253 GO:0005886
GO:0055085
AF-A0A7K0MKI9-F1-model_v4 ABC transporter permease subunit 0.9557 12 228 GO:0005886
GO:0055085
AF-A0A4Q3YL27-F1-model_v4 sn-glycerol-3-phosphate transport system permease protein UgpE 0.9556 12 220 GO:0005886
GO:0055085

Map